3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
4WOBA 2E1PA 1DUIA 3BGOP 4M1ZA 3H42B 2SECE 1THMA 2XTJP 3P5BP 1SCBA 2Z2ZA 1SUPA 4RYDA 3QTLA 1GTJ1 3VSBA 1T1EA 1KDZA 2ZWOA 1SVNA 4GI3A 2ID8A 5ARBA 3I2YX 1TM5E 3QFHA 3VHQA 3GCWP 2PRKA 3DE7X 1SBCA 1SUCA 3DE4X 1GTL1 1P7VA 4DJ5X 2SNIE 1SCDA 4CG0A 4OV6A 1Y34E 1SUEA 4MZDA 3OSZA 3VTAA 2WUWE 1IAVA 3EDYA 2HD4A 3LPCA 5AVJA 1T1GA 3QMPA 4YN3B 1YJBA 1MPTA 2IXTA 4DWWA 3A3NB 1AV7A 1KE2A 3TI9A 2ST1A 5FAXA 5B1EA 3A3OA 1CSEE 1SN7A 1R0RE 1DBIA 1TM3E 1AF4A 2PMWA 1SCAA 5SICE 1R6VA 2SBTA 2DUJA 2G4VA 2Z58A 1P7WA 1AQNA 1YJCA 4NMXB 3LXUX 2W2QP 3DE0X 1OYOA 1WMEA 2B6NA 3WIVA 3CO0P 3DWEX 1GNVA 1SPBS 1SBHA 3PTLA 4ZARA 2W2PA 2ID4A 1Y3FE 1PTKA 3GCXA 2Z58B 3BPSA 3L1KA 2WV7A 1TM4E 1SUBA 2W2NA 5B1DA 2W2MA 1LW6E 4I0WB 2WWTA 5JXJA 3VV2B 1A2QA 2SICE 5AQEA 3SQOA 1WMFA 1Y3CE 2HPZA 1PFGA 2Z2YA 1PJ8A 1BJRE 2Z30A 2DQKA 4Z2AA 5JXHA 2PYZA 5FFNA 4OMCA 1WSDA 3F7MA 1S01A 1BE8A 3TI7A 2QTWA 5CW1A 3EIFA 1GNSA 2XRMA 1WVMA 1AU9A 3Q5GA 4KG7A 1CNMA 2ZWPA 3CNQS 1IC6A 4HVLA 3DE2X 4CFYA 5I9SA 5JXIA 3ZXYA 1Y3BE 1NDQA 1ITPA 3VV3A 3BX1A 1EGQA 2QTWB 1TK2A 1S2NA 1SCJA 3Q40A 2V8BA 1Y1KE 3DE6X 3WQBA 1MEEA 4AKSA 2PKCA 4OV6B 1YJAA 1YU6A 3F49S 1VSBA 2W2OA 1SIBE 1SBNE 4BWGA 5FBZA 1SCJB 3AFGA 1PEKE 1SH7A 2IY9A 1Q5PA 5AMXA 1NLUA 1ZVJA 2P4EA 1OYVA 2ZRQA 1WMDA 1BH6A 3A3OB 1R64A 3DVQX 5ARDA 1Y9ZA 1GA1A 1TM1E 4J94A 4LVNA 2PMWB 1SCNE 3A3PA 1Y48E 2Z2XA 3HJRA 1KE1A 1BE6A 3DDZX 4K8RA 1XF1A 2WUVA 1ST3A 1SBIA 3GT4A 1SBTA 1C9JA 3SICE 1SPBP 1SIOA 2TECE 1GT91 1AH2A 3AJ8A 3H42A 1KDYA 4KPGA 4NE9A 1OT5A 3GCXP 2XTJA 3P5BA 3PRKE 2W2NP 1GA4A 2W2MP 1V6CA 4B5LA 3LPAA 4K8RB 3DE1X 3GCWA 1P8JA 3SQOP 2PQ2A 3F7OA 1HT3A 1SUDA 2Z2YB 2PWAA 4OMDA 2Z30B 3UNXA 1JEAA 1BFUA 1ST2A 1UBNA 4YN3A 1V5IA 1Y33E 5AVKA 1ZVKA 3A3NA 1BFKA 3VYVA 3I30X 3DW3X 3CNQP 1S02A 1TO2E 1C9NA 3GT3A 1Y3DE 1EA7A 3D9QX 1C9MA 1T1IA 1Y4DE 3WIUA 1AVTA 3T41A 1V5IB 3DVSX 3LPDA 4AKTA 4DZTA 3DW1X 3DVRX 4NMXA 3DE3X 1TM7E 4C3UA 2W2QA 1KDVA 4NE9C 4CFZA 3CO0S 5JXGA 2DP4E 1NDUA 2Z56A 4HX2A 2W2OP 2X8JA 3I34X 4KB5A 4LVOA 2Z57A 4H6XA 1SIUA 1Y4AE 2GKOA 3WHIA 1TECE 3DE5X 4H6VA 3DYBA 3ZXXA 4WOCA 1AK9A 5JMOA 1TO1E 1TMGE 3EE6A 5ARCA 4ZOQI 5K7SA 3D43A 1GA6A 2Z56B 3I37X 2X8JB 3VV2A 4H6WA 4NE7A 4FONA 2W2PP 1GCIA 2Z57B 3BGOS 1SELA 1GTG1 4C3VA 3A3PB 1SUAA 2PWBA 3TECE 3BPSP 3AJ9A 4JP8A 1C3LA
chains in the Genus database with same CATH superfamily
4MUKA 2NZJA 1A88A 4N3BA 1QZXA 2QUHA 2X15A 1JMTA 4M53A 2A59A 2WAQD 1HT0A 1QG2A 3JARA 5EL0A 4Z99A 2HWWA 3C4VA 4DHVA 4J0KA 5BUCA 5TSDA 1TL7A 3BMNA 3RC2A 4NJMB 4ILMA 1XZ8A 3BYPA 1VE1A 5C8VA 4JT2A 1I7LA 5HF5A 2YYZA 1SUQB 1G8JA 4Y65A 1W5FA 3PFOA 4GRIA 1X92A 3GNLA 3MMCB 2PRIA 2VG7A 3ZE1B 3QX3A 3ZTQA 3KZVA 1G2IA 4IQXA 1O5JA 4XFDA 3MEQA 3S5JA 1FCJA 1YB2A 1SQFA 1ZC4A 4ECSA 4DL5A 1LFPA 3A4IA 1X4HA 1UKUA 3T7TA 2G07A 4IQGA 2YVLA 3VHLB 1GQFA 2CDRB 4U2CA 2QRMA 1EPUA 5FFMA 1FBNA 5CCBA 4R5HA 1BDJA 2JGDA 1Y1LA 5G3ZA 1U8EA 6AT1B 3FBWA 3JAWB 5EXPA 4GO7X 3PTLA 4OMUA 3S8YA 4TT3A 1I1QB 1JPNA 2RRNA 4B46A 3WLNA 3DEKA 5FBKA 2HFNA 1LLDA 3SDBA 4EWLA 3IPLA 1MC4A 4DVGA 1P8GA 4A4DA 5DRYA 2F1RA 1H2ZA 4L7QA 3IPYA 4RW7A 4UTNA 4G6ZA 1O5OA 4HN9A 3TIXB 4K2AA 2PUGA 2JIQA 3VPAA 2HURA 3GD5A 1E89A 4B3MB 1HX7A 1AE1A 5F8IA 1QIFA 1OPRA 4UEQA 1SZDA 1YTLA 1KAQA 2IH5A 4JI7B 1D6MA 2QM7A 1BXZA 3ZBQA 4RVOA 2VT7A 2XULA 4FT4A 5CXXA 2OO7A 3LW5C 5LMUF 1VRQC 5I3CA 2PO5A 3EJMA 1RAEA 3CBGA 4EUKA 3P9KA 1E3QA 4RDHA 2VF7A 3VYRB 1YQQA 1DHTA 1W30A 3AETA 4WSOA 3JR3A 4JI0B 3CXCR 1T5TA 4B8YA 4QIGA 2G76A 2W0SA 2FW1A 1DSSG 1G3IA 4BS2A 4FE3A 1M2EA 4NI2B 2C2MB 5AMXA 4OYLA 1EI9A 3RAFC 1NJSA 2QD3A 3VCDA 2NYAA 2GN2A 3AESB 1BDMA 2JH8A 4N18A 4RK5A 4MS4B 2QG6A 4EEXA 4IYRA 3RVKA 4FIZA 2ZBEA 4J29A 1U63A 5IVKA 3PUVA 1UM9B 3HJRA 3SQNA 2WMOB 4B9MA 2QYTA 2GX8A 1W6UA 2YY5A 4KACA 1CULB 3E9CA 5CA1A 4JROA 4NLWA 1Z7EA 3T3EA 5IMSA 5J1PA 3R5BA 5I3UA 4IKOA 3GCXP 2J6BA 3E7PA 2ZR9A 3QVKA 2Q4EA 4FQ8A 4GP9A 3TARA 2FDXA 1CC7A 3V8QA 4I6GA 2VJMB 2AR7A 2APJA 4MQEA 3WYFA 5CXUA 2ZTMA 4FBLA 2BP7A 3LDAA 1T8YA 3N0WA 2C4TA 2A1UA 1NXOA 5ELMA 4KV7A 4G5RA 1X1BA 4PNHA 1YCGA 2IP4A 3GVPA 4TSKA 5CYQA 4Z9FA 1W34A 4RVCA 3WYEA 4YP1A 3C14C 4IMIB 1ACLA 1MH1A 5TARA 1KO8A 1QBKC 3EVWA 1M2HA 2IEYA 5KT5A 4QWDA 1J25A 2DKOB 3ILLA 1XBTA 1RS0A 4P83A 5HROB 3OFND 1NHWA 4XQGA 2LEAA 4EA6A 3AJDA 5THWA 3A8IA 1C80A 3VAFA 5FUMA 1N7GA 1WZIA 2R3VA 5JMNA 3PDNA 4Q3OA 1L4MA 4CEJB 4AKTA 2GJ9A 4MVJI 1WD7A 2WONB 1J70A 1IQTA 4YI5A 1H3FA 3BXHA 1L7RA 2I9PA 4UT4A 1H2WA 4USUA 2NYUA 1ZAKA 4A82A 3TMAA 1SQ5A 1V5FA 2ZJBA 1ENOA 1U3GA 1UMBB 1ZD9A 1WW8A 4NP6A 5LJ3Y 1QAIA 3SZMA 3F8TA 2O8VA 3OU7A 4TYAA 2EZTA 2A2CA 1U1KA 5DNAA 5T7LA 1GPUA 4CMEA 3MD1A 2RGYA 3HLTA 1WKCA 5KYVA 2U2FA 2RVJA 2P65A 1XNQJ 1AZWA 3TO5A 5FRDA 1W46A 1ATZA 5T67A 2HSEA 2KJWA 2YH2A 4R8UA 3CEHA 4O44A 1GNLA 1ISFA 3MERA 4Z2YA 2FPHX 1U7LA 3MCAA 4OFWA 3NHZA 2R8KA 2W9CA 4NTZA 4B76A 5AT1A 5MAOA 2V1UA 2NPFA 4DDWA 3RRJA 3G0GA 3VR6A 3TNDA 1D2NA 3TL3A 2GKGA 4KO4S 2E4WA 4U9UA 4CKZA 1NE2A 4KAIA 1SC9A 2CNOA 4AI6A 4RL4A 3K6SB 3I12A 4RW4A 1ZS6A 1T9DA 4P4TA 4RM2A 5LBUA 2KXFA 3HRKA 2LQJA 4OJHA 3H17A 3B3FA 4IWXA 2HWXA 2G0TA 4DR7J 2KLBA 4D99A 3LT2A 2E5HA 2WT4A 4S1OA 1H85A 4YCBA 3HXOA 5DB4A 1KDRA 4L3NA 3BL5A 4CLLA 4QC2A 4HN4B 3FWHA 1JQAA 4L9AA 2BSXA 1VPLA 1PG5A 3KC2A 5FUYA 4WH0A 4UM9D 2QGFB 4UE6A 5J47A 2PO7A 4YC7A 3OD2A 2BW2A 1CJBA 5KS2A 2OPBA 4URZR 1FE4A 4KLNA 1ZRHA 3OLQA 4P7KA 3PYEA 2CPEA 3BE4A 4F45A 5ANRB 5FWDA 4W8GA 4U7TB 4KV8B 2Q29A 2E37A 3ASUA 4NICA 1UODA 3FZGA 1WMFA 2JZCA 2HPZA 4KN6A 3WHKA 1DCKA 2IRWA 3ZGZA 5FR2A 4WESA 3IR7A 13PKA 2C1XA 1HBNA 4OREX 5FIIA 1Y4ZB 5A0YB 4FPRA 1EQAA 4MV5A 2GT1A 1WKVA 4D3GA 2WVJA 4L02A 3F74A 2UVPB 5JAMA 3CCMS 3ETEA 2XVMA 5C7LO 4DMMA 1V95A 2UXCJ 2BI7A 1G19A 3UMBA 4LQ9A 3DYIA 2COKA 4DQUA 2OA0A 3DTNA 2R2TA 4A5SA 4BMOB 4B3MF 4Q44A 3VQSA 2BKEA 4Z8XA 3GJTB 5DYNA 2HNAA 4JI7F 4YRMA 2HC9A 2LVBA 5BR8J 2GVNA 2Q1WA 2Z08A 2GFQA 4MMZB 4ZOLF 2ZUCA 3AZPA 3T5MA 3O95A 1RAAB 3W2FA 1XZGA 3ACDA 3K71B 4ZO8A 4C8OA 4P58A 2YKQA 3BB4A 5DP2A 5KKCA 2ZB2A 3FVRA 4DG1B 2YC4C 1GSHA 1BWRA 2EQ5A 4JI0F 3OEED 1XZHA 3N74A 4WK2B 4ZS6A 1T9XA 3IHLA 3KOUA 1A27A 4CNYA 2OHGA 4QJ3A 2EKZA 5B37A 3LBFA 5F0UA 1RCXB 3ZXIA 4KAAA 5JTTA 2CZQA 3QIPB 4Y1EA 4LK3A 2ID9A 1VA5A 1VL2A 5GONB 3G85A 5A2QY 3EH2A 4O2AA 4BO6A 1ZJ6A 3H40A 2QM8A 3M30B 3IUYA 5CXSA 1PJBA 1MOQA 2DRBA 1YQHA 2AW3A 5A6WA 1L3SA 1G8FA 1SKBA 1P8JA 1P62B 3EBLA 1KAHA 3LDUA 3MUFA 3OQOA 1PS8A 2ZUAA 1PFKA 3WNBA 1R6XA 1P5JA 4K4SA 4F86A 2CHUA 3Q7TA 2ZJOA 4C2AA 2ORVA 1DS6A 2QPLA 1J5PA 4YUDA 4D81A 3QU5A 5JISA 3WRWA 3KT3A 5IJ9B 2GJ4A 2BKUA 3KPJA 4ND8A 2YNIB 5A4IS 4JEUA 3DD1A 1F0XA 4FFDA 4J1NA 4R0JA 2IOYA 4KQ9A 1GCGA 4I4LA 1R8JA 2ZVPX 3FDXA 4B84A 3R3VA 3EXHC 3D2CA 3VKUA 3WGZA 1NJ8A 2W2QA 3MCSA 1PBTA 3NH9A 5L38A 2NT3A 2DEIA 3OH8A 2E7WA 2XT6A 4YB1P 4OI6A 2R4TA 3AHCA 3L0BA 1Z5NA 3CNLA 3IVMA 2Y8YA 1HI1A 3TOVA 2XB2D 4GKJB 1QVRA 1JG3A 5J59A 3TZWA 3LWNA 3Q9NA 5K05A 3QQPA 3R7WA 4F3QA 2WIJA 1G3OA 4CLRB 1ZNQO 5GAHU 2WT9A 4GECA 1SJFA 1K6EA 2I62A 1A7GE 2ROQA 3GV5B 2EJBA 4EP1A 3C48A 2W98A 1X4GA 4HGYA 3W5YA 1UBFA 3OVSA 1YDEA 2JFUA 6REQB 2BYCA 1LNZA 3N6XA 4X24A 1K08A 4ZKAA 1W2GA 3IAS6 1XD2B 3CF4A 4OBWA 3RF7A 5EOVA 4DV6J 3L4JA 2FE1A 1E62A 2AX3A 1N2EA 1TCVA 3NGSA 3UHOA 2EGHA 1TD1A 4USJC 3RSZA 4XCVA 2HNBA 1V8BA 4OQXA 3M4JA 4I4NA 1BA2A 2JW5A 2HNDB 1IWAA 4A23A 5DNCA 1TPYA 3RWBA 4E13A 2WF6A 3JARB 1Y10A 3HXMA 4EGAA 4B74A 3DMFA 2EJTA 3RNOA 1VISA 3BHNA 2ZS9A 3A28A 5CVCA 4KMMA 4I8IA 4MAMA 1NVBA 1RRMA 2ZTSA 1FUYB 5IJZA 3L8EA 3GA0A 4OJQA 5KAMA 3Q15C 1A97A 1J1IA 2ATIA 4Z0PA 1ZN7A 3NP9A 5J4KA 3SSQA 1Y6GA 1WEYA 2O2JA 4LF4J 4URHA 2D5BA 1BFDA 1YJCA 3AR8A 5HKLA 4GE0A 4IKEA 3CB2A 3BG5A 4Q9KA 3BH0A 5TT0A 2RB4A 2RB5A 2XT9A 3QXHA 4NFYA 1GG8A 1G4AE 3OW2R 3HKEA 2IEGA 2B6AA 4DLXA 1TA9A 4M1QA 4GVBA 2JGDB 5IAJA 2WV7A 6FD1A 3QNWB 3GRKA 4EFNA 1UW4A 2Q3MA 1HE3A 4IF4A 1N9GB 5KU7A 4X85A 2XMBA 1F6DA 1FX1A 4H15A 2QPOA 1IR0A 1QE1A 3GV8B 4ID8A 4WZBA 2WY2D 4MA5A 5E0KB 4AJKA 1YR6A 3BWEA 4KQ6A 4RIGA 2PR7A 2TMDA 3U0BA 3AUAA 4DQXA 2B4YA 1WV1A 4QASA 3E15A 4EM6A 1SVWA 1LD3A 1W1UA 1N5QA 5DGHA 3HGMA 1FE0A 2QW8A 4QUDA 2DX7A 2V5AA 4FW8A 4MR7A 3ZIAA 3LWBA 4JC0A 1NNDA 4RW7B 1FB5A 1ZH0A 4BLPA 2ZBPA 1JFFB 2I99A 3W2VA 2EFCB 4UOFA 2OCKA 1T9GR 3QSYA 1RWOA 2O8CA 2OT3B 3F5DA 3JATB 2YKGA 2OAGA 3IKJA 2OGTA 3SP1A 1S1UB 3DCIA 3HWWA 1WUJS 4EPVA 2VAVA 1J2RA 3U4AA 3NTQA 1SVUA 1YS1X 5H1YA 3DAFA 2JHFA 2F4FA 5JQGA 3M1VA 4BLSA 1IDOA 3HRHA 1T2UA 4FOLA 2MDTA 4DXHA 3ASZA 3D54A 1IRIA 2G9ZA 4CEIA 2QX9A 1E3EA 3UI3A 1J1UA 2J7PD 4F4JA 1BH6A 1CS4C 4IDKA 4Y28C 3JSYA 2UUOA 5EVCA 4QNRA 4AIIA 4U6SA 2GO9A 4V02A 1P1LA 4PAAA 5EX3A 5SZTA 3IC5A 3AG6A 1XU7A 3V4RA 2I2YA 2VJOA 4HVCA 4Q2LA 3EZXA 4NHEA 5FI1B 1YZ6A 1A71A 2BDPA 4HTIA 1HFEL 1B8UA 1QGDA 2HGZA 1Y5LB 3M3HA 4J9KA 3LLSA 3M9WA 3FUCA 5B58C 3UV6A 2YVSA 2V4RA 4PPNA 2CVIA 1MO4A 3K59A 3DD5A 5IXYA 3P2KA 2C84A 3ZE7A 2RAFA 1GRQA 5CA1B 4F2SA 4FILA 1RQLA 2LMIA 1L3IA 1PBAA 4HQOA 5I3UB 2FSSA 5FO1A 2I6UA 2EJUA 1J4AA 4MIBA 4C21A 3HT0A 3RK0A 3WGJA 4B3XA 1LTHR 2VJBA 4DPMA 5JADA 2AGOA 5K8MA 2PD1A 2BP7B 5IAKA 1U48A 1QGAA 2C31A 3OOWA 1E64A 2Q62A 3M2RA 2FQQA 3TE7A 3M6VA 4DV6B 2PPLA 3L0SA 1YBMA 2R44A 5CYQB 1HG1A 4CR6A 2I80A 2EDCA 2GYWA 4EGLA 2O2HA 3B1YA 3GWGA 3OJEA 4Q4HA 4HRVA 3NGKA 5DEOA 1X9GA 4JBYA 1ULSA 2R6GA 4L1KA 4YEAA 4X54A 3FIJA 3AC0A 3THVA 1F4PA 1UKEA 3M6XA 1KBQA 3QPDA 3OIWA 1AQ6A 3UK2A 3ZJUA 3N5CA 5KHLB 3BFXA 1RT2A 5DO2A 3FCXA 5DIFA 4P4NA 3A7DA 1IVZA 4HDQB 4I6YA 2OKQA 2DY9A 5HF9A 5IKMA 4F04B 2XCTB 2IXDA 3A4VA 4GKJF 2O07A 1HLPA 4BV8A 1H3EA 3N8NA 1CY2A 3D3CJ 2LDYA 1ZM4A 5T7LB 1IVNA 4C97A 4YH1A 1OSNA 2CEKA 3OV7A 4EY3A 3RAPR 3E27A 3AR7A 5DM4A 3LK7A 1PZFA 3KUDA 5JYBA 4O44B 4F60A 1T9UA 3FTDA 1L1QA 3ETLA 4NEYA 3MB5A 2PRKA 4FJ2A 5JDCA 3QE3A 2H2GA 4PQYA 3DV0B 2AI1A 2WJ3A 3NXZA 4X1IA 1JTVA 1ZD5A 4REQA 3DQZA 3AEXA 1YTUA 1JX6A 4QBUA 1K0VA 2W9CB 1X2BA 4BWJA 2HHQA 4JSYA 4PXYA 1D8YA 4ZYUA 3QV2A 1RTKA 3K5IA 4LYDA 2M9MA 2VNIA 2BJHA 2O4CA 1QO0D 4TTAA 2VRWA 1DQ8A 1XSEA 2C22A 1TKXA 2VBYA 1JDBB 3G2NA 1M1YA 4O0MA 2HEIA 2Z58A 3WL3A 5AIAA 2HU8A 1RA6A 1IBRA 1OD6A 3WJ2A 3F96A 2VHCA 5JSYA 2HQFA 1EBUA 3EDRA 5A62A 3EX7C 2BTQB 4GPBA 2ZOMA 3I62A 4CZCA 4TZTA 1E6MA 1NJFA 4PANA 3AVTA 3JY6A 3TOZA 3KZNA 1Q3TA 2Q2VA 3M8YA 4K59A 3E1KA 9ABPA 4GVLA 3BBFA 3KS9A 5ETVA 3DUWA 3N2ZB 1K6XA 2XI4A 3IEIA 3JQMA 1AUQA 3UT6A 3IIEA 2XQJA 1KJWA 2RIPA 2A33A 4DCOA 3C87A 3MILA 4USKA 1UEJA 1NJGA 1XTSA 2N7CA 1M0TA 2CFSA 2IF0A 3A9SA 2HHXA 4WXWA 1PFVA 2OORC 5JROA 2A0FA 2W2KA 1X2EA 3FAZA 1HNWJ 1XZNA 2XKBA 4WESB 4BZXA 4HNSA 1LSUA 2QF7A 1AXQA 1KDPA 3SHFA 1HBNB 5F98A 3QGPA 5FLXY 5H3CA 2WTBA 1YBAA 3ICWA 4MOWA 4QDTA 1OC2A 4JP2A 2QMZA 3U40A 1GZ5A 2PX3A 4PLGA 2FIUA 3ONNA 1W0CA 3HVTA 1ZHOA 4A8XA 4W6QA 4PZYA 3ZZ0A 1BQ4A 1UUFA 3MJCA 4HNVA 4KRYA 2JH9A 3UWSA 2X3GA 1PSZA 2JHAA 2QD1A 8MHTA 4OJNA 2VSOA 4CLKA 1NURA 3MLAA 4F2WA 4C8YA 1A7AA 1FL9A 3K72B 1YHNA 2HS3A 5EKDA 4YJGB 3PL1A 1NQWA 1CUEA 1JX4A 3H18A 4DBLC 1KE1A 1T8RA 1RKBA 3CM0A 3HRIA 3R3WA 1A5AB 1IBMJ 5AM2A 3PXXA 3CPSA 3FJ1A 5IC5A 1DKMA 5DLQC 4YRCA 3ESZA 3K7RA 1CUUA 3W3ZB 1PCAA 1B6SA 2ZRBA 2LKZA 4RJVA 5TDHA 3MJEA 2ZBCA 4YP7A 5DJ5A 3BBBA 4JI1F 3H3FA 3GCWA 1LBQA 3FWPA 3GILA 1X9WA 4HMQA 3RTBA 4D57A 2VB6A 2W6JD 1Y63A 1E5TA 2XTMA 1BA3A 5L8VA 2D3UA 4D8YA 1N1DA 5TQ0A 1SXIA 2WMDA 2NUPA 3MWLA 1R43A 3SBEA 4AIRA 1CB7A 3QXXA 5K0BA 4B3OA 3HFGA 1NUUA 1AA1B 1QX4A 2OAEA 4FOPA 4G0WA 3NYWA 5IF9A 1LJ8A 1NNSA 3MQ2A 2IZ1A 5CA1F 4G5OA 4RQBA 2VHEA 4NESA 2ZAOA 1TLFA 3FGNA 3WGVA 2G71A 2LRHA 3IBCB 5HRAA 3KOOA 4BNYA 1WDTA 1PQUA 5AXMA 4CKBA 2ERYA 4UHDA 5T4HA 3UGQA 3SEQA 1IY2A 3HVJA 5T3YA 3FNHA 4MWDA 3M7VA 1E9DA 1E5QA 1Z3IX 3KYLA 4M99A 5ETRA 5H7XA 5LD2C 4KWEA 1GL6A 2ADFA 4P2SA 1XOIA 2N0SA 3EWAA 1QUFA 2V4ZA 3V1LA 1I3CA 5CEFA 5LQAA 3LA0A 1S2MA 1FNNA 1YQTA 5CMLA 1N2CA 5A9SB 2RAUA 2Q7OE 4V1Ak 1RJ9A 2GHVC 3JZDA 5DDPC 2IEZA 3PENA 4V0NA 3KG2A 2K2WA 5DU2A 4GIBA 3ESYA 2C2RA 1XWLA 3FGZA 3QFRA 3R7WB 4PYRA 3EMKA 4O1IA 2O0JA 1ZI9A 3ONEA 2HZCA 2HVIA 1YASA 1I94J 3EC2A 2R7TA 5K3FA 2ZD1A 4CHTA 4JASB 4M7WA 4UQTA 1WULS 2BQUA 5TIIA 3PUJA 1VYUA 4F9EA 2JIZD 5KG4A 1RC0A 4CDNA 2Z04A 5DX8A 3IAAA 4DLBA 2NO6A 3KLGB 2EARA 2HHJA 4QXAA 3ZV3A 1QQ5A 2NX2A 3CKKA 2GCIA 2V65A 1NG1A 5DBFA 1TKDA 2VK8A 3HEBA 2O7VA 2L18A 1X4BA 4DMKA 4YLYA 3IQXA 1T3HA 2NZ8A 1RRPA 1YS7A 1BXGA 4ND3A 5AO9A 4QU9A 2DNZA 1FDVA 1Q7EA 4KHMA 4ZOBA 3AD8C 4ZQIA 3PWKA 2ZANA 1MU2B 1AV7A 2O67A 3EF3A 2QM0A 4RTLA 3ZE2B 1SMKA 4WK3A 2ZSDA 5KZMB 3PF9A 2DNQA 3SYNA 3VF0B 1FUEA 2WJZB 2C42A 4ZVOB 1J2TA 2X5NA 1HWJA 3L7CA 1USGA 4WY2A 1HI8A 4C48A 1EKSA 4MQ4A 1T94A 2J3MA 3MTEA 2RHLA 5EWFA 1VG8A 3SSRA 5JAUA 4IO0A 2YQ5A 2JIBA 1VSUA 3PC6A 3WRVA 2GTIA 5DLPA 1HYSA 1TM4E 2TMKA 2FZLA 2XUJA 1GV0A 4TMYA 1RADB 1WSBA 3IRXA 3IT0A 4X4NA 4WXEA 1IBSA 1GLGA 1TVMA 4D3XA 4EX7A 4IM7A 4YMGA 2B98A 3CD0A 2HWIA 5I7OA 1XZKA 3RS0A 4K9SA 4LXTA 5E2QA 1JHPA 1K66A 3TIVA 1KIMA 2J9RA 4R31A 2Z98A 4EGJA 2FR1A 4OYIA 4PONA 3PFHA 3QT5A 2PYDA 2ZWPA 4BO7A 3GTYX 4DJBA 2VQFB 4GLLA 4LSWA 3C5CA 4EUSA 2JFDA 1UPAA 1WIWA 4IGKA 1IWPB 1LQ2A 4AS1A 1RIFA 2I4MA 5JSFA 3CLVA 1QRUA 1TLTA 3N6RA 1X7ZA 2DHCA 3W2VB 2YC2C 3CWZA 3B54A 1Z5VA 2CJBA 2O8CB 4MAAA 5I6DA 3GHHA 5CTJA 4OZNA 1JLBA 3W9JA 2EWWA 4FFLA 4RZXA 4TZ0A 3FMPB 1U6JA 2GC8A 1J0CA 3QWPA 4IBOA 1QLNA 4MWSA 5DE3A 3UK6A 2DGSA 2CQIA 4WT7A 4J0FA 3HCWA 1G7CB 3M1VB 1VBZA 2WM9B 2G1KA 3O3CA 1P0MA 4MTCA 4DV2J 5D0RA 3EW9A 2J5AA 4B3TJ 1C0KA 1ZD2P 2FUG6 4HWOA 1C4AA 4R2LA 1KP2A 1IIBA 1YDLA 4LV8B 3ZCQA 1YIOA 2PY6A 1L7DA 5B7QA 1F2GA 4UEOA 1RT5A 4E4TA 3QVLA 3TUZC 3VAJA 5B7GA 3QGGA 2GF2A 1XMIA 3IP8A 2QFIA 4CTAB 3O9VA 1QFYA 1M5UA 4LI0A 5KOJB 4NJMA 2FF7A 1Y0HA 4A8FA 2GZOA 1RTIA 3VR1A 5JUMA 1SUQA 1JHDA 1U0JA 2Q79A 3Q0EA 3RS9A 4OLPA 3ULKA 1O51A 3BB5A 1FE8A 4OQJA 4ECYA 1TMKA 4UUMA 4ED8A 4V2IA 1QXSA 2Y9PB 1CNFA 4PNZA 4CTKA 5KWJA 4DJFC 3OBIA 4LRXA 4ITSA 3HVAA 2J48A 3VISA 4KWCA 4YB6A 1LBTA 1K1QA 3W5ZA 2CDRA 5IDVA 2H5JB 3SQXA 1HQYE 2O2EA 2JJ1A 1OA0A 4FGZA 3RTCA 5A4MS 2HA0A 4F9GA 5D85A 4B4WA 4OYZA 2AC4A 6AT1A 4CIVA 3M2RB 4NE9C 1EKXA 3LQ4A 4DQVA 3HFSA 1FDAA 2FP3A 3OQPA 4O3QA 2X8JA 1TT5B 2X1BA 3SAJA 4C08A 3KDPA 1RWNA 1X1SA 3DBOB 2VT6A 3KD2A 2O3SA 5F51A 4Q4HB 4JLSA 3GGPA 5CDFA 2YHUA 1H7WA 2FY1A 1ZH6A 2B5JB 2J07A 2GK6A 4WXOA 3B3GA 1F5NA 4X7RA 1RQNA 3U4HA 3ANXA 1RWQA 4DPTA 2BV3A 1EFVA 1UPMB 4ANCA 3T1TA 3EDOA 4XDDA 2RCYA 4F5YA 2VEDA 4URYR 3CIMA 5F23A 4XFKA 2DO4A 1DHMA 4DKXA 4B6GA 3RARA 4KW7A 4YAGA 4TTQA 2P27A 4DX8H 2AL7A 5CYFA 2ETVA 4WF9Q 3H5RA 2AJBA 4OQZA 2Y9HA 1FS5A 5A3VA 3INGA 4C2MA 1ZD8A 1MN6A 1O94D 3B38A 1WABA 2QLWA 4LQCA 2X40A 3V42A 1EVLA 1SNYA 1NSTA 1Z0UA 5LP6B 3PGA1 3HXTA 3TINA 2KG0A 1WACA 1NQOA 2XUAA 7ADHA 4XOUA 4UAGA 1T9HA 1ZGJA 1XEZA 2EKPA 1OFGA 4NI2A 4BY9E 1LLQA 4EWTA 5IT9U 3JALA 3AESA 4X66J 4BRZA 2XOKA 5JJBA 3GG0A 3NDRA 3L04A 2V6BA 3QKRB 2OPSA 4M54A 1EDEA 4B3SJ 2I55A 1DZ5A 4BFXA 3FYUC 3S8SA 1U80A 2O3RA 1R8CA 4OX6A 1WUTA 4TQUS 2RQ4A 1UM9A 1TTHA 3U4IA 1W1IA 1SA0A 4UTRA 1C1YA 4ZAFA 3KDAA 4K6HA 1CULA 1JSXA 3K2EA 1QSLA 4DR4J 1UFKA 1FTWA 4TTJA 3CJ3A 4UY85 5KOHA 4QU5A 2Z58B 3ZYZA 3GFOA 5D00A 3EDRB 4G3XA 2J0UB 4P9NA 2EG1A 1ONNA 3THYB 4BNZA 2HT6A 2D9OA 3LHIA 2VDWB 3KZOA 2HU5A 4C0KA 5L1JA 1XELA 2WA2A 3EFOB 5GOZA 1U8TA 4YQWA 1I1OA 2RGBA 4DEYA 4DV2B 2C5LA 4B3TB 621PA 4YQFA 2QORA 3HKBA 2KDOA 3WKEA 5C9ZA 2M0GB 1SXHA 4UAUA 2QHXA 3D7RA 4MV9A 1E0AA 2FEAA 1B73A 3DLBA 1HUQA 1UBEA 2Y1RI 1K5GA 4YT8A 1XZJA 4CEJA 3KUKA 2A0FB 4Q3CA 4F4AA 2WONA 3RAMA 4G67A 2VBCA 3MURP 2OV2A 5AXNA 1FUKA 2CXXA 4YUAA 3VR3A 2FP4A 4YHHJ 3NQ41 5A9TA 1E3DA 4BJHB 1SJ3P 4WFKA 2R96A 2E7VA 3CA8A 2W2OA 1S76D 1KNQA 3MR7A 2VQFF 3QE9Y 3LAKA 1CE8B 3NM4A 4DM7A 1U7TA 2O2ZA 4B9SA 4RENA 2QAGA 2JIOA 3HI6A 2ZLBA 2FLPA 3EXIB 5TEWA 4K6CA 1Y37A 2R6R1 2G1PA 3ZZUA 1T26A 4GU5A 3HVTB 3KALA 1CDEA 1PQYA 3WK9A 1D1TA 4HT7A 3DTTA 3I0MA 4PSUA 1DWPA 2XYRA 2QL6A 4Q1DA 2IQ5A 1ST3A 3JYQA 1MP0A 3ETNA 3RFXA 5EMHA 3MCUA 4G4JA 3A25A 3AOGA 1SFRA 2IV2X 4FKBA 1JJFA 5JQGF 3O4RA 2VCHA 2OV4A 5F35A 1QP7A 1EFPA 4Q9NA 3SK0A 1E1MA 2VP9A 3K6SA 3FCCA 4FVCA 2C9ZA 3BDEA 2HK3A 4DYHA 1VB5A 2O1PA 4Q7MB 1Q50A 3PIPQ 2H65A 2ANBA 4GW3A 3DXXA 2WFLB 4ED7A 4ETNA 1TO2E 4UBMA 4OI1A 2WFMA 5TQ0B 5CVTA 1BWEA 4BTEA 1U7WA 4B3OB 1Y6RA 5LJIA 3H2HA 1CFZA 2OXFA 3TLKA 2QGFA 1XEWX 5BWMA 3I76A 4B6FA 1YL5A 3GMGA 3HVIA 1EFUA 3JQ8B 2VFUA 3DR3A 3LO8A 2GAOA 2EC5A 1SJ9A 2XE7A 3Q7QA 4IR7A 1EM6A 3BK2A 3TP2A 3K0BA 5HQ8A 1U11A 4H4MB 1IY8A 4CKBB 1E2EA 2ADMA 1VSQA 2C9YA 3HC7A 4IG0B 1NYQA 4KV8A 3DKVA 5JMWA 4OLOA 2MB0B 2PZKA 2O0HA 1F5CA 4B7ZA 1W26A 3R41A 3K0AB 2BKLA 4O3MA 2L48A 4B3SB 5IV4A 2DKNA 4TTRA 1PK8A 5M2PA 3VC7A 1Y4ZA 1N2CB 2E1PA 1N2JA 1WLYA 5KDOA 2F7VA 5A0YA 1GV1A 4J6EA 4QIWD 2CLEB 3OCYA 3NLLA 3TRFA 2YS7A 3KJQA 4O4RA 1RT6A 3MT7A 1KDZA 2ZWOA 2FEKA 4IMPA 4H1WA 1U2SA 4B4KA 3VHQA 4A8JC 1DQPA 1VRCA 4RQAA 1KS9A 3CCWA 2Q7XA 4C22A 3DPSA 2Y76A 4X4SA 5KI6A 4OL0A 3SQMA 2W8ZA 4GOJA 3T54A 4MIKA 1XCGB 2OCIA 3OICA 2ZE2A 3UXEA 1AKVA 2CYYA 4XD7D 1D9FA 4DC1A 4QEDA 4F4UA 5T64A 1RAAA 4BRUA 2GM9A 4GWKA 2FMTA 1HV8A 2PLFA 5DGCA 3KNGA 4U95A 2YNGA 4DG1A 1BXGB 1RQPA 2OAQ1 1NCLA 4XK8C 2QT9A 3SI7A 2QX6A 2G4VA 2OP5A 4QQNA 2VL1A 2MSKA 1GZ6A 5E4FA 2XWSA 2PX2A 1TAGA 4CTMA 3QUCA 3N7AA 1E5DA 2RJ3A 2VP4A 4Z9YA 4FOSA 4M37A 5G0TA 3WZMA 3M4NA 2W2PA 4OZLA 1QMPA 4MYSA 3H5XA 5GONA 3VDRA 1VSTA 2IY7A 3L2OB 5CT9A 1VL1A 2HK7A 2QIPA 2O20A 5D1NA 2E4AA 4UASA 2Y1LB 4ZAWA 3LQYA 1RYYA 3SMQA 1OE0A 1BJKA 2PGJA 4F6LA 2F3RA 1FC0A 4ED5A 1RHQB 3A1WA 4DX5A 5KG6A 3F3SA 4LHSA 2X4GA 3IR5B 1CDDA 4R84A 4F5WA 3BJYA 4QJVA 3IRXB 1D7OA 4XDHA 4BN5A 4X4PA 4IIGA 1JZTA 5IJ9A 4IG9A 2KI2A 4KGKA 3LYHA 4DMRA 5D0GA 2YNIA 2P91A 4RHTA 2XMUA 3CULA 1ZIOA 3M4YA 2AFIB 2NZYA 4UCFA 3O4HA 1RXSA 4CCAA 4MINA 2P6SA 2Q0HA 1C9DB 3DZBA 4DL9A 1KPGA 3QOFA 1NSAA 3VZHA 3GLIE 2GPBA 3ET6A 4DV2F 1FRJA 5GTDA 1JLFB 4PSCA 2RGAA 2J9DE 4XUDA 3IO5A 2FGOA 2ZI6A 3CINA 1R3NA 4QPTA 2P5YA 4C4ZA 2ZSHA 1OGIA 1LF5A 4JBLA 1H2UX 3TKAA 5AW3A 3MHYA 1LWFB 1X7ZB 1N5JA 1E7RA 2IK8A 4CLRA 5K99A 1I9GA 5ALZA 5BSTA 4LF2A 2FV8A 3ZNPA 1Z2PX 5IT4A 4RVHA 3X44A 2FHJD 1HZZA 4L6V3 2GS8A 3WLIA 4NAUA 2IRXA 3MFIA 4ZQHA 3NM5A 3FTNA 4KTTE 4DT1B 1JDPA 2B0JA 3FXAA 3TSCA 2VPXB 1JFLA 3GT7A 4PC7A 4MGZR 5FOVA 4C7QA 1XC7A 2MSSA 2D8MA 3AEYA 1KETA 5P8WA 2QQFA 3ROEA 5DX0A 1PF7E 4LKRA 2W2MP 1LS1A 2PHZA 4OG2A 4DEXA 5EJFA 3RE1A 1FX2A 4BTLA 1UEUA 1KFKB 2HNDA 2HYIC 5H0IA 2GQ0A 4EUFA 4O2BA 1QO9A 1RT5B 2BW7A 1CQMA 5H9VA 1A9QA 3ADOA 3PF8A 2HBRB 4E4RA 3AV0B 3VI4B 2ONKA 2M52A 2CQ0A 1UBNA 2RAPA 3L4KA 1UEKA 5F64A 2PX0A 3KJVA 1N9ZA 2C1ZA 4OHKA 3R0VA 1RTIB 1JRLA 2QW1A 1PZHA 3MCOA 3PXCX 3AIKA 4IDEA 4GL2A 1JIJA 4AD6A 3C4QA 1SURA 1OFVA 1YB5A 1XQIA 4LUCA 1IZ8A 4JBIA 4XTTA 2IYNA 5DXFA 3DW1X 2X0DA 3G68A 2G4LA 4GMFA 2XYHA 5A03A 4OBBA 1Y3HA 3GX1A 1DXHA 5CCDA 3PHCA 3A1EA 1XJ0A 3F78A 4PHHA 3LY8A 1EJ6A 3QNWA 1LPMA 1N9GA 2GEUA 2PFGA 3DHVA 3F5FA 5HPYB 3DOFA 2X8JB 3L0OA 4RTSA 2KM8B 2V0NA 1X9HA 5ALXA 1ONSA 3G2QA 2GPSA 3SG0A 1RWNB 3ITEA 5F7JA 3A3PB 4ILRA 4TYPA 3BFVA 2H1RA 1D6NA 4DDKA 2BHLA 3S7ZA 3IM9A 4JX8A 1RT4B 3BRSA 3ET4A 3PW0A 4YV0A 1NRXA 2VJVA 3U62A 3O4VA 1F3LA 2SECE 1C4WA 1JFFA 1EFVB 3QTLA 3FR7A 1PT5A 3GZJA 4RQUA 4W63A 3ZTSA 4JH0A 4MWBA 4TRRA 3J80Y 2HRBA 3CH6A 4AKIA 1N32B 1QIIA 3D02A 3O0DA 1SBCA 3JATA 3DQPA 3DCJA 4Y2MA 4L5JA 4B3SF 4YR0A 1S1UA 1KFBB 3FRHA 4MV1A 2IU4A 1ZICA 4ED3A 1D8ZA 4PO1A 3K5HA 4ZYZA 3L4BA 2EPIA 2UUPA 1PLJA 4N5NA 5DLFA 2ZJRQ 2B5VA 3RRFA 4F12A 3PFIA 3DLJA 2HW8A 3EQ8A 5SZIA 4TYWA 2XZDB 4C8KA 4ATNA 5B0CA 3WKCA 1P1JA 1ZK4A 2LQ5A 2FUNB 5E6SA 2O6LA 3ZO7A 4ETXA 3T0FA 4KE8A 1AHPA 1JDJA 4UFNA 4NU8X 3VPBA 1JZSA 3MG9A 2BGIA 2AR9A 2RS2A 2G72A 5I4BA 2WU4A 2B6NA 4XM0A 3JALB 1MAHA 3WIVA 3AUUA 1J8DA 2CKWA 5KQGA 1ZTWA 4QULA 2YZMA 3PPWA 3I6MA 1HMVB 1I8TA 2OPSB 1BN7A 4QR1A 4RQTA 5MLCV 5EE3A 1Y5LA 1V4VA 4ZVPB 1N2HA 2PZMA 3QIVA 1CY1A 4PQFA 3V2IA 3PEFA 1TTHB 2DK2A 1XIQA 4QU7A 1SA0B 4QLOA 3KLBA 3MK31 5TVGA 2WDZA 5BYKA 3SS7X 1FWPA 1W2WB 2BVNA 4I4IA 5AM0A 3PNMA 4QXPA 5ECWA 4DHWA 1MIHA 4R9VA 1D2MA 4HQ0A 2W2LD 5KOHB 2C4MA 2V7WA 4ZP1A 2RKOA 1Y1QA 3ZJTA 2DEUA 4XIJA 3AVWA 2PXXA 4NPHA 2WTUA 4HKQA 3TQQA 3TO8A 4C4YA 3U39A 1U24A 2KWIA 2G5CA 4EUNA 3O47A 1JQ3A 1G9TA 3IBWA 4BUZA 1KO4A 2ZJ8A 4OU4A 5EEGA 2XEDA 1WPQA 3HCAA 3HKBB 4Q9DA 1NJ6A 1RZ3A 2FX2A 5YASA 3ONQA 4UOGA 3ZDYB 1S3GA 4D2IA 3BMOB 4YIKA 1QHFA 4MIAA 4KKXB 3C3XA 2V97A 1XQWA 1JAZA 1NZFA 3PDHA 5GVRA 2IEIA 4MYHA 5CJJA 1G5PA 1CQZA 3CN7A 1C0PA 3GN1A 2GUGA 2FP4B 1ZGGA 1I2DA 3HDVA 4M0CA 3T19A 1GADO 2OR3A 4P32A 3BTVA 1SJ4P 2PA3A 1G0OA 3WL7A 1F7VA 2QAGB 5DBOA 3IJPA 4F04A 1FDBA 4KUHA 3DDZX 1R18A 4BV9A 3TLZA 4FX2A 1M0EA 2I3GA 4ZVQB 4YO8A 2OYRA 3FZYA 3N1UA 3LC0A 4YV1A 1G1XA 2DUWA 1O95A 1NDHA 3PI7A 1WNTA 2F9LA 4IDDA 3DV0A 3NS7B 2F8TA 2TS1A 4FUQA 1CF9A 2HNYA 3T7KA 4PR6A 4UNIA 1WG5A 1H0RA 3OPNA 5F78A 1O8CA 3S1SA 3IURA 2MQ8A 3H98A 2EBFX 5EEHA 1EFPB 2V8GA 1P39A 5EJAA 1MF7A 2V5VA 3N7UA 4UXIA 3I30X 4QQRA 4PVCA 4BX3A 1QU2A 3G17A 4YCJA 4EG1A 5BV7A 3G9TA 3VDQA 1QG4A 2JEGA 1E7MA 5BURA 2H65B 2R7OA 4J3NA 2J0QD 2RHWA 4IR9A 3HO1A 4LVUA 1TELA 3WB0A 2P40A 4M9RA 2AJ0A 1I24A 1NDUA 2BTQA 2ZQYA 3MM4A 3ILIA 2XY5A 2CQCA 2IEBA 4QDJA 4E70A 5EA2A 5C18A 1Y4AE 5L8RC 4OIFA 4M46A 5KWEA 3DE5X 2F1OA 5LP1A 1OVGA 1GH8A 2PGXA 3ZWQA 5KC9A 1JMKC 3PX7A 3ZVRA 1VKNA 2HSWA 3CUWA 1OLUB 5E33A 4W5NA 3ESDA 3W6NA 2OFGX 3T6JA 5D78A 1EA5A 1X13A 5AI8A 1ONOA 5GAHI 2J3DA 3A0RB 1MO3A 2FN8A 3IE1A 5ICCA 1URPA 3IKVA 3IPRA 2FR8A 5KG7A 3JWIA 1U3UA 5THKA 2HIHA 5JJIA 4YBRA 3SGLA 1DEHA 5H83A 3NS6A 1APBA 1R3DA 1GTJ1 3MYYA 5K9ZA 4UQGA 1V5WA 1Z4IA 2CXQA 1O77A 2CWDA 1FO1A 4AM8A 1GTL1 3MJVA 4ZAGA 2BQ3A 3UCZP 3KJQB 1JHOA 3JWPA 5G0UA 5HIJA 1RT6B 2ONYA 4CF4A 3RGGA 4YRKA 3K9BA 2DY1A 2REXB 4GR4A 4WCDA 2V9CA 2G17A 3TXAA 3LPCA 4CG3A 1T1GA 1PRYA 1VKRA 2COEA 1N6QB 3RBDA 1UDBA 1MGOA 5SY9A 2MYTA 2AYBA 1N8RT 4QOJA 1N32F 2D2VA 3AJ1A 2ZE2B 1ZNXA 4TTTS 2AG5A 2K3IA 1U2EA 3IDOA 4YJGA 3VUEA 2IA6A 2HVEA 5KNLA 4C7KA 1T2DA 1DMSA 3R09A 2FMXA 1JHYA 2WF7A 3UOGA 3G0CA 3E35A 4ROSA 4KRXA 2FB0A 1N1MA 1A9SA 2JBWA 3FMVA 2YNGB 2BE2B 5KJ1A 3S01A 3JD3A 2WRZA 3DEIA 4GOXA 3AH6A 1Z68A 3KEMA 4GZLA 3WWEA 1COWD 1T9CA 2A8YA 4J7XA 3L84A 5DX1A 4TWIA 3IUQA 2DVIA 2BUNA 4G1MB 4P5EA 4ILKA 2HRUA 4IH1A 3PHGA 3RUAA 2BKNA 3CLTD 3KETA 3R76A 2G1UA 3KYIB 3H9EO 1U2QA 5IULC 1PYTA 2GBFA 4LMZA 4DW8A 3NOQA 3AF6A 2FA9A 4AP9A 4WMLA 4LJ8A 2EHDA 2ISSD 1DFIA 1LTKA 3E53A 5EJ5A 3ROMA 2IHKA 1S4EA 4U8GA 3MGGA 3A6FA 1S97A 1OI7A 4CKCB 4F7VA 3IBCA 3KXDA 1XNQB 4Y34A 1WOPA 5HLFB 3PFBA 3I1IA 2HLNA 4QGBA 3WP0A 1Q95G 2VQSA 2RHOA 3WB9A 1N2GA 5IT5A 3WWPA 2DWQA 4GMDA 3UJDA 3J81U 3SIRA 3UKOA 4M0KA 5P21A 5K5EA 4FKXA 1W88A 5FKJA 3V4FA 2RHCA 2FHPA 3WIBA 3ZZOA 4CIBA 1IEWA 3ET6B 4EBCA 2AXNA 2P8IA 3QT6A 4ZYWA 4LZLA 4WDRA 2CPHA 2B4AA 5A9SA 3WGOA 1FDTA 3A05A 4LEIA 2WF9A 4TV8B 3KT8A 2WC1A 4Q48A 2IF2A 3TSWA 1Z7GA 2NT4A 1KHTA 1JS1X 3SZRA 2FPIB 4DR7B 2CVEA 4N8NA 1VQ9S 3LP5A 4I9UA 3UAVA 3OPXA 3M5WA 3WLOA 2FRDC 2XQKA 3U49A 4HLUC 1U25A 4ZDNA 1OT5A 1UPBA 4I6JA 5K8VA 1NNEA 3S1AB 2HF8A 4WXHA 1I2AA 4S2UA 3KLGA 3NIDB 5SZJA 3O74A 5CH3A 1GKKA 3PUWA 2P9TA 1SOVA 1CJUC 2MMCA 2OC4A 3H20A 5B3KA 2BC9A 4BDTA 2VJNA 2Z5VA 2AJQA 2LWIA 4YR2A 1JHUA 3EQZA 5HSPA 3H99A 1MU2A 3N87A 4O2BB 2CFXA 3DO5A 3SIXA 1U3FA 3HP1A 4FCTA 1MGPA 2BX6A 3NATA 1RU2A 5IX8A 2OBXA 4KYUA 4ZVOA 4C5CA 3KJVB 1KKMA 3UJ6A 3DEFA 1LSSA 4A2PA 2MZ1A 2HCRA 5D4NA 2QQEA 4CM3A 3VZCA 4XW2A 4C30A 2CZCA 4K4YA 2NLOA 3GIRA 1IQPA 4EYOA 2XYHB 4AKEA 2UXCB 1TUEA 1GSOA 4J07A 2JLQA 1OHHA 1RADA 5BV8A 2ZZNA 1VXRA 5CYJA 1OZFA 2O8DB 3PFNA 4U7CA 2OIHA 1UBGA 3P5TL 2W2TA 2FMHA 2H85A 3WHLA 3WYGA 3KAPA 2DYKA 4TXNA 1ZMOA 2R85A 5BR8B 4MCJA 3E05A 4N47A 3VH3A 5B7WA 3K73O 3FUTA 4GKVA 1KVTA 5HL7Q 1JNRB 2QV6A 3DDUA 2IIVA 4UDOA 1JKFA 4KQZA 3QUAA 2O3JA 1FVHA 3EEIA 1UC4B 3ZNQA 1QM5A 3W2WA 5JVDB 1R7RA 4R9SA 3JQJA 2VBZA 1G5RA 2R84A 1LFWA 3MGJA 3JQKA 2PLWA 3WK8A 4DQPA 1WC4A 1MR3F 1AC5A 3DMNA 3AVQA 4KVAA 1WXEA 2PG3A 2FSVA 1IBKJ 1UWVA 2JJ2D 4TMKA 1VLLA 5IEBA 3NOXA 2W93A 3LA6A 4FYKA 2FCAA 1FJHA 1NF2A 1FJ7A 3L8DA 4NLXA 1LXNA 3BFJA 1FRKA 7YASA 3O8RA 2HHUA 4LRUA 4TUYB 2EKYA 1INLA 2VSFA 2TSYB 2Z0GA 1XMQJ 3VKHA 3GG1A 4QXMA 1JQEA 4BNUA 1G7CA 2GVDA 4XYLA 3UD4P 1LQTA 3UXYA 1LWEB 5FPPA 2VAMA 3Q11A 3GL9A 4F8YA 2G7MC 3MRTA 4EVQA 4F3YA 2C96A 3VU9B 4RH1A 1TJ4A 3UVJB 5E6SB 2QSWA 1NK7A 4DYDA 1SUIA 3KDOA 5U1PA 3DVLA 2RJNA 1LPSA 4LFAJ 1SUBA 3DNMA 1Q1AA 4W1SA 2YWWA 3ASVA 3RG2A 1B43A 3AAWB 4CTAA 2GQQA 1IXRC 4PWZA 2ALJA 2WWVD 5KOJA 4WE1B 3Q85A 2OHXA 1D4AA 2HMVA 3E0XA 5CVDA 4F38A 4NWBA 3D1LA 4KQXA 2OD7A 2V98A 1TNDA 1HQUA 4U6NA 3KE8A 4KN9S 1KEWA 4M98A 2R48A 2IYWA 3EARA 2CMFA 3R20A 4CTNA 4LQDA 3A4TA 2HU2A 2H5LA 3BKXA 4NDNE 1P4RA 5D2CA 3DHNA 2H5JA 3WYBA 2TYSB 1ZKMA 5GONF 1C5KA 2PSFA 1ABBA 1JHMA 1W7AA 2AFHB 3NL0A 3TFWA 4USVA 5KFSA 4L4RA 4AKGA 1TV6B 3OUYA 1K9VF 1E0DA 5CDYA 3E2MA 5FTMA 4QJ4A 4X97A 1QK5A 4KDRA 2GO1A 5I9TA 1XYGA 5KVAA 3II6X 3HJVA 1TT5A 4D8WA 5JS7A 2H9AA 3UENA 4LIWA 4WKBA 1IQZA 4YAJA 3TNYA 1QLJA 4XWGA 1KJ9A 2A14A 1X15A 3A36A 3OTOJ 1XNQF 2XLIA 4QYXA 5JH7B 5DOVA 4LNHA 3A9TA 2B5JA 3FUWA 3D1VA 4YDSA 1VMDA 3ZD6A 4I56A 3QU7A 3OVBA 2GCNA 3GLUA 1FDWA 3B9RA 2FMUA 3H5SA 2AKEA 4C3ZA 1GY8A 2Y1WA 3FPCA 2WLTA 2GERA 4K5RA 1SIOA 4PC2A 3AF2A 2WMYA 4MVJP 4KL8S 2PUEA 3EZOA 2N4CA 2OFFA 3QRWA 3BZQA 1GGHA 1NMSA 2ZZTA 1JEDA 1F5BA 4GC5A 4TV8F 4LF4B 4DXAA 5HRUA 1NI3A 2FWJA 2CLKB 4UXHA 7AT1B 4ZPJA 1P3Y1 3EOBI 5EP1A 2JI8A 3A2NA 2RBGA 1M0WA 3GWZA 3WMWA 5I3QA 4DR7F 3I2FA 3UAWA 1IULA 2NTYC 5LP6A 3GIJA 2A35A 1OMSA 4ZMSA 2BRKA 2Y1OA 4FSXA 1EH5A 3AHGA 1C3XA 2JPDA 1PVDA 3ZTRA 4OM7A 2IYTA 2HNYB 1MG7A 1UJ6A 4J2OA 1ZUWA 2WIDA 1LX6A 3KAJA 1EA7A 2QZZA 2K7FA 2DQYA 2JFFA 1A8QA 3QKRA 4WLVA 3C8YA 1ND5A 4XSVA 5H4GA 4D9MA 2QS9A 5AXKA 4LMRA 3TSZA 1CEEA 3R6TA 1D9ZA 1E9CA 1SJRA 3KQQA 3HCRA 1DO2A 2ZETA 1HYGA 5BORA 3TB4A 1YZLA 3COZA 3ER6A 3DMTA 4O2BF 1ZTTA 1KK3A 3DLLQ 1U2CA 2IFXA 4D6PA 1R7IA 1P2GA 4IQ4A 4XDGA 3EPPA 3Q41A 2J0UA 2UZ0A 2FLVA 2XOXA 5LYJA 3BZUA 2WI8A 5CGQB 3IXLA 3R2JA 3THYA 4BFCA 4Q82A 1FP7A 2VDWA 4XGNA 4B35A 1Z4NA 2I65A 2EBUA 5BN4B 3EFOA 3ADAC 3AJ9A 1NBIA 4QGGA 1XJQA 2FTKE 3O2QB 1OOEA 4N7TA 1Z4JA 1AUXA 4FXVA 3RS2A 5EP4A 3UR0A 1T1RA 2UXCF 4ZDWA 2IM0A 5AJWA 2WBMA 1ZJYA 2HJSA 4TLCA 3EVNA 3AODA 2W70A 2NO7A 1NDCA 1UBOS 4XSHA 3DE7X 1BWQA 3KHKA 1PTJA 1SUCA 2HDWA 3L6DA 5BR8F 2H31A 5DHTA 2VEOA 1HDIA 1Y34E 2MGZB 4UTOA 1FDUA 1P9QC 2BEWB 5HIKA 5HHTA 3ELHA 3ANTA 5BSEA 4ZC8A 2HH9A 1R6BX 4BE9A 1GR0A 4OJ1A 2C2OB 1CE8A 1FFBA 2DAPA 2HS0A 5HR5A 5LQMA 4EENA 3K9QO 3DGPA 1U2GC 3EXIA 4LF9J 1SC1A 2X3DA 4M4SA 5B6IA 4PZVA 3CRNA 4RAOA 2YZ2A 3CSSA 1OREA 1VJ1A 1J06A 4M0DA 2I33A 1UKBA 5C2GA 1WMEA 3GH3A 1XL0A 2Q9AA 1OYYA 3HCPA 5IAGA 4ZT3A 1VPTA 6PFKA 2D7SA 3IT3A 3ZWBA 2B3TB 2KVIA 4PUOB 3ZWYA 2BE7A 1IG0A 1WG8A 5B1DA 1YR3A 4ECEA 5TEVA 1HLGA 4AZ0A 2PD3A 2VZEA 3AUKA 1WRBA 3BC1A 5KTQA 1A2QA 1QV7A 1QLHA 3R77A 2Q6TA 4AAYA 3TR6A 2C5EA 2PV7A 2PZ8A 4MRRA 5EUMA 5KQSA 1FMTA 4HAUA 1GUZA 1N57A 2G0CA 1RKJA 2Z6VA 4OMCA 2ZOFA 1DP4A 2WFLA 2ZC4A 3EIFA 1KYWA 4G2NA 1OAOC 3X3UA 4DSUA 1E7SA 1C7FA 2CJ9A 2VJKA 3LOUA 1AD2A 5CHEA 1OGJA 1Y3AA 2IWRA 5ALGA 1MIOB 1TTPB 1ITPA 3RFFA 4HI0E 2VOEA 4YRDA 1DJPA 5DH9A 4ZQBA 3TWOA 3FOAA 3GROA 4JR1A 5EWGA 5HVHA 3IODA 4C0SA 3JQ8A 1NHGA 3H4TA 3ZVLA 4FQ7A 4EABA 1XDWA 2NU8A 3SSSA 3GRCA 4BBYA 2MZRA 4YP6A 1WDMA 2WOJA 4D0RA 1FTSA 1WTFA 4UMDA 4H4MA 1GRRA 3NBPB 4KXNA 1LDGA 5K4AA 5FOQA 4M9CA 5CABA 3ONVA 4IG0A 1RRKA 4R2HA 2VHJA 5FI5A 1S2LA 1LRJA 2H51B 1W88B 1WUIS 4DV6F 4WPAA 2AE1A 3EOAI 3K0AA 2HCFA 4CMIB 4RU1A 1WL8A 2X23A 1L7NA 4A6XA 3DUFA 1KEZA 4YRSA 5JH7F 4HEJA 1BX0A 3EIOA 1OWNA 1ID1A 4L16A 2UUCJ 4HX5A 1YCFA 3N2YA 2JGMA 2ZH4A 5K20A 4BECA 2DYAA 1ZIXA 5E4JA 2GKSA 3BYZA 4JK3A 3VMFA 1BHQ1 1PQWA 4P38A 3DLPX 3E9YA 1QDUB 3I8SA 4B7XA 4KQWA 3M9XA 2CJQA 4I50A 2DNOA 1RBMA 4LF4F 2BQRA 3NWJA 4ZJPA 2VCEA 1YJWS 3HV0A 3KCNA 4FFBA 2PCLA 1CZKA 2I54A 3R9KA 4LJLA 5FLXA 3ROQA 3KLVA 1IY1A 1EVEA 1DBWA 5G0RB 3QVGA 5JW6A 3JSBA 3CVWA 3M3DA 3DR5A 5JI2E 4EB8A 1EDDA 3TOCA 5ALLA 2V6JA 2I4RA 1HNWB 4A8QA 4IIBA 1P17A 4M3NA 1KSPA 5G4KA 2IZ6A 2YN2A 3JD2A 1I1GA 5DHAA 2Z43A 1TO1E 3CDEA 4QGAA 2Y1LA 5KFXA 2YXNA 3IAS1 3LLMA 2WB2A 1N5SA 1RHQA 1YK1A 4EYIB 2LBPA 4J7CA 3IR5A 4G36A 5HCNA 3GXBA 3QZUA 4B75A 1C7QA 1N5YA 4OYMA 3R97A 5BOVA 1OWOA 4R1LA 3W5DA 3F6CA 1BC5A 2X76A 3TRIA 3QWIA 5HA5A 1ZLYA 5HDQA 4R1TA 5D0HA 2AFIA 4J9NA 1E94E 4EHLA 3D1JA 4HAYA 3M8KA 4F2PA 1ML3A 3AX6A 3DA8A 2YWXA 5H02A 5IZCA 2IIQA 1TRHA 1IBMB 3W2WB 4HYKA 1WP9A 1JLFA 1IAVA 1QP0A 3VAAA 4L76A 2FK7A 1O6GA 4C0JA 2PCJA 3H2UB 5JCPA 4ZLLA 5CNJA 5JIBA 4BFVA 1LWFA 2YXLA 2PZBA 3BD9A 1JA9A 4X00A 1Z8FA 1ZNYA 3O8OA 3EYWA 4IRKA 4INJA 3N6LA 1KYTA 1G21E 3PRVA 2JCBA 2YDXA 4RH0A 3F5QA 2HF7A 1FRZA 2P6MA 5KVVA 2P69A 3HL0A 4N01A 1BUXA 4DT1A 2L3MA 1N34J 4OJKA 4F21A 2ZGVA 4ZPCA 2BJDA 2LVWA 1RM0A 3WOHA 3Q7SA 5DDIP 2VPXA 3DWEX 1CUWA 4PYQA 2VC0A 4KSBA 1MBZA 3A27A 4JJZA 2FPMA 2GVDB 3LQKA 4OGLA 4O0NA 4LQLA 1E1YA 3WJ7A 2C07A 4LBYA 1N6NA 2CQ2A 3BGSA 3KYBA 2DG2A 1YGYA 4X63A 4QHSA 3F3KA 4KE9A 1Q3HA 4NLDA 2PZGA 2Y1GA 2CLLB 1G6HA 4JJ6A 1F1BB 3RUPA 1R4NB 1QF9A 2HBRA 1KI9A 1DKLA 5HATA 4LYYA 2UAGA 3M6WA 3BDPA 6NULA 1KO1A 3Q5GA 4LGYA 1AU9A 4KYVA 2G28A 3QAEA 2HA6A 5HQMA 5DEIA 5TF4A 2W7PA 1GARA 3CNQS 4B79A 4YWJA 1IBLJ 4JB8B 3ZCPA 4QTTB 2H00A 1T6NA 2HBYA 1HQUB 4M8KA 4RETA 4DSLA 4KO0B 1RCOB 3ER9A 3LC2O 2CQDA 1EG2A 1I94B 4UU8A 4KNYA 3IO3A 3T38A 5ITVA 3F5SA 1KMMA 4PR0A 4A2CA 1C8KA 1SIBE 3R5GA 2EZ4A 4CG1A 1LS6A 1HA3A 5D3KA 4AJIA 1UBRS 3OUYB 5CBPB 4Y6IA 1MH9A 3QKIA 5LCXA 2YV1A 3IBGA 1RXIA 1Z47A 4AJOA 5FJJA 2Q2WA 3A8KA 3FTPA 4TWZA 2A5YB 2B20A 1FHTA 1RYMA 2FWRA 2PQ6A 3Q5DA 2C8VA 3CVJA 2D1SA 3P2MA 3DOUA 3A3PA 1YX2A 2XGJA 4OIXA 3QPVA 4H08A 5AM5A 2FB9A 2BABA 2ZAGA 1RT4A 3EC7A 3N5KA 1JL3A 1U7XA 3H2LA 3P5SA 4QUAA 1H05A 3L92A 4FSHA 4DMFA 4LIRA 3V7NA 3ET5A 1NONA 4B3IA 3PJDA 4GOND 3KLEA 4FJ1A 3SEAA 1KI6A 3IOEA 1JW9B 5B1SA 5LXRA 3L7KA 1C9KA 1M10A 4MK7A 1FESA 3TTUA 1YRUA 4HNUA 1HDCA 2C29D 3PYMA 4ARCA 3BIWA 3TBKA 1F0NA 2WM2A 3UNXA 2HZAA 5FXMA 2ECPA 2LKCA 4CH7A 3UCUP 4DA7A 3ME5A 3OA2A 3UVEA 5BWLA 2GK7A 5A3SA 1EE9A 5E3QA 2XZDA 4OKNA 2PQ0A 2ZATA 3T3PB 4DL7A 4BL5A 4LZPA 2DULA 1T2CA 1W581 1GMWA 3C39A 1T2FA 3K7EA 4YP3A 4MRSA 3N76A 3P0RA 4RW8A 3DC2A 3OF5A 1VG0B 4MMXB 4NYJQ 3IQDB 4QX6A 3TVZA 1HMVA 1G4HA 2MSTA 2HHLA 3LANA 1Q2UA 5J4YA 2J08A 2H2DA 2XUHA 2IYYA 4ZVPA 2DISA 3IAEA 1RJWA 4NL5A 2FXIA 4XOIA 4FJ0A 3IPCA 5D0EA 4MHOA 2Z2JA 4H1TA 4TRMA 2R2SA 5ILOA 4LVNP 3Q8SB 2C94A 3RVBA 3DN9A 3OCJA 1X0PA 5D8HB 1HNWF 1S77D 4LJ6A 5LYJB 5K0JA 3K0CC 1GQRA 4QTUB 2L9DA 1JLEB 4B71A 4RFVA 6FDRA 4UCXA 4RVGA 1YKWA 2OTCA 3FHLA 1W8IA 5D6GA 1KH3A 5K45A 3HCFA 4KT0C 1T10A 1SD1A 4O25A 2X4LA 4UE3S 1J22A 2LZ0A 3E18A 1QF6A 1VHIA 5HJEA 1MWYA 2VF4X 5BWOA 3QLJA 4U2KA 5EPOA 3KAQA 3W64A 3PNBA 3GG2A 3BMOA 3DEJA 1KK2A 4MYDA 3LS2A 4JNKA 1ADCA 2YWJA 3ZY5A 1SR8A 1Z88A 4E0BA 3PU6A 2YCBA 2JFGA 2VPZA 4KAXA 3D1QA 2HAFA 2OP0A 3KLHA 3UKJA 4NRDA 3PT5A 4QQ8A 1TCUA 4L8VA 4QBFA 1IBMF 3L9XA 4Y9TA 5SICE 1Q12A 4QYMA 1XR3A 2SBTA 3VA7A 3DGPB 4ZPXA 3WBFA 4V3CA 1QHXA 3GH1A 5GMKa 1SC1B 3SZUA 2WZCA 1FX4A 4DR2J 3LBAA 3LWMA 3DCNA 4ZVQA 4OGWA 2ID4A 2UU9J 1MC8A 1RWVA 1KI1A 3L1KA 2AKAB 3P0FA 5EUHA 4Q3NA 5AESA 2WU8A 4FZ3A 1YJQA 2Q6VA 3NS7A 3Q8VA 2RUGA 1VL6A 2LQBA 3HEMA 4FEYA 2X1HA 2ORWA 3I5MA 2OQRA 2BMAA 1CHDA 3EB9A 2JAUA 4AZ0B 4YAFA 2P3LA 3KYJB 5CFPA 4TKMA 2FW6A 1P7PA 3ZU6A 4U7PB 3R8YA 4L8GA 2BHTA 3STUA 2J4FA 4DQDA 1ZRMA 1ZM2A 3G2HA 1H8ED 4GP6A 4AJPA 1T29A 4AS3A 4OZJA 4RY9A 3QOXA 3MTAA 4LZZA 3PSHA 3P0JA 1TKRA 3PVCA 1SUWA 4HB4A 2HRZA 2XO6A 1UFVA 2BTOA 2BGJA 2NSYA 3EZ5A 4MWGA 2HWHA 5K2OA 3RV3A 1VYVA 1GG5A 4G23A 1ORTA 3OE7D 4R6XA 1BRTA 4WUTA 1KVSA 1DC8A 4Y2SA 3S7RA 4NA1A 4FT2A 1U8UA 3HH8A 4H17A 1FS6A 3BSSA 2NU8B 1IONA 2IU0A 3SLKA 1OLUA 3T7CA 4HRXA 1B00A 4JLUA 1I94F 1PKUA 1R5NA 2C2DA 3LOQA 4RU2A 3A1VA 2HV8A 2WSLA 4CV0A 2QSZA 4CKYA 3OU6A 1S89A 2HQDA 3LGMA 3A04A 2IOHA 3AERB 5CQGA 4HDSB 4X66B 4E12A 1KY3A 4ASUA 5JPDA 1L0BA 4ZCKA 1OR8A 3B5EA 2FFBA 5LQKA 3WB1A 3DUFB 2JVRA 4HT5A 1DJOA 3H90A 2DC1A 3PGVA 4BUCA 1F51E 3RBZA 1LI7A 3SOZA 4FXDA 5K14A 5IV3A 4DR4B 3H25A 5A4AA 2OEKA 1MB2A 1Q3KA 2JIMA 3L7UA 1TF7A 1KP9A 1OBVA 3QSIA 1N6QA 4CF6A 2Z95A 1GTVA 2QIOA 5K20B 4HF7A 1MTZA 3MT8A 1KQOA 1YFZA 4G5FA 2RGNA 1EM8B 4ZO7A 5E1MA 1ZD4A 1Z4UA 3DKRA 4F67A 5BT8A 2RGWA 4Y7CA 2P3SA 3AKEA 1V7QA 4Y2VA 2LE0A 5LDHA 4JVLA 5B0BA 1N3IA 2CBGA 2ZB4A 1EWYA 1SU6A 1VMBA 2WJJA 3TG2A 3IMGA 2PJUA 4I50B 5ALWA 2GB4A 3DBLA 5B7PA 2H1CA 1KDVA 4JC5A 2BE2A 5HFJA 1QZZA 3MWGA 4FFBB 3C66A 3LRPA 1QX3A 6LDHA 1HT2E 3TTSA 1Z0ZA 4RZ3A 2AZ3A 2VFRA 2EW8A 4WN3A 5LP6F 1CP2A 3HMJG 4RY2A 4QARA 1RD4A 1VE7A 4R0VA 2ODWA 1LDNA 4Q19A 3QVGB 4YVFA 4GLFA 2P62A 3OR1B 1JLAA 2ZM6J 1AM4D 4FHDA 3EWSA 3BGOS 3BDAA 1B16A 5IUJC 5KTNA 4LXQA 4BP8A 3HT3A 1F48A 1WEHA 1V4BA 4YHHB 1NMQA 2Q43A 4M1MA 3VYTB 1OB2A 5G4KB 4XH9B 1OASA 5CB4A 1RVV1 2FPXA 5DISB 3NBKA 4NJOA 1DEOA 4L8LA 2VI5A 4KN8A 4LPSA 2I3BA 3IN5A 4HAOA 2EKBA 2UU9B 2IDJA 4UQLA 3WBBA 1FNSA 1N5YB 4CKCA 4WGGA 3WL6A 2FZGA 5E5NA 5BYSA 5A5FA 2Z6AA 4M7OA 1O4WA 4IDGA 3V5NA 5HLFA 2DGUA 2CW5A 1FP4B 4PZUA 4G65A 1CZNA 5LYJF 1R0BG 4YAEA 4F3KA 2D2EA 4IDHA 2WP8J 1NJ5A 4QT0A 1ZUD1 2O1SA 5JD3A 3CIFA 4XR4A 4YRZA 5LWQA 1PKEA 2V7UA 1F0YA 4HH1A 4G9GA 5EHZA 4B3TF 3UFBA 4Y6GB 1B6TA 3FX2A 4P8RA 2EK1A 1CJTC 3GVIA 4EVRA 4TV8A 1J5EJ 4IDAA 3UB4A 4M8IA 2X9GA 1X7HA 1XTRA 2XQCA 3QF4B 3RVDA 3QATA 1YKSA 3O8OB 1L5HA 2FPIA 1A8UA 2GHWA 5KYXA 2QVYX 1PV4A 2ZI7A 4DLVA 1XXHE 2QTTA 3T12A 1WV0A 3CX7A 2FQYA 4LVOP 3PY8A 1BQEA 3UC9A 5CYOA 5K0SA 4HQRA 4MDHA 5JCJD 4YR9A 1MWZA 4DLNA 3S1AA 1IVSA 1ZMBA 1U49A 1RFLA 4ANDA 3BJEA 4OP3A 4YRNA 5TPZA 4WBFA 1NPPA 2GM3A 5HK4A 3VU1A 3WDMA 1GNRA 2KB2A 4DQRA 1QIMA 3LUBA 4E1BA 5DLDA 1CZOA 1KHWA 3MWBA 2PDAA 1KSHA 1VDMA 1GKYA 5D7BA 4FD3A 2ZE5A 1H9CA 1F14A 2R7UA 5DASA 3BCHA 1W96A 1QG6A 2W01A 2HEGA 2QW0X 1GGMA 4OYYA 5EGSA 2PO4A 1UEIA 2DNMA 2PSZA 2A92A 4KGDA 2BM1A 3RVNA 3M1LA 3PGJA 3PNIA 1ECCA 3HM2A 4I81A 4E31A 1IJEB 1DVRA 5FLKA 2IUTA 2PKCA 4CLYA 2PKYX 2Z3VA 1L4BA 2HBYB 3PQ5A 4Z5XA 3HZRA 2BIFA 2ZJ5A 5GQSA 3SMZA 5IBCA 3GV0A 2K3KA 3Q8PB 1R3UA 1CQIA 4Q45A 4AG3A 1XC9A 3O4GA 4DA4A 2FUG1 4BIIA 1R1DA 5EE9A 4DLGA 4H7PA 2XMMA 5AXAA 2O8DA 3GLSA 1ZRSA 3KEGA 4FUTA 4KK3A 2GUWA 1P61B 4F1WA 2GBLA 3IA7A 5F2EA 3DXBA 4K2XA 1UQTA 2Y68A 3IQFA 3CUSA 2F65A 2EVZA 3OT5A 5D6OA 1KMQA 5C3MA 1L1RA 3TF5A 2WYHA 1BCRB 1AKWA 2FN7A 1YJRA 3HPRA 3PLAE 3THXB 2WJHA 1TA4A 5BNWA 5JVDA 1IY9A 1GA4A 3KRTA 3DTVD 9ATCA 1NXSA 2I1WA 4BJ1A 1Q1KA 2G40A 1FXLA 2AEFA 2ZIAA 4DCUA 2HRRA 1GYPA 2XKKA 4NPOA 4CZ2A 4DSEA 4YGXB 5T6MA 4FF1A 2G06A 2ZM6B 5C24B 2IHBA 3KLEB 4RMGA 4CDIA 1KI6B 3WWYA 3UWPA 1DRVA 3QLTA 3BERA 4X66F 2O9JA 3OO1A 4TUYA 1JQLB 2JLEA 2PUVA 5IK2A 3DLTA 2IFTA 5I8WA 4WZZA 4OH7A 4BVHA 2JBHA 4CU5A 2W4QA 3E82A 5F7OA 1ZCFA 4J4BA 1LWEA 2DQZA 2V7BA 2FHMA 4DR4F 1EVYA 3PDJA 2DR9A 1MC1A 1KC3A 4FZ5A 1IXKA 3VU9A 2AD9A 2J0EA 3WKBA 3UVJA 5JXGA 2FJBB 3TPFA 4WE3A 3UFXA 3EZUA 3O1LA 2CPDA 2NQ2C 3PGKA 4K2HA 2VXCA 4RFSB 3M8QB 2RAVA 2PKQP 2VNHA 4RW8B 3ZC4A 2CJWB 1SKAA 2YUTA 3ZWKA 3QT7A 1FT8A 1LC3A 4WE1A 4I50F 4NE7A 1U09A 3EEBA 2PTHA 3HA7A 3Q1LA 5JNUA 3P1JA 5CLJA 1IAQA 1YZ3A 2E29A 4INZA 3SJBA 1J5EB 1JLCA 4RTPA 5DCLA 2YY7A 4M1KA 1WHTB 3M8ZA 3JWJA 2RH8A 1TU0A 1U0HC 4XX1A 2HSJA 1YONA 1DDOA 1BD6A 1HDEA 1JR2A 2R25B 3W06A 2RD2A 1NVAA 5GJBA 3L7PA 2R00C 2B82A 2KJQA 2O8EB 2ZYAA 1EGAA 1FFXB 4YHHF 3U1NA 5CFOA 3GFZA 2AFHA 1R0AB 1UXHA 1NBOA 3CJSA 4PLCA 2YH1A 2I9SA 1RQGA 4MW5A 1TV6A 1LVUA 4KHRA 1WCV1 4M1TA 5GAJA 3S2UA 4PCVA 1ZWKA 4XGQA 2RI0A 2ANCA 4JLVA 3E5NA 4MA0A 2ZAIA 2X0FA 4ARZB 2VD3A 3OTHA 4MUBA 3SIPB 4LR7A 2WF5A 3WTCA 1GN9A 4WNYA 8OHMA 2KYZA 5JH7A 1TL4A 1WMAA 2JGIA 5GV7A 3HY6A 1HD1A 4ZC1A 3ZHTA 3PEUA 3ZG6A 3GRUA 4JZKA 4TXJA 2IC5A 1OYWA 2VPZB 1N25A 4BP3A 1YR9A 1FXDA 3CCQS 3KLHB 4O1MA 2CDAA 4P34A 1NX9A 2JVIA 1FYVA 5FV4A 3AY7A 5CB0A 3ZH9B 2AMJA 1L7EA 4ILEA 3S2SA 5KT4A 1X9MA 3QXJA 2DPLA 2PGDA 3ZZRA 3T3DA 3HHPA 2VDNB 3U6BA 4DSTA 7AT1A 2P9FA 2ZE7A 4HG2A 6CHYA 4BQFA 2TRSB 3ZI4A 3MI7X 1RWVB 1HYEA 1HPLA 2H1VA 1WNFA 1BJRE 1NMYA 3LYAA 2GH1A 1T1JA 3VPHA 4HNQA 4WLUA 2P6PA 1Q7GA 2GNOA 4H3HB 4B0PA 5B0DA 4O2LA 4N5MA 4J2HA 3VU8A 4OV1A 1FRIA 3CD6S 1E2GA 2PRYA 5TLSA 2N47A 5L3ZA 4DLYA 4YHBA 4EA8A 1AQIA 4TS9A 5IANA 3PQFA 2OHIA 1F6BA 4IMJB 3ITHB 2M3DA 3BXEA 3J80A 4C6SA 4N54A 1W36D 3O8DA 3VR4H 4YCSA 4YO7A 4NU0A 4GXNA 2NSBA 4N03A 4U8VA 4MUYA 2HM7A 2GZ1A 4HEA9 1L5YA 3I9ZA 5KQLA 1E1DA 1R0CA 5K51A 2JEFA 3FHJA 2KTQA 4YRGA 4Q00A 3TZKA 2ROEA 2YIJA 3FSIA 1QYWA 2NTVA 5AKIA 2PZLA 3WIOA 3AP2A 3KJFB 1VMEA 2HSDA 4BJ6A 5DNWA 5DT9A 1BDIA 1P2BA 4PO9A 2PMWB 4NOMA 5BN4A 4PAMA 3B7GA 3JQRA 3E23A 2ZRGA 3W6ZA 1GTZA 4WW0A 2Q2QA 2RDIA 4KRGA 4IS2A 4RJJA 3ED5A 4PG5A 3KEQA 5LMCA 1SQ6A 4E2WA 2Q66A 3TSYA 1EWQA 1QK4A 4RUAA 1AT1A 1Z73A 3CC7S 4DJTA 2PUDA 3PITA 2HW3A 2X77A 4DQQA 4W5HA 3LPAA 3JZAA 1Q14A 1YB4A 3GEBA 2H4FA 4G0ZA 4ALKA 4DMUB 2BBEA 3M05A 1N5OX 4I1TA 3KFVA 2OCXA 4KQMA 2I2BA 2MGZA 4P53A 1VG9B 2BEWA 3GMIA 5HE9A 2X13A 1KZHA 2Z30B 4DARA 1X70A 4P3YA 2MR5A 4KMRA 3IBSA 1HMYA 2C2OA 3GLHE 3HU5A 4MHSA 2HBZA 4QQBA 1EB0A 2B83A 2DNGA 2BKXA 2DNRA 3AVVA 1PL8A 3D68A 5K14B 2AGVA 4RJLA 1M2GA 4CMCA 1EJ7L 4OBXA 4PPYA 2C99A 5KYTA 3C4JA 3K70C 2ZM6F 4KE7A 4HWPA 1XPUA 3ZDRA 3SFUA 4TPKA 2JFBA 2LCQA 5EJIA 5J1SB 2BCEA 4G1EB 3USZA 1UWCA 1C1BA 3IJ5A 3STTA 4HX2A 3QWHA 2Z57A 3O9ZA 2B3TA 2R4UA 4PUOA 1P3DA 3RJTA 5FBVB 3DBLB 2OLEA 2IHR1 1E6WA 1VBNA 1XJCA 1R8QA 1PO7A 1JQJC 3LTOA 2KO1A 2XYVA 4D43A 3QVXA 2GYYA 2JLSA 2RBKA 3K32A 1EJ0A 2CNKA 1SUAA 1YI1A 2AN3A 2G6TA 5HBGA 2ZJ3A 2J46A 1JLAB 1HWYA 2AKWB 4DSIA 4QYTA 2WVCA 1TFYA 4NC9A 3V1KA 5F1OA 2R8PA 4HLCA 5FBQB 1R88A 2ZUFA 3PK0A 3QHQA 2JLVA 2PJDA 5LYYA 1DKUA 1MXHA 2F7SA 3N0RA 5CR9A 5M2UA 4Y0FA 4GKKJ 1HIYA 4ZVGA 4D9GA 1XLTC 3HHLD 4MQMA 4MJ7A 1MIOA 5CB4B 2FY8A 1ZW6A 4ECWA 3KZCA 3ZN2A 1DLOB 2OVFA 3U1VA 4AYXA 1UFRA 1E4VA 1J5EF 1OX6A 4CE6A 3Q8UA 3MEKA 3CNOA 2VOJA 2MJLA 5AKZA 2BFBB 5JCOA 3I2IA 2PU7A 1PV2A 5ETMA 5DN6A 3JQEA 2H5IA 2BYTA 4EO8A 2FZGB 5CU7A 4F4FA 3MBIA 3OM1A 2J7UA 2IXTA 3G59A 5AM3A 4A1OA 4KITB 2IW3A 3NBPA 1CHNA 2ROPA 4PS0A 1S5ZA 2P9JA 5T41A 1T3TA 4X92A 3T35A 4RTJA 4F72A 1F2HA 2O5EA 2DJWA 2OE2A 4YCNA 2I2WA 2H51A 1TM3E 2BMEA 5JI3E 1FNCA 3EDMA 3FCWA 4GBMA 2XD9A 3C41J 3RREA 4CMIA 3UMMA 4W4MA 2PZJA 3G9UA 4ZU3A 2FN9A 2HHPA 4YT5A 5AVZA 2GZAA 1Y3FE 4L2IA 1Y11A 3E8OA 1FYEA 2X5XA 4RZUA 2W6MA 1L7XA 3LXRA 5C25A 1L5HB 1D4FA 1WUUA 2VXYA 2WD9A 2B9YA 3C16B 5KYXB 4B40A 3SFTA 2PU5A 4KCGA 1N1EA 3RB0A 1CY4A 2HX1A 2ZWVA 2C92A 2HWTA 3E3LA 1VHLA 1T5IA 3K1ZA 2QTAA 4CMBA 1QDUA 3QWAA 2P4SA 4UUPA 2F00A 1CDZA 3D4IA 3PNKA 4NDAA 4QNNA 5HFNA 4CGYA 2IJNA 3SR0A 3BQ2A 3FSEA 2ONZA 3TDKA 5EIHA 4W92B 4MAFA 5CLGA 3NS5A 3SC3A 4PX5A 3DMHA 4DCSA 2MJUA 4WFNQ 3VI3B 1RAFB 4K0RA 5K2MA 3GJSA 2VUSA 4NU6A 3T9EA 5G0RA 4HGNA 1ZD3A 1I3OB 3BJIC 3MMPA 1B8VA 3MTBA 4KGZB 4GPAA 1NXTA 2OLWA 1VCIA 4CIYA 3CGWA 5KWVA 3CUEF 4O4LB 2YNMD 1TC2A 3RIYA 3OY2A 2PKRA 3E9NA 1JUDA 1R9NA 1SD5A 4Y2GA 3THRA 2ZIUB 2QP9X 3M6IA 1G5TA 4ZCLA 1TADA 3AB7A 2XTNA 4GX5A 2Y8EA 1OJ4A 1WXIA 1CQIB 2FE4A 1DHRA 4RHFA 3QLVA 3FCOA 3FKBA 3N07A 1NAQA 5DDOC 4OX7A 1RUSA 4LI3X 2AK2A 2NO0A 5AUPB 2JANA 3AOBA 2GCOA 1AH2A 4TU9A 3RW9A 1GX5A 3H3JA 4JU8A 4RF4A 4TSFD 3ADKA 3IAM6 2Z83A 4X90A 4NASA 3G2PA 5IZHA 3FOBA 1JR3D 3RRKA 2M4MA 1P7YA 4ZPBA 2WUGA 1D9AA 3LCVB 1SVSA 4ZP8A 2V50A 9ATCB 4LC0A 5ULLA 4RADA 4LXYA 3HWX1 4G2TA 2AEMA 5A2QA 1QCCA 2P5TB 2YJ5A 2XVZA 4JGGA 3U5TA 2GN8A 4RTMA 2E4XA 4DUGD 3JYHA 4E5PA 4ZLPA 3N53A 4S0XA 1L3BA 1NOKA 3OF2A 4CXMA 2VIHA 4BDSA 2ZH6A 3EASA 1U2FA 4G0QA 3QBTA 4MS1A 2F3SA 3IKTA 5DM0A 3K5MA 2FGJA 4BFSA 3TQCA 2A6OA 4D8VA 4ZU1X 2MTBA 2DE0X 3HR4A 1L7VC 5GV8A 1DWQA 4EZIA 1FFHA 3DDKA 4LDRA 3AA8A 4K9MA 5JNRA 1J5OA 1EUDA 1N3BA 2Q1YA 2ZI9A 4K3VA 4B3BA 4NYIQ 2FMIA 3RHTA 4U96A 2Z4SA 3RIXA 4WP9A 4FS1A 1S8FA 5HKKD 4F4YA 1EX8A 4H6XA 3TQTA 1CUYA 1HQKA 5KMGB 5CX4A 4YJ2A 4P2GA 4QUEA 3AJ2A 1VQ8S 1MENA 1EVZA 1MB9A 3PWSA 4HDRB 5FWNA 3KU1A 4OCZA 4IDNA 2WWXA 3LRXA 3UFXB 1RKQA 5DGAA 5C3UA 3QYYA 3HWSA 2BDUA 1F1BA 4LOKA 4HJRA 4YLEA 3QEKA 1ZQ1A 1R4NA 2Q8PA 4Y2RA 3I0SA 1QAXA 1T8EA 4JDPA 5A0TA 2I8LA 2PL9A 4W90B 3W6PA 2D3TA 4B3GA 1Z33A 2GXAA 1KEPA 4Z8YA 1QSGA 5EIEA 1K2VN 4CYMA 4ZCTA 4RYDA 3Q23A 2ACVA 2QNIA 4JB8A 4GZ5A 4QBKA 2C7PA 1JLCB 2OMKA 3FKSA 4JJ4A 1KZGB 3J81j 1TU0B 4KO0A 1HNXJ 3CQ9A 1DKOA 1Z6TA 1EETA 3I9KA 3CVUA 3ZOKA 3P9IA 2IPMA 2PUCA 3CC2S 1S9FA 4AECA 1B3BA 3LP1A 4COKA 4JWKA 4Z7QB 3MFH