3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
3WIUA 3BGOP 3DW1X 2ID4A 1PTKA 1R64A 1PEKE 4M1ZA 1SIOA 2X8JB 2W2OP 5JMOA 1BH6A 3DE1X 2WUWE 2W2NP 1VSBA 3GCWP 3DVRX 5AVJA 4JP8A 3VV3A 1HT3A 3AFGA 3A3OA 5K7SA 4C3VA 3ZXYA 5FFNA 3DVQX 2W2PP 1DUIA 3D43A 2Z57B 1CNMA 1SELA 3HJRA 3A3PB 1GA6A 1A2QA 5AVKA 3DE6X 1S01A 1TM7E 3GCWA 1Y4AE 1Y9ZA 3SQOP 1DBIA 1SPBS 1P7WA 1LW6E 3GT3A 3DDZX 2DUJA 1MPTA 1SCJB 3LPCA 2Z2ZA 3GT4A 1SCJA 3UNXA 4DZTA 3QMPA 1OYVA 3LXUX 2Z56B 1GTG1 3BGOS 4NMXB 2E1PA 1R6VA 1T1GA 1GTL1 4LVOA 3DYBA 1C9JA 4RYDA 3CNQS 1BFKA 1YJBA 2PRKA 3VV2A 1S2NA 5FAXA 3LPDA 3DVSX 1SBHA 1OYOA 1BFUA 2ST1A 5JXHA 2ID8A 1AF4A 1WVMA 3GCXP 3EIFA 4MZDA 1CSEE 1SPBP 4CFYA 4DJ5X 2Z30B 4LVNA 3ZXXA 4I0WB 2W2PA 3VYVA 2Z2YA 1WMDA 4AKTA 3LPAA 2WWTA 1SCBA 4H6VA 4OV6B 1AU9A 4CG0A 4NE7A 3F49S 2DP4E 1AVTA 1XF1A 1YU6A 3SICE 5I9SA 3H42A 1TMGE 1TECE 3A3NB 4H6WA 2SNIE 4HVLA 3DE4X 2PYZA 3OSZA 1C9MA 4HX2A 1GTJ1 4YN3B 4NE9A 1C3LA 2PKCA 1T1EA 3I2YX 1Y4DE 1V5IB 1AQNA 4C3UA 3T41A 2IXTA 1Y33E 3QFHA 1SUEA 2V8BA 2Z30A 1TM3E 3TI9A 4WOCA 2WV7A 1P8JA 4K8RA 4AKSA 1SIBE 1TO2E 2PMWA 2IY9A 1Q5PA 1Y48E 1BJRE 1SCNE 2W2QP 1KDVA 4NMXA 1JEAA 1MEEA 3L1KA 1WMEA 2W2QA 3H42B 3I30X 1WMFA 3GCXA 1ST3A 5B1EA 1BE8A 2PWBA 1P7VA 2PQ2A 5AQEA 1KE1A 4BWGA 5JXJA 1NDQA 3TECE 2QTWA 1WSDA 3TI7A 1Y1KE 1SUPA 2XRMA 1KE2A 2B6NA 2SICE 5ARCA 2WUVA 3VSBA 5ARDA 1SCAA 4NE9C 2W2MP 1Y3DE 4DWWA 4WOBA 2P4EA 1SBIA 3BPSP 3BPSA 1ZVJA 3F7MA 1V6CA 1OT5A 2DQKA 5ARBA 1T1IA 4GI3A 3SQOA 3A3PA 4KG7A 4ZARA 3DE3X 1TO1E 1SBTA 1SUDA 1TM4E 1NDUA 1TK2A 1AH2A 1Y3CE 2ZWOA 1SUBA 4OMCA 1SBNE 1AK9A 4OMDA 1GA4A 4ZOQI 1GNVA 3P5BP 3BX1A 2ZRQA 2HD4A 3EE6A 1GCIA 3DE0X 1IC6A 3I34X 1EGQA 3CNQP 1ZVKA 1GNSA 3F7OA 1SN7A 4H6XA 3Q5GA 1SCDA 4KB5A 5CW1A 2W2NA 3P5BA 1R0RE 3VV2B 2Z57A 2HPZA 2PMWB 2W2OA 1C9NA 3WIVA 1V5IA 1KDYA 3AJ9A 2SECE 4YN3A 3VHQA 1AV7A 1Y3BE 3I37X 2Z56A 1SIUA 2Z2YB 3D9QX 3PRKE 2X8JA 3WHIA 1PJ8A 3VTAA 1SBCA 1ST2A 5AMXA 2W2MA 4K8RB 1ITPA 2ZWPA 1IAVA 4KPGA 2Z58B 3A3OB 4B5LA 3DWEX 4Z2AA 1SUCA 3DE5X 3A3NA 2G4VA 5JXIA 5FBZA 2SBTA 3Q40A 2QTWB 5JXGA 1GA1A 1BE6A 3DE2X 1TM1E 1TM5E 1EA7A 1PFGA 3AJ8A 1UBNA 3QTLA 1Y34E 1SH7A 1YJCA 1THMA 1SVNA 3DE7X 4FONA 1GT91 3CO0S 1S02A 4OV6A 1YJAA 5B1DA 1SUAA 2PWAA 2TECE 3EDYA 3PTLA 3WQBA 3CO0P 2GKOA 2XTJP 1Y3FE 2Z2XA 5SICE 3DW3X 1NLUA 2Z58A 1KDZA 2XTJA 4CFZA 4J94A
chains in the Genus database with same CATH superfamily
2R6R1 2DCLA 4PKDB 2JAQA 2R7TA 1VLHA 3BGOP 2YWWA 3MJRA 2B30A 1AG9A 3E7FA 2AD9A 3IPYA 1HQUA 3V7FA 2ZH2A 4Y7CA 4WU3A 4MYDA 3GFTA 1N2CE 1DIBA 1TTHB 5FEUA 1YH3A 5E3JA 3RV4A 3PQ6A 2GN8A 1PN3A 3QUCA 3PUKA 2BW7A 1HT3A 4UBJA 2ZKTA 2IX3A 4Q7KA 4LRQA 4HZUA 3OZUA 4BQSA 3UXMA 1QP7A 1CD5A 1TA4A 3FLMA 4PZYA 1PK9A 1C1DA 4H15A 2Q4TA 4RJLA 2FSFA 3UJ7A 3TZKA 3MQFA 1EFCA 5JS8A 3ZDQA 1T4CA 3WB1A 4KNVA 3RVRA 2Z8XA 4AO7A 1MPTA 4IEEA 2Q5CA 2WJIA 1S9GA 1E61A 3KOAA 5AJYA 2GCFA 1OR8A 2GDZA 2YWXA 4KLCA 4X6YA 3W05A 2XDAA 4L5CA 4XPIA 1JSXA 2PD6A 4O59O 4E46A 3RJMA 3FUTA 4D9CA 2YJTD 5FYQA 4QL3A 3QBJA 1ZXLA 1JPNA 7YASA 4EB3A 1WU7A 1YWXA 4O3QA 2QMHA 4ZLPA 4A2WA 1IHXA 3PHTA 3P4YA 4DPXA 4UU7A 1IKYA 1MAHA 2WVGA 3DMDA 2L18A 4H6VA 3FTQA 2WU4A 2YL2A 2IIQA 4X7MA 4JFAA 1IAQA 1PVOA 2UV8A 1S0VA 4QTYA 3JQ6A 1EUDA 3C4VA 1L8XA 1GMWD 4AD6A 1ZD3A 3GLQA 4DHVA 2IITA 5I7UA 3O3LA 3K9NA 2A5GA 4Y6OA 4UTNA 4IO0A 1HARA 3T6BA 4EHNA 3G6VA 4UEQA 4R16A 3U02A 1JPJA 2W0MA 5PGMA 4AULA 4P22A 3AEKA 3WBZA 1TM3E 2GXAA 1ZC4A 2W5UA 1FPMA 1XR5A 2XODA 1WHYA 1MV5A 3TQIA 1XMJA 2ZUFA 2XCQA 4WY8A 2HU2A 3GC6A 3BK7A 1Q1AA 1ZZGA 1YJWS 3HUUA 4F96A 4Y2VA 4IH5A 5L6LB 3KNAA 5CD9A 4IO1A 4TWIA 2QLMA 2YJGA 1CQJA 2OTJS 5EMKA 2AQ4A 3GFOA 3OQNA 2X4LA 3PDUA 3PE6A 1ZM4A 4TKVB 3TECE 2Y2VA 2VLIA 2EL9A 3I5MA 4JYMA 4BNNA 5INTA 4UW2A 2HK7A 2HAIA 3AESB 2FKNA 1Y3DE 3LUBA 5EN4A 2VJMB 1Y9AA 3QX8A 3AY3A 1U0OC 1PSZA 3TLCA 1Z83A 4FINA 1AQUA 5DHQA 5K99A 1N5VA 4K9NA 1RHQA 5IC6A 3VJMA 3MJFA 4QYIB 1QKKA 3A7EA 4EL0A 1BXGB 1W0JD 1V6CA 3ZTTA 4NFHA 4NXMB 1KD1T 1YZHA 1LI7A 3EVZA 3ZBUA 2V58A 4ZVEA 2V5UA 1VE5A 4E5NA 4D4LA 4KO1S 4X00A 1RUSA 5C25A 4H31A 5FWNA 5HVHA 4BFWA 3R27A 2BGGA 1VHDA 4CNQA 1L3IA 1YK1A 3MIIA 3HBNA 3ZIAA 3TVTA 4ZV9A 1ECCA 2BPOA 4JUZA 2VI5A 3S6JA 3UF0A 3SX2A 1ZJ4A 4OYRA 4ZJYA 2QN3A 4E14A 3VQSA 5CCXA 3GTYX 1FW8A 2M6RA 2BJVA 3OOJA 1IR1A 3I4FA 3BH7B 4DFMA 4C88A 3BGSA 1QORA 1Y8AA 4NZYA 5CLFA 3QWIA 2AZ1A 3TW0A 4MP6A 3AJ9A 1RT3A 4KGMA 1JDNA 4J9UE 2CNDA 1QAQA 3FWHA 3FZ2A 5ALNA 1UODA 3PYDA 3ET6A 1ZCAA 5JECA 1NQTA 2A67A 3ITHA 2MB0B 4I55F 4CLUA 3ONEA 3VH2A 3TSCA 2OCLA 3R8YA 3ZH9B 4OLHA 2EL7A 3IGVA 3QIVA 4UCWA 1ITPA 3PNIA 3FOAA 5CVTA 4LMPA 1H94A 5KTSA 1N2JA 3MB5A 3CZ9A 4TSFA 2Q0XA 3ABIA 3Q85A 1HNZF 2C03A 2R7RA 1UW9A 3OQJA 1PZGA 2CJXB 4OHMA 1G6OA 1MPXA 1TF2A 3TL2A 1A9ZA 2J3HA 1X7WA 4CGYA 3V9PA 3HP6A 4JOUA 4K9PA 4KLRA 2RQMA 4TUYB 3GOQA 3PD0A 3O4FA 2E9ZA 5M34A 3M7IA 2GFQA 3HVKA 4HAVA 4XIJA 2QLTA 2JEYA 1ULTA 3L8CA 4IFBA 3TAPA 2I1WA 2CVZA 1Z5GA 2M1ZA 3DTNA 1HEYA 4BO3A 1COWA 1L3UA 4LE2A 4GKVA 5DU2A 2MYUA 4CUJA 2RF2B 2CNKB 2VR1A 1JEOA 4WJZA 3ADBA 1MLDA 1H0HA 3L0OA 2PN1A 2BFEA 1K06A 4F11A 1F9EB 1WU8A 1RZVA 2GZSA 1KJQA 4YQEA 2WPDA 1PGZA 1I9GA 4EB0A 1ECBA 2FPOA 4GDMA 3IIJA 1V8BA 1DQPA 3MAGA 1M7GA 3BIFA 4ZCKA 4EATA 2CB9A 2C9DA 1DAEA 4Z9AA 2YY3A 3VR3A 3QF4B 4CYUB 3PFHA 4B46A 4UMFA 1T95A 3MAHA 4C76A 5J2NA 3RUAA 5EJ9A 3I53A 5DPMA 3FCWA 2CDNA 2I78A 3MCWA 1U7HA 3AYXB 5AUPB 2H16A 4YS2A 4F3NA 1ZIOA 2P30A 4QT4A 2OUKA 3R9WA 3OE5A 4CF4A 1DG1G 3LT5A 1E3SA 4JUBA 5K8PA 4IILA 4LR9A 4KPUA 1ZK1A 1JJCB 2XMCA 1DC7A 2IYYA 2LP4A 1P5JA 1KWKA 3D3QA 4CLFA 5KVSA 4QVGA 1G5HA 4KE8A 1TA0A 5A3QA 3Q8KA 4BV8A 2AQKA 3DCAA 1I9CA 1HI1A 2P6MA 4B3FX 2IHKA 4FPIA 3DHEA 4AMZA 3PYGA 1UH5A 3IXQA 2C2OB 5DNVA 4FGZA 1AKQA 2B4VA 1QQ6A 5J2NB 3AB4B 2VBWA 5AKKA 3C45A 4A2CA 5BUSA 4GIBA 1HKHA 1F9FA 4QJ4A 1Q57A 3Q7RA 2RK4A 2DHHA 1ZW6A 4H6WA 3ZFVA 4QQRA 4HVLA 1YONA 1NKTA 3L8EA 1L5WA 5T6MA 2R4FA 3CE6A 5EJAA 1N2ZA 1Y33E 5KMGB 4J4BA 3ROQA 4ZOLA 3KD3A 3PVXA 9ATCB 3M8WA 1EB0A 3GNLA 1TT5B 1EP2B 5LQAA 3AZOA 3IP6A 2PMHA 2FWRA 3H2YA 1RPAA 3ISNC 1X39A 2PR2A 3OZGA 1N1EA 3V2IA 5K01A 5C35A 2IH5A 3I5UA 3DZIA 5AVXA 4KXVA 1C0PA 3GUHA 4X45A 1O95C 1RHUB 3H2SA 4WKNA 2OP0A 3WYBA 4HR2A 2V6IA 3TL6A 3DLTA 4AS2A 1E99A 1XBWA 3KJFB 2V7XA 4DV3B 2PLAA 2RIJA 2CRLA 1V95A 3J80Y 1CE8B 5EKSA 3HFGA 2B7CA 4FOSA 5GWXA 3A4LA 1LSJA 1I7LA 1RD4A 2NACA 2L0XA 1SUQA 3VAJA 4EI2A 5CABA 1WDWB 1F51E 2GEDA 3UGTA 2ZIVB 2MJUA 5FWDA 4UNSA 4LJSA 3CM0A 3ZDBA 4F4JA 3OQOA 3WI7A 2YRWA 4EOGA 5CGZA 4EJ0A 3CWJA 3DFUA 1J5EB 1LLQA 3SZLA 4UBNA 4UE3S 1IBKJ 1G59A 1BRMA 1CJKC 2B37A 2MSEB 4QDKA 3LUFA 2ZIXB 3OA2A 1KTQA 2DFTA 3H7AA 4GI1A 4F3TA 1GPDG 3MINB 2W7AA 5DN6A 1CF4A 2C95A 2RKWA 4C4YA 3P0IA 1NRKA 1WUUA 1QY7A 2ZE8A 4UAUA 2OP1A 3UMJA 3WZMA 2GX8A 1FE8A 3O0TA 3AF1A 5J23A 3DOKB 1L3SA 2RSQA 2CZCA 4DKXA 3DCJA 3I1FA 3B9BA 1ZJWA 1HI8A 4YXWA 3MMSA 2M5YA 2W8BB 3KJHA 3I8XA 1AB8A 1GL3A 4WIQA 4IFVB 2CG8A 3GLGA 3BIJA 4GZ3A 3WGYA 1ENPA 1GKYA 4OJ1A 3K73O 2LIPA 1RT5B 1ZBDA 1EX1A 4Y2PA 4PQYA 4FGSA 5ALOA 1K73T 2XG8A 3OTDA 2OCDA 3IEXA 2ZCJA 1E9DA 3DMHA 5A3SA 1C0UB 1XZBA 4IX9A 3DLEB 1F60B 1X19A 3CVXA 2YZNA 1OF1A 2RG1A 1G7CA 1C0TA 3DE7X 2PVPA 3DKDA 3TYXA 3EX7C 4DANA 4NDAA 2WFAA 5EMMA 3LFHA 2HBRA 4L9AA 4D1YA 3SE7A 4OP1A 1AM4D 1LDGA 1TL7C 2D1YA 1D0IA 4N4AA 2JCVA 4X5OA 4DR6J 2DHQA 5SICE 2Q1TA 2ZTLA 1XTKA 2L9DA 1TZKA 1XD2A 2QT0A 5EKXA 1XDZA 4Q3NA 5ES4B 3EMVA 3EZNA 3B7GA 3GPIA 2C2RA 3QOFA 4C0QC 1M2EA 2W6ID 1BJKA 1U8XX 4D98A 1RHJA 3CUUA 1RK8A 5DQGA 1NM5A 3LPLA 1KYTA 3I32A 2D1QA 3B8HA 1Z4PX 1TU0B 1KERA 4X1OA 1VIXA 2WFLB 4PFQA 3MK31 2C42A 3UD3P 3BM7A 1HNWJ 3HYRA 4DMHA 4S0XA 5LB4A 3KOOA 3ZLUA 4YROA 4GR4A 2D5LA 3DLEA 4EKIA 2VFUA 3BWEA 3EFBA 3UPFA 1U0RA 1XQXA 3ADDA 2WF5A 1U2PA 4WW0A 2KHCA 1DQYA 1S5ZA 2W43A 3U4GA 4YCLA 3EGXB 1P2VA 2DKOB 2QD5A 1RHRA 4MPTA 3KPYA 3THWA 2FU5C 3PC7A 2Z6QA 1X1QA 2MSNA 3DL0A 5K0FA 1GPKA 5KFJA 4MPJA 1W4RA 3IBFA 3IUQA 5F9NA 1G2QA 3HG7A 1XJQA 3X2EA 5GTDA 1DFDA 1V1MB 2Y71A 1HR0F 3KAJA 3GJ3A 1JDSA 3B5IA 2WILA 5CFQA 3R9KA 1I2BA 4EY4A 2ZPTX 1NVBA 4MWEA 3O90A 1YI0A 4P3NA 5J5CA 1C2TA 1YR1A 9RUBA 2QE7D 2IHTA 4M0CA 4KOAA 1IHUA 3UDVA 4WECA 4RBNA 3OPXA 4CG0A 4JBGA 1SOUA 4L16A 1TYAE 3LANA 1P7PA 4N49A 2NSYA 2XBLA 1U6IA 3AHPA 3S2SA 4PWWA 3CLHA 4U7DA 2WIKA 4Z4IA 2HF7A 1CJBA 2QQ0A 4IKAA 3EIWA 4HX9A 2Y0BB 1JAXA 3I5AA 4JOQA 3EGXA 2QRRA 1H23A 4N3BA 2DWCA 1IE3A 5ELLA 1U0HB 1YK0A 2GA7A 2YFYA 1HNWB 4JJFA 4P08A 5I5EA 4LJYA 2VZ9A 1USUA 2G83A 5BYAA 4KDRA 4L85A 1LF0A 4LRWA 2CLFB 1FK8A 1A0OB 1W9HA 2ROEA 1JIQA 3LO8A 1KEVA 4BL5A 1XAJA 3G68A 2O4CA 1RJ9B 1IH8A 3C6YA 3OY7A 4QOEA 1SVWA 3SV4A 5JPDA 4XGQA 1L5FA 3A9RA 3TNFA 5DBFA 1GRVA 4R69A 2DPLA 2EQ5A 3AF3A 3LY9A 4ED8A 2FFRA 4LRUA 4L8WB 1QH9A 1V6AA 4U6NA 4JB3A 1TQLA 4X71A 1G98A 3PFBA 2G09A 1ONNA 4A0QA 1M0TA 4DIBA 1DU4A 3KK2B 3DXZA 4MWZA 1WNFA 1CIVA 2CPEA 1CJMA 1VB5A 1I3OA 4L3WA 2RK6A 3PD1A 4O63O 2HU5A 5I9TA 1TEZA 3D2AA 2HTEA 1CFZA 3DOHA 5K6AA 1VPDA 2H1FA 5LC1A 1AXQA 2BQRA 2Z3ZA 4TT3A 3G5UA 1ULRA 4DI6A 4DOMA 4NBSA 1A1SA 2OO7A 3M6IA 2IVFB 4UAJA 3JPYA 4YQZA 3VR6D 1P5RA 4LK2A 1IHYA 5CVUA 2R7WA 1W0KA 4CBVA 2ZYHA 1X8XA 1SN7A 1NU4A 1AROP 1BOOA 2VF2A 3E8OA 3NWEA 1O3YA 4I14A 2ZI5A 2AXNA 1NASA 1E7WA 4FC7A 4Y6LA 1FRIA 1A2KC 4B3SJ 2ZVJA 1CZLA 1VBNA 5FA6A 3PHJA 1P3Y1 2FQXA 2XUHA 1YL5A 3BHIA 3INNA 2BZSA 2EEZA 3R0QA 3JTMA 1MW7A 3CUNA 2K3KA 2VC2B 1T9UA 1T8TA 3ETMA 1CG2A 1ACJA 1R0LA 5A8KA 1PKXA 1DBVO 4XSGA 2KHZA 1RABA 4LREA 2DNRA 1T3OA 4MO9A 2P6OA 3IHLA 1E64A 4BFSA 4RM2A 2OKGA 2VP5A 1QQBA 4F06A 2D1TA 3HYCA 1CUSA 5U9CA 1R0AB 2D2IA 4TL6A 5EP1A 2C84A 3D6FA 4UY85 4JT2A 1Z8FA 2ZE2A 1VE3A 2MINA 1GT91 3D5MA 4JI3F 4FMDB 3DAYA 3T3GA 3PX0A 1KORA 1JKIA 2B61A 2ZUWA 4UTPA 2Z6VA 2EK6A 5ALMA 4EQ6A 3POTB 2JFVA 4M8KA 3JRWA 5ETTA 2D3OR 4OOFA 2ZRGA 1S2DA 3GLJA 2IEGA 2AOTB 5DFAA 3GIRA 2HBZA 5EE1A 5CT9A 1I3LA 1NNEA 1VQ7S 1PEKE 5B2EA 5DLGA 2WB2A 3LXXA 3W3ZB 3S28A 1TTHA 2CXOA 4RVGA 4DSEA 2QY6A 2JLEA 4LFAJ 2HR1A 2QSJA 1LSOA 3A3OA 3PR5B 1XR6A 5K8TA 3SU8A 2HZAA 5G0RB 4QTTB 4EEXA 3PR3A 2GO8A 1UWAA 5JI2E 3E8SA 3T06B 2HMUA 1QO7A 4ITUA 2VWGA 3MVEA 2VB6A 1HRKA 1REQB 5KNCD 3WGUA 1U9IA 4MUXA 3X1DA 1CDDA 2G88A 4PG5A 4F84A 1E1DA 3KKFA 3UNXA 4OYAA 3FMGA 3V3KA 4U8VA 3DVLA 1XNQB 1K8XB 3Q8VA 4LF6F 3EPIA 2Z2JA 1RCTE 4KDCA 1FZQA 4RH0A 5AXMA 2UP1A 4OL9A 4CKWB 4OJNA 3DZCA 4GYWA 3FCVA 2EYUA 5FLXA 1TELA 3ZQ6A 3H9JA 3JAWB 4NABA 4DA6A 3DL7A 3RTCA 1UJ6A 2UU9J 3RB6A 2ROQA 3LK6A 2DO0A 1HXHA 1GPJA 1S6YA 2O9JA 1TT7A 3TK1A 1ZAVA 2XXBA 2GF9A 1Z37A 5K3FA 4DL6A 4F7DA 4RX6A 1H66A 1B6RA 2B3TB 3MFHA 1P4SA 1M83A 3UWKA 3OMWA 2P8JA 4UUBA 4QGGA 4RA6A 3AF6A 4AMUA 2BSQA 3EXG2 1O4WA 1ORVA 4TVOA 2QW8A 1T8PA 5BSMA 1T4GA 4TS1A 4ZGGA 2E9RX 2XPCA 2K5UA 3AF2A 1NXXA 3VR3D 3LZCA 1FXDA 4US0R 1HZJA 1SKAA 3A12A 3ZYZA 3V4VB 4ZK6A 5JWOA 5K8JB 1IVYA 1BSVA 5SZJA 4IDBA 1HE1C 2NADA 5JANA 3KOMA 1H3EA 3BR9A 3IS9B 1K8AT 3PUZA 3IRVA 1KZ4A 3NBYC 1Y4ZA 2EKLA 2RBEA 3MM6B 4PLZA 4L95C 2PAFA 2YICA 1E1QD 1KJNA 2G17A 2IYAA 3V1YA 5JUMA 4IUDS 3C8HA 4R3NA 4CO2A 5F8MA 5HM8A 3KFXA 2ZS9A 1UC9A 2DIVA 1GADO 2P4EA 1S1CA 3ZHSA 3IL2A 2CKMA 4TMYA 3U19A 1AA9A 2E89A 4LDQA 1HNXB 1DL5A 5JC8A 3CZAA 4GXQA 4YCNA 1EHCA 2ZSIA 5H9VA 1NKVA 5D01A 3CH5A 3BBBA 2XHCA 1O9HA 3L49A 1FMLA 1K8RA 2X14A 4TKLA 4URXR 3KTAA 4CT5A 2GVZC 4POAA 3D1VA 3AY6A 4PC7A 3AXTA 3OJXA 1W6UA 2BF7A 4MB2A 2E5GA 2FOIA 1J2UA 1KL7A 4D43A 4X4TA 1EQMA 1MO3A 5CNIA 4JVNA 5IK2D 2YHUA 3RUFA 4IP0A 2P5YA 3ELHA 1DEKA 1W4BA 4DOZA 2WVEA 3L7BA 2AQ8A 4JYCA 2G4BA 3G87A 3PCRB 3BAZA 5M2UA 2B4OA 3E5NA 3B1VA 1RP7A 1T94A 1UCFA 1SV5A 3IPAA 2WD7B 3T54A 3H11A 3WQRA 2HADA 3DBRA 2MKCA 3FPAA 4LSWA 1YB5A 1OOEA 1Y3BE 4FFVA 4KXQA 1FKPA 1G5QA 3D4NA 4TRJA 4FUTA 4K6FA 5FOVA 5EPUA 4DF4A 1YB1A 4QELA 4FYYA 2OHIA 3C3BA 1OPZA 4RF3A 3NMRA 1F06A 5IC5A 2B2CA 4WK2B 3TLGA 3CCWA 4ND4A 2W9XA 4AK9A 3WGIA 4QWAA 2GHPA 2WHXA 3TVYA 5BWLA 2VCYA 1X5OA 3H84A 1JJIA 2XVMA 4CIBA 1X60A 2PUBA 3TI0A 4KFTA 4KGKA 3HSZA 4YB5A 2LECA 4KSEB 3G2OA 5SYNA 3SJUA 4N9QA 5CZVA 1C3VA 4XE5A 2ZUEA 2VP3A 5GMEA 2GESA 5ESRA 3P9YA 2ZRPA 4ZVOB 3EJMA 3TE7A 4BWFB 5KSOA 4QYWA 4TKMA 3DRSB 1S7HA 4PS1A 1OSCA 4OVKA 1X87A 3G6WA 1QR6A 4HHJA 1U02A 4G0XA 4HYQA 4TROA 4DGQA 5C42A 2E5WA 5JTTA 3FVRA 2VL7A 2P2NA 4P53A 4I64A 2JH9A 3A37A 4UT4A 3EUAA 1KKUA 4XASA 2BBOA 2NSDA 3P0EA 4HV4A 5DGCA 4O08A 4X6UA 1CY4A 3IERA 5JY6A 3STHA 2ZDGA 3TAQA 4GF5A 4ER0A 3QRWA 1DB3A 3V2UC 1VKRA 4F0JA 4L73A 3QF4A 1GPH1 2R7SA 2QRNA 3CIOA 1GQRA 1L5KA 1QWOA 2UZ3A 1C0KA 4R8UA 5AKXA 5I51A 4RZ3A 3WNZA 4RUAA 4RK5A 4HH0A 2JJ2D 3VSCA 3ZJTA 4EAAA 2R60A 2FWJA 4GP9A 2ZJ4A 4BP3A 2ZJQQ 4DCSA 1O51A 1ONBA 4KMOA 3QFFA 4AD8A 5HMMA 4YGXB 4RKQA 2WICA 1RYMA 1OHHD 2DKNA 3LHSA 3RDPA 2QUZA 2BE7D 4PYKA 5KYVA 1TL7B 4KPUB 3EMBA 3OFND 5T7BA 4CRJA 1YQDA 2OM2A 5DGIA 2OAQ1 4KHRA 2NT3A 5K8OA 1C30A 4YV2A 1MENA 2H57A 5REQA 2A1UB 3WMWA 3FJOA 1ROFA 4KVAA 4WK1A 4XCVA 1E5TA 2BM8A 1K68A 1ECJA 1NX6A 2X0EA 1M2KA 2JGIA 4P38A 2IIVA 3BXEA 4WP9A 3NTOA 1RI7A 3HP1A 4XM0A 4KXFB 1C8KA 4TWJA 4B9TA 1Z2NX 2A18A 1BMFD 3VR5D 1YZUA 3ZTQA 1OXUA 1NVAA 1JWBB 2RHOA 1QH8A 1MJGA 4DXLA 1L3KA 1K5DA 2VQEJ 2O1PA 2ASVA 1JEQA 2BGUA 3W6PA 2IA6A 4X7PA 4XB2A 4C29A 4Q12A 3SXUB 1CS4A 2GETA 5HIMA 1KI7A 2GHWA 2QJOA 1Z2AA 4OK6A 4NYMQ 1NVFA 5E3RA 1E6EA 2AXPA 1JQAA 4Z4HA 3GV8B 1ZAWA 1D09B 5JAQA 3ROZA 5J4YA 2AYXA 2IPOA 2X23A 4GBMA 4R5PB 4HVTA 1EE9A 2W6IA 3PEWA 3Q9NA 4LDPA 2C59A 5GGXA 1V5WA 1UA1A 2BFFA 4H7JA 4RKUC 1QJ4A 4MWBA 3FPSA 3L0SA 1R37A 4RQBA 1WO8A 4C5AA 3HULA 1NLKL 4UQOA 4RANA 5ES3A 2X77A 2BFMA 5I7SA 4OX9Y 2XTZA 1RLTA 1BD6A 1OXMA 3EVAA 4TYYA 2H4XA 3K09A 5BJRA 1NN1A 4AL7A 1OT5A 3LMKA 4L6AA 3EXIB 4GPBA 2VEOA 3SBDA 2NSJA 1X1RA 5E1OA 2L08A 1I6MA 1KFBB 2V6GA 1SVIA 3FZEA 2VBYA 1BX3A 2PLRA 3J7Z5 1G7RA 1GG2A 3AGQA 1IC6A 4JB2A 4PC2A 5EG5A 4XUDA 5EIXA 5D85A 5GY7A 2OORA 1NV9A 4QXQA 5K0JA 1MQ9A 4MIBA 3CVYA 4KBIA 3LHFA 3ESDA 5FA5A 2XJ9A 4JODA 4Q05A 4I7EA 1FNXH 1FJGB 5A6SA 1DVRA 1JKHB 4K4ZA 1KNQA 3AEYA 2EGUA 2CZGA 2ZQYA 3SDEA 2GZDA 4LC9A 2QRVB 1B1CA 3AY0A 1A71A 1RYBA 1U6KA 4HNVA 3ZD9A 5LP6A 2IOQA 1Q7GA 4Q4HA 5IKOA 3PZRA 4USHA 4R31A 1PEYA 4LYAA 1LJUA 3NZEA 2WOJA 1AXRA 2MHNA 3FFWA 3N2GA 2JRLA 2VBCA 1SOVA 1RACB 1H6BA 4R8LA 2BGKA 2HVZA 4PAMA 3PV0A 3DOEA 4Q1CA 3PC8A 3VC3A 4CKBA 4EB8A 2JASA 3VAFA 4CIAA 1QCYA 4TWRA 4RM3A 2W42A 3PXDA 1TIPA 4N76A 3FVQA 4P35A 5FLXY 1BC5A 4MK4A 1DAFA 1CR0A 2H2HA 2AG1A 1EFRA 1Z8HA 3PIOQ 3TIFA 3E2EA 2QLLA 4X4RA 5LKRA 3QATA 1GLGA 1WZCA 3EVDA 4NEGA 3PSAA 1T24A 5IJXA 4QAJA 3DT6A 1F8UA 3LCJA 3DOJA 1NAQA 1XCJA 4BNYA 4IIJB 1UAWA 4ILLA 2LEPA 2LCWA 4LV6A 2RE1A 2Q1SA 2ZJ5A 3LSYA 1LRKA 3ETDA 2ZJ3A 5K3BA 1K89A 1NI4B 2XMPA 2UYYA 3C8UA 4ITVA 5ALUA 4N54A 2VP2A 1B7YB 4Z1MA 3V8PA 1BD3A 3RUIA 3GBSA 3DM2A 3OETA 2M52A 2RBKA 1PC5A 4H4DA 3EGOA 2EP8A 4HTFA 2GYWA 4EX7A 3D2CA 3AY7A 4TYNA 1IQRA 1XHLA 1VYUA 1EDZA 2WSCC 3JWGA 5J40A 2BJ7A 4GLOA 2HZVA 2GBCA 4NL4H 2Q43A 1OBOA 2QR3A 3KEOA 3UAOA 4E5UA 1NBME 4LF7J 3E2IA 4UOFA 1PR6A 1YQUA 3OURA 1U47A 3EOAI 2JFYA 1NP3A 3GONA 4R2XA 3IEVA 5F8JA 3X1JA 4D02A 2HSEA 3AIOA 2I1LA 4BUZA 2YNGA 4U2KA 2F2TA 4QYTA 5AXAA 1DC4A 2NR0A 5AJXA 4ALNA 2VG5B 1F1JA 4DR1J 3T34A 2E7VA 1MAVA 3A26A 3GA5A 4IIJA 3IH5A 1Y5MA 4YRKA 2ROPA 4XKJA 5A4IS 4A4DA 2FLNA 1O5JA 3CC8A 4FLEA 4KIFA 4MVWA 4HDRB 2ACEA 4KQCA 2WJHA 4MKZA 4P3PA 4FP9A 4JJ8A 3CR3C 4HTFB 3TRGA 1MKYA 1HWJA 2O2DA 4MKXA 3FYDA 2D1CA 3MEEB 2XUZA 2LMIA 2PI5A 1VHFA 2QZ8A 1FFXB 1J1UA 1LWOA 5CLLA 3UDCA 3BSYA 1BE0A 3N9IA 5EOVA 2UVDA 4BMNA 4W9NC 2CYBA 3TMKA 1XERA 2DH6A 1Q0UA 3X2SA 4U39A 1X0XA 3BT7A 1F3FA 1FWPA 1M6EX 1M2OA 3OL8A 3H0KA 1W0KD 3F41A 1AMNA 3HHKA 2VRCD 3VM6A 4R1LA 4EGQA 2RHQB 3QVLA 2JC0A 1DPFA 3RVMA 3QVJA 4A8QA 1PJZA 4CU2A 3DWFA 2G1HA 3JR3A 4MYUA 3K1JA 4ES6A 3SM9A 3I72A 3G2LA 1ELOA 1OQAA 1GNRA 5I3ZA 4I3GA 4DMRA 4DIFA 1J99A 4Y98A 2MSKA 2DO4A 4NZOA 3L7IA 4IRXA 3K2QA 5KFYA 3H2BA 1SUPA 4WOJA 1WOOA 5BOVA 3C7CB 4I4NA 1IM4A 1MU2B 2EFHB 3FSRA 3GY0A 2JLBA 3AYZB 1SJ1A 3DGPA 1B6SA 4NLQA 1UBUS 3KHRA 3GLKA 2FAXA 4KQJA 2CXEA 3CW2A 5F64A 2DLDA 3K1AA 2DLCX 2HBYA 2FP3A 4XRGA 4I1VA 4UCQA 1SUDA 1PZNA 2OXFA 2DB3A 2UUPA 1G21A 2BKVA 1QVWA 3RSSA 2B92A 3R75A 8ABPA 3UAZA 4YCJA 4DMZA 4ZC1A 4F0HA 2OV8A 3ULKA 2Y6UA 1WJ9A 4HEA9 4RVFA 1SKWA 2C5AA 1B0PA 2HJSA 1B76A 2ASYA 4OREX 3JZIA 3B7WA 2YHAA 1YTYA 3L46A 4QBTA 3TAMB 2DNZA 3RK0A 1T9HA 3WGLA 4B3SF 4D3ZA 2ZSDA 3K0FA 1N33B 5KTMA 1EWRA 3IMEA 1CC7A 1GEEA 2FPPB 2JGDA 3RE1A 1HFWA 1UPCA 3HDSA 3DGPB 3UMVA 2A5JA 1HQUB 4EYHB 3AJDA 2PFDA 7FD1A 3HZRA 1MUUA 4PWZA 4UHCA 1WOSA 3IBCA 3AHJA 1NT2A 2GIQA 3KFLA 3L2OB 3VCDA 4ZI5A 1ISPA 2UXBB 2HV9A 5JXIA 2W48A 4PSCA 3AB7A 2DNGA 3EMDA 1R0AA 3NLLA 4UVIA 1TPZA 1XNGA 4Y2JA 4B09A 5COBA 1B3BA 2V8GA 3W3AD 1HLFA 4C8ZA 4RL4A 3NMAA 1MN6A 2XZDB 3X1YA 3WGOA 3V8EA 1HE2A 4UHBA 2FY8A 3PFOA 2GKGA 2A9PA 1Z56C 4A4JA 2B35A 1FJEB 3C3YA 5EMJA 2IYIA 1KFEB 4QIGA 1FA0A 2J9ZB 1KYWA 1Q92A 2ICAA 3ZQKA 4BEVA 1TKXA 4WU2A 2JGDB 4R7GA 4FDLA 3DFZA 1KPHA 4WEQA 2I4RA 2VK1A 2PVCA 4FBGA 1JE1A 3W6NA 2BUBA 1BG6A 2C2EA 2O0LA 4I50F 4QHYA 2PDAA 7MDHA 2J0QA 4WZMA 5BRJA 1YXMA 1TJPB 3BMCA 1C3EA 2HA5A 1PG0A 5IZHA 3AW8A 3MJ4A 2ZR7A 2KE5A 4PYQA 3BCSA 2HQRA 2I5JB 2O2CA 3FI9A 4BFLA 2JVIA 4W1PA 1YE3A 3KG4A 5JNWA 3UOAB 4OB7A 1N52B 1VJ1A 3L4JA 1J2TA 1MTZA 1XTJA 3MPWA 1X1EA 3QFWA 3EZFA 1A9RA 4LYHA 2ZBFA 1KLMA 3JWPA 1P4GA 3QEOA 2AN9A 1TZBA 3DAHA 3UK0A 5G4LA 2HA6A 3B6IA 4HWOA 5A1TA 3SYNA 4FKBA 3NKVA 4WA8A 5TVKA 3W5DA 4HG2A 3OHSX 3DOLA 1VZ2A 4PRKA 1DG3A 2PXCA 1DAIA 3WWPA 3HCDA 3FFAA 4TS9A 4JKYA 4HXGA 2HURA 4XO0A 1UBEA 5KOIA 5AM3A 5PNTA 1YL7A 3BMCB 3I9V9 1O96B 1AVTA 5CXSA 1LQ2A 2NUTB 3QJGA 3M4XA 1F20A 3N9UC 4RF5A 2RC5A 4EYGA 1ESNA 4HAYA 4GKKF 5H70A 1NYQA 4XDYA 3GSDA 2BLNA 3GOHA 1QRUA 3HA2A 4CF6A 3H20A 3L93A 2LDIA 1L4UA 1TW2A 1NXWA 4YEAA 1EX6A 3O7MA 1POWA 3GUYA 3R1IA 3EIOA 3ZWYA 3L1VA 4RW9B 4N6OA 3O2SB 4DF8A 4GPEA 3ANNA 5DDRC 3NYWA 5ILQA 3ILJA 4OX7A 5AOVA 5CD1A 4DV6F 2B4KA 3V6DA 1JT9A 3HBMA 5D3MB 2RDMA 1ZXXA 5IASA 2J0UA 4G3XA 4G6VB 4LF2A 4GX2A 4YUYA 1O87A 1MEEA 1ADGA 5AW4A 4C0HA 4D9KA 1G6Q1 2V7TA 4MLZA 3WLKX 4C8MA 4YMEA 3JQ9A 4JYAF 1PJ5A 4KYIB 5IAEA 2YVSA 2PEBA 4R9NA 2KS6A 3SMZA 2OTLS 4KQGA 3MEKA 3ZTSA 1VQOS 2CDCA 4AUMA 4XVQA 2YWKA 3M8KA 1K1SA 1UMDA 1M2FA 4GMDA 5EMNA 3GLHA 3BORA 1XOIA 2GN9A 3IWXA 2PE8A 3MCUA 2YQ1A 2PMCA 3LA0A 4MYRA 2VOOA 1ZOLA 4FYVB 1H5UA 4Q19A 3GEEA 4EHAA 3UWOA 4GI3A 2IH2A 3WQHA 2V50A 3HBLA 2KLBA 2NQPA 4BO8A 2ZUBA 4EYEA 3THPA 4W5QA 1J8FA 4QU8A 1NUAA 4HUJA 1F12A 3IS3A 2LXFA 1HGXA 5HKLA 4OYBA 1CW2B 4DC9A 2HMAA 2QA5A 4BNHA 4E1AA 3VDMA 1OFIA 4N65A 3GUVA 1JG6A 4PHTA 3SV3A 1YB6A 4J2OA 3ZWNA 3HCRA 2RT3A 3CX3A 3OJEA 2J45A 4H7KA 3DSRA 1CR1A 1XCOA 4GO1A 3MR6A 3AR2A 1IEVA 1WULS 5B3JA 4UNNA 3W7AA 4MAKA 1UBGA 3A04A 1UXJA 4M7WA 1AUSL 2ATVA 3F3YA 5K3CA 1IR2A 4ZT2A 4FYDA 4KIUA 1PZXA 3Q0AA 4WQMA 1YA6A 1BHO1 3L01A 3G88A 2XUJA 5C37A 4NLGA 2DFLA 2ILVA 4O8CA 3QYPA 4ZD6A 1OSNA 1AGPA 4CG1A 1TZ0A 2LNDA 3DOOA 4DV1B 4HR7A 5T4EA 3UB2A 1IHOA 3JAMY 1BDHA 3UXHA 1Z7GA 4FLMA 1L8LA 3HZOA 5IG2A 3K31A 4AN0A 4TXJA 4NI5A 3IUBA 1V5GA 1ODFA 1R89A 1B7GO 4MMYB 1TKTA 5GADI 3OZDA 1ULUA 3UMMA 3LY5A 3S1LA 1IXSB 1U31A 1WMSA 3P9CA 3P9QA 4HH4A 4WY2A 1Q77A 4BLTA 3DRYA 3V8QA 3PFWO 1N9GA 1XU9A 1LPMA 4EYKA 1DXYA 4P2BA 2ZT7A 3P96A 1PL6A 3LC1O 5NLLA 1GFZA 2CIMA 2XWSA 4DR5J 1MV8A 4DMLA 3ZLBA 2VHZA 2HLDA 5CYMA 1NMQA 1NJYA 2G9UA 1KQGA 1RBAA 2D7SA 3KK3B 2I7VA 2SKDA 3O92A 3G2MA 3TZCA 5DH9A 2OCBA 5GOZA 5HQ3A 4KHZA 3C8DA 4LNUB 1XQIA 5BWNA 3U4QA 4HHEA 3WWCA 3BMNA 3EVMA 1HNXJ 4II3A 2G7ZA 4J43A 2R8GA 4AL4A 4AUEA 4HAOA 3CPEA 3UICA 1M1NA 5DGDA 2DNHA 3GAAA 1XVUA 2CQ1A 5L95A 1U8AA 3OEHA 4RXTA 1UIMA 2ZH4A 4G01B 4ED1A 4AIRA 2ZAYA 2XS5A 5BUCA 1UWKA 1P7WA 3NIDB 4J2TA 1IIBA 4I6WA 1JDPA 2XNDD 3EIHA 3PK0A 2GF2A 4HZIA 3TCXB 4XWTA 2QFJA 4RKWA 2E1PA 4NNJA 3HJNA 3JD1A 4U02A 4OGWA 1AYEA 4RQUA 3KETA 1U9ZA 1XN1A 2F3PA 1P81A 2AX3A 5FAXA 5ADUS 1JSZA 2TYSB 2W2LD 4FFBB 4UM8B 1XEFA 3A6ZA 2JIPA 3QUQA 4CKEB 2G5CA 1L4MA 1SKYE 2DETA 3CNNA 3QY9A 1K97A 3K0KA 2WP8J 5L9XA 5K45A 1IN7A 3IKTA 1UZDA 4QPTA 2QD3A 4DSIA 5GOTA 3G96A 4URYR 1N5YB 4PSVA 2I2YA 1HL3A 2OFGX 5BWBA 5EJGA 1J2JA 4TSKA 4K40A 3AIMA 1NR1A 3JS9A 1N8TA 3GD7A 4QR1A 4E15A 3BWYA 5L51A 2Q7OE 3VGSA 2LDXA 3D7KA 5ALXA 3M2VB 4I99A 2ZDHA 1X42A 3J81A 2O2EA 3LUJA 4LPKA 4V19X 2XUDA 1WE2A 3OMLA 4J6FA 1EWQA 1GN8A 3IDFA 1JSRA 3COJA 3C0KA 2OGSA 2HHQA 4KPFC 4ZWNA 2JEGA 3H2VE 1E94E 1TUIA 4AB1A 3EGDB 3W1VA 2J9GA 2O1EA 1WACA 1XZIA 5ICFA 3C16C 3F2VA 1JZTA 4IY1A 1P33A 3JQFC 1OWXA 1E60A 2AJBA 4L4ZA 4B4VA 3GUCA 3Q3EA 1JEYB 1G6KA 4DV6B 3NPAA 1Q1KA 1T4CB 1A8IA 4Q45A 2UUOA 2EW1A 2GARA 3QUBA 3NLCA 1NAHA 1PAUA 3FTDA 3D5QA 2CBGA 2DQKA 3IIKA 3NRCA 4S0MA 2ZUDA 4ZS6A 5B2FA 1E0KA 1OC2A 4HS9A 1G20A 4U9HS 2H54A 1NVDA 1QOZA 4BZPA 4CO0A 1Y10A 2AU0A 4GSKA 2QJWA 3FZYA 4ELUA 4BB6A 5DCYA 3OKFA 3H1TA 4PX9A 5KTNA 1TT5A 3IV6A 1U2GC 2EKBA 1G3RA 5J1EB 2V4MA 1U1EA 3GUUA 3RBXA 1SNYA 3D68A 1P62B 3E15A 1Y82A 4XVUA 3GR0A 1LNQA 2NMVA 2X0KA 1R7RA 1JDTA 1X94A 3QJJA 4LY3A 1OH8A 2ADMA 5HIKA 4COOA 3HDYA 4N0EA 1FNMA 4B6FA 2YVAA 4EPYA 4JV5B 1RU2A 1AQYA 4YT4A 3ZZTA 2NTYC 3FTCA 2PZMA 2WU0A 3CZPA 3FUVA 4BV2A 1N7GA 2JGNA 5KHAA 2GO7A 1T0PA 4NXMJ 3ANLA 1RBLA 1LBIA 2B8QA 2IY5B 5JAMA 1E62A 4G8DA 5EX0A 4IHQA 2VYVA 4ZCPA 4EP1A 2YY5A 2FVXA 5KOWA 1TC2A 5H81A 3FMPB 4NONA 2I2BA 3UQYS 2PZAA 2AXEA 2C9CA 2IWRA 1N54B 2MZSA 1TKZA 2Y1RI 1N5RA 5CA5A 4H9GA 1MQ8B 3CJQA 4ED4A 2CWWA 3HHLA 1RYFA 1CQJB 4RCZA 3RYHB 3Q8SB 4KE7A 4Q44A 3IKJA 1RT6A 2P91A 4I4TB 3ILHA 1HG0A 5F7ZA 4NA1A 5E9QA 1VQKS 5D15A 4HN2A 1SZJG 4E2FB 1BMQA 5E9JA 3T5CA 1AKNA 1SC9A 1AQIA 2H6EA 1HR0B 1QGDA 4B2PA 4HACB 2ZUGA 2JLQA 4A8XA 4II7A 3QXJA 3V8MA 1AFIA 3OFGA 2J5KA 1AJEA 4BQRA 2QMQA 2J3EA 3CDAA 5TQVA 3EZ5A 1PR4A 3NTLA 1LSSA 4EY5A 4LRSB 3GP8A 3J81j 1N5TA 1Z34A 2I6QA 1V3SA 3CWCA 4M1ZA 4MW9A 2HYIC 4CKYA 1IB0A 4IRKA 3KXIA 4X7BA 4HDCA 4ZPXA 2H3EA 2FPPA 5TMDA 4USKA 5IT0A 3EYZA 2WM8A 2BRUA 3N0VA 4F3CA 3OHPA 1Z7EA 3T1HB 4PZCA 2VXYA 3R6DA 4JYAJ 2CJYA 3TZZA 3JD0A 2IYWA 1Z88A 1E9BA 4ZIWA 5HDBB 2RKIA 5LMNJ 2AXQA 1HNVB 1LFWA 1SCJB 3K4QA 4RV9A 1IXKA 3ZZ0A 5CIYA 4PZEA 2PBRA 4NOKA 3TBHA 1R6VA 1N75A 3AI7A 5C8DA 2FFAA 4F56A 1EUCB 4K87A 1O95A 3CSSA 1GEHA 3W4JA 2YOFA 1O7JA 5L7WA 4L22A 2NYVA 2CYAA 2YXNA 3OZVA 1RADB 4I46A 2KYXA 3TJRA 3K9GA 1LVGA 4P9SA 1WLYA 1U63A 1LXCA 2W37A 1YVEI 1LB1B 1JX6A 3P0HA 3NCPA 3CUTA 1B4DA 4O2LA 4EKNB 1SBZA 3PUIA 4MJ3A 2WWTA 5BYKA 5DBEX 2RMLA 4EG1A 2HK2A 1B8PA 2AI2A 5B4UA 1CKEA 5AVOA 3BUSA 4Z1OA 3TZLA 3SQGB 3VHXB 5I9SA 4RADA 1MRSA 1XHFA 3GRRA 2RKIB 3GDFA 3RKSA 5HVFA 3OUYA 5JEDA 1Y3JA 1VMIA 2HT6A 2P62A 2PGJA 1YRBA 5CYGA 3EDQB 3B78A 1M2OB 3ADPA 1NMXA 1GGKA 4Y6IA 4BRZA 1C3XA 2IVFA 3R2DJ 1VLZA 3QOWA 5AUQA 3TARA 2HC9A 1C1BA 3TRIA 3UB3A 3NCRA 2WNHA 3PG9A 1O5TA 2BZ0A 3TM5A 2DQYA 1QIKA 3BMOA 4G81A 5CA0B 1CQMA 3QJLA 4TMFA 1SUFA 5EHNA 4X9XA 3QZ7A 1Q15A 2A14A 4RELA 4JC4A 1LK0A 1K5PA 3W5IA 5JVDF 3M5WA 2PQ2A 2QLWA 3RB0A 2V1XA 3BQ1A 3NAGA 1E8NA 1QU2A 4UM9B 5HMLA 2VSYA 1KBRA 4PWUA 1KE2A 2Q79A 2CC2A 3HDHA 3COZA 3ZTYA 4EJSC 1OGIA 1J5EF 3QV1A 2JAPA 3F90A 3DYVA 3T8YA 4Y1RA 3Q8QB 4RW4A 4NPOA 1FFCA 4K4WA 2XLJA 4ZJPA 3CXRA 4FW8A 4ZDKA 4YAUA 3QF7A 2GUWA 2HVHA 1W36B 4KCGA 2DD8S 2D7JA 2NUTA 4B3RJ 1QS0B 2CL7X 4UOCA 3VKVA 1YQWA 5HZMA 3QKWA 5C8XA 4KXLA 1O9BA 1XDGA 3Q12A 3DF7A 4P98A 4CCYB 1O89A 1NSQA 3QFSA 3PT9A 1NHKL 3LLUA 4GR9A 5JALA 1VLMA 1QTNB 2IVZA 2CN1A 1N6LA 2ZKUA 4JB0A 3UT6A 1I7PA 1CJUC 4P34A 3IAM6 3MFQA 1P27B 1DKOA 4I8DA 1RAEA 1J0EA 3Q87B 5KQMA 4TYAA 4MWDA 2QQFA 2DRIA 3ZW7A 5JDCC 3VR2A 3IBYA 4GMXA 4MR8B 2V7WA 2QG9B 2MT9A 4RPCA 3VC2A 5AI8A 3TVZA 5AK0A 2BEUB 1SUSA 2YBVA 4RTNA 3RRZA 2APJA 2ZIGA 3WYFA 3KD2A 4CWBA 4CHTA 2ZB8A 2P9QA 1YVPA 3KK2A 5C7OO 1I3OB 4AO8A 1BU8A 2K8GA 1PTJA 3TOCA 1MRZA 1QJHA 2HHHF 3ELBA 2WLSA 2PZEA 1T8UA 2X7IA 3UVJA 4JVSB 3KT6A 5FWXB 4YCSA 4F3RA 3BB3A 3RPEA 3AVOA 4FFLA 4FYXB 2BELA 2I8AA 3SZMA 3QGIA 2FR8C 3U5TA 3WXMA 2QA1A 4P80A 2J9CA 1Y34E 2YJ6A 2KFYA 1M8KA 3GRFA 4D6PA 4USMA 2I87A 4LJ8A 2XYGB 2AJTA 2GZRA 5HG0A 5G0SA 4NJEB 1JDBC 3AU9A 5AJ3F 1VBFA 1G42A 5IF3A 4RVNA 2IQIA 1IY8A 4HWTA 3LGHA 4BGEA 3QBTA 5DHTA 2B8WA 4R9SA 2QAGC 3ORFA 2HQGA 3IMCA 1QMPA 1WM1A 1S1MA 5M5BA 3AZPA 5EJ6A 1KDTA 4O1MA 1FTWA 3LT4A 1WPRA 3PWKA 2KZMA 1BS2A 4Q48A 4NEZA 3U3KA 1O5OA 4BNKA 4BYMA 3PR4A 2H7XA 1TTQB 3S1SA 1WIWA 4P5PA 2BFNA 2WSIA 4Z9YA 3LP5A 3RUPA 4EKGA 3QIPB 1P45A 2CUKA 2OFFA 2EFCB 3I9ZA 4ZPCA 5CK5A 1FUUA 5IM5A 3G8BA 4Y2KA 1VFPA 2Z5GA 2PQMA 5B37A 2O8BA 1BWSA 5TC4A 2GAGC 4MKFA 5H8WA 3R8CA 3OD2A 4EY7A 3ZNQA 5BSHA 2ACYA 1S7IA 1ZH4A 1KMIY 1UT8A 5K05A 2I4MA 4TQAA 3N3AC 4D9NA 2PGNA 3Q5EA 3S7RA 4G8CA 4B85A 2P4UA 4P2GA 1C14A 3BMQA 1TQ6A 3UWMA 4DMKA 3NY0A 1UWBB 4NZ9A 4XOIA 2K1RA 3DOLB 1Y4ZB 3QVXA 1FJGF 1NJZA 2X0FA 1P1BA 4PZDA 4ZVQA 1IBKB 1NY6A 4D4MA 4HTAA 4ESOA 5F9FA 1R9JA 1ZQ9A 4LF8B 1R0BA 5HJ7A 4XYLA 3NAIA 2G40A 1XRSB 1W5FA 2ZRNA 3JTOA 4L3KA 5F2OA 1URPA 2FI1A 3G7UA 1W48A 2A7QA 4ZVRB 3DE4X 1N48A 1REQA 1V6HA 1V5IB 3CTPA 4NCAA 1G7SA 2W6MA 1VHLA 3RRGA 1RHMB 2FLPA 2COUA 4DL3A 5BW6B 4AT1A 1MIOB 3PHHA 3KYDA 3P9KA 1OROA 5GAJA 1JWWA 5KDOA 5LOVF 1BVYF 4XQ9A 3AM1A 4O5AA 1EJ2A 2NN3C 1H4QA 4PCUA 4DGSA 1L7NA 2QTZA 3IGNA 3W0LB 1AQJA 1KDVA 2C4TA 3X1MA 3F0TA 2XQKA 1H9BA 4KE6A 4OZ2A 1M2HA 4X2BA 2OV2A 5KFLA 1FKOB 4R2WA 2ZJFA 2H63A 3UXEA 4A03A 4ITSA 1XRLA 2QMWA 4BFXA 4C04A 2Q28A 3EGWA 3DHVA 4WZAA 1HDYA 4R3WA 5JBQA 1I4LD 2XITA 5K4HA 1UMDB 1RQ2A 3FE2A 3LK7A 2VN8A 3IVXA 4CCWA 3N5KA 5ITSA 2JCXA 2HQIA 4R5HA 4WLNA 1BO6A 1UEXC 5D1HA 4Y2XA 4F9EA 3SSSA 4NXMF 3VR1A 3KG1A 2D59A 1SU8A 4IUYA 1VMAA 2VF4X 3WX0A 5AD1A 2BFDA 4NBLA 1WF0A 4MI6A 2SCUB 1WF1A 5A5EA 3DT9A 4M36A 4BUJA 2YIJA 5JNSA 4CJXA 1T6YA 2QY9A 4LF4J 3IMFA 5KYNA 2W1BA 2QRGA 4AS3A 5KT4A 1HKAA 1UAYA 4DY6A 3ROPA 2WZQA 2EK1A 2UYOA 2HFSA 4TNOA 4I4BA 1Y6RA 1YJRA 3OXLA 5T3UA 3IO3A 3QG1A 4MRSA 1GGNA 2HWIA 2HQOA 2BANA 2V6FA 1WNTA 1T34A 2NSHA 2X2EA 1DTTB 2GBLA 3NTVA 2PS0A 3HVTB 3PUVA 4FR0A 4V0ME 1L5NA 4B6GA 5G2OA 3RW7A 4MA5A 3O5TB 1BYUA 3NHPA 4KGZB 2IUFA 1X4DA 4E98A 4ND5A 1M76A 1P1KA 2UYHA 1L2TA 2POCA 4LWZA 1RKXA 1HE5A 3RNLA 2ZH9A 1T3HA 3QLHB 5HE9A 3L7OA 3Q9LA 4TT8A 2UXDJ 4O2BB 1SVNA 2COEA 4ZU1X 4MS3B 3AHDA 4F1WA 4LBPA 5JBNA 3LP1B 3GLUA 4IOBA 3PUYA 4WCDA 3PQFA 1HL6A 5KPDA 1KYXA 1R6TA 5B12A 1TU4A 3R5SA 1T2VA 4DR5F 3ABRB 4JVMA 1MXHA 1K44A 1T25A 1ZCZA 1D2RA 3QVKA 4LC1A 4RBUA 4FGWA 3C7TA 1E6VB 4KFCA 1RNLA 5BXYA 3DEHA 3MILA 1LVUA 3SHQA 5AVYA 5JJLA 3KUEA 3MAAB 2J3JA 1RT1A 3H2ZA 1RMTA 4L3VA 2ALZA 1UMCA 1NDPA 4B71A 3TR0A 1JU4A 2QMZA 1ZIDA 1CLFA 3H3XA 1WD5A 3OLXA 3C7KA 3VR6H 3HPOA 3E03A 3O1IC 2R7VA 3EF3A 1XWIA 4QC2A 3LTEA 4BZWA 1GL6A 1AHNA 4YDSA 4DL0C 3PVZA 5C7IO 2AW5A 2BOVA 4RX1A 1YDGA 4BC7A 4CIYA 1GFWB 2RRAA 2UZ0A 2EZTA 4ZPJA 5BSEA 3NGUA 2ORWA 1UBOS 3PA6A 1NB2A 3NEAA 3PCTA 3LP1A 4J6EA 1JEQB 3PRYA 1IN8A 1X14A 2DR6A 3RIMA 1CQPA 4OSOA 2O5CA 4ZPWR 4YXWD 5HP4A 1P9OA 3D67A 1NMSA 4G1FA 3DYBA 1S1WB 4HWKA 2PJUA 1II8A 2VA8A 2FPIA 3V48A 4N0MA 1VMDA 3QW4B 5E2AA 1IBCA 3NONA 3VPGA 4MJKA 1CCWA 3CF0A 2G8LA 3BL5A 3IODA 5HR5A 2FR0A 1SXJE 3NWBA 3SCZA 4N48A 2IVYA 3TX6A 1RRVA 4WFXA 2Y8YA 4CKEA 2Z30B 4PNZA 1P9YA 4HRXA 3SQNA 2I9SA 2HHAA 3MI7X 1WMDA 4EMSA 1P3DA 2Q45A 2ZB2A 1JQ5A 3V6MA 2ZZNA 2ZIZA 4YR3A 1EGMB 2K4MA 3GVPA 1NHVA 5ALGA 5KQSA 2Z8YM 3KWLA 3HB1A 4CT8A 4JC0A 5JFOA 1YRTA 2PZ8A 3IDZA 1AMOA 2PKCA 4EJSA 1V3RA 1WCWA 1B3TA 1LQ9A 3DOCA 1EKRA 5ETKA 2AOTA 3QX7A 2DQSA 4US1R 4LOJA 4Q01A 1JB0C 5AP9A 3P3DA 1MVOA 3OIVA 5F77A 3C6XA 1JFFA 2NPOA 4Y1GA 1RRKA 1FSPA 2CJPA 4ID9A 1DDIA 4BFVA 1EVIA 2CPHA 2FW0A 3IIEA 3A4YA 4AG6A 2GCEA 1L4BA 1PQUA 1DCTA 4X4VA 2HO5A 2YKGA 3MT9A 1JLEA 3TUIC 1PR9A 1KYVA 3F47A 4XI9A 3U44A 3I1JA 3BJMA 3FUWA 1A9XA 4LDZA 4R5MA 3LP2B 4FMCF 3VSBA 5HEKA 4IIVA 4LVOP 1IVNA 2ZYWX 4G65A 2FMKA 4PQGA 4NVRA 5LOVB 3R3TA 4CEHB 2D2XA 1M8JA 3U3OA 4PLPA 3S1TA 4D2IA 1HE4A 4PRYA 3SEFA 1TKDA 1U2TA 3DPSA 3WZ2A 5KFHA 3T4PA 1MU0A 1Y11A 1YFKA 1BH2A 2FZ5A 4HNTA 5EKTA 2KT2A 4Q1EA 2E48A 5FPPA 1U11A 5H3HA 2PSHA 4DPMA 2HMWA 4LRCA 4YECA 3DLBA 2JFKA 4RD4A 1VMKA 4H4MB 3Q7QA 2AJDA 2ATCA 4ZT5A 4UUXA 4G2TA 4PNHA 2F65A 1J07A 3CDWA 4HY3A 4RW0A 3T3PB 2PL3A 4DJTA 5AW0A 2VFSA 2QV7A 1JRLA 2NV6A 3SQDA 2HPZA 4OKSA 3JAKB 4DFDA 1VG0B 4WH0A 1UPFA 2OQVA 4RACA 4H54A 1KWGA 3PDHA 1IIRA 1JU3A 4CRWB 3P8BB 2VPZB 1H4SA 1C4CA 3M6AA 3JQ7B 1NVVR 3AP1A 6YASA 3N0XA 4OLOA 1CJVA 4LZOA 3K9BA 1EDOA 1MCZA 5I9LA 1VIDA 2A0XA 1NHGA 4PXBA 1TVEA 4K28A 3ZK9A 3DULA 1JILA 3HKEB 5I01A 1QCZA 2CCJA 1H6CA 2IOYA 1GTEA 3DKIA 4KKVA 5JDCA 3SF0A 4E3WA 1VL6A 2EKZA 4HD8A 2H4YA 4JX9A 3OT9A 1KFSA 3VPBA 5DSZA 4NZ0A 3HV2A 4LJAA 4B3IA 4HB3A 3WL8A 3IYLW 2A1IA 3IAUA 1WV0A 5B7PA 1JG2A 1XNJA 2B1JA 3GF4A 1XLTA 4QUIA 2RU3A 4FKYA 4DV3J 4BJ1A 5DGBA 4FHGA 4FBMA 4GNRA 3IJEB 4YUZA 4DF3A 4Z9FA 1VQSA 4LI3X 1J1IA 2VF8A 1O6CA 3UA3A 4OYWA 1EFAA 2PI4A 1F6BA 1RI4A 1DV2A 1Z45A 2V7QD 4JR0A 2C2GA 1F0PA 1IBLB 1WCIA 3K17A 3IPRA 5P8WA 1Z0UA 3BTOA 3GRYA 2EI5A 4ZYLA 5JPIA 3KLGA 1RACA 1HX7A 1SELA 1YDLA 3A3PB 3GJ8A 4FS8A 4E2ZA 3EARA 1SBYA 3NFYA 3RAXA 2ZH7A 1O95D 1KZ6A 3UEOA 3OOYA 4RKEA 3HRKA 2AV5A 4LZPA 1VC0A 1A5SB 3GVCA 3UJPA 1FF2A 3TD6A 5BO5A 2CWKA 1TIBA 1HBNB 2A6MA 2OAP1 5BYRA 2NO7A 3VVBA 2O48X 3NRBA 4INJA 1OFUX 3B7PA 1H3FA 3TD2A 3CNBA 1DOZA 1EP4A 1SB6A 4DUGD 1QLHA 4AE5A 1QU3A 1UC4B 4DV5J 3KZMA 4NJEA 3DVSX 4CWAA 1RLCL 3WK9A 2QI9C 3OT4A 2RE8A 3EIFA 3CJTA 2BMFA 2HRQA 1QHYA 3MPUB 4DLRA 3GFZA 4CFYA 2DYKA 4F7WA 3ZXXA 4UDYX 2ZBGA 4YP6A 5C1BA 2Z2YA 3IX7A 3FBFA 4EAQA 1U7WA 1O94C 3LVRE 1N4LA 1BEZA 2GK3A 4TLAA 1YCHA 3OVSA 1YZ7A 4DREA 4UTRA 2WSEC 1PFQA 3F49S 1JMYA 4L3NA 1Y1PA 2B51A 2IDLA 4MO2A 3RROA 2HNYB 2WTMA 2VT6A 4LY0A 4RY8A 2UU9F 1NVVQ 3I45A 5KBYA 2V0NA 1T9KA 4XGKA 2D5BA 3KPWA 3T41A 1YRWA 1B16A 3ZE8A 3NS6A 2FLVA 3PXBA 4RJJA 5KWJA 1N6RA 4KSBA 5LZ4A 1E58A 2O5EA 3R1LA 1VPEA 4AAYA 1C2YA 1ZGZA 4ZXPA 3ZDRA 1T3TA 4P83A 2PRZA 3AUAA 3TXXA 2FJPA 4NK5A 2BRKA 3RARA 3RSHA 1I30A 1IWGA 1VQPS 4PINA 5CK4A 1WXDA 4LC0A 5IRCD 3T35A 2WBLC 4JI8J 5F1PA 4DXDA 1K9MT 4O3OA 5ANRB 2PYDA 3EFEA 5AVZA 3AJ1A 2QB5A 3CWZA 3OCUA 5KU7A 1QOQB 5FOSA 3E01B 5CA0F 4JLOA 3EGCA 2VUTA 2F00A 4P2MA 4OF4A 4A8KA 2F3RA 2IRWA 3TOQA 2VKRA 3ZLVA 4RW4B 2YVQA 3BFJA 1Q81T 1DIRA 1N5SA 4K5QA 1ZYQA 3RWBA 3M30A 5DCWA 1IJKA 3FBGA 2C7RA 2EKYA 2FMIA 5DGHA 4QYZK 4JI5F 2KVQE 5FOQA 1UOPA 5U4XA 4ARUA 1QS0A 4QXOA 1KQOA 1CRQA 3NTXA 2CEAA 4A6PA 3FRYA 2E37A 2R85A 3C24A 2XEXA 1PL7A 1UPTA 1USIA 4P4UA 3NM5A 1WF3A 4XIGS 3TRJA 1JLBA 3VR4H 1M1ZA 4HNRA 4A8SA 2PV0A 4MMOA 2ZDQA 2GJIA 4WLOA 2V7VA 3QJ5A 3HXOA 3LSTA 3I2FA 3ERCA 4H6XA 1F2HA 4NZNA 4P4SA 5GPBA 1PDWA 1HNXF 1CRLA 1J70A 4NOHA 1FP6A 1FKOA 3WL6A 3SYZA 5KFZA 1YJ8A 3NYRA 3NGXA 2QTRA 1CY2A 1VGRA 5DWQA 1KYQA 3K5PA 3K35A 3CT6A 1VE6A 3FMBA 4A3SA 5JSUA 4F8YA 1QIJA 1T35A 5BNIA 1HNIA 3SFVA 5BSGA 3VAIA 3FUCA 5LZ7A 4IDKB 1BW9A 4EFNA 1UEJA 1KVIA 4PWDA 4ZN1A 2VP9A 1C2PA 3TEHB 5FI1B 1W7WA 4ZLLA 2WJJA 4M2LA 4DU7A 4NL5A 3MXOA 2AHOB 3FSJX 2VBXA 2D3O1 3SYRA 5DN6D 1J8YF 4FSXA 4J3JA 5AVRA 1U7LA 3D8HA 1A7KA 3JQRA 2Q6VA 3L7AA 3D6FB 1EVLA 3KG0A 4Z0HO 2EU8A 5AJ3J 1G38A 5HIAA 1UXIA 4NG5A 3D6TB 1OXBB 4JQOA 3SS9X 1HORA 3KKQA 2H29A 1IULA 2GTIA 3PTLA 3SQMA 2WW4A 1Y3FE 1U8SA 1M6HA 1PCXA 3HUEA 1MN7A 2XTJA 2NZ4A 2K06A 5C8VA 5IM0A 4ZAYA 2H4JA 4NLYA 4GP7A 3IBTA 1JPVA 5ITWA 4XJSA 1LWEA 1RWMA 4CMEA 1NVMB 3AHIA 4OQJA 2PS9A 1BD4A 1ETHA 4PO8A 4NLSA 4O0NA 3H0PA 4FNMA 3VV3A 1QCCA 2M2IA 2WF9A 3HVTA 1VLLA 1SQEA 1SJ4P 1CVRA 1VJ5A 4ITRC 5AW7A 2V7GA 2D9OA 3GR6A 4LVCA 3Q8PB 4BEWA 1XNRJ 2GQ0A 4HUQB 4RORA 4ONEA 1J06A 2CJQA 1A8QA 2OBLA 4ZYYA 2YDYA 1IOVA 2LKZA 2QYGA 1U0HC 3DDZX 3VYSB 1NJGA 2IBSA 4U2DA 1CXZA 3M2UA 2FEAA 2H5EA 4TMTA 5GADU 5CVJA 5F0WA 1ISSA 2EARA 5ALEA 4CKCB 3NWRA 5A2QU 4XWGA 3RR2A 5B7WA 2HHXA 2NO9A 4ZQBA 4NXNF 2VT2A 2J0UB 2ZGVA 3NBMA 3DV9A 1N0IA 5A4FS 2WHOA 3IUPA 3TNLA 3AXSA 3ELDA 1FE4A 1PKEA 4O25A 1WL8A 4K9SA 1Z0SA 2BJDA 3QEJA 2PM8A 3S8YA 3QK7A 4U8HA 5TMBA 1GCOA 3WK5A 1RT1B 1PNOA 1IFXA 4HWSA 2MWMA 4MRVA 1A5TA 3EC2A 4PX3A 2GMHA 2X1HA 1NPDA 3OCVA 4OZ3A 5LL6P 1MJGM 1JXOA 3OQVA 3GIJA 5IXUA 3OM1A 3I3OA 4G4JA 3OSZA 1CTQA 2RK3A 1VYTA 1LBQA 3N74A 3B1KA 4NENA 4JI3B 2CVOA 2X5JO 4ELVA 5JSZB 4AQYB 3R4VA 2AC2A 4CCAA 3D6MA 1R8XA 2I6TA 4GM4A 3C2QA 3E81A 2BQ3A 3HJAA 4AMVA 3WLEA 2HUPA 1D8ZA 1PW5A 4LUCA 3SEOA 4LISA 4X62B 1SPXA 1SIBE 3HNRA 5MF6A 1QAJA 2OBBA 2H48B 2WAYA 1EZZB 3DRXA 2X41A 3OLCX 2VQEF 1IN5A 3LP8A 3X1WA 1Q1NA 3USCS 3C14B 1F5AA 1SOMA 2ANBA 1NDQA 4OLPA 1V45E 2QUAA 2A0WA 1IY0A 1CBUA 3T0IA 2FWIA 2QK4A 5REQB 2AJ2A 1PL8A 2L19A 3M6XA 1T29A 1I1NA 4X6XA 1U0LA 1SD5A 2FUNB 1X3SA 5DTRA 1P72A 3NOQA 3UMFA 1K1QA 3W1WA 1FDAA 2R5NA 3WMXA 2XMKA 2QN1A 3EXAA 1XBTA 3B53X 4KXMA 3FC9A 5EIBD 4PQRA 2Z43A 4YIHA 2EEPA 5B4TA 1H6AA 5AT1A 4YONB 2F4FA 1JKFA 4JYAB 3CZMA 2EGGA 3T7DA 1G5PA 1YZ6A 4EECA 1VMBA 3I9LA 1JTFA 2QPLA 4UEKA 1GZ5A 3AHFA 1TL1A 3ORSA 3EIUA 4OXQA 4CLHA 3SFUA 4NASA 4MK7A 2ZOGA 2FTRA 2Q2WA 3Q89A 1RBZA 1J6UA 3CMCO 4N7JA 1Z5UA 1K6IA 2DHSA 4GOKA 4WPAA 4GMFA 3D3EA 2C2MA 7MHTA 1AK2A 3PJEA 5AXBA 4KWHA 1ZG3A 4C97A 2XDYA 4BRSA 3RG6A 1H65A 1FA9A 2C5BA 2XBPA 3DBRB 3RH0A 3T3OA 5F51A 4R8KA 1R0ZA 1XLTC 3ZVKA 1J8DA 1Q0RA 4EGSA 1RE0A 1BS1A 2WYVA 1NM5C 2JS7A 5A4DA 4JEUA 1T43A 3OZEA 2WUFA 3ZZRA 4YUWA 3ZJVA 2W2MA 4EEYA 2VTEA 4G63A 3OF3A 2R8BA 3EGZA 1K1EA 3M9LA 4DLAA 4JBIA 2EC5A 3IMKA 1IUOA 4A92A 1GAOA 1WUIS 3A6EA 2B7BB 1RBOB 3EEQA 3H99A 1KN6A 2X76A 2NV2B 2JAOA 4EFLA 3RS9A 1EX9A 3GLIA 5LB2A 3EULA 2M6SA 2RHMA 1FF9A 2B6AB 4JZYA 4AURA 4OM7A 1RWKB 4IF6A 4TRRA 3IMGA 2OD4A 2E7ZA 1VHTA 4NZZA 1VKOA 1MU2A 4PSUA 3MEDA 1WW3A 2VXBA 3G0CA 5DBIA 1XVIA 4F85A 4N7RA 1JAHA 3BHJA 2EERA 3BFVA 4GVLA 1BJTA 1ESZA 1NC3A 5B0GA 3E9ZA 2LCFA 2Q3LA 4AJLA 3JAKA 2NS1B 5JO9A 4UNQA 4BMVA 3W5VA 3V4MA 4GFDA 5CLGA 1N5OX 5GMKa 1G2OA 2VBFA 3BQNB 1T9XA 2QTGA 4AN1A 4RPJA 2DISA 3E9RA 1UMJA 1WCYA 1R8BA 4PN7A 3ER8A 2D3ZA 1U8EA 5C32A 2EGHA 4NATA 4K5RA 4B2IA 2ABWA 4FWBA 2QTNA 1OI2A 3FMOB 5EHXA 2YKOA 3QMVA 4D0SA 3GFVA 3KKEA 4MIWA 4ZALA 3N2GB 1J0DA 1T8YA 4MVJG 3MSCA 2PU7A 4UXJA 2C2WA 4DRXA 2X2OA 1XMIA 3C6TB 3VBCA 3JY6A 1J5XA 3MBIA 3VVUA 3GGSA 4N8EA 3PF8A 2VSXA 2ZANA 2OXEA 3PCXA 4ZJQA 2JNWA 4NU0A 5EQDA 4LAFA 2LP4Y 1QP0A 5AHKA 3C15C 4Y34A 3EAGA 2YXLA 5KREA 3OR1B 4P3KA 2IYRA 5CYOA 3PT5A 4PCAA 2EQBA 4PAGA 1R6AA 3UR0A 3KE8A 3Q3GE 4CL0A 1P4JA 1O4VA 1N2CA 4IH7A 4B4OA 1BYIA 1NPYA 4PCVA 2NU7B 1ZU4A 3BVPA 4NCXA 3ZGOA 5EMLA 2DBRA 3UY4A 4RTKA 5BYBA 5CEEA 4QEDA 1YRQA 3PFNA 1IUPA 2GAIA 2FIUA 1NRXA 1YC5A 2G9ZA 1SZCA 3L84A 3IC1A 1BWPA 3BXXA 1GPMA 1N33F 4G9BA 5D5QA 4C3UA 1UKUA 2IXTA 2ZUSA 1SO8A 3ZJYA 4NI2B 1SUEA 2VH2A 4YR7A 5EWMA 1HYSA 3DL2A 4F8JA 4RNNA 4JI1B 4KITB 1ZGAA 1OC4A 2JLVA 2HBRB 4M9CA 1TVMA 5HQMA 3ASZA 3WRYA 1SXLA 2UUTA 1D2GA 4UU0A 2AOUB 3GQBA 3HFVA 1ODTC 2GJ2A 2BHTA 2WU8A 5M7EA 2DNYA 1BHSA 1UADA 3DAGA 4QPJC 3H1EA 1AURA 4CETA 3C41J 4DM3A 4EY8A 2X1GA 4WXWA 3AETA 2RHJA 3U3XA 3BGRA 3M1YA 2E7XA 1X7ZB 3IT0A 3SBOA 5L3RA 5FUXA 3D5EA 4CLWA 4YJFB 1DRVA 3Q3CA 2KFZA 1ZVJA 2Q0HA 3W9IA 4AJIA 2RRBA 4Q3EA 2QRLA 2NVUA 1R50A 1SCQA 1GITA 1NE7A 3AQ4A 2D5AA 2Q27A 2Z4PA 5F2KA 1Z47A 5EY5B 3Q4GA 3HXTA 3DZKA 3HUFA 3E70C 3CN7A 2IV2X 3RVJA 2NXNA 3ICLA 3P5BP 1T1SA 2KU7A 5ITHA 4INAA 2IHNA 2WABA 2JFWA 1JLKA 3GJSA 2XRZA 3RJ9A 4G9EA 2YQ0A 3U48A 2Z1DA 3H86A 4KB5A 1H98A 2W2NA 4TS4A 5F8GA 2IGTA 3OJUA 2X8LA 4MR9A 3VYRB 4U9IS 1RWNA 2GZMA 4LBHA 2VQFJ 3Q0EA 2WSYB 1ONSA 4UREA 1UC8A 1LW2B 4NYJR 4G0ZA 5FPHA 1H6KX 5EP4A 2FGCA 3FKSA 2BM9A 1P60A 3VPSA 2WINI 5DG8A 3TOZA 3KJIA 1V1RB 1DBWA 2PZKA 1XPRA 3LOQA 1QK4A 4A8YA 3IOEA 5BW5A 4AXXA 2FA9A 1V2GA 4YCCA 4AF8A 2Z58B 3C70A 4YV0A 4K4YA 4IFYB 3BCUA 3EVFA 2HFNA 4M6WB 3R5BA 4Z3DA 1G41A 2VJAA 4HDNA 2JFHA 3AJ8A 4Z7OB 5CBKA 2MU1A 2V4QA 3LJKA 3K5HA 4D5EA 3E22A 5BN3B 3T3IA 2VJMA 1OU0A 3OW2R 1IK6A 3ILVA 3MRSA 3OUTA 4RSGA 2IAJA 3KYCA 3H8SA 5LJ3Y 4TXMA 3URMA 3HB9A 2MKJA 3LBAA 2WJAA 1R8SA 3G0BA 4QQ8A 4L28A 3PHBE 1AFJA 3BD7A 1WG8A 3WGGA 2XZPA 4LKRA 1JWLA 3AOEA 1K92A 2AFVA 3H5AA 4BNDA 5C4GB 3J7A1 1RWWA 1RT5A 2VC1A 4MV3A 1N5QA 5IDYA 3KC2A 2EF0A 3DMFA 3IEKA 4UUQA 3KLGB 1TL3B 1FD8A 5MFZA 4N5HX 4PICA 1E9AA 4MWOA 1GO2A 3MURP 2R8XA 2P4HX 4QX6A 3Q6MA 3NASA 1KP9A 1C0UA 4J75A 4OHFA 1Y8QA 4MINA 1ZA2A 4JL5A 1DT3A 5B58T 4DCTA 5LA6F 3MM9A 2AH5A 3BC1A 4FHZA 1C0TB 2V2QA 3MJVA 1DBIA 4GI7A 4J9VA 5A4AA 2IIHA 4L5BA 2BJHA 5HUQA 2HNAA 2QGZA 1JI0A 3ZEAA 3QPWA 2BVZA 1P2FA 2E1MC 1LFAA 1H2BA 3AR4A 2IYFA 1RXUA 1NE2A 3GV0A 5L45A 5CDSA 1XFAA 1YCGA 4CO3A 3B1FA 2HMSA 4Z53A 1R4MA 5IZCC 3HB4X 3H4TA 2IBKA 3EQ2A 4QGFA 5IF9A 3VHRA 3SC2A 4K7QA 2FPGA 4OHZA 1PBTA 1Y7HA 1BOFA 1CU1A 3NGDA 4ZVTB 2K2QB 1XZDA 4C1BA 4HEHA 4HTJA 3SIRA 1KVJA 1LUAA 1T13A 5ETMA 1D8TA 5GV8A 3CRQA 2OY0A 2WD9A 4JZKA 3E4CA 4FGJA 1Z2ZA 4NDZA 1QP4A 1SCUB 1NVTA 4KHPF 3IA0A 1WETA 4F2WA 4WJBA 1O0BA 1JLCB 3QPAA 3WMRA 4E31A 3LWZA 1IDOA 2O7NA 4LFBJ 4TU8A 4K4UA 1GFIA 4LUBA 3ML1A 3WAKA 2ZIUB 2A1BA 3LGMA 4BAZA 2YTCA 4K8RA 3MXTA 1OI4A 1GGFA 3A0RB 1TJYA 3ACDA 4K0KB 3ROMA 2VF3A 1Y89A 4XFDA 2SKCA 3WICA 3PI6A 5HS6A 3TCKA 1KNXA 2CLEB 3E58A 3QVUA 4OTZA 2NLWA 2BMDA 4MR8A 3TZ6A 1HMVB 3BDVA 4JLSA 4KWIA 1Q79A 3I04A 3JAMU 5GM2A 2VDKB 1LZLA 3AU8A 2EZ9A 3IP0A 1ITZA 3R5XA 3CVVA 3GAZA 4MB0A 1GZ4A 1XTUA 4TTRA 5GZ3A 5TB5A 2D7DA 3HA3A 1R6BX 1UBHS 1GKIA 2JFFA 1RYEA 1ADCA 3IR6B 4XARA 3MJCA 2IBOA 4RTMA 1JKMA 3IAFA 3QJYA 2GFHA 4EVIA 2VDWA 4TV9B 4ZA1A 3LRPA 1XVLA 2OAEA 2QC3A 3CURA 2W4CA 2VAXA 2R6JA 1VQ1A 4AZ3B 4YFUA 4UM7A 1GNSA 4EBEA 2FMHA 4I3FA 3DC2A 4KXUA 3STVA 3TQFA 4MUYA 4HNAA 5HBMB 4D8WA 2W6JD 1UZUA 3U9TA 3I61A 2KYRA 4BEBA 1LPNA 3PQ5A 4TMVA 3AUSA 1MD9A 3QHPA 5B0EA 2JKVA 3OSNA 4Z7YA 2B8NA 2WJ4A 5ISMA 2GX6A 2RHHA 2YPZA 3TQOA 4IPTA 4QE3A 2HIAA 4O1HA 1FP7A 1G3QA 5GVRA 2VYND 4FQ8A 1D1PA 4P7JA 1FEEA 3HLUA 4X4OA 3PR1A 1WW2A 3ER9A 1NNUA 5SZTA 3ZW9A 5KG7A 4NC9A 1HNIB 1C3OB 1F5NA 3OJWA 2JLYA 3OLQA 3CULA 1OBHA 5IN5A 2ZWPA 3OOSA 3PDIB 2BFBA 5EQFA 3H0EA 3R0ZA 2OG2A 3OM8A 1WZIA 3ADOA 3PDWA 3VZRA 1Y9DA 2VDMB 3MUNA 1RAGA 3V2GA 4IDNA 1KJ8A 5CDFE 3Q1KA 1DIAA 2PHZA 1H4VB 2C2HA 1SAYA 2DGUA 1JPUA 4KKOA 2IZZA 3KOZA 5EP2A 1NLYA 4Q4LA 3O8QB 3GQCA 3G1WA 1JLLB 2WIJA 4DWVA 3BXZA 3TO8A 2XCLA 3DDSA 1S3FA 5F2NA 2BZ1A 4D3GA 1OZFA 4JV0A 3C1UA 4WCFB 5KOHA 4CFSA 4S04A 2O6HA 3JQBC 3KZOA 2O8DB 3PX7A 3BMQB 5ICSA 2GN0A 2CVEA 3TA1A 2HW3A 3H2HA 1N0VC 3LF1A 4R40A 4YMGA 4ER8A 2KLHA 2P2DA 4C0KA 1U26A 1NG9A 1DJQA 2RU9A 5DM60 4C3VA 4Q6BA 4UARA 3O2NA 1V11A 3TB4A 1KRXA 4AJ1A 4ETNA 1HYEA 2JGFA 3US5A 2VC0A 4JYZA 1IG0A 4LDRA 1RTDA 1SIWA 3DV0B 1EIYB 2O06A 1HQDA 1QLJA 1P18A 5TS3A 2IF0A 4PR6A 3X3UA 1NQWA 4ETXA 4CQNA 2H9ZA 1QIMA 4OJMX 4C4TA 2A33A 3DBHB 3OD1A 1XTQA 3H5SA 1TEXA 1TCCA 1Y3IA 4ECSA 1Z6ZA 5JAOA 5L1JA 2PO4A 4P7KA 3ITEA 2HU8A 5JMPA 3DEFA 5JCPA 1GTG1 1YGYA 4E22A 1M2JA 2EG5A 1YVFA 1Q7BA 4CXMA 2U1AA 1OS5A 5GINE 3GG2A 2O8DA 2PJDA 5HDQA 1NK9A 1SBHA 1OFGA 2CLMB 4XYMA 2HMYB 1Z2PX 1TLLA 5CVEA 3UKDA 5BYJA 4ARZB 3AHHA 4CH7A 4D0NA 3G6YA 3ZCXA 2Z9CA 4W7SA 4WZAB 4M88A 2HQFA 2R1UA 2Y1OA 4Y2HA 1GNTA 1SY7A 2BGLA 1PJQA 2IY7A 4NJMB 1U1NA 3B51X 2IXDA 4OU4A 1QFZA 3TTWA 1XXHB 3RTGA 3N6XA 4IQGA 3V7YA 1G3OA 3V81A 3BF4A 4PEOA 4H7EA 1VR6A 5B0AA 3D4PA 4N1AA 4JJ7A 2V2ZA 1I4DD 4V02A 1TJ5A 3THTA 1E9VA 4KHPB 2BSAA 4H6PA 4UHFA 3OTHA 1PNQA 4JLUA 2HHUA 2OD2A 3V46A 3C66A 1VQ4S 3IPLA 3HSDA 2P75A 3MWYW 1RYSA 4QCLA 4NV3A 2NP6A 1MMDA 4ARZA 1Q1BA 1W85A 3EXHB 5K9FA 5I7FA 2JFZA 1C9EA 2OQIA 2ODBA 3IESA 3T99A 4B2LA 3CPHA 5FAKA 1Z62A 1DHRA 4PXSA 5I4MA 5F3DA 2ZC3A 3AI2A 2FUG9 5C53B 2Q6TA 1H2VZ 3L43A 1E3LA 2V59A 1IY9A 1B8UA 1HHSA 5IC6B 3JZFA 4HGYA 1YIAA 4K2JA 3BSCA 4A73A 3O2QB 4RIEA 1Z16A 3DYAA 1TM4E 2C5FA 5EDWA 4URFA 3F0NA 4YAIA 1Y3CE 4D44A 4EJ6A 4IH1A 5DOVA 1ATZA 3TVKA 2GSDA 1FRNA 3B70A 1DQSA 3RD5A 4G09A 4QFDA 2V34A 3NTRA 3FHTA 1AXEA 3SSAA 3LDHA 4KW7A 2OZPA 4ZOLB 4DA4A 4M0EA 4NULA 3MPYA 3HJGA 2AUMA 4QWWA 5DK6A 4BKQA 3B1WA 2O54A 4HQ6A 5GAHI 4CMIA 1Z5PA 2VUSA 3BB4A 4YGYA 3JW8A 3K9QO 3WIDA 4IGEA 5FEMA 3I5YA 5FTJA 1PSDA 4ME6A 2QMOA 3EGDA 2C04A 5KFXA 5E6RA 1TU3A 3LWMA 2DNKA 2GHIA 1WB4A 1COWD 4I5EA 1TV6A 2JPDA 1GJRA 4RDHA 4JOBA 2RAQA 3WWDA 5EC8A 5GJBA 3OVBA 2NUAA 4I4IA 2OHOA 3U13A 3R7WB 1MN9A 3O6VA 1K9VF 3TTSA 4B3BA 3QELA 5BNTA 3LT0A 1EAMA 1SQ6A 4GVXA 4AU1A 2LPMA 3KQUA 1VLQA 2PSDA 3ILIA 3LQRA 3K20A 4BU1A 3FPGA 2O7RA 3M3HA 4NYJQ 4F8EA 1QE5A 5JXGA 4I2NA 3GDHA 2A2ZA 1V3UA 1SXJB 4OX9F 1MNEA 1YJCA 1Y7IA 1KQFA 4AJJA 4WXRA 3LWLA 1RXSA 4BNFA 5HKAA 1FBNA 4D45A 2UUCJ 1WC3A 5A6VA 2CEKA 3KAKA 5SY6A 3RADC 4R3UC 3MNFA 3R7SA 3NQ41 4XYBA 2C0CA 2VTBA 4LMAA 5KTQA 5EPOA 2JJQA 4QIWD 3PDJA 2IHVA 2DECA 1N36B 1UM8A 4DQ0A 2ORIA 3C3PA 5CDFA