3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
b'NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
molecule tags Hydrolase
source organism Thermococcus kodakarensis
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
1AH2A 1BE6A 1SBTA 2ZRQA 1SUEA 2Z58B 1NLUA 1IC6A 1Y9ZA 1ZVKA 4AKSA 5JMOA 4NMXB 2W2NP 2Z56B 2ID8A 1OYOA 3A3PB 2X8JB 3Q5GA 3AJ9A 4Z2AA 2QTWB 3Q40A 3BPSP 3PTLA 1VSBA 1SIUA 3QMPA 1GTG1 1GT91 3DE4X 2P4EA 1C9JA 3P5BA 4LVOA 4FONA 3H42A 5JXHA 2Z56A 3EE6A 3D43A 4AKTA 1Y3FE 3A3NA 3SQOP 3BX1A 1P7VA 4KB5A 2G4VA 3L1KA 1IAVA 4YN3A 2ZWOA 4YN3B 3UNXA 1YJCA 3GCXA 3I34X 1TMGE 3DE3X 1SCBA 2X8JA 1PTKA 3A3PA 4WOBA 1GNVA 4I0WB 3LPDA 1AQNA 4NMXA 3HJRA 2W2QP 2Z57A 1Q5PA 5FAXA 3WQBA 3I30X 1SH7A 1T1IA 3GT4A 1CSEE 2Z30B 3DWEX 1AVTA 1Y4DE 1NDUA 5JXJA 3ZXYA 4ZOQI 1KE2A 2WV7A 1SELA 1TM1E 2PQ2A 1SCDA 3WHIA 5B1EA 4MZDA 2PMWB 3TI9A 1R64A 1GA4A 2W2MP 1THMA 1GTJ1 1WMDA 2SBTA 2IY9A 3AJ8A 1WSDA 3A3OA 1WMFA 1GTL1 1SBCA 3F7MA 1TK2A 1SUCA 2V8BA 1SIBE 1P8JA 4CFYA 1V5IA 2W2OA 2W2QA 3CO0P 1SUPA 1DUIA 1SBIA 1Y3DE 1SCJA 1SIOA 1SUDA 3T41A 3DVRX 3TI7A 1ZVJA 1XF1A 1A2QA 2WUVA 3DE2X 4NE9A 2ZWPA 1NDQA 4DJ5X 3LPCA 4WOCA 2Z58A 3AFGA 4HX2A 4J94A 1SVNA 4H6WA 3P5BP 1UBNA 1GA1A 2TECE 1Y48E 2PYZA 3BPSA 1CNMA 1BFUA 5AVKA 1MPTA 2PWAA 1GA6A 2Z2YA 2W2NA 3OSZA 3TECE 1AF4A 1ST2A 2WWTA 1KDYA 5JXIA 1DBIA 4C3VA 1PEKE 3DE1X 2B6NA 1T1GA 4OMCA 4GI3A 4DZTA 1HT3A 1Y34E 1BJRE 1C9NA 1Y3BE 2PWBA 1SCAA 2ST1A 1SPBS 3VTAA 1OYVA 3VYVA 1R0RE 1YJBA 3DW1X 2DUJA 3VHQA 2W2MA 3EDYA 3WIVA 3VSBA 3DDZX 1TM7E 4H6VA 5I9SA 1TO2E 3I2YX 5AMXA 5JXGA 1GCIA 1YU6A 1AK9A 3EIFA 3BGOS 1JEAA 3I37X 3GCWP 1SCNE 3VV3A 1EGQA 3VV2B 1WMEA 2HPZA 1PFGA 1MEEA 1SBHA 1PJ8A 2PMWA 3SQOA 2HD4A 5B1DA 2SECE 4K8RA 5K7SA 3VV2A 2W2OP 3F49S 4B5LA 3CNQS 1R6VA 1BH6A 4LVNA 3GCXP 1S2NA 1ST3A 5ARBA 4BWGA 2Z30A 1KDZA 3SICE 2QTWA 1SN7A 1S02A 1TM5E 4OMDA 1WVMA 5ARDA 1T1EA 2Z57B 5AQEA 4KG7A 4HVLA 2W2PP 4CFZA 3F7OA 1S01A 1C3LA 2SNIE 1SUBA 2Z2ZA 2SICE 3GCWA 2E1PA 1GNSA 2ID4A 4JP8A 4CG0A 1OT5A 1SBNE 4K8RB 1YJAA 1BFKA 1BE8A 4OV6B 3DE6X 1TM3E 3DVSX 5FBZA 3A3NB 1AV7A 3PRKE 2IXTA 4NE7A 1Y33E 1V5IB 3QTLA 4OV6A 3BGOP 1TO1E 1LW6E 3H42B 5CW1A 5ARCA 4RYDA 1V6CA 3D9QX 1AU9A 4ZARA 1Y4AE 3CO0S 2W2PA 1SCJB 1TECE 2GKOA 3ZXXA 1ITPA 4H6XA 2Z2XA 3QFHA 3CNQP 4KPGA 4NE9C 1SUAA 3GT3A 1TM4E 3A3OB 1Y3CE 2WUWE 2PKCA 3WIUA 3LPAA 4C3UA 2DQKA 1KE1A 2XTJA 2XTJP 1KDVA 1C9MA 2PRKA 1P7WA 2DP4E 3DE7X 2Z2YB 3DVQX 2XRMA 5AVJA 5FFNA 1EA7A 1Y1KE 3LXUX 4M1ZA 4DWWA 3DYBA 3DE0X 3DE5X 5SICE 3DW3X 1SPBP
chains in the Genus database with same CATH superfamily
3HKZD 5I7WA 1I51A 4JC8A 5DYYA 3WIOA 2C2OA 1NSFA 2O8CB 1I7LA 3GE9A 4NI2A 2HH9A 2PDAA 3STUA 3PXGA 4BEVA 2KB2A 4GKJF 2YVLA 1X8XA 1NE7A 4QTTB 2R7QA 4WN9A 1NK0A 2ZTVA 2KQUA 1BJKA 3FKBA 4LXGA 3LHIA 2AOTB 5F3TA 4BKPA 3UAWA 1NWHA 1IZZA 4Q1FA 5G0WA 3UGQA 1Y5IA 2GLTA 2YICA 3KHRA 1S4EA 2O1XA 4QWWA 2FSUA 1SC1B 1ULSA 4CT4B 3EQZA 4JIMA 2H1RA 1VQ8S 3N53A 2V2ZA 2BM0A 5B1YA 4LF6B 1TMMA 4G01B 4QJ3A 1WHSB 4WZAA 4QBTA 1T5TA 4FYJA 6NULA 1TCCA 4C3ZA 4IWYA 4AFNA 4D9JA 2OY0A 3K0BA 1N54B 4Y6QA 2VSFA 4US1R 4HEQA 3M30A 4DTIA 3FCSB 4G56A 3T1YJ 3NHUA 2WJ6A 2NU7B 4UMFA 4PZLA 3J80Y 3NVKI 1H7WA 4D3XA 1CBUA 3VTIA 5CYOA 3MB8A 1AOXA 1EQ2A 4GWKA 5CHYA 4MKHA 2A6MA 1KFBB 4F8EA 2IYYA 1OXKB 1MC8A 3N8IA 4CQ1A 4HY3A 5CH3A 3GEPA 2XZLA 1T8TA 5D87A 1CR0A 1CEEA 3MINA 3IOMA 4JUCA 2QAGC 1W93A 3IRXA 1R6TA 2HF9A 1QX4A 2UXBJ 3FNIA 3OT1A 1ZYUA 2BCEA 2M8DB 7AT1A 3W2HA 3O4HA 3ZZNA 4LBPA 1ETUA 3ROKA 4TUYA 1N34F 1X1RA 1S6YA 3TLAA 3SSRA 3ZY4A 2H5EA 1RAHB 2UVQA 4ZRNA 3S68A 4R5PA 1TR0A 1G6HA 3IQDB 3KWMA 4QE3A 4S12A 1AJEA 1TLTA 4J7CA 4FFMA 2WB1D 1R3DA 5H81A 4BC9A 1YMQA 4L6AA 3FPSA 2WWTA 2C4VA 2D2XA 4D56A 1TOAA 4RDIA 2OECA 3SIPA 4F4KA 5FI1B 1HDXA 4LRUA 3SE0A 4WFIA 3VTAA 1N6IA 3KALA 3MT9A 2B9VA 3AZPA 1YJBA 4FFBA 4KE8A 3PACA 3ELBA 3D4IA 2VL1A 1NQTA 4I6WA 4GC7A 2Z09A 4F71A 4Z99A 5BYAA 3MK31 1DC8A 5I9SA 1WCYA 2UUCB 4YAWA 4LZAA 3VV3A 4K8OA 2AE2A 3LAMA 3K6SA 2CWXA 2ZJ6A 1IWPB 4AZWA 4AY5A 4Z49A 1V9CA 5H9EK 4DC0A 4CRWB 3GJRA 3OX4A 3HGQA 1RCOB 4LY9A 1EDOA 1K1QA 3AHCA 1O97C 1BH6A 1ODSA 3JS9A 4MV6A 1RACA 2YH2A 4OL9A 1V6HA 5EXXA 2VA3A 2X9GA 3INGA 4YONB 1UKVY 1P27B 3G59A 1VJCA 4PPYA 3GJXC 1DXQA 1QK3A 3IJPA 1G98A 3WWYA 1HE4A 2P0EA 3C1AA 4KE7A 3OLWA 4RXTA 2ZM6F 1T11A 4ZTZB 1RHMA 1J6UA 2HQFA 2V5AA 3KYCA 3ZD9A 2VAMA 3FYCA 5HMXA 4OJQA 3T1YF 4PLYA 1A8IA 1KC3A 1SC4B 3UAXA 1MX1A 3OQNA 2SKDA 4B9LA 3M89A 2GQCA 5IXJA 5EJFA 4I4TB 1A9OA 3MWFA 1XTSA 2ZB7A 3L8FA 2AT1A 4TM7A 4YB7A 1QH0A 3WKCA 3OECA 1BCRB 4HR2A 1RWOB 2K2WA 5F73A 4XGNA 2Q8PA 4O3RA 1IJFB 5DHQA 2ZUAA 1R8HA 3VGVA 4OU4A 4UEJA 2P3QA 2BJ7A 3PR4A 1UBLS 1EJ7L 2P2ZA 3CX7A 1I3OB 3E5MA 2DY1A 4BNDB 4P4SB 2L9DA 4M22A 2HNYB 2RGCA 3NBAA 4RUAA 3I6BA 3VMMA 2HVHA 3HCNA 5K3AA 2G13A 4FVCA 3HPRA 2IMOA 3UJBA 1GZ3A 4XGQA 1LCIA 1N4AA 3DTYA 3OZCA 3NLCA 2FSPA 4EKIA 2JCBA 4ZK7M 2N3OA 4PNEA 2I33A 5IT0A 2IDMA 3SYTA 4QRDA 4IYQA 1I2BA 2XCSB 1FMFA 1W8DA 2WE7A 3H04A 2C2NA 3AZOA 4PFQA 4GYKA 4J7UA 2NLOA 1VSBA 1D03A 1SKUB 2VT3A 3HTXA 3N2ZB 4MWSA 5AM1A 1TK5A 1JIJA 2YZGA 2XS2A 3OE1A 2H4WA 2D0DA 4EB3A 3ND5A 2PS0A 5EFOA 1N2EA 1NVKA 1U25A 1XMOJ 3G1WA 5A3SA 2XLBA 1YCFA 4A23A 1QTMA 4K50A 3BH0A 1RTHA 4RJVA 1WNEA 3EFOB 3L8DA 1FXWF 1GL9B 3UMYA 5D8HB 4RW8B 1I7NA 4YP6A 1FKPA 4R3NA 1LS1A 2FK7A 4YCMA 1GP2A 4CM3A 1D8AA 3WL5A 4E2FB 2CDNA 3P9NA 1PQUA 2VH1A 1T95A 4FWBA 3H5UA 4QFMA 2M6RA 3UT0A 2HNZA 4Q00A 3SR3A 1FYXA 3OZFA 4FKYA 3O94A 3RTCA 4Y2PA 1VBXA 3R5DA 1GXSA 5EMMA 3ZWPA 1S1WB 3GQVA 1SA0B 3DV2A 3G23A 2BR3A 4FYXA 1P9QC 3QNWB 3KTDA 2Z5LA 1W75A 2Y0CA 4FE3A 1DQ8A 4KXFB 4EATA 3NNDA 4U02A 1GU0A 1F5SA 2G36A 3BD6A 5L3VA 2GVDA 1NEEA 4X2BA 1LFPA 3WGQA 3B53X 3S5UA 4DI6A 4Q21A 1CJKA 3ADCA 4TZTA 3IAUA 4ZOLF 2DFTA 2NYUA 5JATA 3O2IA 2AGPA 1QGED 1A72A 5DF1A 4HWGA 2JRSA 4S0ZA 3G0HA 1QGDA 4LRAA 3LVBA 5KDLA 2QLNA 4B76A 3FX2A 4HQOA 1RLDA 3A6KA 4LF5B 4IHQA 1DPGA 3C3WA 1VGYA 2LKZA 2D74A 2JFWA 4EBCA 1WB5A 1WSVA 2H9ZA 1GPH1 2RIPA 1T1GA 3DDCA 2N3ZA 4ER8A 3USZA 1Y89A 4QXPA 2OC9A 2XY5A 3BB1A 3OQMA 4CQMB 1RBMA 3CVYA 4QFDA 3DG9A 3NB0A 4RADA 4TT3A 4LOLA 2DWCA 3F4LA 2J67A 3W5XA 4AX8A 1M5HA 4DVJA 4FXPA 1R27A 1LC0A 4W98A 5A6SB 4MARA 2F4VJ 4E32A 4HDKB 1H1LB 1Y8QB 1SKWA 3Q15C 3KHUA 1MN9A 2XB6A 4R1NA 2W58A 3DC7A 4BLTA 3VA7A 3OVMA 2Y76A 1H7XA 3VNSA 3G2QA 4Q8EA 1DEKA 2QMEA 5ITHA 2MLZA 1OB2A 1Y7LA 4NZYA 3UHAA 1JXAA 3P1JA 5DHUA 3OMXA 2BFDA 4GVLA 2FJEB 1V8FA 3IR6A 5F3DA 3D4NA 5TS3A 4X62B 1K7CA 2W71A 4I69A 3C8UA 2RF2A 2MSNA 2YVAA 4HQ0A 3I5MA 1XEAA 1JHAA 3CYFA 1NQUA 3AY6A 1L5MA 4OXRA 3NANA 3OPKA 1F3FA 2CDRB 4YTEA 2NQTA 4YUAA 2DERA 3OPYI 1Y0HA 5EJGA 3MW8A 3ULKA 4W1SA 4XVQA 4EKDA 1JHVA 3GD7A 3DM5A 4IHJF 1BMFD 3I28A 3MWEA 2OBLA 3QTLA 1QNLA 1JR3A 2YH0A 3SI7A 2KT5A 3EUNA 1N5QA 1YZ6A 2M70A 3D9QX 1AKYA 1T15A 3HUDA 1WG4A 1VC2A 3OLVA 3TP2A 1L5NA 5JYBA 2H1VA 3OD5A 3CTRA 2XKBA 2ASDA 5EHHA 3OU7A 8ADHA 3E2EA 3FMBA 1H1TA 4M36A 3PK0A 3UK6A 4WUVA 3R97A 2XUIA 1VHLA 5MLCV 4FKBA 2DUUA 5DZ7A 3VC1A 1RTHB 2FZCA 3OF5A 2CV2A 2R1TB 3PCOB 4KO3S 5H80A 3OL7A 4QFBA 1F2UA 4WINA 2A3RA 3QXXA 2XTJA 5E0KB 1RQ7A 3WRVA 3MINB 2NZ2A 2PRKA 4UNIA 3K1JA 1GYRA 3EIEA 3LSYA 2X15A 2GV1A 3AW8A 1FFXA 2PJRA 4DV6F 4B85A 2KT2A 1HX7A 2XMDA 4HEHA 3V4SA 4AMUA 4RS3A 4PPZA 3GRPA 5HN0A 3BO2A 1F5NA 3VZIA 1GTMA 1X0XA 2QT0A 4PZAA 4BV8A 5JDIC 2I22A 3FM9A 3ENNA 3MRXA 1AUOA 4GMKA 2WU4A 3WTBA 1V5FA 1XSEA 2XTZA 4BVHA 4AXIA 5MN6A 3LT4A 2J7PA 2ASYA 1QRRA 2ID7A 1Y6FA 3TVZA 1FU4A 4A0GA 5KWIA 2VOJA 1YR8A 4NSNA 5L3ZA 4IUFA 2FX2A 4K4VA 3LQKA 4CM9A 1HLWA 2FHJA 4PXSA 1PTJA 3CZ9A 1JSZA 1RT5A 4EBEA 2KSQA 4NY1A 4YUDA 3DFKA 3I34X 3POTB 2GQQA 3HVRA 2KI5A 1W2BR 1IJFA 4MWGA 3QRPA 1XTVA 4EOGA 2RKWA 3R6WA 4RL4A 5B6IA 1M6VA 4NLWA 3DQQA 3IH5A 1GWNA 3RTGA 3DMYA 1PNRA 2AVDA 3X2EA 5CFZA 2QTTA 1G2IA 1L5OA 2UYCA 2LP4A 4CR6A 3RLFA 1TM1E 1ONSA 5CT9A 3GPLA 1AGYA 1O6GA 2QZSA 2A33A 4IXMA 3TTXA 5JAQA 4IR9A 2W2VA 3VZRA 4J0IA 5LIPA 4M5NA 4HV4A 5J2TB 1J2EA 2Y6UA 4A9AA 4IUCS 2MYPA 4FZJA 2W7TA 2EX4A 2OTLS 3DFZA 3C3EA 1RAOA 4AY3A 4ZTBA 4HN2A 1XRPA 3N01A 4RCZA 4C78A 4GECA 2V9PA 1ULAA 2MZRA 2XGJA 5ULLA 3TKAA 1C7RA 1K8RA 4OFBA 3NOCA 2YY6A 3IQWA 4AZTA 3NCPA 2G0TA 2GW8A 2QJTA 5CA0F 4E0DA 3G8CA 1A5BB 5JYEA 2FR8A 2ZUWA 3R7WA 3I9V6 2ZYVX 3KV1A 5F8NA 1JNRB 4S1WA 2Y1KA 1DFDA 1FPQA 3FI9A 5AI0A 5F0UA 4BO6A 4V0NA 1VOTA 2VEOA 3SMZA 1P3DA 1N5TA 4NNOA 3BJYA 4N3GA 2X8LA 4DCUA 5CXTA 1IBLJ 5ILOA 3IMGA 4N41A 3BERA 3MFYA 4FM9A 1T3SA 4ECYA 1G3MA 2M2IA 3ITEA 5LOQA 3OF2A 5A5GA 1JWWA 3IO1A 1WL8A 5FUXA 3HJCA 4WF9Q 2D7JA 1SNYA 5HUQA 3B1XA 1XTUA 1DLJA 4G89A 4GP7A 2O01C 3IHKA 5FRDA 1KPIA 3CT9A 2NUUG 5IT9A 3HB7A 4LDJA 2Q3FA 3HKBB 2PANA 3G7SA 1A1SA 1KTIA 3KX2A 1R0AA 1NK7A 2RKOA 3HADA 2J31A 1Q8IA 1EGQA 3ZBPA 3FJYA 3O3NB 4NHEA 1LDBA 1QE3A 4AC9A 3OQVA 5IM5A 4ELUA 1ESMA 4ZAVA 4IO9Q 1BDMA 5FBLB 1S9HA 3QATA 2EJVA 5ES4B 7AT1B 4NBTA 4IFYA 1SVSA 3OKPA 1TUWA 3MXOA 3V4FA 2B9EA 4O29A 3CVVA 4DLAA 2ZLBA 4EGCB 1WPXA 4USWA 2UV8A 2QW8A 2BUBA 4TKZA 2NZVG 4MEAA 4X4VA 5JTUA 1V4NA 1TVEA 1XQ9A 4X1IB 4CG3A 2MCFA 3DL2A 4GWLA 3ZLVA 3O1IC 2FH5B 3ICEA 3T5GA 1W1UA 1HC7A 4HPJB 1AUQA 2BABA 2Z08A 2ZUCA 2WVJA 4HXGA 4NE7A 3EAQA 1RWMA 1FW6A 3G5UA 5ETSA 1AC5A 4Q4HB 3K3PA 3GJ3A 3G79A 1AU9A 3GOQA 4MWTA 1N5IA 2PO7A 3DSRA 2FEAA 4L1KA 3WNDA 1TEHA 3WK9A 5G0TA 2N1BA 4ESOA 1U0TA 4EARA 2A84A 1R8AA 3IDAA 2BSAA 5CFNA 2E48A 3AK4A 4D6YA 2RG1A 5KREA 3DOKA 3C6YA 1PYOB 5FPQA 4F3YA 4QL3A 3IAFA 5B1HA 4I6JA 4L4UA 2MZSA 2YHUA 2E7ZA 2FP4B 1XCJA 3NDPA 4L0CA 5LQMA 1E3WB 1TUEA 3S8YA 4HAIA 2CPDA 1OSNA 3RYIA 3GVPA 1ZW1A 5UKDA 2HQRA 4X65J 3STTA 3ADKA 3Q11A 2YNFA 2PLNA 1DMSA 4YJ2A 3LXUX 1ADCA 4F7WA 1UPMB 1H1LA 4M94A 2XDWA 3IAM1 3G8YA 2V4JA 2GETA 4JBNA 2AIRB 4U2FA 4Z4EA 3K73O 1G7SA 4UBLA 1E2QA 2ZDPA 3SSMA 1D1SA 4YALA 5EVCA 1YQUA 2YFQA 5DGAA 2WWYA 1KL7A 3M0EA 2BGMA 1ESZA 5JXHA 3R0ZA 2ZIFA 3A9TA 4Z0HO 2OKQA 3I8XA 1NJXA 3G89A 2VG7A 1N6NA 4MGZR 2YWXA 4W92B 5THXA 3EY9A 1DDOA 3C3CA 3ESBA 4FGZA 4P2XA 2KYXA 3I6MA 1I10A 1FX4A 4GLBA 2P6RA 1RWWB 1PK8A 2ROQA 2W2TA 2HDNB 3T15A 1LFWA 3WMGA 3JQ7A 3MRSA 3L1IA 4HDGA 4C6RA 1XLWA 3KPVA 3MM7A 3HHDA 1ISPA 1FVSA 3Q9SA 4R83A 4DV1J 3ZWXA 2ZKLA 3BMOB 3G82A 2EQBA 3H4DA 3QE4A 3A37A 4ECUA 2YVKA 3RYTC 3JSRA 1ZK2A 4RR5A 3M32B 1SCDA 3MQFA 3OAAA 3SQWA 1Z0UA 4Q2LA 2AF6A 2HO4A 4MW4A 2E9ZA 4ZKAA 4C0BA 1EE1A 3I39X 3FZBA 3WDSA 4B9VA 1SBCA 1NMEB 1SUCA 4ZREA 2ZWMA 3OIVA 1SA0A 1WI8A 2D5LA 1EIZA 4Y28C 2BGWA 1H9AA 3KUEA 2OXTA 3AINA 4UVGA 4ID3A 1TUBB 4A8XA 4BVGA 3HI9A 2P69A 3BXZA 4DCMA 3OQ2A 2AU0A 4FBUA 2F63A 4KYVA 4EUKA 3SM9A 2RAQA 3E7XA 3UH0A 3H9GA 1T0IA 3OPQA 5FBRB 1YVFA 1EETB 1UPAA 2Z58A 2FTKE 2I5JA 2B69A 2G07A 5FH9A 4RW8A 5C81A 1YIDA 4OHRA 1Z2AA 4NS4A 2IVYA 3ZHSA 3CJ2A 3NOGA 3CTPA 4USTA 3G71S 4GBED 4F3MA 3GG0A 4BMXA 3U4QA 3HSGA 4XIIA 1NH7A 1ZPDA 1LWCB 3Q8LA 2W4CA 1CY2A 3PHBE 1ZJ5A 5KG1A 4QLOA 2C0QA 1VRUB 1NYQA 3AI3A 3KJZA 3WWOA 2ODEA 2QBYB 1JHQA 1P9YA 3ETMA 4HQNA 2BBSA 1NUTA 3PJWA 5E6SB 2R3VA 1QF6A 1RZRA 4CLWA 4Y6RA 2ZJFA 1ORVA 2BDTA 4IQ0A 3PPYA 3DLTA 2LE0A 2EFHB 4X4NA 3WWZA 4QD3A 3RS2A 3ZYCA 1AO0A 3MPUA 2AN4A 3SCIE 3ESDA 3UPFA 3RUFA 2CNNA 3RIHA 1ONBA 3LF2A 4QUBA 3Q7EA 2CFXA 1SBHA 3EHEA 2PNFA 1HR0B 5CEEA 3IPRA 4W8HA 3REFA 3IM9A 2ZBEA 1KEEA 5KG5A 1CYDA 1ZLYA 3H9UA 1GG2A 2XSFA 1IQPA 3BF7A 3W1YC 3VR4A 1I4LD 3GNTA 2D13A 4CETA 2DQ4A 3TSAA 2PGJA 1QOPB 4M7WA 3JRWA 3WDKA 3Q8VA 5HP1B 5CK4A 3BZBA 2OQVA 3F7OA 4MICA 4O2AA 4NQZA 1JDVA 5IWAF 5C24A 1L5UA 1MX9A 1MIHA 2I3AA 3EARA 5TX7A 4N48A 2EWWA 1YU9A 2B36A 4TSKA 1XMBA 2OIHA 3KCQA 3KIPA 1DAFA 2RH9B 4G0PA 1JJFA 3OM9A 2JFKA 1TO1E 2JIQA 2PZMA 5HKKA 2X3FA 4YDSA 1HNWB 3ONEA 4KWEA 5D8DA 4XYBA 4F6CA 2VQEJ 2UDPA 3O91A 2FPSA 1B23P 3MUTP 2FHSA 1J1UA 1JJAA 1H2VZ 5IAAA 3ZHTA 2JVJA 2DUNA 3BVPA 1ZGAA 1A76A 2GHVC 4GQIA 4U9UA 4TKVB 3I72A 2AC2A 4QNMA 3D54D 5E41A 1NBOA 2P7HA 3T1AA 1OB5A 3WWCA 4G5HA 4Q9HA 3QSYA 1JIIA 2JI4A 3VPSA 5AW8A 4J9NA 1M5KC 3SCKE 1AQJA 5K8IA 3PDIB 3LGHA 4UUPA 1VP3A 3N6XA 5IUKC 2XNHA 2KFZA 2E4AA 1LW0A 4QW8A 1YMUA 2QG9B 4DREA 3DE5X 3KJXA 4JI0J 1K1SA 3HP7A 1HF3A 1BA2A 2IYRA 3V8RA 2IYSA 4Z4GA 1GXLA 5DCLA 1M1YE 1E79A 221PA 5I47A 1D7AA 1G7CB 3VUEA 3NWBA 1ZDMA 2VDNB 3TKLA 1YZGA 3Q40A 1QCZA 1RPNA 2CYCA 3ONFA 2HEIA 3RVBA 3UMRA 4OFZA 3O8OB 5G41A 3BREA 2RT3A 3FDZB 3I56S 2INGX 1RC1A 3H5TA 4UHFA 4U7WA 1RPTA 2RGWA 1DG9A 3AKYA 3WGKA 2VA2A 5BRJA 1AQYA 4Q7KA 2FHJD 3CVXA 3DEYX 2A6PA 2VHVA 1NOIA 3MCVA 4ZGBA 4NMXA 5C46F 1KZ1A 3SBXA 2A58A 3EJ6A 4RPIA 2XF2A 1X7WA 4L0MA 4ZD6A 3CEPB 4BVEA 4BVFA 4RW6A 2ZIAA 4LC1A 4ID5A 1H42A 2EWHA 1XZIA 4HXEB 3VPDA 4EFAC 3MM7B 1BDBA 3ZV6A 3V8MA 4MIOA 3OJUA 5HBMA 4ZJPA 3D8TA 3SM3A 5H9VA 4RK6A 3W3SA 2PFFB 1HT2E 1O0PA 1LKZA 2XLCA 3DMFA 3IOCA 5BNZA 3UXHA 1QRSA 3L92A 3I64A 1GMVA 3PKMA 3D6NB 2UZ3A 4GU5A 2GILA 4IY1A 2QD2A 2VPZB 1W5AA 4XFDA 4R7ZA 3UN3A 1WPRA 3O4FA 3CF5Q 3E8XA 2H48B 2Y0BA 5CDTA 3GRFA 5KHLB 1C0TB 3KK3B 2JI6A 3QA3E 1E32A 5F8HA 2MYUA 4YRQA 2CHQA 3AD8C 3B6ZA 4P7BA 3C15B 3LD9A 2XBMA 1GO2A 5ERYA 4C04A 1SK9A 4WZQA 5HXAA 1MMFB 2G2YA 4UTZA 4A92A 2ZREA 2R5FA 2PYZA 1EUYA 1S8NA 5ABPA 2DHSA 4QZVB 2Q9BA 1S1XA 3ILSA 3AB7A 4GT1A 4IXTA 4LXHA 1UPXA 4Q3LA 1CKEA 4C0JA 3HR8A 4Q7QA 4HJXA 2BJHA 5JJLA 1AB5A 4CLUA 4I50B 2D0OB 4B2LA 3PXEA 3WMXA 2VUIB 3MGAA 3MLEA 1KJIA 1O0BA 1N2JA 4BMDA 1I7QB 4JAVC 5K8CA 3O6QA 2FUCA 2GLUA 3CWCA 1UT5A 2VPXA 2BHSA 1MLDA 4JC4A 5IAGA 1QHEA 3TMAA 1J8MF 5ELXA 4U7CA 1Q1AA 2F9MA 1V95A 4DR3J 2FPHX 5F7ZA 4BRWA 1E2PA 1M8KA 4U95A 2R1VB 5CLIA 5JJCA 3F44A 5D84A 4FDMA 5TGZA 3S1SA 2FWIA 4L72A 2AKWB 4NR0A 3U7FB 1KDZA 1QQBA 1LF0A 1LTKA 1XQYA 1FU7A 1Q19A 3E61A 4DPMA 4KH0B 4C9DA 1VMKA 2IITA 4YA6A 5C8XA 1E9AA 1ZC3A 3DT8A 5F9FA 2W2PP 1NFFA 1SL0A 4KXLA 3NYRA 5HATA 2DNHA 4O4LF 1TZKA 4Z4FA 4DV2F 2Q50A 5IQQA 5TT0A 2N7CA 1ECGA 4OFXA 4JP8A 2G9NA 2FFJA 4L8VA 4NBVA 2BV3A 3LO8A 2E3JA 4O59O 2R7NA 2BFAA 1AHIA 4E7PA 4DLEA 2G9OA 3T6JA 3GLIB 1VPTA 2HEKA 2AP6A 2UUWA 2A0XA 2ETXA 3O5TB 3R9KA 2V9WA 1EP2B 1F2DA 3ZV7A 1HBOA 2M32A 5LB4A 4F2RA 1FQKA 2QTGA 1R37A 3PKYA 1JGTA 3H2HA 1OLXA 4J4TA 4IHKA 2GMHA 4ZRDA 4MWCA 2LUOA 1NLMA 2VXYA 1QJHA 2JLAA 4O25A 4E2YA 1NSQA 4X61A 3GEIA 4EHHA 1QB8A 3X1YA 1OVGA 3WIUA 2IT1A 2C88A 2XTJP 4WK3A 1MAHA 5K0GA 1XNRF 4PIPA 1QM5A 2DP4E 1LW2A 4E5SA 3V6LA 3K0HA 3R20A 2CD9A 3T4UA 3UM9A 4FYYA 2PRZA 1C30B 2YIVX 4NFYA 3P96A 1TM2A 3PYXA 3A28A 2R8JA 5EA2A 3DOUA 4X85A 1D6NA 1OGIA 4ZVLA 3RIYA 3CD6S 1K63A 3GV5B 1OLSB 4JOUA 3ZHXA 2ZATA 3DAOA 3ZTSA 3Q5GA 1TXGA 4L8YA 5AD1A 1QHSA 2Q41A 3O4JA 1K9SA 3GMIA 1N2CA 4CIYA 2F7SA 1NJZA 3H2JA 3KB1A 5GOZA 1HR0J 3MFHA 1BMTA 4HUJA 1GXTA 3IEVA 2A0YA 1YZKA 5AVSA 4WK4B 2CLLB 4FDUA 1AXEA 2JAHA 4KR7A 3W9YA 3LQ1A 5E6RA 4HS4A 1OZGA 4RF5A 5ITZB 3ZU5A 1S6PA 2HHWA 1DL5A 2OENG 5K8OA 1YRAA 4FDAA 3GCXA 1OF1A 4AZVA 4BQOA 4J9PA 3ZY6A 1PTJC 1WETA 2BMEA 3KHSA 1IDOA 2Z9BA 1W94A 3K4HA 1KVIA 2Y1RI 3NGLA 1UPBA 2JLUA 2FUG6 2B4RO 2A0KA 3OPMA 2VTDA 5LD2B 4LBYA 3S1AA 2QRGA 2NSDA 4URHA 3GJ7A 3HCCA 2Z30B 1JYEA 3BD7A 4LFAJ 2BMAA 2C5HA 3NAMA 5AE1A 3A4YA 2GLXA 2H59A 5BSTA 1USGA 2YIDA 4BMOB 5JTTA 4U7DA 4FTWA 1SBZA 3RASA 2VJMA 4MQUA 2FN9A 1W87A 2CUTA 3Q87B 4PXAA 3W9JA 3BYZA 5IC6A 1MJNA 8LDHA 1M8JA 2E6KA 3C6KA 2ZBQA 1YA4A 3OZEA 4XUDA 1UAGA 1LWOA 3B3QA 4WWHA 4ZVQA 2PBFA 5ITVA 4LHWA 4XH9B 3Q3HA 3DNCA 1T5IA 4DAOA 2XQCA 2O20A 1NJ5A 2FQ1A 3V6DA 4NG5A 4BQEA 3D2WA 3AOGA 4LNUB 4O4IA 4MK4A 3V4RA 3K6KA 1J2YA 3OL6A 4QULA 5AVUA 3K9LA 4OI2A 3FFBA 1ZX1A 3AIMA 3SSOA 2CUNA 1EVYA 5M2QA 4X54A 5A03A 4KTVE 3T7TA 3HCFA 4JY7A 2GPJA 4YFYA 1LPNA 4P32A 1E6EA 4ETXA 4XB1A 4HNSA 2PJUA 4UXJA 5C8DA 4M0LA 4LFCB 5J2PA 3YASA 5B7WA 3UOWA 2R00C 1X5SA 1AMNA 4TWBA 3LM8A 2EJUA 4IMRA 2ZIZA 3G2NA 4D0GA 2H16A 2B8EA 4IQXA 2V4MA 3I6YA 1Y3BE 5A9RA 3W8RA 1KFCB 2RK6A 1ZCJA 1VRTA 1E62A 3L6DA 4L9SA 2DFVA 2Y8EA 2ZQYA 2Y67A 2WU8A 4WCEQ 1QAXA 5IJ0A 5K3DA 5BN5B 3EA4A 4JMPA 4B2YA 3O4RA 3CVUA 1V7PC 2PSEA 3OR1A 1WKLA 2F4VF 1A6LA 1G59A 2FFQA 4ZO4A 3IWLA 3O1JC 3P9SA 3BR9A 4MS1B 1GSIA 2MMYA 4MGHA 4B5LA 3E9ZA 3K96A 3WGLA 4IO1A 3CLRC 1P6UA 4HUTA 3DMTA 7REQA 1DCMA 2JZCA 2I2FA 4PXYA 3ZWYA 4FFOA 5A4DA 2DFPA 3C7DB 1E6MA 1ZP6A 2XGPA 2G63A 3L6CA 4MIKA 2AJQA 4YRSA 5C51B 1B8VA 4PZYA 4IYRA 2FFHA 4IOMA 2OKCA 3EB9A 4K4TA 4BS2A 1I2MA 3W34A 4B48A 2BFDB 2Y1JA 3DMGA 4Y7DA 1G6BA 5DBGA 4ZVRB 2MZ1A 4NX2A 1HD0A 2SCUB 5F1YA 4B43A 1OI2A 4BTLA 3VZBA 2OV6A 3KTFA 1QZUA 3OICA 2EYQA 3IQZA 4R98A 2CLEB 4XDHA 3IOYA 4CLTA 2IJFA 5JZOA 4LCBA 2GD2A 2ZNZA 3NOOA 4TY9A 3GFXA 1KOHA 2TYSB 2ZVJA 5IJZA 2MKSA 3ZW7A 1XMQJ 2P2NA 3NHAA 5KAPA 2VZ0A 2M5YA 2DT8A 3SFVA 4JI6F 1FTQA 4K7QA 4IQGA 3QNMA 1Z7YA 3I9FA 4CKCB 3H86A 3K0EA 2P65A 4I9FA 2X41A 3RT9A 3PRJA 1WDDA 1NJ8A 3D66A 2B1IA 1J39A 2DWPA 4YJ3B 4ZC8A 2ZE7A 3MCSA 1JDNA 4LG1A 2O1WA 1E58A 1EFDN 2ZI4A 3A3PB 1NLZA 3AJ9A 1TFWA 2F3PA 3RPEA 2EXUA 2FXVA 3P2KA 2JLXA 2O5VA 4F2PA 1C9JA 5KOHA 2CFCA 1ESCA 2OB1A 3CVJA 3SZ2A 4H60A 2NN3C 4LISA 1Y3FE 1DIGA 3ODPA 1YUNA 4YT8A 1SVIA 2R8IA 3FZYA 3W8EA 3LA8A 5CLQA 1H0HB 3E3NA 1FRLA 2WTUA 4EWTA 3CLUC 3CD0A 3FGNA 4AIRA 3HBLA 1E5XA 4RD3A 2AH5A 4FYXB 4ED4A 3L7JA 4ZI2A 3ZDDA 3MT7A 2XQIA 2AKYA 2W7AA 3QV2A 3HVAA 3EUAA 4BMSA 5EYPB 1WPQA 2NV2B 2K7JA 3K59A 4O4HB 2JCYA 4G3XA 4U0JA 2UU9B 2XH8A 1G21E 3TNDA 4RK1A 3VOBA 2B1RA 4KV8A 1RHKA 1NB7A 2A9RA 3DRPB 4REMA 3ZD6A 4OL8A 2GKGA 2IS6A 4XVUA 3PFEA 1GTJ1 3EE3A 1WD6A 1OV4A 1R5BA 2IYWA 4TWRA 3IPAA 3A1SA 4PLCA 3FFAA 1FRMA 1XNQF 4WXOA 4OXQA 3SF0A 1NQAO 5IKEA 3LJKA 1WKBA 1F1BA 3O4IA 5IVHA 3ASYA 2ZBFA 4BFLA 3CO9A 3T61A 1FEHA 1OX5A 5H70A 4RMNA 3J81k 4NU5A 4ZU3A 4FMBB 1T24A 2YWCA 2XMMA 4U00A 2QSJA 4JOQA 3E9YA 2ZAOA 4DU8A 4HQ6A 1U0SA 2YVQA 1PL6A 1UVLA 3EEOA 4OYZA 4KKOB 1Y80A 3I2IA 2JCGA 4EEKA 4ILRA 5BJRA 2ZT8A 3RAJA 3NHZA 1Y5LA 4XCXA 1KI3A 1FTCA 1NF3A 3KLVA 2VU5A 2G77B 1KPGA 3ID6C 4OIXA 3UENA 4XFJA 1ZN2A 4K6FA 2I6UA 2OSQA 3HULA 1Q74A 4LF1A 1XDGA 4MFBB 3TO5A 3FH0A 2PX6A 1NR1A 3ETNA 2HRRA 2I7XA 3DKRA 2DHRA 5DISB 1DBRA 4U8HA 1Y34E 1O77A 4WVFA 3GFPA 1P77A 3TWOA 3DOFA 2YX4A 2DUJA 2G6BA 2O7NA 1Q21A 5TXGA 1ZITA 4RK5A 1U6BA 3OWOA 2GM4A 4Q3AA 1LB1B 1N77A 1V0JA 4YCCA 1E77A 3F78A 3I2YX 3THYA 4A7PA 3KLIA 3TANA 5FNVB 5HROA 3HA5A 2CW5A 2FB0A 4JUDX 4DLYA 3OEHD 4UJ5A 3KYLA 4R8UA 2HA2A 3UD3P 1QAQA 3EIOA 4F0KA 3VR5A 1ZA2A 4OSOA 5B0AA 4HT3B 3P9PA 2GCNA 3IAS6 4CIVA 3HJHA 2CMFA 1ZIDA 3S4YA 2PMFA 2BANA 2FR1A 2JC0A 2YWJA 3PEUA 1NO8A 1CNFA 3L8YA 4LYJA 3LDGA 3RS8A 5J47A 2HHAA 3L9WA 4OMDA 1CUSA 1OCEA 2GT1A 1DLOB 2FQQA 5LUAA 3KTAB 4MA0A 2ZULA 1EK0A 2FWPA 3W5CA 5DRYA 2GHTA 2VP6A 4KDFA 2FDNA 4DR5J 1SQFA 4ED0A 3U40A 1Q82T 5FWYB 5DM1A 4KVFA 3T7EA 4PSAA 3FY4A 1WDLA 3PX3A 3MEGA 3T9FA 5AOBA 1FJXA 4CM8B 5FL7D 5JE8A 5FDLB 2ZE2A 4P80A 2EKQA 4B09A 3PHHA 1N5YB 3LUCA 4URZR 4I1YA 1G42A 3C46A 4E5UA 3BE8A 2FTRA 2HFKA 7FDRA 5AXAA 5IBRA 2IUYA 1RWXA 1IONA 1KOFA 5G4DA 5TQJA 3TQTA 4H4KA 3VXKA 1O94C 2JLGA 1GNRA 1GKIA 3CEJA 3RWMB 1FCAA 4KXXA 2QAGA 2PSZA 3VPAA 2BFWA 2PZLA 5D01A 1JT2A 4HYQA 5C7OO 2AVNA 4RZUA 1Y7TA 3UBTA 4ZEXA 1GM5A 1NVEA 1EA7A 3KOYA 1RADB 4M9ZA 1Z2LA 4ZJUA 3VH4A 1V3QE 3SHOA 3G3EA 4R5PB 2WHEA 1H73A 3VR5H 1KJYA 2ZI7A 4AWXA 2CJ9A 5HG0A 1NXXA 3L7OA 2GCOB 4R8RA 3R3HA 4GBMA 3AMVA 3IE2A 3B82A 2VHTA 2L19A 3FVRA 3SYZA 2V0NA 5C3MA 4BE4A 4AO7A 4CF4A 5J5VA 3O93A 3FMPB 3K5PA 5JJBA 2AFHA 2JFOA 1QBGA 1KDTA 4OZ3A 1PFVA 1XC7A 5A3RA 3NHWA 1QVZA 1HQ2A 3DBVO 3R3UA 1GGVA 3M1LA 4D4HA 1NJYA 4ID8A 3VKFA 4H6PA 5HILA 4U8GA 1RQXA 2OPSA 4UBMA 3VJLA 3UAOA 4WMLA 1BXRB 2CPJA 5L51A 1FJGJ 3IGVA 1NB2A 4L5BA 1VTKA 2NOAA 3UT5B 4MVWA 3IRVA 4IIYA 1C3VA 3LXMA 4OI6A 2P4SA 4LKOA 3OE5A 2QLJB 3EGVA 4BZZA 1SZPA 2M98A 3GP9A 2BSXA 2LQ8A 1E6WA 1HI1A 3GD5A 1X7XB 4I9NA 1WSDA 4TTAA 1NU6A 4AXXA 4P7FA 4X66J 4QDUA 2VODA 4IRUB 4UD2A 1PCXA 3E5RA 2BEFA 1EWVA 5DULA 2VH7A 1FFGA 2QAGB 1UDRA 4ECQA 5K8NA 4S1NA 4JHLA 3QHQA 5I9LA 1JFVA 2B82A 1NU8A 3LUFA 2AJBA 3OUTA 2CL0X 4DV7J 5C7YA 2CLHB 1BXGA 4LNUA 1IHPA 1CRQA 1LWNA 1A98A 3LK7A 4Q1CA 3V4IA 4GHWA 3N2IA 2C07A 4KRGA 1UC5B 4E5YA 1GA6A 5DVZA 1I4TD 2CPYA 1OD6A 1VSQA 4RA9A 3TW8B 4S1VA 1U2SA 1ABFA 4RK4A 2DPIA 3RU9A 4LHEA 2IFXA 1T4CB 3QFRA 2IY8A 4OHBA 1ZM3A 1DBVO 2GD6A 2PEYA 4ES3A 2WHYA 1M7GA 2A3JA 3GBVA 3DBRA 2B8JA 1I14A 3A06A 1L4YA 1UZHA 5C4GB 4PWDB 4BLWA 2BW7A 2OO4A 2CB0A 3FLEA 3HN6A 4ZVFA 2RONA 3FSEA 4ZYYA 5K1ZA 4TROA 1Y81A 3DFUA 4RTRA 3L4BA 3T0FA 4RMGA 3K1ZA 1HXHA 3ZGVA 5JH7A 4X5OA 1O08A 3AUYA 3K5WA 2A1UA 1BAPA 2EC0A 4O33A 3NJ8A 4BFVA 1II8A 3W9BA 1KQNA 5D0RA 1T9VA 5F3ZA 1K6EA 4NLQA 1I24A 1SB8A 2J0SD 4B32A 2ZM5A 4V0KA 2I6SA 1DC4A 521PA 4QU6A 1ZU5A 2B6AB 4CH1A 3RC9A 1CP2A 3DAYA 1VA4A 4CU5A 4KG7A 4B6SA 3JU3A 2PUVA 1YZ7A 4QU8A 1N3IA 1J0EA 3W3AA 3A7DA 4N8SA 2YTCA 2W8LA 1MC4A 2O2JA 3H25A 3H2VE 2ODBA 4Y00A 4UC0A 1PJAA 5J4VA 1BFKA 4TRJA 4GDMA 4BWYA 1W35A 2C42A 3ZWNA 5A2QU 3CCVS 4U8VA 1IBKF 2PR2A 5EEGA 4BX9A 3W06A 2HQ3A 4EP1A 1B00A 1L7NA 1JXQA 5JROA 3E8OA 3DOEA 3OEHA 3DXYA 3CF2A 1WHXA 3IPCA 1BMQB 2J32A 2P90A 4K2AA 1KHVA 5I7EA 4UTGA 4I8XA 1EUDA 1C9EA 1SUAA 3ZKWB 2J5QA 1RJ9A 2IL1A 2QNBA 1N3BA 2WU0A 1KXZA 4U96A 4EH1A 3RSFA 2K7ZA 3GLGA 3MD3A 3ZH2A 3JX9A 5B4UA 5BYSA 3PX0A 1U48A 4XIFA 2XZTB 1QGZA 4OKIA 1RHUA 2G6TA 4OFWA 3F6YA 3NH6A 2XOXA 5HS4A 1FJ7A 3W2FA 4K0KB 2MQMA 2H1CA 1JKMA 4LY3A 3MM8B 4YACA 1XEZA 3AGQA 3ZK9A 5I45A 1KA9H 1GPWB 1KY2A 1YQHA 1Y8RA 3L0PA 1X3SA 3SXLA 1B2LA 4BNHA 3HQ4O 4RW9A 2QDKA 3V6KA 3F6RA 3I6QA 1E1QA 3U0BA 2ZRIA 1RXYA 2RHJA 4KFRA 1I94F 4KH1A 5D86A 4HB2A 1NGSA 3VOTA 2REQB 3EVGA 2FC8A 4E94A 1O9HA 1RRPA 4O4HA 4ERXA 3P5TL 4LZLA 1DQ9A 2QN2A 4K9NA 4EEXA 2OXEA 3N2KB 4O3QA 3PV8A 1R7RA 2JIZD 2OPHA 1FKOA 4QIHA 2CYAA 1A9QA 3ENAA 2WYOA 4O02B 2PKYX 3L0CA 3R5BA 2CNOA 4II2A 4B6FA 4ND3A 4KVAA 3HVTB 4X1YB 4I0WB 1MX5A 5HGXA 3SXJA 1XR3A 3HB0A 4XVCA 2JAPA 5SYNA 4EM6A 2RH4A 1MG0A 2KJQA 4DJEC 5CCXA 3W7AA 3ZS8A 2HCRA 1S12A 2BFBB 2PY6A 2PD6A 4ZOQI 1JFSA 2XD9A 4FN5A 5F3RA 4AZ3B 2HF7A 4NX9A 1GG9A 2H29A 3IA7A 1Z29A 4AULA 1PFUA 1ZY2A 4IMJB 2I99A 2BF7A 2XQGA 3EXIA 5BYRA 5EQDA 4YAFA 1TMOA 4TMWA 3GQBA 2WLSA 2Y0SD 2CJFA 4NS1A 4GC5A 5ETRA 3RU2A 3M2VB 2WA2A 5MGNA 2IF0A 5JCOA 5IJXA 1KWKA 1JWLA 2VHZA 2VJAA 2CMHA 4M46A 1CS4B 5BV1A 2FQQB 2IM1A 4CF3A 2XUGA 2J7PD 3K6JA 2XE4A 3UV3A 2LDBA 1TJPB 3SY8A 3SC4A 1ZIPA 1BW9B 4OQZA 1SVWA 2EFQA 1HK7A 5GJCA 3SK0A 2XNCA 5E7JA 3KQKA 4Z1MD 3OJCA 4JGGA 3MWDA 4WXEA 3TUZC 3N3AC 1T2AA 4PZDA 5JADA 1SXJB 2W6JA 1RT1A 5TR9A 2HJVA 3AZQA 3RLIA 2PWAA 3RUDA 2II6A 3MA0A 2NUHA 2J41A 2FRDC 2R86A 1QY7A 1CXZA 1J2UA 3HYCA 1Y9OA 4RU1A 1V9SA 2NU6A 2B43A 2AZ4A 3G68A 4JU9A 1WXQA 2XKKA 2HNDB 3IEMA 5FCDA 4GOXA 1FE8A 4XWAA 4FK8A 2PKQP 3DEFA 1QTIA 4W7HA 4ENQA 2V94A 1EX6A 1X9WA 2VATA 1YIAA 1IVNA 3GQCA 4EYGA 2VOPA 2QLBA 2NQ8A 4NLRA 5SY6A 2DRDA 1BS9A 1FP6A 4RELA 2EFEB 2G83A 3HFGA 4Y1EA 3QRQA 1MEJA 3NKVA 4Z7OB 2J5RA 4MVJE 3QEBZ 3KZCA 3QVSA 3H9EO 2ZE6A 3IEPA 2VBXA 3O2QB 4JT4A 1B0UA 3D8NA 1OWOA 3NH9A 2QR5A 2IH4A 3OR1B 1LLFA 3C5EA 4YFUA 2Q1SA 3O83A 1TVCA 3ZV5A 4QNNA 5D6OA 3RADC 1TW3A 1QOQB 2HHHB 1XZHA 1NVVR 3HB4X 3JCZA 3RABA 3EUFA 1HNIB 1EK1A 2O8DB 1A5ZA 2JFUA 3O8LA 1C8VB 2OD2A 1P2TA 3B78A 1BMQA 3OOJA 4JOCA 1G291 4MUKA 3PWTA 2WWFA 3DOJA 2XNKA 1BCSA 1DEXA 1HORA 5JOQA 2QPAA 2OBFA 1TUGB 5TDHA 2VDMB 1QTNB 2LDXA 5B0DA 1AKWA 4LR8A 2CQIA 2O2IA 2GCEA 2DLNA 2HHHF 1KZ7B 2AOUA 3PRVA 2VPQA 4TV9B 4IOLA 4NCGA 2Y0PA 1QGAA 1TKXB 4CP5A 3JSXA 1IM6A 2ZSHA 3DEHA 1JEEA 4FCWA 4NLUA 5CT6A 4Q4JA 4C3LA 2NXJA 2E0IA 1PAUB 3H20A 5IEBA 3FEZA 4UMVA 4A5OA 4J3FA 1VJGA 5JMPA 4AL7A 3DHWC 2EJBA 3AA9A 4DLZA 1NM5A 4LZNA 3D6FA 2VDLB 4N0PA 2WINI 5IN4A 1VYVA 3KSZO 1S3SA 1RKJA 5C5JA 1WD5A 4PS0A 2XCTB 1M2GA 5ESXA 4DSFA 4MUHA 4RACA 1AMOA 4DLGA 3PR1A 4KIWA 4MTCA 2IH5A 4DDVA 1RWUA 1OBCA 1W0KD 3KC2A 4JV0A 2VHYA 2PSJA 1F6WA 3T3PB 2X13A 5I7VA 3LT5A 4CZ2A 4LY6A 1UCFA 1IVZA 5EE1A 2AJ2A 2I6TA 1CJMA 3NT2A 3RANA 7MHTA 2AS0A 2V7QD 4P82A 5KWSA 2RUGA 2RK3A 3EZXA 4XVRA 1RE0A 2VQSA 1LVUA 3H59A 3S27A 5IXSA 5JAPA 1AA6A 4MTPA 2HIHA 3TSOA 4XLTA 3BGIA 5LQAA 2BE9A 4X64F 1Z08A 4Z7CA 1IQRA 4EG5A 3QPVA 3KQUA 3JYTA 4WASA 1SWWA 1QXSA 4O0NA 3BWXA 1A97A 1P7VA 2E82A 2RU9A 1XEXB 4DLBA 3SLRA 5FTMA 4B6EA 2LLZA 1NRJB 4KO8A 5HK8A 4WESA 4A48A 4TYYA 4JI8B 4F9FA 4D5EA 5JIBA 3QYFA 4XGIA 4EHLA 2BA9A 4LIRA 4EY5A 3RT7A 3ZGNA 3UMGA 1HMPA 1Z74A 3N39C 4GD3Q 2Z43A 1PFWA 3TN7A 5CJPA 4DVGA 2JS7A 2FKNA 1F14A 2HTEA 1M2JA 2J6HA 2PH7A 3EXHA 3UB3A 1SJ1A 3NVAA 1FSSA 1O51A 6PFKA 5KTYA 1RU1A 2MTLA 4NXMF 4RZRA 2JX2A 3KOUA 4ZVRA 1DO8A 1VRUA 4NLSA 1UMKA 4I6EA 4IJVA 2FZKA 2FZWA 2W8KA 4U2GA 1LPPA 2CHFA 4FMPA 1HM5A 4ZAZA 5JZMA 4OKNA 4H7KA 4FYYB 1QVWA 4E6EA 4EG0A 3NBPB 3M5CA 1UBTS 1RC0A 3UJ9A 3VR6H 4XR9A 4R9UC 4A0HA 3VWSA 4GBGA 2RSLA 1ZD2P 4R9RA 1E66A 2ACKA 3UF0A 2VPIA 1KDPA 4QTZA 4OZLA 2EL9A 4RH0A 3SEQA 2VASA 3MM9B 2RBEA 4Y6PA 1V43A 1LUAA 4XRRA 5EKXA 1DRUA 3KSRA 4DZDA 5HBRA 4CKWB 1BH2A 5AXLA 3UY4A 4AJ2A 4RSMA 2NX2A 3K30A 4RDXA 2EC5A 5K0ZA 1RZUA 4LRYA 3VOSA 5M2UA 2OGUA 5KDDA 1PZNA 3I4PA 2Z2YA 4EELA 3EY4A 4TYNA 2FPGA 4DFJA 3H3JA 1U9ZA 1S1TA 4LJLA 2NZUG 3CZAA 2AG6A 2IZ0A 4RNCA 1PR4A 5C53B 1JJVA 1PYDA 3HVKA 1S72S 1MLAA 4X4SA 2ZH1A 2XTNA 1VQ5S 3PEJA 4LJYA 2UXDJ 3ZJ4A 4NYZA 4CO2A 2W2MA 1PV1A 5AUQA 4J1NA 1P8AA 4BCDA 4K26A 1ML3A 2BKLA 3MBKA 5HE9A 1KTVA 2PT0A 1H0SA 2IDZA 2C9BA 2LRHA 2J87A 1WKJA 1F7UA 3IGFA 4USMA 4W6QA 4FFRA 3U39A 1H5QA 1C81A 1PUJA 2Z4TA 2OV2A 4JI3J 1RT4A 3MMNA 3TG2A 4FGKA 3AQIA 2VUHB 2PI5A 4RUCA 1JDTA 1W85A 1S6OA 1NIJA 3FYHA 2PGCA 4ZPXA 1S0OA 4RY8A 2ZJ2A 1ICIA 4BMZA 4ZO9A 1WBBA 3L77A 3OIDA 1S2NA 3HN2A 5I8PA 3PXGa 1TM5E 3KSUA 1PHPA 1K08A 3BKUA 1NAIA 4X84A 1H2RS 3CZ5A 3FK4A 2X0KA 2DHEA 1R18A 1CULB 3BK2A 1ZAWA 2ATLA 2E9RX 1HDEA 3KD3A 4FNIA 2G9QA 3BHIA 5CNIA 2FPUA 1PX0A 3HN7A 2SICE 1H4QA 3RB6A 4H0FA 3IIIA 3BGLA 4JWTA 4YY3B 2R7RA 4RL1A 4PR6A 1KF0A 1P8GA 3T5LA 1CDOA 2EFYA 1V5IB 1LD3A 5FWYA 2XZWA 3AEKB 4CMGA 3GG9A 1CJSA 2DT5A 3C85A 5BV8A 5KYXB 4ELVA 5ISMA 4NEHB 1QO0A 2PGNA 2A9JA 2WU3A 1NY5A 3PC8C 3M4JA 3ILIA 1L7XA 3CW8X 4Y2AA 4B6GA 1ZCFA 4WAUA 5EKTA 3Q3EA 1U5BB 4YI5A 4LSMA 3WJAA 3RC7A 3UMSA 3CRNA 3USES 4TWAA 2NIPA 4D26A 3K2QA 3FPEA 2QU7A 3E9QA 2H48A 3LPAA 1TZ0A 2Y1OA 3WAGA 1CF4A 3AOBA 1B1CA 1I4WA 3VU3A 3GWGA 4Q12A 3QKSA 2N42A 3E51A 1BGXT 2MZQA 2DVIA 4G41A 1MOSA 3K0CA 1SVLA 2DH5A 4TSRA 3U3OA 1KVKA 3LYAA 3R2CJ 4Q2MA 2HU5A 1KZ6A 3U7QA 1X7HA 1U3FA 2VYNA 3GEDA 4X92A 2CKDA 4OY3A 3T3IA 3K7EA 5D3MB 1HE8B 3GCDA 4IIXA 1T43A 1GL3A 1DEOA 4D9EA 5LUBA 1DOHA 3H9BA 1O96B 1I5OB 5CVUA 2DH6A 4PHCA 3WLOA 4C7MA 4HAOA 3AXSA 5G0UA 1T8EA 1P2BA 3OXLA 2D1SA 1I32A 4GSYA 1WUIS 3UIEA 2HZAA 2OHHA 3IS9B 3RSQA 2UUPA 1GRCA 2ZQZA 3TEJA 4QXQA 2YNHB 2QQGA 1OI3A 3GH1A 4AWBA 4CLYA 1OLXB 3QFWA 3Q2SC 1TLFA 2JPDA 2OK8A 4CCYB 2ZH4A 2JKYA 1XEWX 1Z12A 2FVSA 2PX8A 2C9DA 5EGNA 4ZDJA 3EVFA 4IMPA 3TZBA 3DQPA 3IV9A 1N2IA 1KQGA 1ZNWA 2PS1A 1REQA 2M1XA 1SC3B 2DETA 3CNOA 1V3SA 3CGIA 2IDJA 4MKZA 1NZAA 4X71A 4GI2A 1YDGA 3UZUA 1JQ3A 2R8YA 4DM4A 3D4LA 4R4JA 3H5XA 4MW9A 3OZIA 1SZDA 3VKGA 3ZEAA 3W5SA 1URRA 3H4BA 4HMPA 4BHTA 3TBHA 2DBYA 4LZWA 1T2VA 2CLIB 2OGWA 4GFDA 3TLBA 1XMIA 1KD1T 2EYUA 2HMWA 4WOKA 4QU7A 4LDNA 4ARZA 2GO8A 3B12A 4GL2A 5IV4A 5BVGA 1E1MA 3B2EA 3PX2A 1ZM7A 3SCZA 3O3LA 3D3BJ 1ZRNA 1QC5B 4ZVEA 2CFSA 1JZSA 3TR6A 4PE5B 4E2WA 2ZYRA 1VI7A 3J7AN 2ZWPA 1BKSB 3WIDA 1G4HA 1PJBA 3U1MA 1QKIA 1HL3A 1WZNA 2H54A 1FVQA 5TMEA 4N6NA 1NK9A 3DV9A 5ALWA 2RI1A 2EP8A 5E4JA 4P8RA 2ZUEA 3LUHA 1LDGA 1Z6XA 5DX8A 5LZ2A 1VKRA 2YRXA 1P17A 1BDJA 4URYR 1AKRA 1L7BA 1QH8B 5JU6A 5JAHA 3G9ZA 3H1GA 2VPXB 4MUNA 5CXSA 2VHCA 1YBVA 2CVFA 2V74B 3FOWA 2GCPA 4IH6A 4NXMB 4PWWA 3UTDA 1JLMA 1OBVA 4Z4CA 2V7GA 1FNMA 3LKDA 1ESNA 3OQIA 1F6TA 4FF1A 2ZTMA 1EZ4A 1Q7CA 1O6CA 2HMIB 5A5EA 1TJ5A 2OHXA 3WKDA 1FEZA 1AK9A 3IL2A 2BR4A 2H2GA 3QELB 3BXGA 5DPMA 2F6RA 5AVWA 1JFRA 1YTYA 1VI6A 3T5KA 1A4XA 1SEPA 2C8JA 5LMNF 4HNGA 2BEJA 2YKNA 1B14A 4CKCA 2IKSA 4LF6F 1QANA 3A9UA 4IL5A 1H5NA 4IZ6A 2QMYA 4U5QA 4ED9A 4GNRA 5C7PA 3BORA 1XNJA 1JN0A 1CX9B 3T12A 3KK3A 4F86A 2JHFA 3D6UA 3T3EA 4XAKA 4PZEA 3TRJA 1UPCA 3T5PA 4RAQA 4KOEC 5KKCA 3RS9A 2UP1A 2NXUA 4BNVA 4NK4A 3QT5A 3EG9B 3N2GB 1GGMA 1J22A 4JB2A 2WG0A 3CF4G 4OLOA 3AVOA 1UXHA 4KB7A 3GX1A 2CQ3A 1JIVA 2ZSIA 3BXFA 1S9EA 1KYIA 3FWPA 5BOSA 3TOQA 4K88A 2QBYA 4B3TJ 4H4MB 3MGJA 1FLNA 1VLHA 1EVKA 4BVJA 2XAAA 1R10A 4PWZA 4GP6A 4Q02A 1P5ZB 4Q1EA 1LWCA 2HAFA 4Q05A 4HAVA 4B9TA 1F2UB 1Q16B 1RVV1 3TTTA 2A30A 1G3IA 3KU4A 4B7ZA 4DCOB 1VL8A 3JTMA 3QFSA 1U26A 1N34J 2BI4A 2VK1A 2OXRA 3GLJA 1JA0A 4OJYA 1WE2A 3OIGA 4Z51A 3ZTWA 3BK1A 3EGXB 4NXNB 2WUFA 2JFYA 3VNAA 3VKWA 2PGIA 3Q3GE 2RKIB 1OI7A 4LF9J 3K35A 4USHA 2CPFA 3TX8A 2OHOA 3K16A 2POQX 1YH3A 3LTOA 3WMFA 4II7A 1I2CA 3K72B 2H65A 1D09B 2WEKA 4GMDA 5E6UB 3EG5A 1XPJA 2DE0X 4YP3A 2IUFA 4JP2A 5C8YB 1PCAA 2C2YA 4BNZA 5IFLA 4OREX 1U1QA 2DKOA 4AL5A 3PQ7A 4QO8A 1Z2CA 3EGXA 1USVA 2J6IA 1T5HX 2QVYX 1MH1A 2O1EA 3VU8A 1MQSA 2BJDA 2YOGA 4PC1A 1T94A 2DT9A 2E5GA 2QGNA 2IP1A 1EFTA 2VBZA 2FPKA 2RQMA 2BSQA 3KKKA 2RF2B 4GX0A 5IXYA 1MOQA 3HC7A 5ALUA 4EYQA 5LB2A 1D4FA 1Q16A 5CHCB 1F1JA 3AD7C 1VHWA 1FRKA 2I67A 4BQIA 3EGWB 4MPJA 4GDFA 3EXCX 1CUYA 3KZNA 3A3NA 1C2TA 2MKIA 1X4AA 1AF7A 4H77A 3NGSA 1TQHA 2W8ZA 2GBIA 4DDMA 2XUKA 1KZ9A 2JFXA 4K2JA 1T9DA 4RWXA 4ZPAA 4DCTA 4JLOA 1CVRA 3V3KA 1SXJE 1RKIA 2OORC 2RD2A 1KO7A 5F9NA 5JFOA 2IJGX 3FRHA 4URWR 4FXOA 5ETKA 1FXUA 1WQ4A 3OH8A 1GEEA 4M54A 4EEZA 1T9KA 2FPIA 1RXIA 5CM9C 2IHJA 3GN2A 1F0PA 1U3DA 5FA6A 1L4KA 5K2OA 1RTKA 3I04M 1UWLA 4EFDA 2VHQA 4ZVQB 1NJ1A 1OLOA 2CHGA 2ZUDA 2ZM6B 2XYGA 1U2RA 4AQ7A 4LF6J 2XZDB 2QP9X 2NO4A 4YUWA 2R8HA 3ZU3A 4TS4A 2JI9A 3RRJA 4IINA 1VRWA 1UXOA 2CJAA 4TQGA 3R74A 4EECA 1QKJA 4GEKA 5T6BA 4UUXA 1B8UA 1JDJA 1EDZA 3OQIB 4AKHA 1FOEB 5LSAA 4GGOA 4GVPA 3SYLA 1NPYA 3GFRA 3KQNA 3K53A 1FUUA 3INRA 2FJXA 3G6XA 3EZ5A 1I8TA 5E3PA 2I7DA 3GMSA 1YULA 3RBXA 3W5IA 3QOXA 1B6RA 5DSZA 3LDUA 2BZSA 2AFIA 1E96A 3B6EA 5DHSA 2R5WA 2G25A 2CYYA 1TYCA 3VO1A 1Q3KA 3GVCA 1H6KX 1FFWB 2NU8A 5EY5B 5LSRA 2W2NA 1OFIA 3RS3A 3OZGA 2DJ5A 1E98A 3T1NA 3STYA 3N0XA 1KXJA 1OYVA 1GAEO 3VAKA 4IH1A 5H82A 5E6SA 3MXHP 1CJUC 5DBEX 2R6CA 4A8JA 4YRCA 3JARA 3QAEA 4MKIA 1OLSA 1B42A 1XA0A 4UZFA 4OQQA 1N1EA 1B3RA 3CCCA 4GM0A 4EF5A 4DZ6A 3QT8A 3VC7A 4FVTA 4DF8A 1M34B 4XQ0A 5DDOC 1O0CA 4F6RA 3V1YA 1RWBA 2QRUA 3HFKA 4M1SA 3RARA 5JCJD 3R6LB 1T2CA 1D4OA 2IA6A 5EN1A 1GGKA 5CA0B 1KSGA 3N07A 4ZVNA 3RFTA 2PUAA 3O3MB 2WIKA 3WICA 1KQGB 4YRZA 2KRRA 1QFSA 1TZ2A 4JYAJ 1GU1A 3W5VA 3R7NB 3HB9A 4LE2A 2QP3A 5BR7A 5LQCA 5JMNA 5JQWA 1RYFA 1WORA 3NNCA 1EP3B 1KGSA 1LBQA 4V2IA 3DNFA 4WY8A 3RWOA 1J9ZA 1OT5A 2DHAA 4HQRA 3RK4A 2VD3A 3WGTA 5B09A 4ND8A 1KH2A 1M8PA 4FHGA 2OCPA 1QF9A 3I0RB 3RIGA 1VCMA 3T7KA 3K8WA 1PK9A 4Z2YA 1ZRHA 2EW1A 2JVKA 3LWDA 4LSNA 1ZJWA 3MECB 3U44A 2CNLB 1NPPA 1J23A 1RCXB 1XOIA 2P91A 2J3DA 3BDVA 1SOAA 2W8BA 3F9IA 4HT7A 3OTIA 2ZSKA 2FW8A 1LQTA 1FPMA 3FPKA 3KCNA 1RWOA 1ZHFA 4WKOA 1N5RA 5FV4A 3GUHA 3OJWA 4HHEA 2B0JA 1RKVA 2Q2VA 2R60A 2J09A 3I3SR 3OOYA 3PC6A 1H6DA 4I4TA 3QU9A 5KNCA 2Z4PA 1FP4A 1D1UA 3N28A 2PXHA 3OUYB 3RUCA 4IEFB 3KBOA 5DLDA 1RYNA 4EJMA 4LF5F 4ED6A 1NKSA 3HBMA 5HRCA 3ICOA 5BQXA 1N52B 3OT4A 2ZUVA 3RAXA 4RVCA 1B16A 4A0SA 1M5PC 2KVIA 4TKTA 3ZXIA 1COZA 1QJCA 1N36F 2VDIA 1V8OA 1KMHA 4EY4A 1J07A 2EXXA 4DR7F 2D9PA 1GFWB 4ANCA 3KUGA 4OJNA 3WJ7A 3BXOA 1MD9A 3E1KA 4YAKA 1VC6A 2Z9DA 1ZR4A 4KC5A 3PW7A 3GCZA 4PVCA 4B7XA 4FR2A 3JAKB 4MDEA 2LECA 4G0WA 1YJRA 3I6IA 4KO0A 3K0CC 3PSAA 4C87A 4I5EA 3AYZB 3MLBA 3GR0A 3IDOA 1KRPA 2OD4A 5HJYA 1JMYA 4F2GA 1KBRA 1RVDA 3H8SA 2J0QA 4FS1A 3X3HA 1XR5A 3WADA 3A1EA 3VX3A 3G0DA 3POTA 3LUBA 2PSFA 4IBOA 1C1DB 3I76A 1RWNA 3QKRB 3MPWA 1JBEA 2EG5A 4NH0A 1HGXA 5DSTA 4JHXA 1W25A 4RHYA 5AW2A 2AEEA 2PO5A 3AB8A 1G8SA 2OVBA 4WFYA 4XB2A 3KMSA 2MINB 3T38A 2P2SA 2FG6C 3JQPA 2BY4A 2UYOA 3U17A 4DUZJ 3K5LA 1L5SA 2CXXA 5L7TA 5I42A 4EDHA 2WSMA 1PR2A 4NF2A 3W65A 4WZAE 1W85B 5DM4A 2BJ3A 3ZCPA 4FOSA 3PICA 4O4GA 3GI1A 3BGDA 2NT4A 1ZH0A 3T34A 4XTCS 2VH5R 1V16B 3N86A 4YR2A 2UU9F 2X77A 3CA8A 4L50A 4WEQA 4YCJA 2DQZA 5HJXA 3PDUA 5I5GA 3CDBA 1BD6A 5JSZA 1LSJA 3DVRX 1UXJA 4J91A 2PZEA 4MR8A 5HWSA 3OOHA 1QGUA 1A9XA 1WP9A 4P0PB 2IFTA 5HVHA 4EA9A 2QI9C 3OJSA 3RRGA 3TSZA 4YASA 2QA1A 5JJIA 4V38A 1Q2XA 4URSA 4FNAA 3T3OA 4HF7A 5KFRA 1X5TA 3IULA 1KO8A 1GNKA 1RTDB 4JI6J 4PTZA 3W0LB 1TL7B 5D0GA 3BL5A 3LQFA 5FTNA 3D3QA 4DYDA 3AKDA 4GO1A 5GAHI 1WAMA 4OLBA 1NVFA 1ZNYA 2GTIA 3DE1X 2AQ8A 3MOSA 1EHCA 2DFDA 4KP7A 3KD2A 1MJGM 2E5HA 4JI8J 1ES9A 1KO5A 3LLSA 2P27A 1MB2A 3NM4A 1P0MA 2X58A 1ZUWA 3AF0A 4CN8A 1CS4C 1SRQA 1XRSB 1N36J 5KFQA 1WG1A 4XPEA 4ER5A 2BONA 2RARA 1U99A 1G4CA 2PR7A 1P1BA 1WHSA 2JG3A 4AJ9A 1QZZA 5C42B 5C1OA 2KBFA 5KWVA 1N2CE 3QIDA 5BW6B 5D1NA 4EG8A 3WGHA 2X51A 2BMDA 4L51A 5HF9A 4M9RA 1BHJA 3C74A 1N5OX 5MGBA 4USVA 3U4AA 5AW7A 3U60B 4WECA 4DQPA 4Y9SA 1UPUA 2F62A 3RAGA 3ENWA 4ZVGA 1XAJA 3GCXP 4ANDA 2V6BA 3GJQB 1F8YA 1U1FA 2IY7A 2YHIB 1W6RA 3CUEF 4D6PA 1S3FA 2B20A 5I7HA 1P9RA 1Y3KA 1E0JA 1Q0TA 5EUCA 3HSDA 2XY6A 3VU0A 2D3ZA 2C03A 4IIDA 4XX1A 5IT5A 4F4ZA 1WM1A 2C9OA 3E7WA 1C8LA 3CKKA 1RHQA 3Q8PB 2V97A 3EDOA 4OQLA 4OCZA 2DHQA 2C00A 4R2LA 3L7BA 2OE2A 2NUTB 3UWTA 4EO7A 4AN0A 4YECA 5F78A 4GR5A 4LX0A 2P79A 2IXTA 1SBRA 1U6IA 4BP1A 2YUTA 4BZXA 2O3RA 4GNKA 3F71A 4D9HA 1JA9A 3GLQA 3IQXA 4KC0A 1GPDG 3EULA 1F0NA 1M5TA 4EF6A 3E9CA 2WPDA 1N5VA 3DRSA 5CD9A 1O8CA 1KLMA 1VHDA 1RHRB 4LY0A 3TLXA 5P21A 1WVIA 4YRAA 3EAGA 4QBFA 1DWQA 1X4BA 4OGKA 1UKZA 3IUMA 4OYLA 3HBNA 1UP1A 4A1OA 1BG6A 1EX8A 2B1QA 1AROP 3T5JA 1YJNS 3TW0A 4LQ3A 3PGKA 3P2JA 2F1FA 4WFQA 5KMGB 2VUSA 2V03A 2WAQD 3TX6A 3KRTA 1VQPS 5SZTA 4JBHA 2V4ZA 5T3UA 4ZOAA 3FUWA 2M2BA 1IKWB 4R0NA 1HSOA 1Z82A 1VIYA 2GIRA 4H1HA 1PSZA 3BG5A 4L16A 5IKMA 3AT1A 2R2UA 1QFYA 2R66A 2XRFA 5ER6A 1GNTA 2KVQE 2F55A 1VE7A 1LXCA 1ADBA 4F2HA 1RHJA 4IICA 2C2DA 2QG6A 4OQMA 2Q9CA 1U90A 4OJTA 3IT1A 4BFZA 4CMIB 1U1GA 2LCFA 4Q4JB 2N4DA 1RJWA 2PH5A 5CNKA 4Q39A 4PAOA 1NHKL 4BLRA 1BXZA 3IBYA 2G71A 2MTBA 2IJRA 3H87A 2IYOA 2ASLA 3F6SA 4JYCA 1YZUA 3C3LA 3W90A 5FBVB 4XIJA 2XMTA 5EHNA 3IEKA 3WYGA 3AUJB 5DBHX 2BD0A 4PBTA 1SJQA 1PTKA 1JFTA 2DR5A 5B7PA 1TE2A 5G2OA 3KKNA 3FPAA 2XXAB 3VYWA 3ZGZA 2V4UA 5FAXA 2HEGA 3QGPA 2ZYIA 5KJ6A 4DZZA 2DWOA 1AXRA 5DM70 1FO1A 2O2DA 1BVYF 2PLAA 2XEXA 2J6UA 1CS0B 1B4SA 3UTCA 3T5AA 1EJ0A 1P3JA 2CGEA 1WU8A 1Q7BA 3NTXA 1T8WA 3NZEA 3MWEB 4KGXB 2PD3A 3D0GE 2L2QA 1UK9A 4JELA 1KIFA 3T1YB 4JYZA 3A3OA 3HL4A 5GM1A 2DAPA 3QU7A 3PNSA 3HO6A 4Q18A 1UOPA 2HCFA 2OO5A 2BR5A 2W6IA 1SU6A 3NRBA 2MY7A 2ARKA 1GAXA 4JI6B 3AJEA 1IOZA 1AUVA 4QSHA 2IV2X 2R85A 1BC5A 2PV0A 1MP0A 4Z3DA 1T03A 1NY6A 1M0EA 3TJ9A 4EZ6A 2XHZA 4A1FA 4BZPA 5AESA 3CCQS 1M74A 4INJA 1XL1A 2I1QA 1HNVA 4FYVA 2Z1MA 3HZZA 1GFZA 3KLMX 3DKDA 2LCQA 2WWWA 1SXJC 4ZPBA 1I36A 4DUZF 2C2MA 2I71A 3R09A 2X4DA 5C32A 5LT5A 3ZJ5A 2VKRA 5CFOA 4MAMA 4PICA 4ZYXA 5B5SA 3C6TA 3KPWA 3MI7X 1M5SA 3B9RA 4GGPA 4ANFA 4N6GA 4LMAA 2BISA 1N9ZA 2YKGA 3R23A 3LANA 2DCLA 3GFOA 2UU9J 4EGJA 1DE0A 3MHPA 5T7LA 5C5IA 5FTKA 1R88A 1ZIXA 3O03A 3CFYA 1QPZA 4JVSB 1E6YA 3BIWA 2MZTA 3LO3A 2GNOA 3PKIA 3NTRA 3RYCA 2KXFA 2C20A 3FSXA 6FDRA 3T4EA 1QQ7A 3KXKA 4ZHQB 4S0MA 3HR7A 2GUWA 1PL8A 1VPEA 2XJ4A 3O44A 3GJRB 1AV6A 5GVRA 4YP7A 4JU8A 2CK3A 1E1NA 1GPNA 4K8RA 1Q0SA 3I31A 4ROSA 2X0NA 2I3DA 3MR5A 3CW9A 4D4IA 3P20A 4MB0A 1LPOA 1E1CA 2O3SA 1UCNA 2FGKA 3B2NA 3MRVA 4JC0A 2ORVA 4QWMA 1G1AA 3FR7A 2HPVA 1OS5A 5JCOC 5GVQA 3WYNA 4HVZA 1D2HA 3T3NA 3WTCA 4PYLA 1SUBA 2BFEB 5KFOA 4ECSA 1ZQ9A 2AQIA 5FF9A 2ZCVA 3MR7A 3F5FA 5GPBA 2WVDA 3D6TB 3TQ1A 1UBSB 2ONJA 2PKEA 1OY6A 2EZ4A 4D8YA 3SN6A 4XARA 1FYDA 4H3VA 3T9BA 3TMKA 2QUIA 4HATA 1IHXA 1O97D 3T1OA 2QM8A 4MIEA 5DGIA 1U9IA 2DGWA 3T9ZA 2ZB2A 3T1HB 5BQ5A 5JWOA 3DOCA 2CMKA 2JGKA 3VR4H 3R41A 1NQXA 3DYAB 4I3FA 3PC4A 1K8ZB 1IN6A 3NTLA 1P0PA 2UXCB 1DQSA 2G5TA 2P75A 4ZT3A 1TELA 2RDMA 2I9PA 1HYQA 4C8ZA 2ZHOA 4DR7J 2Q3CA 4BFTA 3WXMA 3QIAA 2OELA 3UK0A 5LQRA 3TVTA 1CJBA 1SC3A 1R4ZA 1YL5A 3DE0X 4F67A 4CDIA 2YKQA 2WZDA 1L5FA 3KDPA 4JH0A 3EGIA 3EPJA 1JPNA 4YRTA 3VTKA 4HADA 2A2DA 4I66A 3LPMA 4CIOA 4Z2AA 3JQCA 1D8ZA 1BHSA 1E3LA 4UM5A 1S7IA 1F0YA 3RROA 2WFMA 3P9YA 1CUAA 4YCAA 3BJZA 4LJ7A 4QGAA 1EAYA 3CLRD 2VXCA 4OU5A 4N03A 2JFBA 3FCAA 1K5HA 1U0HC 4ZVMA 4B4KA 1U49A 4M8IA 1C1DA 1GLNA 1NYLA 4YXWD 3ZH9B 3CEDA 1D0EA 2R6AA 1FYFA 1BN6A 3PJXA 3BHNA 2ZR9A 4RHUA 4TSFA 1QV7A 2FSSA 3UAGA 4OK6A 4MWOA 1K6MA 3DRSB 1R31A 1T9BA 4J0DA 1A4UA 1V26A 1SURA 4E70A 2QEQA 2WK1A 4QYZJ 2PJDA 2X0RA 1WO8A 2PLRA 2BFFB 5KQPA 1ZWLA 1RB0A 4YO7A 2G5CA 1GG8A 1LNZA 1Q0PA 1Q6YA 1ZUHA 4G1IA 4RD0A 3PUKA 3VM6A 1B41A 3KJHA 5CHEA 3T9DA 3CU5A 4HNUA 2GESA 3GARA 1YUBA 1TTQB 3EZYA 1W30A 4DRZA 1CE8A 1DXHA 1B3TA 3DV0B 5ECGC 3LC0A 1PZHA 2VLIA 1KVQA 2H2FA 4DLSA 4KWIA 3DC2A 1X0VA 1RQ0A 2BI8A 5DTJA 3B7PA 5THQA 3ES9A 3LUGA 3V46A 3HHLB 1YZNA 2B4KA 1DJLA 4A8SA 3BV8A 5B30A 3UA3A 1ZZEA 3ED5A 1JVNA 1LY1A 5B0CA 1PBNA 4HXFB 4AS1A 2QT7A 4HACB 3TW8A 3K6SB 2XX3A 3DYIA 2XIQA 3NXKA 3IBWA 2WVCA 3OFGA 3U3ZA 1JEQA 1C3JA 3MSCA 1EG2A 3VCDA 2ZBRA 3FGPA 2BC9A 5TJHA 2QRKA 3IIEA 4HWTA 1YHQS 2B6NA 3PYDA 3DYVA 4NLPA 2QMUA 2ZYTX 3H2GA 4X8LA 2WONB 1SKQA 2BM9A 3FMVA 2J9FB 1RAGA 1ZAXA 5C4MA 2OO3A 1JEJA 1ORHA 4R7GA 3I5UA 4OYIA 1TYEB 2DG2A 4HQKA 3OSNA 1P75A 3H99A 1TL3A 1E6KA 2DH9A 2PTGA 4AE5A 2ZYHA 5L4LA 4KI0A 3NWJA 4GF5A 3DBHB 3EASA 2NVBA 4WACA 1X4FA 1PFGA 4E5PA 2F4NA 3HY3A 1Z73A 2DHHA 1PR1A 3MFIA 2NXCA 3ANSA 1ZCBA 1D9DA 4GOOD 2Y6VA 4Z8YA 2FEWB 4HS9A 1MG7A 4L3NA 1FNDA 5CITA 5DLGA 1GTEA 5JD3A 2R1ZA 4NDNE 4IUDS 3D1LA 3FB1A 5D77A 4PLFA 1ZOOA 4ED5A 4WXRA 3F9CA 2O3JA 1NE2A 1BHQ1 2VAXA 2X5KO 1Z4NA 2L42A 1BE8A 2RAUA 2HK3A 3OLCX 4NYJQ 3RUEA 3ORSA 2P0YA 3JQ8A 5JQGA 3LCRA 1Q77A 2ZBIA 3KQLA 3AYXB 4PQGA 3SWWA 3EMTA 3AP2A 2DB3A 2KHZA 3DCAA 2GBGA 1IBLF 1RJEA 1U7ZA 2H5IA 3S01A 2DKNA 2DVMA 5BN3A 4UY85 4DQSA 3KU1A 1MC1A 1UAYA 2UZ1B 1KMIY 3T6BA 4TYQA 4LF5J 3QOFA 1SKAA 1GH8A 1HMYA 3EC2A 2V45A 4CQLB 3RS4A 3M1AA 3CH4B 2PA8D 4PPFA 3MELA 2FRXA 1GCOA 2H0QA 1JKIA 5JZVA 1RTTA 1DX4A 4OB8A 3GIRA 3HY6A 5JALA 3PUIA 3DVQX 5EWMA 3VSDA 4KO0B 2Y1IA 1S3IA 4JLKA 4AMYA 1KO1A 1E6YB 5DW0A 5AHXA 3VH3A 1XG5A 2BMJA 4TMTA 2O50A 1Q95A 3K0SA 4NLDA 4Z6KA 5DM0A 4KKXB 5AKEA 1SUEA 1WF1A 2JASA 3QKTA 1VJ0A 1J56A 3JW8A 3FEXB 4V0OA 3IR5A 2GEDA 1F8FA 1SKMA 4JYAB 2XUDA 3UDCA 4BNIA 2A0UA 4WBSA 3W4KA 3ELDA 5J1TB 2C94A 3M2RB 3IO3A 2R62A 3EZUA 1AFIA 3HNPA 2I3GA 3QU5A 3WYBA 2E4YA 1XDDA 2C2MB 5JUMA 4EGSA 4H4KC 3LIPA 3NNAA 2WJJA 1PI3A 3C3KA 3CPEA 3L8MA 5DBIA 4LZPA 4GRAA 3KFLA 3EVTA 2ZT6A 3O8WA 1KR5A 1EXVA 1OR8A 1WZUA 3EXEB 4BJ3A 2CNLA 2BANB 1YR7A 1Z6PA 3PW5A 2DPJA 1WOYA 4ZQCB 3F3KA 3K5MA 2YFHA 1E20A 3I0RA 1FWPA 1ZA2B 1MBZA 3F5DA 4PPQA 4RX1A 2X86A 2YYYA 4O5OA 1QH9A 1ABEA 1PN3A 1T9YA 2O14A 3LOPA 5BYKA 1X9HA 4B9MA 5L7WA 1UC9A 2X4IA 2ASVA 4FI3F 3I9MA 5EQJB 3M8RA 3I9JA 2I76A 2VF2A 3EFBA 4LPSA 5CT4A 2QU8A 2CJXB 3JAMU 1QUVA 3GFTA 1RT3A 3BRSA 5H16A 2JA2A 3AR5A 2VDVE 2UVPA 3OUZA 1UKEA 1WBJB 4Z7QB 5ELLA 1RI4A 3VJKA 5E3QA 3ESCA 4NE9A 4LYHA 1NQOA 1JXVA 2XCIA 5EXEA 2Y1LB 3CZCA 3RTAA 5IBPA 3BQ1A 4HX2A 3MERA 4DGSA 3ZNJ1 4D0SA 1I30A 4LIWA 1ZBDA 5I7RA 8MHTA 2P5UA 2JBAB 4XYMA 2W4DA 3K4PA 2ERYA 1BWSA 3GLGE 1ZEMA 1PO6A 5HCNA 4KRYA 3G8SA 1DBIA 2QK4A 2GSWA 4RIGA 3VO8A 4KKOA 3CG0A 4EENA 1JMTA 4BN0A 4H27A 1YK9A 1OFUX 3UFBA 4KIAA 4JWKA 4CLOB 1S2GA 1EZZA 3U61B 4W82A 1L3TA 1A77A 4NXMJ 4AG3A 3FFIA 5F41A 5FOTA 4RVUA 3EG9A 2CXEA 5IZHA 1EDBA 4MRSA 2VF8A 1U28A 5CGQB 1U2ZA 4NMWA 1YTUA 1TO2E 5F2EA 1RDFA 3KAPA 4RTPA 4QPJC 1XEXA 3AF4A 4FYKA 4U3JA 2D62A 2B37A 2YXPX 2YASA 1ODLA 3VR4D 2YKNB 5A4MS 4HG2A 3NBMA 3GSDA 1RCUA 1X4HA 2OZVA 4BIIA 1NK8A 3KZKA 1Q1EA 2M1ZA 1WEYA 4YB6A 1RSCA 1OYWA 1HL6A 1VL2A 9ABPA 4JOBA 4JI5B 2F48A 4V0ME 2GZHA 1YITS 5FNVF 5CZVA 3CN7A 1Q1ZA 5EUQB 3NHJA 2V7QA 2OUIA 1UWBA 4MRRA 4ZAFA 2AT1B 4HDQB 4OI4A 4Z1MA 3W77A 3A4MA 1XRJA 3U7IA 1T5BA 4KR2A 2QW1A 3DA8A 3SKVA 5AICA 5DEOA 5A3QA 4QYZK 1GNSA 1AUXA 5EPEA 1UKAA 4OYBA 2JAUA 2E49A 3MJTA 3RM3A 3ZNOA 3A58B 3BAFA 3PQCA 1M1NB 3GU0A 1F2HA 5DHRA 1FY2A 3ABRB 3DVAA 2N7YA 3ROPA 2NW6A 5KYWB 3SX2A 4ZV9A 4F06A 3O3OB 1ECPA 3T9CA 4GKJJ 1C0PA 2IQ5A 4EUFA 5FBHA 5DP1A 3QENA 3AUKA 1ECBA 4MUYA 4NDAA 2BACA 2IIQA 1TI7A 4PN7A 2QRMA 3C16B 3QF4A 5ILQA 4D8UA 3VPFA 1NATA 4AKEA 4NE9C 2YW9A 2CCGA 4DLVA 4NEZA 2JDJA 1KAHA 3GROA 1WXGA 1NAHA 3BGFA 1OYDA 4F36A 3LNCA 2QWXA 3SFGA 3P52A 1KHTA 4NCHA 1XMXA 4QTXA 3BWVA 2WJZB 1TKXA 3OFFA 3LP0A 1QYVA 3KHHA 1TPZA 3HVWA 2CXPA 1TA4A 3OPYA 1DKNA 2VFUA 5G3ZA 4MQFA 1XA3A 2DR9A 1TQDA 3QH4A 3TLZA 2PA3A 1EB9A 3ZOZA 2HHHJ 3QXJA 4BNFA 2ZBVA 1H94A 4CV3A 3HFVA 3J7Z5 3AB3A 4RZ3A 1T0UA 4MJ7A 2VF4X 5JNVA 3OTOB 4AUNA 3GLHE 1FDSA 2E5JA 2B7BA 2JJ1D 1W5BA 1SB6A 4ZVPA 3BE5A 2IE8A 5IK2D 4Q9KA 2FG5A 4EY3A 2UZAA 5JWHA 4EKYA 1BEZA 3C1UA 5CM8B 2R7VA 1IAVA 4IEEA 4XCVA 2MSDB 1A96A 1FEEA 3P9KA 4KLZA 1QSSA 3REOA 1QHGA 2RKIA 4DSOA 1PUIA 5CDYA 1GVHA 1H2HA 1WVGA