3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
b'NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tk-subtilisin
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
2W2OA 2Z2YA 1PFGA 2Z57A 2Z30B 3PTLA 3DVRX 1Y1KE 1SUPA 3P5BP 3I2YX 1AK9A 1SBNE 3A3NA 1SVNA 3H42B 4MZDA 1Y3BE 1C9NA 1Y48E 3LPDA 4NE9A 2Z56B 1KDYA 1GA4A 1V6CA 1TO1E 1SELA 5JXIA 3A3OA 1GNVA 2Z2ZA 3EIFA 2GKOA 1SCAA 1GTJ1 1OYVA 2SNIE 2PRKA 1CSEE 1P7VA 2TECE 4B5LA 2E1PA 1SCBA 1BE8A 3A3PA 2X8JA 2XRMA 4NMXA 4KB5A 4H6WA 5AVKA 3CNQS 1Y3CE 1TM7E 1TM5E 1C9MA 5AQEA 2W2MA 3VSBA 1SUDA 2SBTA 4H6XA 4OMDA 1SCNE 1ST2A 2P4EA 1SBHA 2PYZA 3DE5X 3Q5GA 1OYOA 1NDQA 2W2QP 1EA7A 1KE1A 4C3UA 3T41A 1TK2A 2XTJA 3WQBA 2W2PA 4DWWA 4YN3B 3TI7A 2IXTA 3AFGA 1C9JA 1TM4E 2ZRQA 1GTG1 1R0RE 1S01A 3PRKE 5FBZA 1SPBP 2Z58A 1AF4A 3I30X 2WWTA 3DDZX 2W2NP 2DUJA 1TO2E 5JXJA 3A3PB 1VSBA 3L1KA 1KE2A 1T1EA 5K7SA 4NMXB 2W2OP 3GCWA 1GA1A 3Q40A 3D9QX 2G4VA 1C3LA 1BJRE 3HJRA 1OT5A 4M1ZA 1SCJB 2HD4A 3BPSA 1SUCA 1SIBE 2ID4A 1YJBA 4DJ5X 1HT3A 5JMOA 4AKTA 4HVLA 1V5IB 5FAXA 1ZVKA 3F49S 1GCIA 4C3VA 2WUWE 3VV2B 1YJCA 3GT3A 2IY9A 3P5BA 1DBIA 1PTKA 5FFNA 1NDUA 3SQOA 1MPTA 3DE1X 1T1GA 4Z2AA 1SUAA 2HPZA 1YU6A 2QTWB 1SN7A 3SICE 3BX1A 2V8BA 2ZWPA 3WIUA 1AV7A 3VYVA 5B1EA 2Z2YB 3LPAA 2W2MP 4H6VA 4BWGA 4OV6A 4OMCA 4I0WB 2Z57B 5ARDA 3DW3X 1Y4DE 1TECE 4J94A 3A3NB 1Y3FE 1NLUA 1S2NA 1ITPA 5ARBA 1THMA 4KG7A 1ST3A 2SICE 1BFKA 3DWEX 3CO0S 2XTJP 1BE6A 1PEKE 2W2PP 3WHIA 1DUIA 3A3OB 3CO0P 1AU9A 2ST1A 3H42A 3LXUX 1SPBS 4AKSA 4CFZA 2Z2XA 2Z56A 2SECE 3GCXA 4K8RA 1P8JA 1SBIA 3QMPA 5I9SA 3DE0X 1SUBA 2X8JB 1TMGE 5B1DA 1Q5PA 2DQKA 2PWBA 3GCWP 1ZVJA 1Y9ZA 1GA6A 3D43A 2WUVA 4OV6B 3DW1X 3LPCA 1SUEA 1SBCA 1WMFA 1AH2A 1YJAA 1MEEA 1EGQA 3DE7X 3DE6X 3TECE 1A2QA 1BFUA 5JXGA 3OSZA 1R6VA 1KDVA 3VTAA 3UNXA 1R64A 4KPGA 4WOCA 3TI9A 3BGOS 1WMEA 1KDZA 4ZOQI 5AMXA 1Y34E 1SCDA 3SQOP 2PWAA 3BGOP 4LVOA 3F7OA 5JXHA 4NE9C 1LW6E 2Z58B 4K8RB 4LVNA 1XF1A 2PQ2A 1GTL1 1TM3E 4YN3A 2ID8A 1PJ8A 3ZXYA 3DYBA 3DVSX 2PMWA 2DP4E 2WV7A 3EE6A 4DZTA 2ZWOA 3VHQA 3QTLA 1SIUA 4RYDA 3QFHA 1IAVA 1AQNA 4GI3A 4WOBA 1TM1E 1SCJA 3CNQP 2Z30A 4FONA 4NE7A 3I34X 1Y3DE 1UBNA 3I37X 3F7MA 4CG0A 5ARCA 1P7WA 1BH6A 1Y4AE 3DE4X 1SBTA 4HX2A 3GCXP 2W2QA 1V5IA 3AJ9A 1SIOA 1Y33E 1SH7A 3VV2A 1IC6A 1T1IA 1GNSA 2B6NA 3EDYA 3DE3X 3ZXXA 2PMWB 1S02A 3AJ8A 3DVQX 2PKCA 1WVMA 1CNMA 1WSDA 4CFYA 3WIVA 3BPSP 4JP8A 1AVTA 2W2NA 3GT4A 4ZARA 5SICE 3DE2X 2QTWA 3VV3A 5CW1A 1JEAA 1GT91 5AVJA 1WMDA
chains in the Genus database with same CATH superfamily
3G2JA 1JECA 5L46A 2YNFB 4G5RA 4BB6A 2PQ0A 2FJVA 1WPGA 3PXGA 1YR8A 2HXSA 5G1NA 4P72A 1LPNA 1I2DA 2H17A 2J0UA 3R0IA 4N01A 3WMEA 1SC1B 1E62A 4EO8A 2XHZA 1X8DA 1YUBA 3GWGA 4E11A 4YDDB 3S1TA 2EP7A 4AN0A 4RK5A 5B3LA 3UZUA 3LCMA 2YWDA 2H1RA 1BE8A 4MYSA 3W2IA 3REGA 3KPVA 1RKUA 2G83A 2ZDQA 2A88A 2MR6A 2DETA 1T6ZA 3HYNA 2V3VA 2A5YB 4USHA 4FDAA 1SBHA 2Q6LA 3B3JA 4EY4A 3P96A 4ZPDA 2ONJA 3BQ0A 5FA8A 4OKNA 3JXEA 5T5QA 4AKGA 2ZH2A 1MBZA 1NSYA 4CKEB 4WE3A 1HL3A 1GIAA 4GKAA 4J9VA 4NV0A 1KFCB 1GRRA 4REQA 3ZUGA 1ZH8A 5BNTA 1DTEA 3PKMA 2P35A 1X1BA 3KVYA 1P1JA 4UF4A 4X6LA 1QLNA 2I4TA 5DDQC 4UBJA 3HC7A 2CFRA 2ZIZA 4PO1A 4YB5A 1Z83A 3EA5A 1S57A 1FFCA 1HLFA 1XLTC 2KXHA 2IYNA 1KI7A 2E4WA 3GR0A 2CCJA 1CG6A 2VIHA 4P7JA 2OHXA 3QE9Y 2V7BA 4ALKA 1SULA 5BNFA 1GQYA 1YJ8A 4DZDA 1GXLA 1T24A 4P4SA 1TX4B 2QM7A 1X31C 1G7CA 8AT1A 2Y6VA 2Y1CA 3NS7A 3THOA 1V5FA 4WXRA 3ZJYA 1JLQA 3HABA 4O3PA 3QO9A 4DXHA 4OZ2A 2IIVA 3O9VA 1WACA 4OA5A 3HHEA 2PGXA 4AM8A 3IMQJ 2G3YA 3DOOA 2PLFA 2VPYA 2X0NA 2O4CA 1DRJA 2ZFHA 1RM3A 2DY9A 3UN5A 3G2QA 3HU2A 3ILIA 4DVJA 5SZTA 1CC8A 1LOUA 4KYTA 4D3SA 1HWIA 4E6PA 3PFBA 1TD9A 1J5OA 2FGOA 4RXUA 4MCHA 2X15A 5DBFA 3QKSA 2B6AB 3H42A 1CDDA 1VRTA 5JRDS 2DG2A 3G89A 3A3KA 4QNRA 3OR1B 4Y2QA 2FFBA 1Z25A 5DHRA 2CIMA 4XWWA 3HRHA 4ZS6A 3MCMA 4YCMA 2YWGA 1O5TA 1GPNA 4F2DA 4NV1A 5FV7A 1D3WA 2WVDA 2UU9B 1DAHA 4C5BA 3LNCA 3CDUA 1NJSA 4WNYA 3VZDA 2DXFA 4KBGA 2VFSA 1E59A 3IXQA 4EW6A 1R50A 2CPYA 3KEOA 2AE2A 1YZQA 3AXMA 5KUTA 3BCHA 4C4PA 4UBOA 5DBOA 4QPCA 3I61A 5MFZA 2WSCC 3KZNA 1V9CA 5KNLA 5KG7A 4JC5A 4EQ6B 1XQ6A 3OFVA 2IS6A 1FQWA 3ACBA 3AHGA 1YJ9S 1HR0J 1WRBA 3VZRA 4PU0A 1Z37A 2WMDA 2H5LA 1D6SA 2KTQA 1KHWA 2UZ3A 1AGYA 3NC0C 4PTZA 4RZ3A 1P5JA 3FB1A 3CVXA 2X4LA 3NBXX 2F3TA 1ADJA 4KIWA 2DP4E 3SDBA 3ETLA 5TS3A 1A5TA 1ZL0A 4WU2A 1ZONA 2B1GA 3B7WA 4XEUA 1NQAO 1P17A 3O73A 1XHFA 1WZ2A 1TM2A 4Q4HB 3WL4A 1E66A 4NVRA 4MJKA 4UREA 4YAJA 3TNYA 4LSZA 4WVFA 3W9BA 5EC8A 4IRKA 2V6IA 3CH7A 1ONPA 2VFUA 1RT3A 3HLUA 5GZ1A 5EKSA 1ABEA 2EK1A 1NBMD 3NEPX 3R3UA 1S4MA 3BAZA 3F7MA 2JFVA 1E89A 5DNWA 2IDLA 2JH3A 3ID6C 3GDGA 2AMCB 4ECZA 2AXQA 2PX4A 3RK1A 1HDOA 4JI4F 4ED2A 3EDYA 2JLAA 3CCJS 4A8XA 2ERCA 3JVUA 3LHFA 1KZ6A 5HOQA 3AHHA 4DQLA 1XZCA 3CW8X 4LXXA 3LPLA 2KG0A 4RIGA 1XR7A 2HDHA 1R4MB 3LAMA 1OLXA 1X1QA 3KL4A 1Y1KE 2CBXA 4PNHA 4Q7LA 3I2YX 1G9TA 3NCTA 2M6LA 1NNUA 2QNRA 4YYEA 4OLHA 2HA0A 1XRSB 2VJNA 4ZVGA 1K8YB 4R2HA 2AMFA 2R6ZA 4OEHA 2AT1A 4DCJA 4C4SA 3MRVA 3DRSB 3QNMA 2I80A 5AXNA 3BO2A 1SQFA 2DPGA 1AKQA 1VQMS 4MB6A 3WBFA 1NQWA 1WB9A 1PWEA 1K66A 2JK0A 4CM9D 1QC5B 2BAGA 2G7MC 5K3FA 3GJQB 4NYJR 2JKVA 2I6FA 3LKDA 2DLDA 4OX9F 3AESB 4ZV7A 3P2MA 1IY2A 5E1DA 5FF9A 4JYBA 5BVGA 1FFDA 4G86A 3OQ1A 4DJTA 1TZ0A 1YE5A 2DQSA 1ABBA 1OJLA 7AT1A 1YIDA 1UC4B 4W92B 2D5IA 1N33B 5I7SA 3RRFA 4BX8A 5B0AA 5IWAF 1YJTA 4OX8A 3DL4A 4CBVA 2L18A 1VK8A 5SZJA 1NFQA 2AXPA 3Q5DA 2R5NA 1F17A 4IUFA 1MQAA 1P61B 3K0AB 4DV4B 2QYGA 1XRQA 1KVJA 4QBKA 4M1WA 1W29A 3IWXA 2IVZA 4NQZA 4YCAA 2GVDA 1O6FA 2RIRA 2H3EB 1G38A 4WESA 1K97A 4ZO8A 5ALKA 3IOMA 3MWEA 2I6SA 3GRUA 2XW6A 5IM5A 4YV0A 2CLDX 5JMOA 4DKXA 1YASA 1Y0BA 4FYDA 4UY8T 2Y1WA 4F2SA 3LBIA 2WYUA 3PLRA 2R1UA 3M8KA 3MOGA 3PC8A 4QOJA 2XDQA 2GM4A 1V7ZA 2J9ZB 3GB0A 4ER7A 1PU2A 2WEKA 3QLJA 2X9QA 4HACB 1Q7EA 3HB7A 4FFNA 1F3LA 5D4LA 3B6EA 5CLGA 4NBRA 3DLHA 3SF8B 3ME5A 2PS9A 5FCDA 3PGLA 4FSDA 3COSA 1NJFA 4TTVA 4PFQA 3HJNA 3LF0A 3HO6A 1SCIA 2ZCUA 4Y6SA 3W2TA 1NSKL 3WB0A 1TUVA 2B99A 5EQDA 1IULA 1DUVG 3F5QA 2FLVA 4CLOB 4CQLA 1DPGA 3E48A 2VA8A 4AKSA 3G2MA 4QIVA 3UDVA 1I7SB 4QSHA 1OSDA 5JHHB 3I2HA 1NYRA 1BKDR 3QEKA 2JDIA 1KVRA 2Q27A 4BEJA 3VHRA 3ZQUA 4Q0BB 2BE2A 2C4UA 2W25A 3BCSA 2FUKA 1PYOA 3ENWA 4MARA 1EFDN 1JJCB 4MIWA 4IDOA 1NQUA 4ZZ2A 2EFGA 2O66A 5ICFA 3GROA 4ZQIA 1PZHA 3B5IA 1NE2A 4IHAA 1Q19A 4AJIA 2QY6A 3MGCA 5L4LA 4AP5A 3UPDA 2E85A 2C96A 5LMNB 3V32A 3GLVA 4IKPA 1Q12A 2VCEA 2YQ1A 1U7ZA 1NONA 3CYFA 1CUEA 1NP6A 4O8CA 2J3EA 4IRDA 2NSJA 1DX4A 3IBSA 1GR0A 5AOCA 4ESHA 4RA6B 1Q83A 1VIDA 6FDRA 5HA5A 3D4LA 2M4MA 3AUAA 2MZRA 4YP6A 4EA9A 4J3JA 3SMVA 1I2BA 1TM3E 5FR1A 1XNRF 3BR9A 1WQ1R 3UK2A 5DOZA 4JZYA 3D2LA 4V3CA 4TWJA 4LTNA 1QAQA 2J9RA 5HF6A 2W6CX 5AVWA 4GKJF 1GQFA 1DS6A 1SUWA 3M5PA 3ZZ1A 3BMNB 3RANA 3QLVA 2JATA 5KNCH 2OUKA 1W5FA 2JLWA 3ZC4A 3GP8A 1B7GO 4BC9A 5KS2A 3V4RA 3WAKA 2IA0A 4DV5F 5NLLA 3T9DA 3KLHA 3C8ZA 5JH7A 3I8SA 1MVNA 5E8RA 1TUEA 4HAVA 5AM2A 5BW4A 5KIAA 2QMXA 1GAQA 4OHRA 5B0DA 1T0JB 4ETWA 4O3QA 4EA6A 3TOXA 3PGXA 2F40A 1ZSVA 2W8BA 4E94A 4ZTUB 1QCZA 2ZOFA 3NIBA 1NK5A 3CD0A 5IANA 5HUJA 3KTOA 1PJ6A 4EW2A 4CHTA 4KHZA 1T8UA 2ISQA 1A6LA 2P6NA 1XU7A 3BFKA 5JEDA 2GA7A 1J07A 3Q4GA 2Z30B 3PQ8A 2GXAA 1SBNE 3DOKA 2JJMA 1WDLA 2Q6CA 1GKUB 1JJ2R 4P2GA 2ILZA 3U16A 1CULA 1DADA 5GMOA 1RTDA 2DFDA 3ETCA 1P2UA 2HKEA 4KGZB 4N18A 1SCAA 1JJAA 1FDRA 4KITB 4V1CB 1ZK0A 2OP5A 1EZ1A 4AL4A 3ZD6A 3EXHA 4W99A 3BHNA 4E51A 4BCAA 3R76A 2B7BA 3PS9A 4YB6A 5T4EA 2FX2A 3E3LA 3LQ1A 2NUHA 1KO7A 1V7CA 1XVTA 4K6KA 2IPMA 2DBRA 2IHJA 4M2LA 5CDYA 5BR1A 2YVSA 3FYHA 3A2NA 4GRIA 4BNYA 4TKUB 2VWHA 4JUZA 5TPWB 2VSFA 4MYTA 5F2EA 4K88A 5BVHA 4JB8B 4MUBA 2D5BA 2GHWA 1Y7TA 3ZHCA 3GC6A 1XZJA 4G56A 2LXUA 4Z0HO 3LC1O 1KJJA 1BD4A 5CYJA 3LH2S 5DASA 1WF6A 1GT8A 2YVUA 4QIHA 4DRYA 3NANA 1TCVA 1Z6AA 3SX2A 2IC3B 1E98A 3BGSA 2QN1A 2QGFA 2Q6VA 4YLYA 4AULA 3PI7A 4ABTA 3OY7A 4JA2A 4MH0R 2HD4A 1GRCA 3QM1A 3SSMA 3B82A 5DTQA 3SLGA 1D6MA 4KQ6A 2XSJB 2PGLA 1LX7A 1DC6A 3MFHA 3IDSA 5ECWA 3C6UA 4L7QA 1QO7A 4F4WA 1XELA 3UB3A 4GKKB 6REQA 4JLMA 3F0NA 1HNXF 5JHGB 5DBGA 5A5DA 2XUHA 4EKNB 2Z09A 4C22A 4ZRNA 3T6BA 4HRYA 4DR5J 2H57A 5E3IA 3VSCA 3ROXA 2XGOA 4NZOA 5I9BA 2E4UA 4B2LA 1XLVA 5J4KA 1A8UA 1HURA 3R9XA 1R0XA 5ADUS 4IR9A 1P44A 3CR3C 3ICVA 3IR6A 2M70A 1E1CB 2PT9A 4PZDA 1WCV1 1RBAA 1UBEA 1UINA 2I6TA 2YWFA 3V1MA 2XTJP 3W6PA 2WOOA 5FD1A 3CH5A 1ISHA 3DMFA 5EESA 5L9AA 5A03A 5FPYA 3TB4A 2Z2XA 3KX2A 2XZTB 1B74A 3I31A 3QWUA 4KKOA 1E99A 2XSZA 4BECA 5IW8A 1NR1A 3NATA 3L8GA 3LW7A 3TARA 3D66A 1BDMA 4P8RA 4O0IA 4ZAXA 4UHBA 3SS8A 2O7QA 2P8IA 4QXQA 5A4DA 2PUJA 2F8SA 3OCCA 4I2VA 2W2TA 2ADMA 2MQMA 1G17A 3P0FA 3DE6X 5I9MA 1Y8RA 2QV7A 1V3UA 2FZLA 4X64B 4FE3A 4Q9NA 2OAGA 2I6GA 4KI7A 2H2DA 4DG9A 2V9PA 1RADB 1H4VB 2QJWA 2JFGA 2GMWA 2A0KA 3T1HJ 4LHVA 4N41A 3ASZA 4B7XA 3F47A 5KHOC 4PLFA 4YAWA 1M2JA 1Y81A 3M4XA 2A10A 1E0SA 4F92B 4ES6A 5EUHA 4KBIA 5KFXA 4O4HA 1YDLA 1XOIA 4E2ZA 1IDOA 5M04A 1FQOA 4QG7A 4CN9A 4ND5A 2VG6B 4DXLA 3EVBA 3FMOB 4B4OA 4WBNA 3LALA 3T7JA 2I6WA 5G3YA 1D9ZA 3GCZA 1YVUA 2JD0A 7MHTA 3ADBA 2HT6A 4FDMA 2O8EA 5I9TA 4D4HA 1HMPA 5TJ9A 3T1NA 2Y1LA 1QNFA 4FONA 1F06A 3LO5A 4J1QA 3MUFA 3PQ2A 2BXJA 3BQ2A 3PR4A 3RABA 1SOAA 2PX2A 2EEYA 3W2WB 1MO2A 3DE4X 4EYHB 1M2HA 4NU0A 3CXRA 2GCPA 2V4UA 4HGQA 1DC4A 4DBQA 2QX9A 4TXHA 1DRKA 4A47A 5SUHA 1QFMA 1FCJA 3MI7X 3MERA 4KQJA 3AB3A 3AEQA 4BLQA 3N8DA 5A8WB 5ETKA 4TTJA 5DHTA 1P19A 4HZGA 1S0NA 5I7UA 1E5QA 2B3DA 5LUBA 4MWDA 1I7LA 3Q7QA 4CM4B 3I4LA 1ZNQO 1RM0A 2W6JA 3DULA 1OKKA 3NEJA 1QYDA 1C0IA 2M6KA 1N6RA 3CSUA 1R8QA 4IDAA 1RUSA 2Q2VA 4IIHA 3HXLA 4EYSA 4FBGA 2E5LB 4KEAA 1INLA 1E2LA 4X24A 2JFQA 4NEQA 4BFTA 2JVJA 2X3FA 4KXMA 2RHBA 3QKRB 4C4YA 3VA7A 3RTBA 4EF6A 4B3TJ 1FEHA 1E8DA 1W2IA 4LYJA 4QOEA 1YR1A 1Z4MA 2JA2A 2ASEA 4RHEA 1ZSYA 3RBDA 2J1LA 2H1VA 4DR1B 4LMRA 3CKLA 1R6DA 4K50A 4QQ8A 4MIAA 4C0KA 3B1YA 2VRWA 1SKMA 3AXKA 1W88A 3C6BA 5JG7A 4GR4A 1DO2A 2XTMA 2NGRA 3I83A 3BL5A 2PCLA 3ICOA 2JDID 2DXDA 1DQ8A 2I03A 1H0HA 2ZPUA 4KO8A 4LXUA 1WU7A 4MPPA 3Q22A 3I2GA 2JGLA 1X1AA 4LNHA 4GPIB 2OGWA 4C3OB 5FNVB 3KM0A 3B7PA 3E9QA 3M6VA 3QFWA 4G3IA 2J7UA 2ATIA 1RDFA 1UW4A 5DGXA 2NR0A 1OASA 5IPFA 1Y37A 3EVOA 2W58A 5CLQA 4ZJLA 2X76A 1KP2A 3QG1A 1IG3A 2I0XA 2UU9F 2VF4X 2XMKA 3KHHA 3CNOA 4X8OA 3IUSA 1EP9A 1FFXB 1Q86T 3BH7B 3X3UA 3NRBA 2HBZA 1R6BX 4QQNA 3UKDA 1DAXA 3N75A 2EIHA 3DHVA 2CQ0A 2GNKA 3FCOA 3KVRA 4B1FA 4OV6A 2XVXA 4NOKA 1W93A 1LLQA 4G3XA 3RC9A 2BUNA 1SCQA 4GZ5A 4JJZA 4CDMA 3U4QB 4LXGA 1FRHA 2VFVA 3DKKA 2JLBA 3K8QA 4N3BA 3TS1A 4PQGA 4NZMA 1Q53A 3AI1A 9GPBA 1JGTA 1W2WB 4NZ7A 2JFNA 1SH0A 3E9MA 5LUAA 3QMQA 3UATA 4LY9A 1BOFA 2IZ5A 2C9OA 3O8OB 2ZKIA 1MROB 1MDFA 4ARCA 4D9MA 2QMYA 2IP4A 4ZDKA 4YP5A 3PXGa 3CGWA 3QRWA 1KO5A 4H3VA 1ZD3A 1K27A 2IOFK 1GPWB 5DBHX 3DW1X 3RFTA 4D4KA 1DT5A 3HR8A 1LWEB 4EA8A 4BNMA 1CWUA 3FE2A 3RB3A 1KSPA 4LYFA 2BMDA 3HULA 4DBLE 1RPTA 5FYQA 4EKEA 3WC2A 3PZRA 4ZI7A 3O93A 2X13A 3SOPA 2XQKA 3MEKA 4WL0A 1VSTA 3UFBA 1BCSA 1Z4LA 2AFIB 3ORYA 3TEMA 1GUAA 3OE1A 1KTQA 3SC3A 3MN1A 2PQ2A 4GMGA 4X91A 4I4TB 4LMPA 3DL2A 1ZISA 4K3UA 2ZVPX 4JU8A 1H69A 3MR2A 1XWLA 3GLGB 1QB7A 4C7BA 5DLPA 1N78A 5EHIA 4NK4A 3D7SB 2CVEA 5LLSA 2MSSA 2PBLA 4HB4A 4ETZA 1M5VC 1XZKA 3L3BA 2EWVA 2IBMA 1E9SA 3CDBA 2ODAA 1YTUA 3R3JA 4TWZA 1L3IA 4OJQA 3FJ1A 3DTVB 1SCJA 5BXQC 3DHNA 3IIKA 4X95A 5JSHA 2IYTA 4EY8A 3D6NB 2EC5A 3ZWYA 2GQQA 4ACAA 2L82A 4MLPA 1NPRA 5K0EA 3WL8A 1VIVA 1PJRA 2OV4A 5A5EA 4W5NA 4XASA 5T64A 4USUA 1WUIS 1D0EA 2BRKA 5I7HA 4QASA 1AX9A 4DLYA 4GC9A 3WZLA 1PR4A 3WB9A 3R1IA 1E0KA 4WE1A 3EVTA 3PNKA 3FZYA 1E6LA 3QGMA 1FVOA 5EMNA 2VZ9A 5CA1B 1ENPA 4Z4IA 1WAMA 2JVKA 4TTPA 1AG9A 2O8DB 5IAOA 5JPDA 4I0WA 4M5NA 4ETMA 2QGZA 3TN7A 3HL4A 5M34A 3SD7A 4UOCA 4I6EA 3STUA 1R27A 4Y0FA 3ISVA 4JLDA 1X0PA 1O95C 4NL5A 4I6JA 5JWOA 4MW7A 2AIRA 3WRYC 4DV4F 1P4HA 2EHDA 1N6OA 2EXXA 3TPZA 5IAEA 2DNLA 4MGHA 4HYKA 3KCQA 5HP4A 3GUUA 2IW1A 2ERXA 2DE0X 4DA4A 4RVSA 1HE1C 3B1FA 5IOLA 5KQMA 5LQMA 2B8JA 3MJ4A 2DHAA 1WEXA 1KNQA 1QZ3A 4DV3J 3CCVS 4CH0S 3R9KA 2FI1A 4TS3A 2EVZA 4F9GA 5DHFA 2R8HA 1GFSA 2HNYA 3A05A 4K7JA 5KEIA 4QHSA 4UD2A 2IXAA 4KRYA 1S6QA 4UZSA 1L5LA 1DX9A 4FC7A 3NTVA 1L7BA 3FRJA 1K9VF 1IKVB 2B1RA 4BUCA 5HKOA 3PTAA 1T4GA 2PT7A 2XSZD 1WOPA 3EXG1 3HVTA 3EC2A 1CEXA 2H9ZA 4QM6A 1L7PA 4MUAA 3NLLA 4JL8A 4UMVA 2FWNA 4Z54A 2QPLA 5CMLA 5JFOA 2PA3A 3TW8B 1UJ2A 1JR6A 1WSVA 3DM9B 5AM1A 3AIOA 3I0RA 1B8OA 2J09A 1E6VA 3EVWA 2GXQA 5HFJA 1NLZA 4MRMB 3BRQA 4F5ZA 3O2IA 4CCYA 3RR7A 5HLFB 5HI7A 3BJZA 4Z4GA 1UFLA 1ZVKA 5LU8A 2E82A 3C14A 1K4KA 3HT3A 2CQIA 2B34A 3B2NA 3O2SB 2D1CA 4H35A 2J3DA 3GAMA 5KT4A 1UZDA 1X5OA 4M5KA 3C2PA 3TOCA 1V8DA 3OUZA 1JIKA 3ZIDA 2OZPA 3DAGA 4D0SA 3QOWA 4Q12A 2C97A 4F84A 2Y0EA 1AV7A 3D6HA 1JLCA 1UPCA 2VONA 1QJHA 1B2LA 2G82A 5DP1A 3UJBA 4CQNA 3TLCA 3VC1A 2DH5A 3CN9A 5LMNF 4OMCA 5PGMA 3MMJA 5C7PA 1X4CA 1XXHA 4JYZA 3O1HB 4Z4EA 1QZXA 7YASA 2DPIA 3EFBA 4QRHA 1M1YB 4PO8A 4MHTA 3TXYA 4GVXA 1NKSA 2E4YA 2XGGA 4OG2A 4LFCB 3D4IA 1G5TA 3NGUA 2B9XA 3DZJA 1KZ1A 5KJFA 3LQKA 2FP3A 3U4IA 3UCFA 1F5NA 1P9OA 4PABA 1WNFA 1C4CA 3MGAA 8ABPA 4DL0C 3SQDA 1DC8A 1LFPA 3BF8A 4BTVA 2Z56A 4CM8A 4M5HA 1DT3A 3DDIA 1OH8A 5ALRA 2DR0A 5EJIA 3KQLA 1W5EA 2AL7A 4EGQA 4HDSA 4X6UA 1H22A 1G8JA 3MM4A 5C4IA 3OTWA 1TMGE 1M5UA 2NTVA 3NHFA 3R5CA 3OU7A 4E2FA 2LVBA 1FVQA 3ESBA 1G3OA 4DQRA 3K0BA 1HBOA 4DBZA 2CKMA 1G5QA 4IH7A 3BORA 4LJSA 3ROKA 3N0WA 3YASA 3AHEA 1T9KA 2CHQA 2Q43A 1ISGA 4IMPA 5HZGA 2VKRA 4MCJA 2QBYB 1JKXA 1X4AA 4UUMA 3M34A 8ATCB 4ZREA 4ZOQI 1NHWA 1THGA 2G9UA 3DLLQ 1ZJZA 4OO3A 2VNAA 1SXHA 3MFQA 1Y80A 1OV4A 1Y4ZB 3GRKA 3MT8A 3JU3A 5E2AA 2W6JD 1ZH4A 5EJ5A 1OKKD 4JGGA 4FMCB 1O6XA 4AIRA 5B7NA 4AL6A 2ZSKA 4LKRA 2IVFA 1E5VA 5TGTA 3MOSA 2BM1A 4EJ0A 2C3OA 2QQFA 1HE8B 2Y8EA 1FKOB 4DYDA 4ZLNA 4TKVB 3PNSA 2AOTA 2EX4A 2CQ3A 2GFHA 2OTCA 3SK0A 2QD4A 5B0GA 3CHYA 1N2BA 2D0OB 4X4NA 1EAYC 5FP0A 1UAWA 1J99A 2E9RX 2QVLA 3VZPA 4RNOA 2BSQA 4X5OA 3EOBI 4LDZA 1YFKA 5B2FA 4WZAE 4NFHA 2AKWB 2HTEA 1XCPA 4A8FA 1JWLA 2A9VA 4PHCA 5TB5A 3F5MA 1GMVA 1AMUA 2VPZB 1C80A 3D5TA 1JA1A 1PFUA 3TEGA 3KCNA 3TO5A 4MCIA 5C4MA 1IUJA 4P4TA 1YMVA 1U8FO 1XJWA 5KJEA 4LK3A 4BNVA 1J24A 5ETNA 1FKAF 2D0IA 2VP4A 1WVGA 2XQGA 1GEGA 1DKNA 4K1LA 4KZKA 2J9FA 2C3PA 3PEFA 5H3LA 5JMWA 1O3YA 3NOVA 5JNRA 1CE8A 1FFWB 1RTJA 1NM5A 5FUMA 1DLOB 5I3ZA 4JBWA 5E41A 1KJNA 3ZX4A 1TVEA 3U1VA 3WKBA 3VKGA 5DSTA 2F1RA 4RLSA 3S4YA 1GZ4A 3LD9A 5IKPA 1WUJS 4PNZA 5MFPA 3JW8A 2KYZA 3ZN2A 2YMLA 2W1BA 3JZMA 1LBTA 3UHJA 5AI0A 2H06A 5LP6F 2QQGA 3E5RA 3BF7A 1BROA 4CG3A 5ICMA 1CS4B 2H8GA 2X3UA 3U7HB 4DQSA 1ND5A 3RVQA 2V1UA 2BFCA 1AKVA 4FN4A 1EXVA 2V9CA 2BHLA 4WJLA 2NZ8A 3I9ZA 3PY8A 3E7PA 2OIHA 1K7EB 3HFGA 3NBAA 1JQ3A 1GDTA 1A8SA 4JI5B 4E14A 3ZHTA 5A4FS 2VK1A 1X6VA 4P93A 2XTJA 4K9DA 1FFSB 2JI4A 4JOBA 1A7UA 2MWMA 3F1KA 1NJ8A 3WNBA 3L7BA 1C1CB 3GJTB 1NAQA 2OI2A 1T13A 2EW9A 5CDFE 2QSUA 4JBGA 2GEJA 1HBJA 2I9KA 3AUKA 3AETB 2YKPA 2QN6B 3QEMB 5FUVA 2DXIA 4EUNA 1VYHA 2W98A 5BR7A 1RYFA 5ERXA 2JFBA 4P75A 1BD3A 1CB0A 3E2PA 1URRA 4J9UE 5B7WA 2JBAB 2EG1A 3F3MA 3WK6A 2G09A 1Y8ZA 1I4TD 2BFAA 4GX1A 3AONB 5KFDA 4EB8A 1CRQA 4WRRA 1R0BA 3BHMA 1FFEA 3SI8A 1CQMA 1XD2B 1TK3A 2GTHA 3F44A 2WYVA 4UMFA 5JJKA 4QYZJ 2F17A 1I3KA 2P78A 1LWNA 4DCGA 4K0RA 4EJSB 4Y2TA 3TZWA 4KWHA 3QQPA 2ZUGA 4X64F 4E5NA 3BJRA 3T8YA 1PV2A 4JUFA 3DMNA 4EKYA 3R7NA 3U2QA 1VLYA 4G4SO 5GJCA 4R5HA 2XB6A 3BK2A 3T9FA 4D8TA 4A0HA 4BJ3A 3DUFB 1AKRA 4OI6A 3MPOA 1EVIA 4KE7A 3UUGA 5JISA 3IA0A 1MQ8B 2E2WA 3IGNA 1LFDB 1DV1A 1PWHA 3HKCB 2LXFA 2QYSA 1GTHA 2RD5C 4DJBA 1S3IA 4CLLA 2AMLA 4P86A 3ZCPA 1CY0A 1P7ZA 3MMPA 4G23A 4O0LA 4B9NA 5ICEA 3KFVA 3FUVA 2OFWA 3DR5A 1K7XB 1AHNA 2PNJA 1L3TA 4G41A 3KJIA 1ZLXA 1RI7A 3IKJA 2AR9A 4WNAB 3A1WA 4CKCB 3PHEA 1E3DA 4LYGA 3ZWQA 4D0NA 3V1NA 4CEJB 4HTIA 4NJMA 2IYXA 4TYNA 1YJNS 2IAJB 2P3OA 1WG4A 1FXWA 1JSCA 1GUYA 1LJUA 4QHTA 2P7IA 1F2UA 5KYXB 4DV5B 1XLWA 3WDKA 1ZI6A 2BTQA 3FBFA 4PLVA 2RG7A 4Q3BA 1X0FA 4TWIA 3VPHA 1C4XA 2JW5A 4HO1X 1I1HA 4Y1RA 1IE3A 4KMOA 5KFWA 1HE2A 2FFRA 1FYVA 4HAUA 1QV7A 2OSBA 3QV2A 2VTEA 2Q3CA 3R7WB 3PDNA 3U3OA 3PU6A 4ZJPA 3W3AH 1ARZA 1C0KA 2AJ2A 3ZWAA 3FDXA 3UN3A 2N3OA 1X13A 1Y6ZA 5LCXA 5DCWA 4IXDA 2FJ0A 2CPEA 5FQNA 3ISTA 2MKYA 1RCTE 3C4QA 1A2OA 3LKZA 1M6VB 4LF6J 4XX0A 1ZCJA 1N2JA 2FWBA 3TYXA 2VB6A 3DEJA 3DRRB 5JPIA 3DT9A 1NURA 3HV0A 4MAFA 2CQPA 4ZVRA 4DV7B 2V2KA 3UC5A 2E5LF 4N5IX 3QU5A 3WRXA 2EZ9A 5B3JA 2HA7A 2B2NA 5IZHA 2E1CA 4ZVHA 5F7ZA 3W7BA 1D2NA 4DYVA 1G7SA 3KQQA 2Y8WA 1RFGE 1ZL2A 5KFRA 3JB9k 2DK2A 2FEWB 3SWWA 3UANA 2WDZA 4DR1F 1DIRA 3MHYA 2FPHX 3F74A 2C2MB 3B13B 1E63A 1KI8A 2VXBA 5LQRA 2YYZA 4IXNA 1VBYA 2ZCJA 3PX4A 4HDRA 4N4AA 2P3SA 3DDHA 3II6X 2CV1A 1LQ9A 4KK3A 2OPSA 3H4BA 1WOMA 4CYMA 5DM7Q 3SIPB 1WHSA 2QAGC 2C58A 4IUCS 1O77A 3RWBA 5L51A 3MIIA 5JJIA 2K87A 4HEA1 3PCOB 1U8TA 5FNVF 1G8GA 5AXCA 3U37A 1L4NA 3PG5A 5G1PA 1QHIA 4HQFA 1VJ0A 1OGYA 2GPJA 2IQ5A 2W90A 3OWXA 1ZINA 3ZQ4A 1T5TA 1NDQA 3KO8A 1AXQA 1YKWA 4ZVPB 2UXCB 5CCBA 2DEUA 3QKTA 2O0MA 1K3FA 1DFDA 4ENVA 3B54A 1YOBA 1KU6A 4GUDA 2V8DA 1E2QA 3WFJA 3NCRA 4L78A 3A6KA 3PX7A 1ZHHA 2UYGA 2EEZA 2YTCA 4P2XA 2OHHA 3G9UA 2VPPA 4JC4A 4PSDA 3LZ6A 3OQOA 3V7NA 4DCCA 1WHTA 4GI2A 1WW3A 1EGMB 3EZOA 1HI8A 3GVHA 4TRRA 1RZ3A 2EJWA 2X5NA 4Y6LA 4S1OA 4QECA 2GFIA 5C8DA 4FBUA 1AGNA 2YWWA 3UC9A 3IDQA 4B17A 3Q5EA 3ZCUA 1ZO8A 3R3SA 2B8QA 3GIRA 2IPOA 4C7QA 1YDFA 2X7HA 2G06A 4JXXA 4XR4A 3ZDDA 3DE1X 2VJLA 2W0SA 3OQJA 1OCEA 4WFZA 2QN7A 2QD3A 3MMZA 1AW0A 1RC1A 1Z3IX 1ZOOA 1L5GB 4A1FA 5COAA 2G1UA 1L3CA 2DGSA 4XGKA 3LPYA 4Q6BA 1YR2A 5JMPA 2WJWA 4E7OA 3FMFA 1GGJA 3EZFA 2ASJA 2YXLA 4LVCA 5C7YA 4KR0A 4LGMA 4Z7CA 5E95A 2GETA 3RTEA 3GFTA 2X0JA 3N2ZB 3IX7A 3IQDB 3L6UA 1TEVA 3S2SA 2WSEC 4HH4A 5TMPA 5EPOA 3STXA 2CXQA 3AHJA 2EFHB 2VQEJ 4P3KA 3FQKA 4FDFA 5FOSA 3W1YC 2AFHA 1WUTA 4YY3J 3NEAA 4JLBA 5DBEX 1EWQA 2HWHA 2NZVG 4WIIA 2XNKA 2X2OA 2H1FA 2WE7A 3MWJA 2WPNA 4A8YA 2O7VA 3CMQA 3JQEA 1IN0A 4P4NA 4DWIA 5ERGB 3MF4A 5K2OA 3BZQA 1ENYA 4I1VA 1J4AA 1JIXA 1P62B 4TYPA 1I9CA 2FQQA 3PE3A 3H18A 2GNAA 1KIFA 4G1QA 2DHHA 2J76E 1S59A 1WTFA 2WIBA 3FTNA 1QNLA 1HMYA 3UNGC 4O5OA 4IQXA 1RI5A 2Q4EA 4NBLA 1Z7EA 1KZHA 4KIFA 4D5EA 2Z58B 4A03A 1EPUA 1U63A 3LQYA 4ZOLA 3LW5C 3NOGA 3ACCA 1CUUA 4DTCA 1Q8BA 1YUMA 2H59A 2FWJA 2GA9A 1HYEA 3AB2B 4PG5A 2CLKB 3AR6A 3MJDA 5BN4A 5CA1F 1TTHB 3H1EA 4M76B 4R05A 2YPZA 3INYA 3D8RA 2BH9A 3GFQA 3GMTA 1SRRA 3W06A 3FRIA 4L2IB 3LS2A 3OH8A 4YRFA 1AA9A 1T6XA 4CXMA 5JIBA 4LE1A 1Q3KA 2O8NA 4NF2A 1WCIA 4ZVEA 5DZ7A 4HWGA 5KSZA 3VAIA 3SV3A 3ONFA 3E9NA 3HCRA 2NXCA 1TMJA 2N7CA 2QYOA 1WC4A 5ETJA 4O4IB 3RVRA 3LAWA 1PGOA 1JEAA 4CTMA 1E77A 2Q3EA 4RX6A 3PYGA 3RG2A 4I50B 2JGDB 3ITEA 3QNUA 4DV1J 2NU8A 1R0AA 1RPAA 2J6BA 3N8HA 4BAUA 4V1Ak 3P5BP 2AR0A 3O4IA 3E9EA 4MZDA 2EBWA 2VFRA 3H0EA 3WGJA 1EQUA 2QE5A 2FQ1A 3VOTA 4MULA 3BXPA 2UYHA 2E5HA 1TKXA 1RYMA 5JLJA 2JGMA 2FUCA 1VZ3A 5BUSA 1I01A 5HJ5A 3S01A 1P9LA 3H83A 2VATA 1W1IA 3INGA 2IS2A 1PR5A 2F8LA 1H42A 3SZ3A 1XB2A 4UHHA 2JFUA 3GJ8A 1LF5A 3ABRB 4Y1EA 5BUCA 1IQZA 4B08A 1QOPB 3D3NA 4IJKA 3MTBA 2CUNA 2GIFA 2GLUA 2PUGA 4HN2A 2GYUA 1UEIA 1H2HA 4RSRA 3VX4A 5CITA 4GUAA 3UJPA 2WU1A 2C8VA 3KSZO 3HN2A 3KJGA 2EX1A 1MV8A 1BO6A 3SKVA 2GBLA 2B4UA 4RVDA 1VDMA 3IKTA 2HBYB 2CNLA 1RXVA 4PZCA 4ZQHA 1PG5A 3FWZA 4S24A 4YCSA 3QSGA 7FDRA 2QXUA 1M6YA 4GPD1 2AQ8A 1XVUA 4Y2XA 4OIXA 2VJOA 3IRWP 5E9QA 4YMSA 4N0EA 3FDSA 5TXGA 5JALA 4FPXA 2OPRA 4FFDA 5JBIA 3TOSA 1EQAA 4ATNA 2C00A 1II0A 3R5JA 1F2GA 5D5QA 1QK4A 2CMGA 4F0MA 1NVFA 4BP9A 4AQ7A 4K7QA 4KPYA 2H4ZA 3TUPA 2G5CA 5T67A 1JIJA 4MLCA 3UJNA 3MGGA 1THZA 1ORVA 4LFCF 1YJ5A 2VAVA 4L6CA 3HFKA 4V1CI 1R9JA 1RWOB 3SHWA 1H3DA 3MIZA 4XGQA 3C70A 4I64A 4HAIA 3PC2A 1D07A 3AT1A 2AWOA 1NLMA 2QP3A 3K96A 3KZ1E 1I4EB 5D7NA 1CJVC 3FPAA 4C8NA 5LL6d 2A1IA 5CDGA 4I2NA 5ERYA 2IZ7A 4AMBA 3ZKWB 2EKQA 3GSIA 2D00A 2RU9A 2V9KA 1Z73A 3FKSA 4W5OA 3PYLA 1KQKA 1UOPA 5K6AA 5L1IA 4XWAA 5J5AA 3MPUA 4Z4CA 2BISA 3KC2A 4LN1A 3C48A 4HXFB 1GVHA 4J7XA 2ZPAA 4W90B 2YCLA 2GD0A 3MUOA 5EJ7A 4G5FA 4FMCF 2VDRB 5EZ5A 1NL3A 2EWMA 5IULC 1II8B 1O94A 1GNLA 1JLLA 2ZJ3A 3TKAA 1G19A 2C98A 3BWDD 1Z5VA 3TEHB 2QG9B 4ZLLA 3A4IA 2H52A 3KWLA 1CRWG 1KY2A 4A8OA 1CS4C 4IM7A 2P90A 2EC0A 2W6OA 4RKUC 1TL1A 4S1VA 4QO8A 3U4GA 4C08A 1R6VA 4EFKA 4Q48A 2B4VA 1FKPB 1JI0A 3I9FA 3WYCA 1NW7A 4EUKA 4C88A 2GKGA 1CS0A 3GOQA 5AMXA 1T3OA 5B3KA 3Q8WA 2RRNA 4KR2A 3KFWX 2J7PA 4CYUA 1PJ3A 2Y9PB 1FFGB 4X8HA 4BZPA 3C46A 2O67A 3RIMA 1LVHA 2IXDA 3SE7A 3GJ5A 3EE6A 1Z0IA 1MU2B 3NMRA 1VJQA 5E4JA 1J27A 4LC1A 1QGED 4F3QA 3A8IA 3D2WA 3TUJC 1MW9X 5B7GA 4HT3B 3JYNA 5ALHA 1RYDA 3P4XA 3C6TB 4FYIA 2VHEA 1NVVQ 1JKHB 2CG4A 5LR6A 2Z43A 1N57A 2HV9A 3R9LA 5TRTA 5CT9A 2JD1A 1UBNA 3EC1A 2Q6OA 5DX1A 1IBCB 3H7IA 1T05B 1RHRA 2KT3A 4UNQA 4KVFA 3GCXP 3JD0A 2QL5B 1NXIA 5TPZA 2GHRA 4IJQA 1BMDA 4B3RB 1HH4A 4UOZA 1KY3A 4OBEA 1TL3A 3GVPA 5HBRA 2JAHA 2VSQA 4XUCA 1LWOA 3VNQA 5F12A 1YB6A 2O48X 1DP4A 3SKYA 1NIPA 1HBNB 1S2MA 5EPUA 4BNXA 1IJKA 3T9EA 3SEZA 1OAOA 3FTEA 1SQ0A 1BQ3A 4N1AA 2BFMA 3K6JA 3EG5A 5AT1B 1M1NB 1OR8A 5JCOC 1BEZA 3AUYA 4TN5A 3CLTD 4ETXA 4K9OA 4EJSC 2HC9A 5J1EA 1NVWQ 4JI5F 2FWAA 4FU0A 5CBPB 1TP7A 4TXSA 3DBRA 2FZGA 2GI4A 4YJKA 1H05A 2GN2A 3A7DA 5IVKA 1M33A 1TL7B 3EFHA 3MHPA 4LYDA 4YEDA 4CF5A 4G0PA 1OOEA 2IZOA 4IFVA 1AJEA 2PL3A 3FBBA 2JS7A 3HBAA 3PWTA 5DOVA 3VJLA 2XCIA 3KV1A 2XITA 4NV3A 4O4LA 1QFSA 1N2CA 2GK7A 3CNQS 1PJSA 3AGPA 4FEAA 4RXTA 3PYEA 1W2HA 3OD1A 4NC9A 4Q24A 1J06A 1JKFA 2A1TR 5ALXA 1RT5B 1YR7A 3PNBA 3RHSA 5C18A 4YONB 3NAZA 2EARA 5CDUA 4X1YA 1OTHA 1MB2A 3ZY3A 4W63A 4HQRA 4CIAA 4OQEA 3RVJA 1CJUA 1Z8NA 3CSSA 4R0NA 1IXSB 4JC0A 4GWLA 3FKBA 4Z2XA 5TLSA 4C7OA 1N6HA 4EIWA 2VL7A 5AUNB 3LQVA 2XWYA 5J59A 3C19A 3LT5A 3CF0A 1V1RB 1OXSC 1H1LB 3EIQA 4EFDA 2ZSUA 3VR4H 3U19A 5L38A 1K2WA 4D4MA 4FYKA 3P0JA 4PLZA 2ZJPQ 3O4HA 2L48A 4AZVA 1D5WA 2E4VA 1AFJA 2CF5A 4F0KA 2D74B 4UULA 1QF7A 2CVZA 5SY4A 1C1BA 4FS2A 4HXYA 3MUNA 2AJFE 1CDEA 2GYWA 5ITHA 4PC7A 4RENA 1SV5B 1D9FA 2MMYA 2RHWA 2VHJA 6PFKA 4F2WA 3R8FA 4DPYA 2ATVA 2D2VA 5JS1A 3RRKA 3WWZA 4CNQA 4JLWA 4DQXA 4M5JA 2O7NA 4MQLA 3K58A 1X2EA 2DRBA 2GAJA 3MECA 7ADHA 2AZTA 2VXYA 1UFWA 1JPNA 1KS9A 3C6YA 3WAGA 3AJ2A 1YTYA 1F0NA 1Q20A 5JYEA 1DLJA 1TB4A 1Z17A 8RUCA 4DLEA 1SZJG 1N5YA 4AI6A 2Q3FA 4FX2A 1QG4A 2W4CA 2DD8S 4YR9A 2V7VA 2CZ4A 1UEVA 3M30A 2QO3A 2QLNA 2W9CA 3A6GA 2O0HA 5KYYA 2WSLA 4IQ4A 3DKDA 1RHQB 1HWJA 3WLMA 2ZE2A 1SBIA 3IVCA 3QLUC 1EX1A 3L1UA 1P7CA 4M5DB 1ZLYA 2JAUA 4RCYA 1FOEB 4NZNA 1A3CA 4MYUA 4P4UA 3TBHA 2OTLS 3QFTA 1SVIA 3DMPA 3QPVA 3K70D 4B71A 4HEHA 1U3DA 2HLPA 3GT7A 3U7EB 4F4HA 5DI3A 2JI6A 4EPWA 1C2PA 3LGAA 4JUDX 3DFUA 4MR7A 2HFKA 2PKXA 4HFMA 3DFKA 5IJ0B 1RLIA 3EGWA 3SQOP 4NKRA 3KUCA 3EX7C 3C5VA 1EVLA 4AAYA 4DV7F 2YH0A 5TMBA 3F46A 5I51A 2NUPB 4IDGA 1NRWA 3N6XA 5IFMA 1NYTA 1ZW1A 5DV9A 5CB4A 3N58A 1WSAA 2MSEB 3PGJA 4DV6B 1OTXA 4U7UD 4UPDA 1VHLA 1I7DA 4YREA 5HZMA 2OZVA 3M6IA 5FUXA 4GI3A 2HAEA 2XTZA 4INPA 1YJWS 3FHLA 1TCCA 3CBGA 1PO7A 3AY0A 4MWBA 4R8RA 1AHPA 5KFYA 1RHMA 3DWIA 2AK3A 5L1LA 1I3OB 3A8KA 1FDOA 5IJWA 2ZH3A 3I0SA 5J2PB 3HADA 2QVGA 2F62A 1ZIYA 1UIMA 5FI5A 1HTTA 4ZOAA 1MN7A 1MX5A 4MVYA 3BMCB 2BMBA 4IIXA 5F1PA 1J8YF 2WMNB 4IHKA 2FR8C 3QJGA 5F3ZA 3A0RB 1S48A 5EIOA 4BFYA 3R6WA 2QMUA 5LP6B 3J80Y 3ER8A 2RHMA 3MWDA 4N8DA 2CMFA 2RHCA 1WKVA 2IU6A 3LVRE 3M81A 2C0CA 3UA3A 2OK8A 1XDUA 3Q83A 3NWPA 1P91A 4CRWB 1F20A 3VR5H 1UBGA 4E2WA 1YOVB 3N8IA 2UXCF 4UMDA 3O1IC 4BHQA 5KNCA 2CVFA 1QG0A 1V6CA 3O3CA 3G0DA 3RC3A 4DSOA 4F91B 3EGOA 1TPZA 2QRMA 3DLJA 2PKQO 2Y3YA 1E2KA 4ZP8A 4TLDA 1OREA 4ND2A 4CEHA 2BEUB 1GTJ1 2J67A 3X1DA 5DIZA 2AEEA 5BSUA 5HUHA 3DCNA 3CPEA 2HSJA 3WDSA 3FKSD 4PBSA 3TH5A 4KO2S 4TL8A 3R2JA 3G88A 4LHZA 3IP1A 4U7FA 1XNHA 4NS4A 4NYIR 5I48A 3PHJA 5IVDA 4RHYA 1P39A 3SS7X 1NJGA 5IAJA 3JR3A 1V9SA 3IMCA 4YI3A 2W9BA 1NJWA 3MQ4A 4QBFA 1E2UA 4HVCA 5H83A 3GX1A 2FVCA 4LIRA 3D2CA 4KSCA 1PKXA 3GXBA 3WQPA 3KQYA 4YP1A 3HB4X 1SPBP 3FBGA 1KQPA 1O94D 2NN3C 2XGMA 1VIMA 4M9UA 3I9V9 4NXNJ 1VRUB 2LV8A 4YR3A 3DKRA 4ZCPA 3P9RA 2P3QA 3W5YA 1TMYA 3UDCA 5TVGA 1NHGA 2G4VA 2AYYA 3BMQB 4LOLA 1ZETA 1U8SA 1QSGA 2YRXA 2Q3HA 5BO5A 1ODFA 3DGFC 4ZK2A 1JKMA 4HB2A 3OLCX 2RJZA 3WGVA 3USZA 4YO8A 4LG1A 2ZJ4A 4K5SA 1W4CA 2GZAA 3GELA 2YBDA 1BXGB 3IAS9 2AW3A 1W9HA 4MQBA 2GCIA 1DXHA 1P0FA 2M9KA 3BBCA 1RXIA 1A69A 3VGSA 3Q8LA 1T03A 2J7PD 1CEZA 2GX6A 3MRXA 3PPXA 1T6BY 4ZXPA 1KLMB 4RZSA 1C9YA 3K4PA 1NNSA 1D9DA 1U28A 3DZHA 2B30A 5DG7A 4PPGA 4BEBA 4TYQA 1XKXA 2B8NA 3S44A 2VTBA 5J4HA 1QGOA 1WZEA 3GT0A 1MZVA 1WBJB 3SXUA 4WZ6A 5JCJA 1WB5A 4O2BB 3A2LA 4J9QA 2YY7A 3PXXA 5MN4A 4MS3B 2PIIA 2CJYB 1K6XA 4XVHA 3S40A 1Z62A 3TZEA 4BOYA 3DO8A 2FHKA 1MW8X 3OVBA 3VF0B 3AKYA 1ZUIA 4XO0A 3PNLA 5IABA 2M6SA 2GO9A 1F9AA 5CYMA 5TPZD 4G4IA 2J7WA 3BIFA 2YMMA 4X66B 3C8YA 3RYIB 4DEXA 2Z5LA 1J8FA 2C3YA 3R1HA 2VPWB 5C52B 2H2IA 2O2EA 3STYA 4MPDA 3Q6MA 3OPMA 4JUCA 1QAMA 2CB9A 1SMKA 3LV8A 4FYVB 3HVRA 2QZ4A 4Q1VA 5E9WA 1YQWA 3P9IA 2XB9A 4QYSA 4DQVA 3Q10A 2FPLA 1PJCA 3I05A 5IEJA 2ALYB 1KDVA 5KFHA 1GEEA 2R66A 1NBEB 3BB3A 1S1VB 4JJ6A 2QJOA 3PIIA 4R8VA 1V45E 4B3GA 3DC7A 3DOJA 5FUQA 3CNHA 4AO6A 5JZMA 1U9IC 5BSFA 1ZU4A 3BBFA 2VD3A 3H2UB 4Q7AA 4GWGA 4GZMA 4O4IF 3EARA 3MCWA 3D1QA 2ETXA 2ONZA 5KB3A 3R0QA 1A8PA 4ZQCB 1KPGA 1P77A 5LKAA 1GN9A 4I50F 3PUXA 4URYR 3I92A 5DGCA 1XJ0A 4GLFA 5TMEA 2DNZA 4DLTA 1N3YA 3ANLA 3KSRA 2EKYA 2DUWA 1NULA 1F9EA 2W4IA 2VR1A 3HZOA 1YZGA 4MWZA 3V81B 2Q7XA 4CG0A 4I7EA 5IHXA 3HP6A 3X1KA 3U3MA 3PV8A 1Z75A 1E3MA 4Y2KA 4RF3A 3W63A 2QV0A 3DFEA 2UZAA 1E7YA 4UEWA 2D8AA 4QYRA 2FP4A 5AI8A 4LKOA 1S4QA 3X1YA 4JJIA 5L9NA 4QVKA 2H4HA 1EZ4A 1NE7A 4CLKA 3TINA 2EYUA 2ZQYA 1CPZA 2AMYA 1YVFA 3HRKA 3LP1B 5ITWA 3KK2A 4U0JA 4W98A 1IJEA 2DPHA 5KVAA 4NFSA 5I3CA 2N82B 2V1XA 3MA0A 2B78A 1NU4A 1REQA 3BN7A 4B3OA 3O75A 2XZDB 3OF5A 5ALLA 2P0AA 2IH4A 2ZHOA 1PL6A 5SYMA 2GUGA 1VYUA 3UWDA 1HYSB 3MBIA 1Y1SA 3PEYA 3PUKA 3AF1A 3HFVA 1RQLA 2PV7A 4I3HA 1HMVA 3KVOA 4USIA 1NBWB 5EX3A 4UAGA 9RUBA 1QSSA 2DC1A 4Q7QA 4UAUA 1U2GC 3WV4A 4US1R 4KQWA 4Y9UA 4L5CA 2XUOA 3MM9B 1E2EA 4I2PB 1X7XA 4MW5A 1NF8A 5JNTA 1DIAA 5KYNA 1NBOA 4IVQA 1UWVA 5HG0A 5IC5A 3B1JA 4QUBA 1HQUB 2RFLA 1OQ6A 5HROA 1T8SA 4TWRA 2FPUA 1UT5A 5JS7A 2H29A 3VDRA 3OD2A 4GS5A 3VPXA 2ZKLA 4IG3B 1DQ9A 2YWHA 4DV0B 3TLXA 3MBKA 4K2XA 2W2NP 4IWXA 5FFFA 3VWSA 4UNRA 2HMIB 1N2ZA 1MJNA 4WIQA 3GLFA 1JH9A 3I3SR 3GV0A 4OK3A 1KXZA 3JZAA 2Z9CA 4WY8A 2VYNA 2DKOB 4KX3A 2AKAB 2P9JA 1WXDA 1NFFA 2ZSFA 2WICA 4B3BA 1C7IA 4D41A 4XDHA 1P33A 4KV8A 5ADZA 2Z4SA 4AK9A 4EI9A 3JQGB 2AUMA 2Z2MA 3ZXWA 1DAKA 4LFAJ 2RCNA 1Z8FA 4MIKA 1RWWA 1FK9A 4IW3B 4RUKA 1A76A 3ZV4A 2ZUCA 4BV2A 3EDRB 3SR0A 1KEEA 4OXXA 2GN8A 3RRNA 3V6LA 1TK0A 3DZCA 4DR4J 2WJGA 4LTMA 4AUEA 3EGNA 4IHJB 1UWBA 4AD8A 1G3MA 4ABYA 4DA0A 1U4BA 4Z1MA 2JLRA 3ED5A 1F0XA 1K7YA 2A0UA 5KFSA 1QLWA 2MKKA 4CUJA 1JXAA 2ACMA 1OLSA 1RJWA 5D4NA 1XRNA 3LPEA 1ZK2A 5AI4A 2OMOA 2J3KA 4TZ0A 1PAUA 1Z0AA 3FCVA 2HK7A 3F9RA 3K57A 1W36D 3OJ0A 1UIRA 1O6BA 3QW4B 3CF4G 3KLEB 2DM6A 3HVKA 3ZIAA 2EV9A 5HBMB 2BGIA 3CZ9A 4C0LA 2OG2A 4MRNA 5JNLA 2R0QC 3QE4A 2Q4BA 4ECRA 2QX8A 2QN9A 1QAIA 2EVWX 4ENUA 2BZ0A 1MCZA 1OLUB 1TL7C 4OI0A 3GCXA 4C6RA 1XP8A 5JJ5A 2EL7A 1FTNA 3Q2IA 1OX6A 3Q9SA 2HHHJ 4ZU1X 4CMCA 3DBVO 2R6DA 3KT0A 5KG0A 2F43B 2HDNB 2C83A 4F4XA 1RHUB 4JLPA 2ZU6A 3W2VA 4TXLA 3UCZP 4W9NC 3FUWA 4R2LA 3IE1A 5F78A 1IHYA 1ZJYA 1JJHA 2QAIA 4FTWA 5B6JA 5C5CA 5E5NA 3SP1A 4ODIA 3RS7A 1U7HA 5DHPA 2JGAA 1VIYA 1D09A 3BQMB 4D0LB 1D03A 3OQNA 4Z37A 4B3RF 1NPKA 5KNCD 2AFVA 1TTPB 4HDHA 1JLMA 1RKQA 3D3WB 2NZWA 5B4TA 1QHFA 2Y93A 1OIAA 3T54A 2ADFA 4DAEA 2DYAA 3IDAA 3DVSX 4A8HA 3VAJA 3OA0A 3K1AA 4R2XA 1YRUA 4EU0A 3JALB 1IY0A 1QWOA 3HCBA 2Q2WA 4TMVA 4BQIA 3AVOA 4NCIA 3BHJA 3I72A 4PFKA 5TGZA 3ZZMA 2HMUA 2SCUB 3DHEA 3R20A 4P54A 1T26A 4N76A 2ZR0A 2UUOA 5BN5A 3NTLA 2G9VA 1UWLA 4PPQA 1P1HA 5K8CA 3ZOKA 5C7OO 3JAKA 2VTKA 4DL9A 4J6FA 1CEYA 2CPHA 2Y0PA 4DDWA 2O2CA 3Q7SA 2GDJA 3B1WA 3K9WA 1JFFB 2P69A 2CQ2A 1HNZB 1GLGA 5F41A 3L05A 3AJ8A 4IJVA 2WHPA 2ZWVA 3IR5A 1S5ZA 4MJ7A 5JVHQ 3FH0A 1WTCA 4MS4B 5I3UA 3KLVA 2II6A 4RTRA 2BRUA 3IERA 3T3MB 3F6BX 3CTMA 4RW6B 4PR0A 3THVA 5IT4A 3G8YA 1XJ5A 2CFCA 3M3DA 1FI4A 1NKTA 3GEHA 4DL6A 4S35A 3NLCA 5EIFA 1IG0A 1X3LA 3LBHA 3JASA 3QUQA 2GNOA 3FKJA 2ATXA 3TRKA 2QTHA 2BKVA 3U09A 4N8SA 3E8XA 2WM2A 1KORA 3QVOA 4XKJA 5DX8A 3LLMA 5DG9A 5H9EJ 1K73T 3H98A 3Q8SB 2G9ZA 1CQIA 4M0PA 5MN5A 2PLNA 2Z83A 4ZRMA 1K8AT 4UUOA 3FTPA 4PAWA 2MZSA 1FNDA 2CUTA 3UMRA 3NYWA 5A7FA 1E3WA 2K3KA 4K4WA 5KT6A 3D4BA 5JCJD 2FPXA 1NK0A 3NWJA 2HZAA 3KZVA 4O1IA 3V9AA 5DHQA 3HSDA 1CUCA 3NUGA 3X2EA 3GFYA 2H1HA 1ORWA 4MVJF 1Z4QA 3ZCSA 3LLUA 2I3DA 2VHXA 1T11A 5FWYA 1DEOA 4CG1A 4JYMA 1AN0A 2ZJFA 1QSYA 3UAVA 2HEKA 1LK0A 1U1EA 5FB3A 3Q3HA 4ZZ3A 2XUGA 4MJ3A 2W2OP 1EQMA 3SXPA 4LNUB 3DDSA 1PJ5A 2EKNA 2R4TA 4KQFA 1T2NA 1CUSA 4X65J 4W5WA 2OGTA 1TZKA 3AJRA 3DGPB 3QXHA 4J9SA 2JF0A 5LZ9A 1U09A 2YC2C 4MINA 4TY8A 3QPWA 4QEKA 3HP4A 1W34A 1N6QB 4K26A 4KRGA 1TGVA 4Q37A 3L02A 3SQOA 3PRBA 4OHZA 4JBIA 4W8OA 4QATA 4JV2A 2JH9A 3DO5A 3V8BA 4DVGA 3SICE 1P9RA 4ERDA 3CRNA 1W52X 5D3GB 2LXIA 1NN1A 3HA5A 1Z7YA 3IP5A 2REBA 4DNXA 1X4BA 3KSAC 1SB9A 4M0FA 1CQPA 5LP6C 1QX3A 2VF2A 3CZ4A 1FX0A 1KI4A 1YK0A 4J7AA 4GI1A 4Z9YA 4WFBQ 1C7QA 3GB9A 1Z2OX 5J2QA 1YWXA 1QDUA 2YRFA 1J42A 2ZH9A 3PGKA 1VHDA 3WWOA 3GWCA 4IO9Q 3NFRA 3T3EA 1Z18A 3LZDA 1QAXA 5CCEA 5DM70 4U7CA 1FO1A 1B26A 1Y7HA 2ZJ7A 5EHZA 3DV0B 3HFZB 2EGUA 4EB3A 1Q5PA 4F04A 1MSWD 4EPXA 4DV6F 4F9FA 5IXYA 2OXRA 2ODBA 3ZYCA 4R8MA 2P6UA 3UWTA 5IH7A 3HSJA 4YP0A 3ZVNA 3LRTA 2E5WA 4D80A 2BI4A 3L04A 1U6FA 4E4RA 4MSUA 4OM8A 4JLAA 1V4VA 4FYWB 3L7KA 3CJKB 4F72A 2J07A 2FW7A 1XMBA 1NW6A 5FWNA 4QRDA 3ZGZA 2IYZA 4KDEA 4JZKA 3GMIA 4YCNA 1AMNA 1E1YA 4TPKA 1N4DA 2MGZA 1H5NA 4N8EA 4MXDA 5LB4A 3NXKA 5AW7A 5AJ3F 3FZNA 1RBYA 4ECUA 3LC2O 2PG3A 4UDXX 4HGPA 2W6ZA 3L9ZA 4UNIA 3G0CA 1XAGA 3KJFB 1YRLA 1CB7A 3ENVA 5A8KB 4GOMD 4E0BA 3HX9A 3M6MD 3DOLB 4DUGA 4B0OA 4HVZA 5HWSA 2ZVQX 3AKZA 5AO9A 1DJOA 1NNI1 1O08A 3D31A 1VC2A 1WMSA 5CA0A 2Q6KA 1YL5A 5F8JA 2IHZA 1PD1A 3N0RA 1V3TA 1E2BA 1EWKA 3E4DA 3LX4A 4D82A 1J8MF 1ZUD1 3MTQA 2GS9A 1ZNYA 2RH8A 4BDSA 1D4AA 5D51S 4HEA6 1S1XB 2OXFA 3CG4A 3WJAA 4UVGA 1VGYA 3ASYA 4K4XA 1U90A 4WXEA 4YRDA 4CFYA 4YJHA 1Z22A 1LV8A 2R7AA 3KYCA 1NC3A 1JEQA 2UUCB 3OESA 1RT9A 5DLGA 4LHXA 3ESCA 1ZAWA 2X8WA 3HJBA 2VYND 3ZTSA 1KVQA 4RS3A 3D3EA 3AOBA 2X0EA 1QRSA 3SV4A 4EY6A 2BGNA 4X62B 1AK9A 2EBHX 2VRBA 4HPJB 2AXEA 1WABA 5AKJA 3RIYA 1MENA 1ZMBA 3K5MA 3G6WA 4JDUA 3BWMA 3C45A 3ABOB 1EVEA 3TNFA 1O6GA 3CCCA 3FDZA 4KXQA 3AMVA 2GBFA 4BB9A 3PXEA 1H9AA 4M9CA 4E2XA 1JR3E 2HYIB 3CNEA 4FS8A 5CABA 3D3QA 2MSWA 3DBLA 4Z1MD 1LI7A 4IV0A 1FDNA 1SHJA 4BKOA 1T9WA 4NMXA 4Y65A 1XEAA 1ECBA 3KOOA 3AEKA 3ET6A 4LFBB 2OFGX 1WOOA 1Q1GA 4DCUA 1L5HA 1XMOB 3KOXA 1ZS6A 1OXKB 1S8FA 3DCAA 3H8JA 4E12A 3K4QA 5JXWA 2B4TO 1KE1A 5BT8A 3OIGA 3ZIAD 3JS5A 1X0XA 5FNZA 4BVHA 3RSZA 4KFRA 1GD1O 4DU8A 2BFDB 4OQ4A 4C4RA 5JJCA 1BQMA 4P0PB 4QTXA 2W43A 3RS3A 2G1PA 3QSYA 1L7XA 2LDXA 5DTRA 4H4CA 1T1EA 5A0YB 3NR2A 3ZVLA 3T1YB 1ZBDA 3DZBA 4DQKA 1RWMA 2LKCA 3GNLA 1K86A 2Q79A 3DOIA 2H9IA 3HR4A 4O2BF 1K8ZB 1NA5A 3TPCA 1VC6A 3W05A 3NZEA 1ZOIA 1LPOA 4PANA 4QOGA 3L0SA 3QELB 4H4MB 2JFZA 4HQ0A 4F6RA 4LVNP 4NLQA 4X9XA 4WUVA 1VLVA 2B4YA 3TD6A 2C2NA 1S2LA 2JLCA 2P5TB 3EPRA 3A6EA 4X66F 4DLLA 1IM4A 1FHTA 4PGMA 5HFAA 1AZSA 3FPSA 3HKWA 2XO7A 1Y8CA 3BBLA 5E3HA 3HY3A 2V8BA 1Z29A 4W9RA 4AY4A 3HN6A 2F6RA 1QFZA 3K5WA 3COPA 5TS2A 4PUOA 1FDTA 2HDOA 4F0HA 1CUAA 4AVYA 2CFIA 3ZZTA 1LV7A 1USWA 2XLBA 2PMBA 2VH1A 1Q1ZA 3BTSA 5IM4A 4CTJA 1XC9A 3CO0S 4FFWA 1XZFA 2O19A 3G2PA 4TRJA 5TNXA 5BMVB 5HZKA 3LXUX 4JKOA 5KMGA 2Y77A 3IEUA 4LRCA 3WJ7A 4D9JA 2CXEA 3OEYA 2QZPA 1SXLA 3L0DA 4K8RA 2I6XA 1SH2A 1KJZA 3W5XA 4NG4A 1JQGA 1RT1B 1AXGA 1GXUA 1EBBA 2X8JB 2RC5A 4DSKA 4YQEA 1EWRA 1PQ4A 3HFRA 4IJ6A 3OLWA 5BXYA 2UVUA 3G1TA 4U96A 1SBCA 4H1HA 1JU9A 4CU5A 5LDDC 5BPFA 2GCEA 1E6YB 3CJ4A 2C2YA 1P74A 4TYBA 4L6AA 4U5XA 4N7MA 1TK8A 1LWCB 5J9FA 2XMAA 1U5BB 1MHPA 4RIEA 2HSGA 4GSYA 5AOBA 3V55A 5A6WA 3VNSA 1P4AA 1MGOA 2GF0A 3UBTA 4E09A 3WSVA 1XF1A 4JJGA 3K53A 1PRYA 1EFUA 4J2OA 5AXAA 1BE1A 4CJXA 1FMFA 4UT4A 4CLWA 3H4MA 3GFXA 3NWGA 4Y9SA 3HR7A 5AW0A 2Y05A 1JFRA 2QLBB 4B87A 4RYDA 1UK6A 3NIGB 1MH1A 3BXOA 4H7KA 3ZD8A 3N2NA 3ZQ6A 1RKJA 2VA2A 4M0CA 1U0OC 2W7TA 4LT6A 4TN2A 1XALA 2FFQA 4ENWA 1HQDA 1M74A 3BJEA 4G0XA 3H4DA 3E1SA 2WOMA 4DCOB 2B0JA 4GYWA 3IVAA 3NV9A 3QOXA 1YI2S 4Q7JB 3NASA 4EWTA 3M5WA 1PILA 2PMWB 2PKCA 1ZFNA 1AV6A 5D5HA 1N75A 1LNZA 2W2NA 1XMQJ 4AIIA 1TRKA 1OLOA 4MGEA 3OZRA 4DLRA 2YNGB 1L7QA 1ICEB 3ZU4A 4P2SA 4ZGGA 1IZ8A 2XQFA 2GZHA 4Y7DA 5K0LA 3PUHA 5KJCA 2PR7A 4A2WA 2K3IA 2CQBA 1CUYA 2D41A 4QPPA 2WQZA 3Q9LA 1Q21A 2A9RA 3SYNA 4OXIA 4DV0F 4DCPB 3GLHB 3K9HA 1RHKA 3R7LA 1PSWA 2VODA 1G20E 4HWKA 4ER5A 1BWVA 2JLUA 2XXBA 3GCDA 1RHJB 4J90A 4B9UA 4LHYA 2MU1A 4PZ0A 5KQSA 4HEQA 2GJFA 2LDBA 1YZFA 3P7MA 1I0ZA 4LSNB 2OLKA 3NHYA 2CYAA 3SQWA 3W34A 3I87A 1DJMA 2EU8A 4NL4H 3DAYA 3FPGA 2ZYRA 2AJLI 1YTLA 2ZH8A 3I5MA 3CIOA 4ZC8A 3WSTA 2XNHA 3ANMA 5A71A 1H4SA 4E5PA 2CAJA 4XOUA 5HL7Q 1ABFA 2X2EA 4MPJA 4Q1DA 1W8IA 4EF4A 4C8MA 2ZWIA 3N1UA 4X93A 5E6SB 2OKQA 2ZH5A 4IHJF 2AJDA 3G5MA 4IX9A 1NQOA 5FH9A 2UZ1A 4FOSA 5ES3A 3HVHA 1E7RA 4I9GA 5D3KA 4ILRA 4BNFA 5CEFA 3ZVKA 2I4MA 2GN1A 3G49A 3GP9A 2CPDA 1EWTA 3UFXA 1EVQA 4GVLA 3VDXA 5CGZA 3NW9A 4ZO9A 4NLGA 2ZBVA 4IZIA 3SDZA 1ONNA 4B7CA 4D45A 3CCLS 1L5UA 5AW6A 1BA3A 2FPOA 2I2BA 1C4KA 4EY5A 1NK9A 4FCVA 1YNOA 4XDZA 2GD2A 3H5UA 4RQBA 3KUDA 3B2QA 3PGVA 1IN4A 2XYPB 2HHVA 1COWA 5DLQC 1P72A 2E4XA 3C0KA 1H65A 1K0TA 1EFPB 2NU9A 3AA8A 1KRWA 3VKVA 1RWVB 2XI4A 2G9OA 1QH1A 1APBA 4RD0A 1XQYA 2ZAIA 1CR0A 4D5GA 1PTJC 2HPVA 4LJRA 5CX1A 3RARA 4F06A 5HQJA 5JROA 3KZKA 2OOSA 1VC0A 4A6PA 2OV3A 4ZYTA 4HP8A 1IFXA 1RT4A 2HJ9A 3J7Z5 2J6IA 5AK4A 1MAUA 2V4JB 4DF4A 4IWYA 4J9RA 2W2KA 3DFFA 4RIHA 2HFVA 3WHIA 4UDNA 1WVIA 4LJMA 3JAWB 4BNUA 4YRMA 4B4WA 2Y4NA 3ANNA 3DOUA 1RLOA 1JJVA 5ALSA 3JS9A 5EOVA 1EUZA 1VPVA 3OQHA 1RM4A 3ROTA 4M8SA 3GNQA 5BY2A 1VL5A 2ZC4A 3G7UA 4FGZA 4P3YA 1ZM2A 4TTQA 4OVKA 1QQ5A 2DBYA 4HAWA 4OYRA 3VNRA 4RJKA 3E27A 1V96A 4DFKA 3O3MB 3R7SB 3D1OA 1M5TA 2P1ZA 5KTRA 4HDMB 1HG0A 4MVJI 5HM6A 4YO7A 3D8SA 4IGFA 2AC7A 2HHAA 5AW1A 4DY4A 2PM8A 3B6KA 1DJNA 1I94B 4RORA 4NE9C 4UNNA 3ULKA 5KFUA 2WJPA 4C6AA 1HNZF 4OJHA 4N7TA 3DOMB 1Z74A 2REQB 4EGFA 3AUFA 2AZDA 2YNIB 4ALMA 4D3FA 1SIWA 1LBEA 1IZZA 2AHOA 3PZPA 3RR8A 1AQIA 3NEKA 2BHTA 2HADA 4U4AA 2HA3A 3GEGA 3UAZA 4UM9D 3C7KA 2OV8A 4YV1A 5J2NB 4IINA 3LKVA 1ORRA 1S7HA 3F96A 3PRHA 2VTDA 2QU7A 4BU1A 3GPIA 1KDOA 3FG9A 3TNVA 2VT7A 1YDGA 5B36A 3Q0AA 4Q21A 5K3DA 1EJBA 3CCBA 3CJSA 2F3JA 1T0BA 3IO3A 2HK6A 1L7OA 3TPFA 5KREA 3S7TA 2XADA 1A9SA 4RTKA 2O20A 4E6EA 3VTKA 5I7FA 1R5JA 5KTPA 2WHQA 4MAKA 5FEMA 1F6WA 2GVNA 2PRZA 4M6WB 4DLZA 4J3FA 3DNPA 2OELA 3O8DA 4TKTA 2RMKA 5AVJA 4KLZA 1RGVA 1AHHA 2W2OA 5F1KA 3BE4A 2IELA 2DPLA 2NTNA 3MWBA 2HXGA 2L19A 1Z2DA 1RE1B 3UD3P 3FY4A 5TEWA 3KUEA 3WX8A 4V0MA 4HAZA 2GS8A 1LJLA 4JI4J 2WMOB 3OSUA 2AG5A 3D6UA 2PC6A 2DKFA 1N8RT 4Q19A 1TLFA 2JGEA 3TNJA 1N32B 2WU3A 4OFXA 3FN4A 2DF8A 4P3XA 3WJ1A 1MJGA 3L09A 3L8FA 1JJIA 4OPMA 1WF0A 1C8KA 4KXNA 1I5EA 3ELWA 2YQ5A 3BSSA 1VLQA 4BO0A 2W8ZA 3ZNUA 1VL6A 2RGWA 1JJ7A 1PCXA 3EBOA 1R6XA 1IQRA 3DKPA 1GUBA 2F67A 1KDPA 3AOAA 4KQIA 2J48A 4DJEC 4BS2A 3VSAA 1NATA 3KPUA 1RAHA 4LECA 5DMXA 2OFOA 2J6TA 4ED0A 2G36A 4IQFA 3CUUA 4NXMB 1L5MA 4B45A 4XYMA 4GRSA 5HANA 2PD1A 4URQU 1ECCA 1PC4A 1NZJA 3NAMA 4Y3CA 3K6SB 4DABA 1RA6A 3DFMA 4L74A 2G80A 4GRAA 1VQLS 3IEVA 1MT3A 4S1TA 1EB9A 5F64A 1NQVA 1YHNA 1HEIA 1WQ4A 2Q2NA 2F9LA 1SKSA 4URHA 3OO0A 2QZSA 4OX9J 1BQNB 4M87A 5B1YA 1U0HB 2QE6A 3BG5A 4RJ2A 1Q2UA 1U11A 4GT1A 3TM5A 1M34E 4AKTA 2FPGB 3FBWA 3K9LA 4QUJA 2P5SA 2OQ2A 1OX4B 4E3ZA 4EBDA 3FGNA 3WGIA 3LFHA 3GW8A 3ZHQA 1PTKA 2D3ZA 3VVUA 1JPUA 1KQFB 4KN6A 1E20A 1I30A 3SE0A 1UBOS 1GRVA 4RW9B 4WDRA 2OAEA 1R8CA 2UVPB 4BQOA 2WINI 1N6PA 1KERA 2C1EB 4Q82A 5IKEA 3PRYA 3L77A 2PFSA 3P26A 5KFCA 1UFQA 2A0WA 4EKIA 4JR2A 5JCPA 3UA4A 5JQGA 3LJKA 4CO2A 2WWYA 4M0DA 2HNAA 3N2KB 1THMA 3F6RA 1JHQA 4I08A 2ZIXB 4ILEA 2FUG9 1P1IA 3GIKA 1Z7WA 2MJNA 1OY8A 2RJ3A 3U0VA 4HYYA 1KC1A 2QA4S 1IJFA 1XQXA 2NNLD 4ZVOB 1MJFA 2O3SA 3CNNA 1R2QA 4ZVTA 4A6EA 5J3JA 4JASB 4D8YA 4B79A 1ZH5A 1NH7A 1Y5LA 3J81U 4U2GA 2I0FA 1FJGB 3ROGA 4I8IA 1XBWA 1RBQA 1JKJA 1IR1A 2GYYA 1GAWA 4OYPA 3K2IA 4UHDA 3UMFA 3TXAA 1GU1A 3MEDB 3RJ9A 2GD6A 3KL2A 1L4YA 4I7FB 1SL2A 4PQAA 1EJ2A 1P2BA 1JBKA 3D2BA 4BMDA 1C0LA 3IV9A 3TCKA 1FS4A 5BJRA 1GKLA 1FW6A 1A2QA 3TLKA 221PA 4KH1A 5KFJA 2PS3A 5HN0A 2C59A 5G4KA 2XMRA 4WPAA 1Y5NA 3HRIA 4YS6A 4J49A 4F8RA 3C6MA 4D4JA 1C29B 3EDQA 1M5HA 4FHEA 2VJMB 4W8HA 2LBPA 1A95A 5BQPA 1V0JA 4B6OA 3GBSA 5FBLB 3GUZA 3FVVA 3DF9A 3R5BA 1DQAA 4RA9B 2UUCF 3RU9A 5J2TB 4K5QA 3NTRA 4WCVA 3HDGA 1P0CA 2RKIB 3ZH2A 3SYMA 1JAZA 3T7TA 2F9JA 1YIAA 4X62F 4BLRA 2ACEA 2FZVA 3NTUA 1LKZA 4CIXA 2XNQA 5TF4A 4QVIA 1VJRA 2VH2A 1YRYE 2XGJA 3S8EA 4YHBA 4RVHA 3DLKB 1XNRJ 3M9XA 3E2EA 4JI3B 5E7IA 1XEXB 1JMKC 1ZRHA 4F45A 1ONSA 1R8PA 4ZCMA 1M7BA 1X7YB 4GKJJ 5EP1A 1ISSA 2A4KA 3P4UA 3ICCA 1KFKB 3PDJA 5C35A 4JJAA 4IZHA 5AKXA 1DAPA 1CHNA 5EZQA 3W62A 2LP4A 4MR8A 4O3FA 4LFBF 3DV2A 1IMOA 1XMOF 5E33A 2UZ0A 2WF8A 1SU4A 1DWQA 1H5QA 2RHGB 1RWXA 4FYXA 9LDTA 1SG9A 1XR5A 3A1FA 1ZD8A 1RAEB 1NXOA 5KC9A 2Y71A 3U62A 1BN7A 3KB1A 5H70A 1DEHA 3NX4A 1H66A 4DSTA 1FDBA 1WI6A 3BWEA 1COWD 4X85A 2O5RA 2GZ1A 1Y8AA 3M4NA 2XECA 2I2YA 4BKQA 2QQ5A 1VLMA 2VJQA 3LT0A 4KTQA 3T1YF 5EUCA 4EHIA 3FK4A 2XA2A 4QR2A 3VSDA 3W04A 2A2ZA 3GLIE 2O8BA 4EI8A 2VK4A 2ZW9A 3BUSA 5GAEI 5HFNA 3FNIA 4IO1A 2HL6A 1U8CB 1Z7GA 1GQSA 5CU7A 3PNQA 4TRMA 1RAGB 3IR7B 4WDQA 2GEVA 2UYYA 1I7PA 1E9CA 3KR1A 2VQ6A 4RW7A 3OTOB 3WYAA 2D54A 3HN7A 1Y63A 1KQGA 2C0QA 5EL0A 3SZUA 4RUHA 4HH1A 3AG6A 3NT2A 2P77A 3P2IA 5DYNA 3M6WA 3HFSA 2ZRNA 4J0DA 4F93B 2BM8A 1X7GA 1AKMA 3QATA 5KT5A 1NH8A 4UZBA 4MZXA 3FSGA 1FSPA 1XQ9A 3H2LA 1CZNA 4F4ZA 3LCRA 1HD0A 1E4OA 2U1AA 4X0EA 1KS2A 4FMBB 1WEZA 1XEWY 2JJ2A 5A9RA 3I6QA 2R6JA 1MN9A 4OH7A 2DHQA 2ATEA 3QRRA 3L6OO 1L6RA 5CX4A 2D1FA 1W19A 4MR9A 1J6UA 1ZIOA 4DLVA 2GZDA 5H9VA 3BDIA 3LUAA 3M49A 3PP8A 2EFJA 4FFBB 3K9NA 3KQHA 1JQJC 2JFYA 3Q23A 4HVLA 5BMVF 3GH3A 3A9RA 4L08A 1GCIA 3KJNB 2V97A 5CHEA 3INNA 3KKOA 4FNMA 1AUOA 4XPEA 3C3XA 2WFLB 3K0CA 2AEFA 1DELA 3SAJA 1P5FA 2B6HA 2IDZA 2P79A 3EIUA 2VSYA 5AUQA 1ESNA 4RTSA 2WTXA 5BSKA 1T9BA 4AMYA 4YRIA 3TJAA 1RZVA 5DF1A 5A3VA 3UQZA 2BMJA 2IV2X 3FEXB 3UMBA 1JDBB 1ZD4A 2Q3LA 3OJFA 2RGYA 4DIFA 3AR8A 2C2GA 1PQPA 2QX7A 5EFZA 1OB2A 1IEQA 4L0DA 5AKZA 1PDVA 2MYUA 3LCUA 5BNZA 5D6GA 2NUTA 3COVA 3VR4A 4UASA 1R10A 3RGWS 2F9FA 4EG5A 3T4UA 2R8ZA 3FZBA 3TYTA 3GD5A 3KE9A 1XZAA 3RHZA 5FTJA 3SSNA 1PK9A 4Y3UA 2X4DA 5HVGA 1Q0UA 4OL0A 3MEEB 3ZK9A 2C5EA 2I1WA 1WL8A 1WF2A 5M7EA 1P1TA 3G2HA 1XXLA 1H74A 4Y2IA 3K6RA 3KR0A 3RJMA 2DH6A 1EP4A 5E6UB 3QRPA 2VJYA 13PKA 3SDEA 2QMOA 1KI9A 4GKVA 4X1IA 3I01M 4HSEA 4CTOA 4I55A 4IFYA 3ISND 1G8SA 4OFBA 5AXDA 5DU2A 1PEDA 4ZVUB 3ZHZA 4Q4JB 5HKBA 3D8HA 3CVWA 1QP0A 4B9MA 5ALVA 2ZCVA 5CYFA 5I7EA 2FG7C 2LXNA 1M0SA 4DNQA 1T8WA 3ACDA 3EMBA 2VASA 3A4LA 1QIHA 5CAEB 3GF4A 1A5BB 1CZLA 2AN3A 4UKDA 1SFRA 4S3MA 2R8BA 2Q9BA 4YB7A 4XI9A 1GGVA 4IH9A 1W25A 1TJNA 5HMWA 1E5TA 4NYJQ 5YASA 2I3BA 4BBJA 1WXQA 3LYLA 3M2VA 2NWQA 2JEJA 1SVDA 4BEWA 2Y0BA 3FVYA 3CF2A 4B9TA 4O63O 3SCIE 4Z9FA 5DDOC 2CJBA 1OZ0A 4P74A 3RB6A 1B6SA 4KQGA 1C8VB 1C7ZA 4J29A 3ENKA 5ILGA 1GZSA 4WXHA 1VKJA 3IUJA 3BK7A 2FD2A 1Q8KA 4J9OA 3WDMA 1O9BA 2IQIA 4DLUA 5HQLA 2EI5A 4TTSA 3U3KA 4L4UA 1JG6A 1KOFA 1IR2A 3P9PA 2C2BA 2RE8A 4JLKA 4EX7A 2WVJA 5D15A 2QVYX 3KQMA 4KSEB 2XBLA 1Y1PA 1KJ8A 1N8TA 3G0GA 2CSUA 1P2SA 3DU5A 2W48A 4RGYA 1NKBA 3DD1A 1O2DA 3Q9NA 3JAMU 3PKIA 3UGJA 4F8EA 5KQLA 3T1TA 1XZGA 5CVEA 3IRXB 1JLEA 3O4FA 1QV9A 3H6HA 3VU0A 2HBQA 4DA9A 4D0RA 2JFOA 2PI4A 2R8XA 3JZFA 1NV8A 1RU2A 3IIIA 5EVCA 1IM5A 2XMVA 1V3SA 3WLHA 4A1OA 3A36A 1GQRA 4OGLA 1QTMA 5BW5A 2V69A 3Q0IA 5LYJB 2SBTA 1PT8A 3L7CA 4EZBA 4BJHB 3RUHA 2R1ZA 2EFEB 4OJMX 2HVIA 4W7SA 3Q5GA 2GO7A 4MK9A 4R69A 1SC3B 3A6HA 3L9XA 4IFEA 2XWBF 4YFUA 2E0IA 3AFGA 3CLRC 4ASUA 4N5NA 4YV2A 5JMNA 2XE7A 3EQ7A 5GVRA 4BVKA 3VR5A 5CT6A 4KACA 1AIPA 4B6EA 5FBZA 3H05A 2IXGA 4EO9A 2FPPB 1A72A 1UEJA 2C7RA 5DO9A 3MTJA 4B8WA 3ZDBA 2C2OB 2GW8A 3HP1A 1DIGA 4KDRA 1IOVA 1NBME 4BO5A 5DYYA 4U95A 1UJNA 4L3OA 4WHMA 1SA0A 3ZLBA 1NDKA 4J4HA 2HGZA 2EJTA 1SUQB 4AYTA 3JQ8A 2C8JA 4M9QA 5EWMB 5G0UA 5CEEA 2ZT8A 2JVOA 4YCLA 5J1NA 3IBGA 5E7QA 5P21A 1EU1A 4LR9A 5E6RA 4QELA 3P5BA 1S0VA 2ZAMA 3LTOA 4C4ZA 2WK4A 5C5EA 3L7PA 4LQ3A 1GYQA