3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tk-subtilisin
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
2ZRQA 1GCIA 1ZVKA 3I2YX 1ST2A 4CFYA 4K8RB 1P7WA 2Z2XA 1PEKE 3LXUX 3D9QX 3DYBA 3DWEX 4K8RA 2PKCA 3GT3A 2P4EA 3H42B 2WV7A 1Y1KE 5AVKA 1SBTA 2PWBA 4B5LA 1PJ8A 1XF1A 1SIUA 1A2QA 1MEEA 3QTLA 1AH2A 5AVJA 3A3NA 2IXTA 4LVNA 2Z30B 4Z2AA 1IAVA 1ZVJA 3I30X 1GA6A 1EGQA 2Z30A 4NMXB 1AV7A 5K7SA 4DJ5X 2Z56B 3WIUA 3DVQX 4I0WB 4NMXA 2W2OP 1SPBS 3GT4A 3DE3X 2Z56A 1AF4A 1KDZA 1Y4DE 1SUCA 1TM7E 1SELA 2QTWA 1BJRE 2W2QA 1TM5E 2IY9A 1C3LA 3A3OB 2WUWE 3AFGA 5AMXA 2DUJA 3A3OA 3T41A 1YU6A 1NDUA 1OYOA 1SCAA 1SUEA 1T1IA 2W2PA 3DE1X 4C3VA 3SQOP 3AJ8A 1P7VA 1SPBP 3Q5GA 1Y3CE 2SECE 1SH7A 1R0RE 1GA1A 1SCNE 1YJAA 4DZTA 4NE9C 4JP8A 3DE5X 2Z2YB 1SBNE 2PQ2A 3ZXXA 1CNMA 3GCXP 3EIFA 3EE6A 1IC6A 3DVRX 2TECE 3TECE 4CFZA 4RYDA 5JXGA 1TECE 3DE6X 1Q5PA 1V6CA 4OMDA 1V5IB 1HT3A 1V5IA 1S01A 3VHQA 1CSEE 1VSBA 1BH6A 3DDZX 1GTL1 1EA7A 1Y3FE 3PTLA 3GCWA 4KPGA 1GT91 2SICE 1Y3DE 4J94A 1C9MA 2XRMA 1BFKA 4YN3B 2XTJP 3H42A 4HX2A 2V8BA 3I37X 1R64A 1SUPA 4YN3A 2DQKA 3BPSP 4OV6B 3F7OA 2Z57B 2PMWB 3L1KA 2W2NP 2W2QP 1SCDA 3CNQS 4WOBA 2PMWA 1R6VA 2W2MP 3SICE 1KE1A 1GTJ1 1BE8A 5ARDA 1PTKA 1C9JA 4H6VA 2PWAA 4MZDA 4M1ZA 5JXIA 3CO0S 1S02A 1Y48E 1SUBA 5FAXA 5FFNA 1NLUA 2ZWOA 2WUVA 1SN7A 1YJBA 3EDYA 3P5BP 1P8JA 1GNVA 1DUIA 5CW1A 2ID4A 1THMA 3A3PB 3QMPA 1WMDA 4KB5A 3ZXYA 3A3PA 5JXJA 1UBNA 1BFUA 2W2OA 2HPZA 3WIVA 3CO0P 2Z2YA 5SICE 4LVOA 5B1EA 3OSZA 3D43A 4ZARA 3I34X 2B6NA 5FBZA 1ITPA 3DE7X 5JMOA 1KE2A 1SIBE 4GI3A 1TK2A 1Y3BE 3LPDA 4KG7A 1SUAA 2SBTA 3AJ9A 3VSBA 2GKOA 5ARBA 4HVLA 1TM4E 3SQOA 3PRKE 3VYVA 1S2NA 1OYVA 3DE2X 3F7MA 3DW1X 1MPTA 2Z58B 1SCBA 1WVMA 3GCXA 3DVSX 3WHIA 2DP4E 3BX1A 2Z58A 3BGOS 4OV6A 1C9NA 1Y4AE 4NE7A 2Z57A 3A3NB 1WSDA 2X8JB 1LW6E 2W2PP 4C3UA 3DW3X 2X8JA 4H6WA 4BWGA 5I9SA 1SCJB 1TMGE 4WOCA 1SVNA 3TI9A 1SIOA 1SBCA 1SCJA 1BE6A 1NDQA 1DBIA 2E1PA 1Y33E 2G4VA 3DE4X 1WMFA 1YJCA 2XTJA 3BGOP 3CNQP 1GTG1 2QTWB 3BPSA 3HJRA 2HD4A 1Y34E 4FONA 3DE0X 1TO1E 2W2NA 1SBIA 1OT5A 5B1DA 1Y9ZA 4NE9A 5JXHA 2W2MA 1GNSA 4OMCA 3GCWP 2ID8A 2PYZA 2ST1A 1SBHA 3LPAA 3VV2B 3UNXA 1TM1E 3Q40A 1GA4A 3VTAA 3VV2A 4ZOQI 3WQBA 3F49S 5AQEA 1WMEA 3LPCA 1AQNA 5ARCA 1TM3E 1TO2E 1AU9A 3QFHA 1SUDA 1KDYA 1AVTA 1JEAA 1ST3A 4AKTA 1T1EA 2SNIE 1KDVA 3VV3A 3TI7A 2PRKA 1T1GA 1AK9A 4AKSA 2ZWPA 4H6XA 1PFGA 2Z2ZA 4CG0A 2WWTA 3P5BA 4DWWA
chains in the Genus database with same CATH superfamily
4IJKA 1GNTA 2QOEA 2WUFA 2V3CC 4FCVA 2OCXA 1M0EA 2A9KA 3LXUX 1RM4A 1OBOA 3ZCPA 4TUYF 4QRHA 1JMVA 4MP8A 3E70C 3FMVA 4KQWA 4MYSA 5CVJA 2MKYA 2AR0A 3GU3A 5FIIA 2IEGA 2WVCA 1I6LA 3L84A 5IAGA 3G1TA 2GJ4A 1P2UA 5F9HA 1QLWA 4RBNA 2ICAA 1WG1A 3PPVA 2LBPA 5KYUB 4TS9A 5F7OA 1JSCA 1ACJA 1H05A 4FDAA 3LLVA 5KCMA 1MMNA 4AG6A 4CLSA 1XZHA 4DSNA 2VA8A 1QIDA 1IQUA 3E84A 1ATIA 1SC4A 4QWAA 4R8UA 3L4SO 5A5EA 4BN0A 4RQUA 3HLUA 2I4LA 3ICOA 2B3TB 4DSAA 4OAOA 3DT8A 3ROMA 1A9TA 3A10A 1I4WA 1QOZA 4BEWA 2BGTA 1A4IA 1HDCA 3JQBA 2Q07A 1KI6A 4ITRC 1KHTA 1QF7A 2NU6B 3WE7A 2XDYA 3R6GB 4RVSA 4BO5A 4Q9HA 4ZAWA 4JV0A 3T3FA 2PR2A 5EFZA 1RQNA 1QRUA 2QA4S 4N8NA 4CM1A 2FPLA 2RGGA 2P9TA 2JOQA 4OX9F 4ZYWA 3LTNC 4RMJA 3HA5A 4OHKA 2IE0A 2Z0MA 5JVDF 5KCZA 2VP0A 1WC1A 1SUSA 2B4YA 2OM6A 4EW6A 2CNLB 2C78A 2UZ0A 1DAHA 3ADBA 1CS4C 2WF7A 5G1NA 3I96A 3I9JA 4YMTA 4I50A 5LMUF 4DY6A 4PS1A 2ZYHA 1TAHA 5HDQA 2JJ1D 3L6CA 4YN3B 1G4CA 1BDBA 1GXUA 1QYDA 3QLUC 3ONNA 2Z98A 1ZHOA 5MN5A 2V8BA 4B0OA 4ND5A 1GZ5A 2DIVA 3PB3A 2LIVA 4UTNA 3DHYA 3R27A 3IKJA 5I01A 2J4FA 3VZIA 1SCDA 3GJSA 3L7IA 2YNMD 1VDZA 3EH2A 4O25A 2BM8A 4BDPA 2W9CA 1Q7EA 1OTHA 1Z8FA 1MB3A 5LMZA 4JLBA 3DCIA 2A1UA 2QE6A 1YVPA 3NX4A 4ZVNA 3MTQA 5BWOA 3D3CJ 1K0VA 5FLXU 2AEFA 3MMAA 4JBNA 3AJEA 3RWMB 1M2GA 1FU4A 3AY7A 1EBUA 2XSFA 1T05B 2QLJA 4CTNA 3WJAA 3ER8A 2BM0A 1FQOA 1OAOA 4BQEA 1VBFA 4L3KA 4KODA 1CG2A 4X45A 3DO5A 4PWWA 3EIEA 4B08A 1ORDA 2ZJPQ 4K9OA 5A1TA 3OXLA 4PSVA 3SE7A 1GKUB 3DUWA 4C4YA 4J9MA 2RI0A 4IGAA 1PBTA 2D1FA 3I34X 3M6FA 4FWBA 3QPWA 2N3ZA 1N5KA 4GIBA 4A0HA 1VCNA 1AA6A 1XQYA 4G8DA 5FPSA 1TZMA 4EG4A 4JI1B 2QE5A 3G88A 5E3IA 5DBHX 3LBFA 4YRPA 3IOEA 2DLNA 4UEKA 2AZ1A 3NBFA 3BSAA 3D4JA 4U0KA 4H54A 3GLIA 2HLNA 4JC8A 1DWUA 3NIBA 2H51A 4HJXA 1ZGZA 1FW8A 5KREA 2ZKUA 1M76A 1PSZA 2XMMA 2XB8A 3I76A 4EGAA 4NBSA 4KQMA 3V7NA 4H1VA 4Q9JA 2LEBA 1VISA 3TLYA 4US1R 5CQGA 1HWKA 4KWHA 4ZK2A 2D2FA 4LBWA 4DLZA 4ZVGA 2HJRA 1X14A 4D2IA 1FJHA 1ODLA 3HVHA 1WF6A 2J3MA 1OUMA 2B5VA 2F62A 2IOHA 3USES 4WFYA 4NL5A 2VEOA 5COBA 5F8NA 1Y5LA 4B9UA 4LE1A 3RVLA 1JEDA 1VBNA 5GAJA 5FLYA 3CGGA 4DVGA 1WOYA 2WG2A 5AIAA 3G6XA 3R7BA 2VPYA 3MMPA 3KLGA 4R51A 4MK7A 3KLEB 2XUGA 2YWHA 1P2BA 3IQGX 4M94A 2OCBA 1A9XB 1Q20A 3VTAA 3ZHCA 1RS0A 4PRFA 2G9UA 1NNEA 4GH5A 4NXMB 4MVJE 5JS8A 4B46A 1TK9A 1TDJA 5KG3A 4TTTS 2C3MA 3ZDCA 3BPDA 1CZLA 3DMFA 5HF9A 3IILA 2JANA 1NIJA 3GEGA 3I4HX 3O93A 3PTZA 2OEJA 3F3SA 3DBVO 1K0TA 4B48A 4X1IB 4C03A 4JSYA 1Q7RA 2NV6A 3CZMA 4PZLA 1JLGB 1IKWA 3NW9A 3R40A 3OZTA 4N5NA 3U9SA 1EDZA 1GPJA 4DUZJ 4JI1F 3UN1A 2E5WA 3WMWA 1BA2A 4CM8A 4JXJA 2X1GA 2ZJ2A 1N5QA 4ZEOA 4L3NA 4LJKA 3GZJA 2AKAB 5IVIA 2D1CA 4DXAA 4R9UC 2AWNA 2FYXA 4PW0A 1E1RA 3D3JA 2BKNA 1E8DA 1FXRA 1DV1A 5M2UA 3EPHA 2YWKA 4NYJR 1E61A 3W7VA 3BG5A 3PXUA 1IH8A 3RVSA 4L85A 4PN3A 4C4ZA 1C3LA 2NU8A 1WZIA 1WCV1 4RD0A 4HQLA 4R5PA 3FN4A 3J81Y 1QCYA 4F5WA 1TMMA 4NEZA 5IC6B 1C8LA 2ZC4A 2DLDA 5FPQA 1ULSA 5EHGA 4L4YA 1V4NA 2ZDOA 3Q12A 3HO1A 3NGUA 2I55A 1X7XA 4FHGA 3QLJA 3UH0A 3AIOA 1RTTA 4A91A 5JSZB 3I5UA 5JXGA 5C25B 1TW3A 3DULA 3AKCA 5HCIA 3NNNA 2HPUA 4GX0A 3NHFA 2ZOMA 3T9NA 3U4GA 5D8DA 2I4MA 4M0KA 4I1YA 4CT5A 1R1DA 4K9PA 2ZQZA 3IXMA 2QLFA 3KKZA 2CYYA 3FKSA 2CT8A 2PS1A 4PONA 3QSYB 1NVVR 4AXBA 1CPZA 2HDHA 4MGEA 3FCVA 3I37X 4U7FA 1RI4A 1AGXA 5EKDA 4DPYA 1Y6FA 2ONCA 3HJBA 4JOCA 1FYDA 4G5YA 5GADI 4HDSA 3EZUA 4CLUA 4GOXA 4XIJA 3VI4B 2ADFA 2C1EA 3BSYA 1XB2A 4UNSA 3GVIA 4X2BA 1WBDA 5HMXA 4DR6J 3BR9A 1KFEB 4K4VA 2V8DA 1LC0A 1FTGA 1W4LA 5AJYA 1XKTA 3VH1A 4RK7A 3S01A 3RUIA 4H4CA 1RYFA 1RWWA 1NNDA 4P3XA 1Q0UA 4DV7J 5CVCA 1XX6A 4UPDA 2DPHA 4QU9A 1OAAA 1I7LA 4L0DA 1L5FA 1ZXBA 4D41A 2GLUA 2AK3A 3WYBA 3MMZA 4YYEA 3UHFA 4LIWA 5KNCA 1LFAA 2WUEA 1MH1A 4FNHA 3R3HA 3VGUA 4UFPA 2NUPB 1GNVA 4PO3X 3WC4A 4IX1A 1GTHA 3MMSA 1S0OA 3WBJA 4E2FA 2D74B 1R50A 1IHPA 4P58A 3B8HA 2NV0A 3L0SA 1KEPA 3FMOB 1EX1A 3MJTA 3EDMA 4AWAA 4UMVA 3CJ4A 3TYXA 3OPKA 2V4QA 4WA8A 4MV9A 2MKCA 1JXMA 1EE9A 4YLYA 3SS8A 1UKEA 3OBBA 3HSGA 4LCBA 4AS3A 1SBQA 4M0CA 2P67A 3A6FA 1K63A 2QA1A 2NYAA 1JG1A 3BF4A 3M4NA 2O4UX 5KT2A 3B48A 3F46A 4Z9XA 4XW2A 3ZWWA 1ZC4A 3EE3A 3ET6A 1RHJB 3O84A 2DPGA 1EQUA 2LCIA 3STXA 2GN0A 3I5AA 4BFXA 4CVNA 5AJVB 1H22A 2GFHA 1VA5A 1WULS 1Y5IA 3CRQA 1B76A 3OM0A 3L0ZA 1CUIA 1X5OA 5ALKA 2A0KA 5CABA 5KOIA 1OQ3A 3H2VE 3BFJA 1ITZA 1GMWA 1KOHA 5J1NA 2ZZMA 4YLGA 3ZOZA 3VC3A 3N2KB 1WELA 3RU3A 2FLVA 3IE1A 4ZYYA 3G0HA 1JU3A 3ONDA 4ED5A 1VL0A 1YJCA 1NAHA 3GLIE 1W26A 2OHGA 4UT4A 2Y1FA 3CNQP 3AEZA 5DM70 3HJFA 3KVRA 5GV8A 2JBHA 2B6AB 3M9XA 1ONSA 1TK5A 1T3HA 2FLKA 5LD2B 3N0WA 4MWEA 1TKXB 1JR6A 3LC7O 2L69A 1PT9A 2CNNA 5F7JA 4NLLA 2O8BB 2FXIA 1PT5A 5IS2A 2DHGA 5JH7A 1Y9JA 1O6BA 5HCNA 4KBFA 4QRIA 4ZHQA 2IPAB 4PHCA 4K9LA 4ARCA 3AVVA 1KF0A 2DVIA 1O1YA 3B54A 2DHXA 3SFTA 1CEEA 2OGZA 2QV6A 2J48A 3NAMA 3S3TA 3IALA 1OIVA 1AS0A 2VZLA 1H8ED 1OI2A 2JDID 4NEHB 3VNVA 4MKZA 4M5IA 1H2UX 5AI5A 2BV3A 4NV1A 1BQMA 1N5MA 1YJQA 2BTQB 1LV5A 4QBGB 2H54A 1FFEA 4RTLA 3N9UC 1KZ1A 1OKKA 1L7PA 3THOA 3OETA 4Z5XA 1V35A 3CB4A 3D6FA 4Z7CA 2HV9A 3LYHA 2B7CB 1HQ2A 5D3GB 1NC3A 5T8KC 4JUZA 1A7KA 1FRVA 1YK1A 4ZO9A 2GPTA 3C8MA 1ID8A 4W9MC 2RE8A 4NBKA 1ECBA 1JEQA 1CQIB 1LSOA 4DSIA 3AEYA 4BKUA 3LRXA 1Q1KA 2WU3A 3MJVA 5ALOA 1FYWA 5KG5A 3HKDA 3A1UA 1B2RA 2IS6A 1W2GA 2HEIA 3W8PA 4C78A 1UK6A 1Y4UA 2BI8A 2Q3BA 3S5JA 3ONVA 2MINB 3N2GB 3AB7A 2AGQA 1N34J 4FGKA 4KDEA 3QMVA 1NDCA 5ETJA 4PXCA 5JWOA 5BN4A 4MUXA 4RD4A 2GHRA 3MWFA 3CLVA 1K9SA 2P9ZA 4B4DA 4QELA 4I5IA 1D0SA 3R6LA 2DEJA 2VFVA 3TX8A 4O4IB 1Z5NA 1JHPA 3PF9A 3FRHA 1WB6A 5EIHA 1EE2A 1MB0A 4J7AA 4WNAB 1KDOA 1RUSA 1AQ6A 1BS9A 2BJDA 2GCIA 2D3OR 2BYCA 3NOXA 4TT3D 5B7PA 3Q85A 4JLJA 3PVCA 3I0SB 4BQPA 3H98A 3ZBPA 2P90A 1RAFA 1AK1A 1BXZA 1DBVO 3WHLA 3KSRA 3C6TB 4QASA 2DR7A 5E9WA 3MGCA 1BY9A 4DLUA 1SU6A 4B8WA 3DKKA 1B0TA 3SE0A 1ZUD1 1QVZA 1KPGA 3NWRA 1Z73A 4IV8A 5E2QA 3FMWA 2XCSB 5KWJA 1U99A 5IM0A 1PEAA 3BJRA 4MJ7A 4FYWB 4ND3A 4XB2A 4M7PA 3LGAA 3NV7A 1JKXA 2P65A 3BN7A 4JI5B 4N3GA 2OEMA 3E2PA 4LRUA 5LVAA 4B84A 3RYHB 1P9WA 1KOLA 5FV4A 2ZTVA 2B8JA 2XNJA 4MOWA 1GMVA 3KVOA 4DL4A 1IUNA 3JQKA 1N56A 2D9PA 3RHSA 1W6UA 2JX2A 5EAIA 1F0KA 4L7QA 3CRW1 3IIKA 3PYEA 2H0QA 2CPDA 1ZDMA 1TOAA 3W61A 1ECJA 1RWOA 2XMRA 2E5FA 1HBNA 2D0OB 4RVCA 5DDQC 2B5JB 1UBNA 2ZB8A 2HPZA 4BATA 5GJVC 3OQBA 2HRYA 2RHRA 3GIIA 4LF9B 3WK6A 5IVPA 4QFMA 3RGGA 5HKOA 2X2OA 2JL9A 2C99A 1XBWA 3MFIA 2VDHA 1N48A 3RS3A 3RLIA 5KSYA 2WHPA 4ZOBA 4RKEA 4RTMA 4F4YA 4PYRA 3C8YA 4OKNA 1URRA 3E5HA 4PSAA 4V39A 4BGUA 4DQRA 2W90A 1QWSA 1WABA 2GBFA 5EGYA 1T3LA 4NQRA 1WOOA 3UJAA 4O4IF 4BQNA 2DR2A 3C0KA 4CNBA 3COPA 3EGIA 4LFCJ 4KR2A 4R1UA 1T4MA 2GX6A 1Y4AE 3P26A 3EGOA 2IM0A 3LY9A 4EAAA 1ML4A 1Y6ZA 1RGVA 1U1NA 4AULA 1N32J 4C76A 4H6WA 1AT1B 1RKJA 3OZDA 4QWEA 5I7UA 3KAQA 3KTFA 3K2BA 4DPXA 1NJYA 2O8FA 3EXHC 2A9JA 2PLNA 5CVVA 1KR4A 1S49A 2BI7A 1WZEA 2X7JA 1E2IA 2G4VA 4OJHA 1VZ2A 1DCTA 3TO8A 2B99A 4Q4JB 3FDIA 3PL5A 1JLQB 4E0DA 2VP5A 2VJLA 3IJEB 1VC6A 3QJJA 4R16A 3SP1A 2NQPA 3QE4A 1HG0A 4WZZA 3KFWX 4XLZA 4DQ0A 5E3RA 3ZDYB 4JI5F 4OX8A 4UOCA 3ZXWA 2WAAA 3IAFA 1N0IA 5EI5A 1IRIA 5T41A 1X74A 2ID8A 2F4VB 1XIVA 5JCOC 3W66A 4CDRA 1UZLA 1STOA 1VCTA 3M8WA 1TZBA 2FJAB 1COWD 3QFFA 2FPIA 1EFTA 1Q8KA 2GNAA 4EBBA 3C6YA 3WXBA 4OY3A 3AZQA 3V7YA 3QO9A 3B5EA 3TQHA 1WXFA 1ISSA 2DKFA 4CLOA 2RGCA 1N7GA 1OLXA 2XYVA 2RKOA 1W36D 4LF9F 4C43A 1ULBA 1LV8A 4C4WA 1KYQA 1CF4A 1X4EA 4TY8A 2EWHA 2ZIVB 1T3TA 4NYPA 3AONB 2Z2MA 4DV5J 1R0BG 5B6IA 1BE0A 1G4UR 1XP8A 1XJ5A 3WHPA 1NVKA 4E5SA 1LBIA 2VO1A 1SIZA 1V3RA 2UZAA 4HQOA 3OIDA 5KB3A 5J2QB 3M6AA 3CF4G 2PZMA 3EF0A 5BXQC 1ZGAA 2ZC3A 1ZZEA 4XDDA 4BNYA 4NPAA 5KFTA 3PJDA 2QVZX 5A4FS 2HWYA 2G09A 2ETXA 3E9DA 5KNLA 5FPTA 5I9TA 1GG5A 1HL3A 4JB8A 3BJZA 5K3DA 4TL7A 6NULA 4FDUA 1Q0ZA 5AXKA 4LYFA 1K8QA 3MQ2A 3O82A 2AUTA 3HXTA 2MZTA 1IMJA 3EA4A 3BULA 4W1PA 1SH7A 3WKDA 4C30A 1RAGA 4Z4IA 5CYOA 3M3DA 3C41J 2ECOA 1JQKA 1M6YA 2M6KA 3H5NA 1H2EA 1PT6A 4MLPA 3DE6X 3BB4A 3WLRA 4DLBA 1WSVA 4KGXB 3T4XA 1R6YA 2PFKA 1O0PA 2F4VF 1ICEA 5DM60 3R76A 2B0GA 2Y4NA 5CD4A 3CC2S 3GGCA 5IYZB 2RH3A 5DX8A 4KU4A 3T9BA 1S2OA 4CV3A 4V19J 3N76A 2IY7A 1K4KA 1K6IA 1TF5A 4NNPA 2ZNZA 1NNUA 2GXSA 5FA5A 1NRKA 3IMQJ 3DWGA 2ZRPA 2QTHA 2PUAA 4GQBA 4U7UD 3B2QA 3U3MA 3LMKA 2PMWB 3EVAA 4LC9A 4I1RA 2V6GA 2W2QP 5G40A 4BNDA 3DKRA 1TXGA 1GUFA 1HD1A 4W63A 3F41A 4NF2A 4ZOSA 1WPRA 4U8HA 3NASA 1NXWA 1G66A 4JOBA 2HNYA 3LYAA 4PHHA 4ZU1X 3D3NA 3HB5X 4KQGA 3HK2A 1EP3B 1KFSA 4PC6A 1H0HA 2VRNA 2DJWA 3QV2A 2N47A 1T9VA 5C3UA 1RWVA 1P73A 3P4UB 3LT1A 4HXYA 4MP3A 1G21E 5BUSA 4JI8J 2E9SA 4X8LA 1EP2B 2WSMA 1JN0A 2JLQA 4YREA 2W6OA 3LANA 2IHNA 1M1ZA 2R7XA 1PWHA 2W8LA 2ZSKA 3ZXYA 5JXJA 4KLZA 5I48A 2O23A 2YNMC 1ZD8A 3RQIA 3ZLUA 1FB5A 4G5GA 4TV9F 5BVGB 2H1CA 3HDYA 3ZO7A 3UUGA 3VVUA 1CUAA 2VJMB 2LPMA 2VJYA 3P9QA 4O3QA 1Q1NA 4ECAA 2OPHA 4G3IA 2HSJA 5DZ6A 1C0LA 2HSEA 3KOOA 4I19A 3JAWA 3ETJA 4KTTE 4AX4A 3TQOA 4IS3A 5CA5A 3FMGA 1K6EA 3GMSA 2GCGA 4NA3A 1A6LA 4N7JA 3F6SA 1UANA 4PQGA 3ONFA 3ASUA 3DB1A 2ONKA 2CG8A 1M2OB 5ADHA 1KO8A 2EVWX 4E31A 3RIXA 3RS4A 3SJ7A 2AHOB 1Z3CA 4CMIA 2EJWA 3PJFA 5I5EA 4P53A 2IM1A 5BSEA 1SJQA 1IYZA 4Q82A 3HB1A 3G6ES 4L6CA 1Q7LB 2LU1A 4ZI3A 5A0TA 1IATA 3H5OA 2OO7A 3IKMB 1IM4A 2B1QA 4TQUS 2E1PA 4MW0A 1D2GA 2R7LA 4IUYA 1HF3A 2PBRA 3DTTA 1VE7A 4Z8YA 2X3GA 1SKUB 3BH6A 1BDMA 1N7IA 1NK0A 3IX7A 3B1VA 3AIKA 4JUDX 4JA2A 3ROGA 1SXHA 2IWRA 4CKCA 1T10A 1FVHA 1F6WA 3FPHA 4L78A 3RSOA 2YWDA 2XS5A 2YMLA 3H1BA 4LOJA 1GPDG 1RPZA 1PNTA 3N5BA 1C41A 2RS8A 4QM7A 2QRQA 1G0NA 5BSRA 3EBOA 2O3SA 4YCCA 4QG3A 2VTKA 2F43A 1OPRA 1CE8A 3E58A 2B8QA 1TFRA 5DXFA 1T0PA 2BR5A 1TKZB 2XOKD 1BJTA 2IP1A 2QIPA 3IFEA 1FP4B 5BNZA 5EIAA 4LCJA 4GOMD 2VFAA 5I9IA 3LCUA 4MKXA 3F2VA 5C18A 1FRJA 5EDWA 1MAUA 3N05A 3PHEA 1TL1B 3HFVA 4WFXA 4QNNA 4Q43A 3W05A 5BNIA 3VAJA 3AUAA 4LWZA 4LJ6A 2FF5A 2Y1WA 5CCBA 1RYBA 4UU8A 4J49A 2CAJA 4JT4A 3PHLA 3DEIA 2PUFA 3R5HA 3AFIA 4IW3B 5DIZA 5KQPA 4NH4A 3TOQA 3VDRA 1JE0A 3TRHA 4MQFB 4QXPA 3GNLA 3ZOKA 1CTQA 1W52X 1MLDA 3C7AA 3DMDA 1MJFA 1V3SA 3DVQX 4A8XA 5LJ3Y 5GP1A 4JY7A 4AZVA 5JS6A 4EM6A 5B4VA 3LDGA 2YDXA 3NCQA 2GK4A 3MT8A 1TYCA 3A6JA 3GQCA 4JX9A 4KYZA 1CSJA 2A78A 3E01A 3SCKE 1DV2A 4XWGA 3QG5A 1HFEL 1J56A 5CNJA 5GVSA 1XLVA 4F06A 1SU8A 1NVDA 1YUMA 2D5CA 3I9KA 2GD2A 2P1DA 2D8MA 1JJIA 3I0NA 3LTOA 4G5XA 2G08A 3NT2A 4TXMA 1QO0A 2DY1A 3F74A 1WP9A 3GLFA 3SQGA 3P9CA 3V8BA 2VUSA 4Q4HA 4TMXA 1T8EA 4LJLA 4IDOA 3MCVA 2JKVA 4LISA 2CMFA 4N0QA 1FK9A 3D2WA 3DGEC 4KGVA 4TXLA 1HSOA 2NSDA 2E9ZA 1QGUB 3IPLA 4B3FX 4CKZA 4DTIA 1VPVA 2ZI5A 1RADB 3A6KA 4AECA 5CDYA 4FE7A 4ANDA 2Q46A 5L51A 4KQZA 2VKZG 3AVUA 3DOLA 2VN8A 3S2YA 2D62A 4N3BA 2C3PA 2GBLC 3GIDA 4UZEA 3BN4A 3ZXUB 3ZDQA 2EBFX 3AQPA 4RIGA 4ENWA 5JQGF 1J0DA 1RHKB 5LBIA 4IFYA 4R54A 2MU1A 1GNLA 1G3RA 3PPXA 3LO5A 2VA9A 2IYPA 1BD3A 2GYWA 4LJAA 3PUYA 4ES2A 1M1UA 1XSEA 2LCWA 4K2AA 1DINA 4QLBA 3SSAA 4H6VA 4GR5A 1ZCJA 1N5OX 4USJC 3VGVA 1ZNWA 4ZT5A 1Q4RA 3LP5A 4BQOA 4MW5A 2EG1A 5L39A 5KWEA 4LF8B 1DO0A 4HUQB 4ZA2A 2QX8A 1NBOA 1M0WA 3N5CA 2E5GA 1L7AA 3ZY3A 3UMCA 5G0TA 2DNNA 2ZBDA 1ZHHA 4W7SA 3FYSA 2GVNA 3EXEB 3AM3A 4Q48A 1KAGA 3BMQA 3LO3A 4ID5A 1SVKA 4KN9S 3TTVA 1NY5A 4LX0A 2HDWA 3ABSB 2SXLA 1QIFA 3D3WA 3E15A 2C4UA 6ABPA 3H11B 3D2CA 2QB5A 3K4PA 5A9SA 2PGNA 5IT4A 4O4LB 4HD8A 4ARVA 3E48A 1RE1A 2YBDA 4GVBA 3EDRA 4Z2XA 3ZU5A 1YASA 3RS2A 5JZMA 3T3MB 2YXEA 4XYLA 4UM9D 5FRDA 2MQMA 4DTCA 2GJFA 4D4LA 3B1XA 4PGHA 4EMSA 4DWVA 2Q6VA 4TLCA 1QHHA 3FPBA 3R24A 4JUIA 2J67A 2EKZA 4QVKA 2Q28A 2OFWA 1AX9A 1ZK4A 1L5MA 1ZH6A 1JPUA 4FPXA 4GSKA 3NC0C 2D00A 2ZH4A 3WL6A 1V7PC 3F96A 3GJQA 1J0BA 5THWA 3KT3A 1Q2XA 1CB7A 3QZ7A 4EJSB 1W5SA 5EPOA 4F85A 4BXOB 4RS4A 3KYLA 1UKZA 2C8LA 3WWCA 5LA6B 4EDHA 1FUUA 2OMKA 1NYRA 4ILKA 4BVJA 1PG5A 1LXNA 3RREA 1P6XA 4UHDA 3TE6A 3LHIA 5ICMA 2LXFA 3DKVA 1XNQJ 2PUCA 5D6NA 3D1VA 1Y37A 4Z9YA 4GPD1 4IDKA 1YRWA 1PHRA 2WAMA 5FD1A 5K4HA 2OPPA 1DEHA 4ENVA 3PYGA 4BZQA 4LDPA 1UPBA 3MEQA 4LF8F 1IY8A 2ZJ0A 5IDWA 1TRHA 3AJ1A 1KL7A 4GWKA 1HWIA 4QIEA 3FRYA 1MROA 1XN4A 4KQ2A 3DU5A 1AU9A 2QRKA 2HJSA 4Q0MA 3W79A 3BBBA 3QYJA 5IK2A 5K0ZA 1U8AA 2CPFA 2BTOA 3CDBA 2IJFA 3PU6A 1PFGA 4BRWA 1CULA 4GI1A 4ZMBA 4RLEA 2JASA 1P6UA 3C15B 4KQKA 2X8BA 1ZI8A 5EE1A 1M5TA 2OT3B 4A5SA 2YQ0A 3NNSA 2I3GA 4AVYA 2M88A 5FOUA 2O7NA 4CMAA 4LQ3A 1YF3A 1WUTA 5EWMB 1KBOA 4I7FA 2EG9A 3OEEA 10MHA 4Q2MA 3PICA 4KCGA 5B0AA 5DE3A 3DKPA 3OXGA 1RJGA 3NETA 4PLYA 4J29A 2YYZA 1NG9A 2DBZA 5A2GA 3LOPA 1CVRA 3D7KA 1XA3A 2BW2A 2AZ4A 3Q0AA 1PJBA 3QQPA 121PA 3ZTPA 3AF2A 1WPGA 2W9BB 2V7BA 1XRPA 3CWZA 3DS8A 1EWQA 1Y9DA 1DXHA 1R9MA 2A67A 3C4VA 3VO9A 4QU6A 4LNAA 1DEXA 1IFXA 2ZSEA 3L02A 4D3ZA 3G0GA 2FKNA 2H9YA 2EKDA 5BWLA 2WUDA 5BYSA 4ZPXA 1EVJA 4G9EA 2WSFC 4X54A 5K3FB 3RVJA 4RU1A 2IOQA 4IP0A 1PN3A 1QBKC 3IXLA 2OH2A 1P2SA 5IX8A 4DU7A 5LA6F 3NG1A 2GFFA 4YMLA 5AJZA 1NFFA 3IAEA 4LECA 4J0CA 3GLHE 4IUDS 2XY5A 2FK7A 2JZNA 4RUKA 1HQEB 3VTIA 2Q3MA 1U2RA 1E98A 4IDBA 4KXUA 6FDRA 2G0TA 3JSBA 3UIEA 2J0SA 2MSWA 2IJGX 4R41A 3ZDZB 3FY4A 3INNA 1M7GA 2FMXA 1B1CA 3BKTA 2GJSA 3RIMA 3F0NA 1ZGBA 2JK1A 1HUQA 3MSCA 4JJGA 3WA6A 3U3DA 3ZCXA 4O1HA 3MTAA 2PVSA 5B7QA 4LJ9A 5AM3A 3ESYA 2P9HA 2JEGA 1Z6AA 2IAJA 1ULHA 4U3JA 5C2GA 2IU4A 1HMPA 4UVDA 1EBFA 3GLFE 3ZBQA 3L1KA 4V0LA 3CJ3A 1AFIA 2OTCA 1BVYF 3QOYA 3T5TA 3KUCA 3EHDA 4H4MB 4P86A 4LGVA 2H4XA 5G41A 4K0KJ 4UU1A 3E53A 4C1NA 3KUDA 4HHJA 3DV0A 2H7YA 1E3WA 5EE9A 2J3DA 2H4YA 1LSUA 4L1KA 2ASLA 3DWFA 1S6YA 4R1TA 5BR7A 5EJMA 1YVUA 1E9FA 3OM9A 3CR7A 2CA9A 3EVNA 3DNPA 1KDTA 4GS5A 3HQ4O 3EA5A 2G5GX 3GCDA 3Q11A 3SWWA 2Q3HA 4BBPA 5ALWA 2C3UA 1NJ2A 3B5JA 3K5HA 3RNLA 1S8NA 1L4BA 3OF2A 1QPBA 4NJEB 3I9OA 2J9DE 2DFNA 4MTCA 5G4KB 1OLUB 1RQ0A 4P3KA 4C0LA 1TJYA 1XNRB 1KYXA 1HDZA 1JK9B 1GITA 3CB2A 1L7RA 3CO0P 1U2DC 1VMEA 2H2GA 2ATCA 5MGBA 2QPAA 4EFLA 5I3UA 3C7KA 3MERA 2MHCA 4OHBA 2NXCA 4JWTA 5A0FA 1E4VA 4NYJQ 1TCUA 1WA5A 1YB6A 3GPAA 1VSQA 3SQNA 1RSZA 1Z6PA 4PQRA 2F1OA 4DUYB 2XUHA 3N7TA 2CPIA 3BWXA 4ZCPA 2DLCX 2VCYA 3U56A 4CU5A 3AJ9A 1RZVA 4LTNA 4EO8A 5ARBA 1AG9A 4JUBA 5DNCA 3ZDBA 4ZIWA 3PC7A 4LJYA 3H9UA 4CEIB 2I3ZA 2O50A 2RH9B 1GV1A 5DOZA 2IIHA 2PLRA 1IJFA 4LHZA 1B73A 4MGKR 1T8UA 4ZOAA 3BX1A 3A28A 1WV0A 4NLQA 1WSBA 3CO5A 1C9NA 1YFJA 4EW1A 3A12A 1ZKMA 2AOTB 2FPKA 2AD5A 1J24A 3RIGA 2BFMA 3L0OA 3MMJA 2W25A 4OF4A 1P5ZB 2H8KA 1QANA 4C8OA 1Y5RA 3SBMA 1L8XA 1C1DA 2XYQA 4BFUA 2DGSA 5AW9A 3RK0A 3DTYA 3AA9A 5H1YA 1DFHA 1GG9A 5B0EA 4MV3A 4HUTA 3DOKA 4H6PA 1NVVQ 1O54A 2PXAA 2MQ8A 3LOUA 4OZ3A 5KEIA 2XCPA 3UDVA 4NCNA 2OD9A 4FHZA 2GA8A 1NBMD 5B3JA 2VDVE 5KFOA 1TJ4A 4Y2UA 2WWYA 1HOXA 4MUBA 2CJPA 4PAWA 2P0AA 4CQJA 3PO5A 4NAHA 1Q1AA 3D0OA 1EFPA 1F2GA 4IJUA 1W59A 3R3UA 3DI6B 3PWSA 3JQMA 1AVTA 4B9NA 2W93A 4N7RA 2APOA 3QF4A 3UMFA 2MQLA 2A1IA 2ZRNA 4M38A 4KQCA 2VC2B 1E9SA 4XQ0A 4I46A 2NG1A 3PWKA 4IUBS 2N0SA 3QE3A 2E7VA 2ZDPA 3HVUA 1PEKE 5ABPA 2WAQD 3I01M 3PNVA 2H5LA 3VR6A 3OFSA 4D42A 4HDMB 4DUYF 3L1HA 2RGWA 1YKWA 2QA5A 1Z4KA 2KLHA 2R4TA 4EZBA 4RJ2A 2QBYB 1VKHA 2LWIA 4HACA 3IC1A 4E2ZA 5GJBA 1S9GA 3PNMA 3LALA 1GA6A 2IWHA 5IBCA 4F84A 2IA6A 5T4BA 2KE5A 2LKDA 2HZBA 4NMXA 1XEFA 2GDJA 2BBEA 3LJKA 3TIVA 5KFMA 1L8OA 4R8LA 2XMZA 2WWGA 4H1UA 2CJYB 3QUAA 1YOBA 4LBPA 3M7VA 1W36C 1R00A 3R5JA 1X1RA 3PXXA 3TJZA 5KVVA 3O21A 2GVZC 1OVGA 3G86A 3IEIA 3Q8QB 4MR8B 2UUBF 2MZRA 3R5CA 2KHZA 3GNQA 3D3EA 4ZOLB 4EA9A 3HN6A 2E29A 1QSLA 2XTAA 1D0IA 5DN6A 4RD3A 2UUCB 4BFCA 1MABA 1LS1A 5HQLA 1B23P 4XKJA 1CJVB 5LZ8A 3NH6A 4YCBA 4R8RA 1CJUC 4BTEA 3HA2A 2PRZA 2C2GA 5DPMA 3TECE 1WU8A 2BFEB 1LJ8A 1I2AA 5JJKA 3V00A 2PT5A 4MMOA 1O9GA 1AHPA 3K8ZA 2HU8A 1UW9A 1RYEA 2RAPA 2O2XA 4DJAA 1Q86T 2YX1A 4J4HA 2G8NA 2V1UA 4QPXA 2WPDA 3QNMA 4GL2A 2ERYA 4BP8A 2BF4A 1JL3A 2QPTA 4CF3A 4DR7J 2HGMA 3NR2A 3QXCA 4GRAA 5KFHA 5JTTA 4RUBA 1DGQA 1MV8A 3OU7A 3KYIB 2DR6A 3I9ZA 3LBNA 1AKTA 3LF2A 5LQUA 4YT2A 5EKUA 1WHWA 5CVTA 2VQEB 3C3WA 3MELA 5A7FA 1N8RT 1KOFA 3NBQA 4U8VA 2RHDA 5DGXA 1U2QA 2ZIXB 3IA7A 4X24A 4C0KA 2QJ3A 4ZT4A 3OOYA 4XFKA 1FU7A 1NXTA 2JGFA 3CTRA 2QLWA 3KBBA 4O0IA 5D5HA 4UNQA 3VGSA 5E2IA 1FJGJ 1N8TA 2I34A 1DX6A 1ZYQA 1GT8A 3P5BP 4GYJA 3JVDA 1UC4B 3JRXA 5FX2A 3O5AA 2H18A 3NL0A 2VOJA 5A6SB 3SY8A 2FUCA 2C0QA 4KBGA 1VJWA 3N2LA 3KR1A 4AX8A 4XWKA 1C1XA 4G3XA 2KHDA 2R2UA 4O1IA 3DRSA 1M5UA 2F3QA 4OLHA 4F4WA 1ECCA 4ZARA 4AL4A 5L4NA 2FWIA 3EN0A 2ONZA 4ZOLF 1HTBA 1P6QA 3RYFB 3DLJA 2C2ZA 3ICPA 5AOVA 1JPJA 4NXNB 1TLLA 2ZAYA 3LXMA 2FB9A 4C4AA 4TVBA 3KLFB 1NQWA 8LDHA 2VYVA 4KV9A 2I65A 2BSAA 3JZIA 3BMCA 4TWRA 1SXJB 1T3SA 4Z7JA 2B69A 3I1IA 5GTDA 2VCHA 5TNXA 4UNNA 1J8DA 1PF7E 4OXYA 3O7MA 1LF0A 4YIKA 3A4LA 3P2OA 1KO1A 4WRRA 2FCAA 4GE3A 3C43A 4E30A 1P1CA 2OZPA 1U28C 1QG0A 2DH6A 2JGMA 2GZAA 4QE3A 2QRVA 4Z51A 2C5LA 1SVUA 2FHMA 2HAFA 2X2PA 3PQ5A 2CVQA 1TVRB 3UBMA 1GPUA 3QYPA 1FTCA 1GFWA 2WICA 5H68A 4C2MA 3JZMA 1N0HA 4MICA 1PJ6A 2X2EA 4WFZA 1U0RA 3E5NA 4F46A 2EDCA 1J2TA 2WU0A 4CM3A 2C7RA 1IM6A 3FA2A 3IP7A 5CB4B 3E05A 2VQEF 2NU7B 3F5SA 4PZEA 4WFKA 4HEQA 1ORVA 3TCNA 3WYEA 3KJQB 2YDYA 3TYTA 5D15A 5TS2A 3BXEA 1VK3A 1SCQA 3RJMB 4RXUA 1TZ2A 4XM0A 3ZIAD 1JTVA 4IOKA 5TPWB 2N3OA 3FOWA 1FKPB 1Z4MA 4TLAA 5M2RA 1A04A 1X92A 4YMSA 3GIKA 3EPRA 5B7GA 3ZU3A 3OE1A 3MURP 1KMHA 4QUGA 4JP3A 3GV7B 3E8XA 5IUKC 4EQ6A 2WILA 4UEJA 3DDSA 2I5JA 4C2TA 2X0FA 3GR6A 1YQTA 1AZLA 2H4HA 1RAHA 2BR4A 1A4UA 4CMEC 3R7SB 2FSSA 3TKLA 3QLUA 1DEKA 1IOZA 5A4KA 4ALJA 1FFYA 4F8EA 3P9PA 5EWEA 4W1SA 1QYIA 1NVFA 3OFFA 4CG1A 4NXNF 3ZHTA 3OQIA 1KDPA 3N1UA 4FOOA 4Y7DA 2PZAA 5LZ4A 1H6BA 4G85A 5KJFA 5DMHA 2FP3A 1FTSA 4M1WA 4EBDA 1P0MA 5K8OA 3PD1A 3HDJA 1NEEA 3RFVA 3DVAA 5EIBD 4JV5J 3J7YU 5K20A 1UBJS 5JTUA 4FS3A 2XCTB 3EW9A 2ZEJA 3KUHA 3F1KA 3R6DA 2Z8ZA 2JAQA 4JDPA 3TO5A 4FCTA 1U2GC 3W2HA 2PT0A 1WO8A 3A1DA 1G8JA 4PLCA 4HEA6 4F3KA 3FUTA 2AGOA 1LPPA 4RHXA 4I68A 3MR3A 3T6BA 4WTOA 3EZGA 3CCMS 4HBZA 3BWVA 2BEWA 2VKQA 3V46A 4RA9A 1W85B 1X19A 5CB4F 3G9QA 4MGIR 3MIIA 5AXMA 5JALA 1ZP6A 1Q15A 3SF8A 2C20A 4CT0A 2QJWA 4KDFA 2MJUA 4IQ8A 3AMVA 3IYLW 2BQRA 4YAUA 2BBOA 1PJ4A 1NV9A 3K8WA 2J5KA 3EQ8A 1UM8A 3GD7A 4J6FA 2E37A 4YP1A 5A5VA 5CJPA 2ZOSA 4UDNA 2XS7A 4FHEA 1C4AA 1ZOSA 3PRYA 1YJ8A 1Y3AA 4I9GA 4XFJA 3K5LA 1D09B 3FGNA 3JQDA 1XMQJ 1RDRA 4PXSA 2Z9CA 2CXNA 1N33J 3BZWA 1ZN7A 3ZXSA 4F6RB 1LW0A 5HP1A 1ZJ5A 2A88A 1RMQA 2G25A 1KP9A 2FGCA 2J6IA 1X2EA 2FG6C 1XZBA 3WGGA 4UHEA 4H7FA 4CM0A 4XWOA 3OF5A 1HYSB 5TGTA 3BIFA 3FTQA 4MVJG 2Z0GA 4I64A 2JIPA 3PG9A 3E8SA 1IRXA 4RTOA 4M5LA 1LW2B 4PY2A 1PGPA 3QUBA 3AB4B 1A8PA 1T6YA 3MTJA 2ZETA 5H3HA 2FVXA 5DQIA 2R5WA 3X44A 1OLOA 2GZRA 4PSUA 3HHLB 221PA 4GRIA 3KQVA 3IRVA 3IE0A 2YWCA 4EYGA 1BHQ1 4K9SA 1ONOA 3MUNA 5ALDA 1QVVA 4RELA 3LPEA 4PWZA 1II8A 4KXLA 3RYIA 4Z3DA 5B7WA 3B60A 4HB3A 3LNTA 1RWXA 2R8XA 5DT2A 1XRRA 4D9CA 4PGFA 3IRXB 3ACDA 3ZE7A 4WHMA 5KFXA 2P5VA 1RP7A 5JBQA 5ETKA 2UYGA 3VYRB 1V43A 4YMVA 5DM1A 5AXDA 4B83A 4N5HX 1WETA 1NIPA 3LBIA 4I1IA 3GRRA 3IP6A 2FFAA 3LWLA 3SGLA 3G0IA 4AMGA 3URKA 5H83A 4QPTA 4O02B 2VHJA 3OPMA 4HB2A 1DJPA 4CQNA 5F8MA 3D54D 1M34A 2UVPB 5I42B 3JASB 1KBZA 2WJ6A 1OMSA 3Q3EA 3GJ8A 3LQ4A 3RAFC 2YHIB 2HHXA 4FN4A 4QDZA 3GELA 2ZATA 1KXJA 2LIPA 2WYVA 3K9BA 3ZYCA 1LBQA 1BHO1 1E5DA 4E1BA 1RBZA 3V4IA 4EG3A 3BGVA 3DRYA 4A8JC 2QUKA 5KNDA 1UL1X 1F0XA 3HYRA 4IIHA 1MP0A 2GN8A 4ARAA 4MVJH 2J7KA 1Y1QA 3QXJA 1HNVB 1S1WA 4I4BA 2LGJA 1MTOA 5C2JB 4NFHA 1DQ9A 1NVUQ 5B37A 1Z63A 5BSFA 5LSRA 4RNMA 3ZHUA 4LF6J 1ZU5A 3OQHA 4TRMA 3FTFA 1RYZA 1PWZA 1ISMA 2QSUA 3L1JA 1QP8A 3LPAA 3RRNA 3UCXA 4IQMA 4YLEA 3L7MA 1DURA 2O0HA 5FDFA 2Z8YA 2QLMA 5D3MB 4FGZA 4MWDA 5CM8B 4EPTA 4DBLC 1X7HA 2FXVA 3EIXA 3DDUA 4B6GA 1T43A 2ZRJA 1FX0A 4Y0AA 1HNWJ 2J0VA 3ZZNA 2AZTA 3SEFA 4NBTA 4D81A 1LFDB 1YJVA 2CHVA 2I7VA 2VYND 2IYVA 4B6QA 2WINI 1SKRA 5HUHA 2IHTA 1ZW1A 1OA0A 2MLYA 1MJGA 3CIFA 1V7CA 1U1KA 2WSBA 4TMYA 1VI6A 5HBGA 2XSJB 2GNKA 4XWTA 5HKBA 5CNKA 4MDYA 3IG1B 4OL9A 5F41A 3QEBZ 1JLFA 4RORA 4B2YA 2I5PO 3K15A 4Q18A 3U7EB 4POOA 3CH7A 1UXOA 1F3FA 2GIFA 5JRDS 2WONA 5K03A 1LFPA 2PZBA 1R8BA 2XNSA 2DHHA 2G67A 3OZCA 3JARB 2WC1A 5C4GB 1ECFA 4KW7A 2FZ5A 1RXSA 5LQNA 3JSRA 3E1SA 1HLFA 1L5LA 3UB2A 4WN9B 1UOOA 2RAFA 2VZ0A 1KJQA 2G0IA 5EN4A 2PBFA 2DHAA 3NT5A 1K7FB 4TT8A 4N6GA 1R0RE 5AKIA 2CSXA 1EJ0A 3DQQA 3R5XA 2ODAA 3ZTOA 5LL6d 4QUIA 1X7VA 4XE5A 3QE0A 1YZUA 2IHZA 3WLMA 3VAHA 1UKBA 3QVJA 3PZBA 4AF6A 4YT8A 4M0UA 3PNYA 5G02A 3TLAA 1XTKA 2EV9A 3LWMA 1LLQA 3FPJA 4YP9A 2W8BA 2HA3A 2H7XA 4ICIA 4X62B 3K9HA 1J8QA 2FZ4A 4U39A 3T3PB 1YZHA 1J0CA 4YUDA 4QWDA 5EZSA 3SS9X 3ZWNA 3VAMA 5BW5A 4NKRA 5ULLA 1D5WA 1XTUA 5AFSA 1T2VA 1AUOA 1JQDA 2J4DA 1CJSA 3BFKA 3JTMA 3ZV3A 2A14A 5DBIA 3SIPA 4ESVA 1SKBA 2FLLA 5FDLA 5FADA 1WY7A 4PZZA 1Q7YT 2KJQA 3TLMA 2QAGA 3PHTA 4KAFA 4IJQA 4GOOD 3RU2A 4N54A 2DNMA 5CA0B 5ETMA 1QH1A 3VZPA 2Y1LB 5A02A 3HB9A 5HATA 4OBXA 5BSMA 3PRDA 3HSSA 4KH1B 4A46A 2XBMA 1I14A 2OQRA 2UUAB 3JD4A 3GLUA 2HDNB 2O6HA 3VNSA 1YJBA 4NMLA 2UZ3A 1HI1A 4USIA 4LBYA 4IDFA 3VVTA 1NUQA 4B76A 3MR7A 1JXOA 3ZGNA 3FGVA 1G5PA 1D1PA 1XXLA 1G8KA 2VBZA 2VODA 3U0BA 3TOZA 2QF7A 4G4SP 4YBRA 1LVHA 3HCNA 3GA5A 5B1EA 2JFZA 1G5RA 1SHTX 1U3DA 4A23A 1N3IA 4HP8A 1P2FA 3E3MA 2VDWB 4MV5A 5HZMA 3B7WA 2ZH7A 2ECFA 4YJGB 1M7BA 3HWX1 1ZU4A 2M0GB 4YNBA 1PJSA 3BR8A 4WE1A 2LCFA 2C2WA 3K1ZA 2CJXA 1MHPA 3DUFB 1GZSA 4QQFA 4I9UA 3FUYA 2I6UA 1ZA2A 5HM6A 1T9YA 4O4HB 2AV5A 4BP1A 1QFXA 3A05A 4L51A 2O54A 5A04A 1TVCA 3L01A 2FC9A 3MWGA 3ZKAA 2VTVA 3OQNA 1QS0B 4FLFA 2MLZA 2HNZA 1UVLA 3KWJA 4X62F 3N8KA 3QNWA 3VGPA 4A15A 1TD1A 6GPBA 4U2EA 5EJGA 3DEYX 1NJXA 1IN7A 2XIQA 2FMUA 1U63A 2HWXA 1DQRA 3F5FA 4AY5A 1K5PA 4PXAA 1T26A 4MKGA 3H1GA 1YV9A 2Q41A 4YRTA 1J2VA 1H72C 1GU1A 2GLTA 2QYOA 3BBLA 4FEAA 4WD3A 3ITKA 3AHHA 3D59A 1YCGA 5CA0F 2AJLI 4PNEA 1NU8A 5DI9A 4D3YA 3WLNA 1N52B 1N5VA 1JXQA 1JIJA 2HLPA 5BOSB 3JPYA 2NZJA 2UUAF 2FR8A 2C8VA 3WV4A 2FLOA 4C8LA 4O4GA 1OWNA 1X2BA 3QWAA 1NF3A 5TJHA 4CWAA 4P2SA 5LBUA 1UPTA 1IHOA 1BXRA 2IHUA 2HRBA 3ZZRA 1IE3A 2AQKA 1P8AA 4LOKA 2YICA 1Z6QA 1T5BA 5FT9A 2FQQB 1W2HA 1KAQA 1A8UA 5EJAA 4MR7B 4HDCA 2VPWA 2QVXX 3CIOA 4RX1A 5DT9A 4IYJA 3SK0A 4JI0B 1N9ZA 3PQ3A 5DNVA 2HQRA 3CCWA 3IT2A 3EOZA 1BRTA 2AZDA 1QRTA 1TYEB 1Y9OA 2IXTA 4Y9DA 2I8EA 3MA0A 2D5LA 1W4AA 3USCS 4HAWA 1XN9A 4O4HF 4N41A 4AW9A 3I04M 1PCAA 5ITZA 1LXJA 1I5OB 3NDRA 4A6DA 1Q7BA 3O03A 4M0PA 2F4NA 2AJ1A 2CB0A 3CO9A 2B1IA 2KRBA 1SIWA 2F3PA 1ECGA 1TYDE 4WFIA 4PG8A 4QYIA 4C0HA 5LQRA 4UOFA 3WBBA 1YR8A 4RDIA 2QN9A 3AETB 3OZSA 2GPJA 4BO1A 2GVDC 4NBUA 1IQRA 4UXHA 2W4IA 1LF5A 3O8QB 1WSWA 5JHHB 2C04A 3G5TA 5HJ7A 1G6OA 3GRUA 4PU0A 1OFVA 1G7CB 2EZTA 4DZTA 2FD2A 2XXAA 1NKSA 1AYEA 4ED7A 3L1IA 3TLBA 2CV1A 1XF9A 2WOJA 4DDHA 5E4YA 3KQKA 5F8LA 1TPZA 1YRBA 1QH9A 1WDLA 1BHSA 2ACVA 4OO3A 4TTPA 1HYBA 1QO9A 4Y2YA 2JJ2A 3J81k 4E51A 4LFBB 2BW7A 5C1PA 4JT8A 3W2IA 3S8EA 5FI5A 1X1TA 4B6OA 4IH5A 5IKEA 4RCVA 1RBQA 4PHTA 3U7GA 2G82A 3I9MA 3ADCA 3LH2S 3VQSA 1MA0A 2HQ1A 5IVKA 2HIGA 2ZS9A 5FUYA 2MHEA 3ZY4A 4J75A 1DTWB 3DG9A 4UASA 5CITA 3T7AA 3BQMB 4MYDA 2FLPA 1AKNA 3IDFA 2QV7A 3AFOA 5LPNA 3OU6A 1IBLB 4JI0F 4XB1A 4WP8A 2PS3A 2FNAA 4PX9A 2B9XA 3H5XA 3ZI4A 5I3CA 3BMNB 5A5FA 2XMQA 4PC1A 1EMDA 3LIPA 4Z99A 5IBQA 4MKIA 5U1PA 2XS2A 4HH0A 2R8OA 3NBPB 2C95A 4U9RA 5IZHA 1GGEA 1E7YA 3GQVA 3D7NA 5JJIA 3B12A 4C5BA 3RS0A 1T3GA 1RLDA 2ZDQA 4FDLA 1ETHA 4OOEA 4A0SA 1SVDA 5P8WA 3HV2A 5B2ZA 2Q7XA 1IB6A 5DBGA 5BRJA 1ZESA 3UJHA 3W65A 5SICE 5ETOA 4GC7A 2ZBCA 2HEKA 4MS3B 1PDWA 1T9WA 2YN2A 1FMJA 1QHEA 4RO0A 3B6JA 3AVTA 1ADBA 4MIEA 2RMLA 3GROA 3BIJA 3KDPA 1SUAA 1RRPA 1UBOS 3ZWOA 3DR3A 1MMLA 4PQAA 2GKOA 3V8NA 1S96A 2G8LA 3FVYA 2HMSA 3A36A 5AJUA 1W0CA 1K75A 3KT0A 4TVKA 4J0HA 3U1MA 3H16A 3DBHB 4BBZA 4C2UA 2O5EA 4URUR 4C3ZA 3FFBA 3MXTA 3KOWA 2WB4A 2A3JA 3M6WA 3PX7A 4RU2A 1Z5WA 1G1MA 4LFBF 1SI9A 1O3YA 1NBHA 4DPTA 4EYQA 4CKYA 4KXNA 4E12A 1ND6A 5JNRA 4I2NA 3R74A 3EDQA 2XUFA 3NTVA 4F3OA 5M04A 5HJ5A 4Q02A 4L72B 1R27A 1KQKA 3V8VA 1NLMA 3EDCA 1ELOA 2FWNA 2MTLA 1HT1E 2C9YA 4FQ7A 3DEAA 3BN3A 1S0VA 3ZTRA 1APSA 3AFMA 4B2PA 2QL6A 1T3OA 4Q47A 2E4AA 1IBLF 1TEXA 4TV9B 3WL5A 4EGFA 4UDOA 1V1RB 3TINA 2BYTA 3C66A 3S7TA 1KAEA 4G24A 5AHWA 2C2EA 4DIEA 4F3RA 1SBHA 2BQUA 4M86A 4OQJA 2B36A 2P27A 5KFKA 4BB9A 4MQLA 3KKPA 4IS2A 3HDQA 3AR3A 1JVBA 1AXEA 4K6CA 1XQVA 1U2PA 3F5DA 1DJMA 1S12A 3G49A 3V4ZA 5JC8A 2DNGA 4GDFA 3ZDRA 2BFBB 2LA4A 4KSEB 1B0UA 2CNWA 2QL5A 1WKJA 1A1SA 4CG0A 4DMRA 2ZRQA 3UN5A 1QFMA 4KN8A 4PG5A 4IQ4A 3C3MA 1GNPA 3I2JA 5GIOE 1RW4A 1RCOB 2PWPA 1D2EA 2NO7A 5AM0A 1N9KA 2QP9X 1E6LA 2OVFA 4NLGA 4KV8B 3JSMB 3BCRA 4DEZA 4QOIA 1FSZA 1IXRC 5EMKA 2JH9A 2R6R1 2CL6X 5F78A 3MINA 5FNVB 3AO0B 1Q0RA 4G1QB 3VJKA 4AT1A 3ZWDA 4CN8A 2QMQA 1H1LA 1VC0A 2IM3A 2NTNA 4UE6A 2OCAA 5TF0A 3M4YA 3EARA 2MSDB 1H2AS 4Y6GB 1K88A 3RRFA 2BKPA 5TX7A 4KWTA 4AZ0A 2AT1B 2JCYA 2Q9UA 3SZUA 1UL3A 2CJBA 4OBWA 3I72A 2P2CA 5L38A 1P44A 4X66B 1AUDA 1UBKS 3KLIA 2XWBF 1VK8A 2KYRA 2AK2A 1SCAA 2X7HA 1CVLA 1T1IA 4NBWA 4LF7J 4C3VA 2ODEA 4XZ3A 3A3KA 1KMNA 1MC4A 5EVJA 2ASDA 1I5EA 1QQAA 1BE4A 1PFWA 5HSPA 5EIBC 4ZVQA 4DHVA 4JQOA 3VR5H 4F21A 2JJYA 3IURA 3H5YA 2OHVA 4DIKA 3FMFA 3QA9A 3C8ZA 1JB9A 2U1AA 3GFXA 1N2ZA 2HF9A 4QGBA 2IHVA 4EA6A 2ZRBA 3TQTA 1RXUA 1YULA 4N6NA 2YKMA 5E2AA 3CWCA 3SSNA 4UHJA 3N3AC 4O8CA 3DVLA 5REQA 1E64A 4GLBA 4MUHA 1G4HA 3DD5A 3HXMA 1O57A 4M9UA 1RJJA 1XQIA 2AFVA 1WUHS 2ATEA 1T95A 2QPOA 1Z07A 2MYTA 3CJTA 3HP7A 3UJ7A 2HLUA 1Q8LA 2CN1A 4X0EA 1NW3A 1QF6A 3S1AA 1MU2B 3UAVA 2ZE8A 4DCPB 2HHPA 4WLFA 3WLQA 1PR2A 2WBLC 2DUNA 3IN5A 2ZSHA 2V7PA 4LFAJ 2YQZA 3B38A 3Q2KA 4ZKEA 4P7JA 5FNVF 2F40A 4W99A 1KFJB 2X0EA 4K88A 2VK8A 3L82B 5D77A 3NWBA 3KK3B 3Q87B 4F2DA 2P6UA 3W5CA 3UMJA 2W4DA 3KZOA 4D43A 4K59A 5KTKA 1A96A 2PH3A 5DG9A 3CNLA 4G4GA 3OURA 5LM7E 4J9SA 4QGGA 4MYRA 2L48A 3HXLA 2G40A 4X66F 4S2EA 4KRXA 2VU5A 1J8FA 1L5SA 4X65J 2R7KA 3EYAA 5DLEA 1Z6XA 4DM3A 2M8DB 4CIDA 3OJFA 1BZYA 4TM8A 1UBLS 5K8UA 1C2YA 3FJ1A 3GIMA 4UTXA 2QQGA 4QDJA 4NENB 1DC7A 4YONB 4LOIA 4MVJI 1BDHA 1AUQA 2ID7A 3VRHA 1UK9A 1XPUA 3WDOA 1AC5A 4CN9A 3FHOA 2MYNA 5JQGB 3GR0A 1TL7A 1T1SA 1B42A 4A2WA 4RW7B 3ORHA 2GEJA 2GRUA 4EKIA 4DSUA 3PNIA 4EY5A 3AW8A 4BE7B 3VPAA 3TZYA 2GO1A 4B3RB 2Q29A 3DYVA 1UMBA 3U9TA 2AN4A 2PGOA 3EWNA 4NLTA 1SCUA 3KQTA 4OM7A 1UVJA 1PC4A 3IQXA 1RT2B 4TSRA 2GCPA 3M1AA 3R5KA 1ECPA 2NNLD 3GIWA 1L5KA 3FSEA 3EICA 1GRQA 3UC9A 5B58C 1JXLA 4MWGA 4CR7A 2OTLS 3FZ2A 2HBQA 1MVLA 2ACKA 2O6LA 3QLEA 1U49A 3TFQA 3C1OA 1N6PA 3ADOA 3KHRA 1E2QA 4QU0A 3ZWPA 4PTZA 2H29A 2ZI7A 2OHIA 1IU9A 4C7QA 2PT6A 2R2GA 4PHFA 3QKRB 4FX2A 2AB0A 3M8PB 4ZOQI 3O3MB 5FUBA 2CPXA 2HU5A 1I33A 5EEHA 3HHKA 1ZRHA 1H1TA 2O0KA 1I0IA 2PN6A 1SJ1A 3I1JA 1DHTA 1W581 5CT9A 4FYMA 4OV1A 1QHXA 3KEMA 1N8NA 4CLLA 4AJEA 2UUOA 4Y0FA 4MW9A 2X6QA 4C97A 3QK7A 5C8YF 1AN0A 1L6IA 2WYHA 5JI3E 4MIOA 2EKBA 4E5YA 2IYYA 3FB4A 4CZ2A 1RXEA 4YV7A 5T7LB 3F78A 1M83A 2DR9A 4NX2A 2FZGB 3H1EA 4K4XA 1ZVVA 4CCHA 3GEIA 1TE2A 1V8PA 3OZIA 2KFNA 3ZK8A 4HV4A 4R0JA 3WL7A 1X4DA 2ODWA 1RRMA 2GF2A 2YQ5A 1L4YA 3PG5A 1ODKA 4G56A 1FUYB 3EXFB 1Y4DE 2X22A 4PM4A 4B3RF 3G3EA 5DGTA 2BMJA 3W5BA 4WU3A 3ISVA 4RE6A 1X70A 1DC5A 2VG5B 4AZ3A 3TWZA 2WT4A 3JQQA 5KWIA 3LCVB 1ESEA 3DBOB 1W5FA 4G4IA 2XTMA 3M8QA 5CHYA 3DLKA 4MGZR 3TM5A 2QS9A 2A9VA 5DW0A 2Q2VA 5D0HA 1W4CA 3H9JA 2SECE 4GP6A 4CGYA 2Z1MA 4CJXA 4RKUC 4HHUA 2DXEA 1WQ1R 3CVKA 1YB1A 1U04A 1M5VC 1DJOA 1THGA 4Z0PA 1JH8A 4ADSG 2VPZA 3V9PA 2ZJ7A 4TWIA 2DCUB 4EB3A 3GLSA 4S05A 3KSUA 5LZ7A 3TW4A 3L79A 3K53A 1EUDB 4RLSA 2GI4A 2X3FA 4R3WA 1CQJA 1WI8A 3MWEA 3EK2A 3KQOA 2P6PA 1B16A 1JB1A 4F2GA 5B4UA 2V7XA 1YS2X 5GJCA 1TKCA 4C08A 5KMGB 5GZ1A 2GJ9A 2HIQA 4V1CA 4PAQA 1DQSA 2E9TA 3WSTA 3DCAA 3I52A 3F7OA 3MM4A 3W1WA 1WY5A 3U4QB 1DG1G 3ZWAA 3M0EA 4WOBA 2E5LB 1JF8A 2IJRA 5AT1A 1G7RA 1UQUA 1XMIA 2CXSA 1Y8CA 2J6CA 2XI2A 2CCJA 3EPIA 1VL1A 1JLBB 1Y8RA 4P3OA 3LTEA 4K05A 3ZZTA 4GBED 3ZV7A 1H0KA 4IZHA 3DN9A 7REQB 4AG3A 4FR5A 3W2VA 1CS0B 4OQLA 1W9MA 3DNMA 4UU0A 1RA6A 1YHNA 2FY1A 2YFKA 3EYWA 5L9AA 2OIHA 5JJCA 4XGQA 2VDOB 4MW7A 4QWMA 1XR7A 1GD1O 1Q5YA 3PKMA 5BYBA 5JO9A 2NUTA 4RM2A 1PZXA 4DV2J 1DC4A 5JEDA 4JI6J 2Q1XA 5DTMA 4KN5A 3WRXA 4OYHA 1RKQA 2DWPA 1E0SA 4LXYA 3OM8A 4DCTA 2GEDA 5C7PA 2PC6A 1U4NA 3AM1A 3SC2A 3A6PC 4J9LA 5BN5A 2YC2C 3HL4A 4KWEA 5ER9A 3BSFA 3L7BA 3RYCB 2QD1A 3DB2A 3A6ZA 3L1VA 4B4KA 1HR0B 1SHJA 2B4RO 5DI3A 2HBZA 1Z0UA 1F8FA 2FE4A 1I3OB 2BX6A 1TKTA 3MTBA 4WADA 4MVJP 3D0QA 2NUUG 4X4NA 3OKPA 3AUJB 3H05A 4D8VA 3ED5A 3UWMA 1RAEA 3QU4A 4ZI5A 3M5PA 2V7QA 3A70A 3GJ3A 4LR8A 2FDXA 1V4BA 2PBZA 1VBKA 1JAYA 2D0DA 1YGYA 2PANA 2JDIA 3T1YF 1GSAA 1KU6A 1YQQA 3GLRA 1V5EA 2OO5A 4Y2KA 1PWEA 4C6TA 1LXCA 4HRVA 3DC2A 3IAS6 3BGIA 1UEUA 5KIAA 3VNRA 4W5RA 2E5LF 4EI7A 2BHLA 1FXUA 4LHWA 3TLCA 2R00A 3MJEA 4RANA 4ZIRB 4OATA 1DTSA 4B8ZA 1G5IA 1HPLA 1GTMA 1EG2A 1N36B 3OJUA 5DYYA 4CR6A 4ELUA 2B1JA 1P3DA 4Q3EA 2R7NA 1UBTS 3CUKA 4DANA 1G8MA 1YJXA 1IKVB 4QGAA 2PNJA 3O6QA 3DZJA 3VV2B 5H9FJ 1JJCB 5DETA 3BE8A 2H17A 3T9EA 1S48A 1WF1A 5J59A 2CPYA 3PC8C 3DZKA 3SYNA 4JZKA 1LFWA 4XRRA 3C14B 4FOSA 4ZV7A 1BO6A 2XYHA 4UAGA 3JQAA 1Q0LA 2A5DA 3K8VA 4TQAA 2R7AA 4LYJA 4LYYA 5FOQA 3RRGA 5GONA 1C4KA 2D3WA 3G0CA 4FHFA 3TIXB 3DBRB 1HPZB 2REXB 2ZH1A 4C0XA 4HF7A 2VQFJ 3DPUA 2FPPA 2XNKA 3UT0A 2IPOA 2XNCA 4KHPJ 5CYFA 3RROA 3RQSA 4BKPA 2YHSA 4BQRA 2AFIB 2XLBA 3PM9A 3WS7A 1HR0F 4O4JB 5I7VA 1EVLA 1I6JA 2QTFA 5KNBH 2JHEA 1ZJYA 3BRWD 4PO8A 3FZGA 4NE2A 2IS1A 2C2RA 5T6BA 3IUYA 2KKHA 3IHKA 5DGAA 4LCEA 5CZXA 4F5DA 5AVWA 5K2OA 4UEOA 4JJ4A 2CDRA 4TT3A 2YTCA 3WK8A 3BXPA 2DGTA 1W5BA 3FQKA 1LOUA 1T2NA 4C7KA 1CBUA 3IDQA 1JIIA 2PMBA 3TSAA 3TVYA 4F86A 5JRZA 3U81A 5IWAB 4WJLA 3CVXA 4KPEC 1M1KT 2J6HA 3BL6A 1NZJA 3ZY2A 3DGPB 1MC5A 2QN6A 1JR3A 3U49A 2ASYA 2HXSA 1CEQA 2VF7A 2GPNA 2WHRA 4YY3B 1ZINA 1JSRA 1VQ8S 3OVAA 3NBZC 2W6JD 3NMAA 1UADA 4D3DA 4FGUA 4GVXA 1X5TA 4XPZA 3NM6B 1N36F 1OLSA 3IS3A 3NTQA 4USWA 3U37A 4QR0A 3CZ9A 4AP6A 4Y28C 2Y92A 1N6QA 5AKEA 5E6RB 1ZITA 1NQAO 1DFDA 4URYR 1F9AA 2HRCA 5HQ8A 3SHFA 1VBMA 1S7HA 1EWKA 2XA9A 3PXDA 4RPHA 2VT6A 1XU7A 1GLGA 3J80A 2Y0PA 3K6KA 2Y93A 2O05A 1TTHB 5T3YA 1IKXB 4Y8VA 1CLUA 4CCSA 2J31A 3SPXA 4D25A 1UVKA 1X9GA 4KO8A 4MS1A 4DSOA 1U9JA 4R0EA 1Z33A 4OQMA 4RVHA 1FX1A 3WWEA 2NP7A 4HLUA 4C2BA 2QQEA 1KZ6A 2MSLA 2DK2A 2L41A 3IEVA 1NI4A 5EZ6B 3P0JA 3C7CB 2UUBB 1WXDA 4I2QB 1HEIA 4O4JF 4CETA 3CVYA 4JNCA 1UK8A 1UXIA 1PT8A 4MYCA 4YJFA 5HW0A 1VRTB 1E3MA 2RI6A 3JQJA 5CFPA 1DAXA 1ZM2A 4ZHRB 2YKNB 1OX4A 2GHWA 3QYAA 3B20A 4JA0A 1Z45A 1SMKA 4L02A 721PA 3F90A 2CNOA 2HMWA 4MKAA 3MQFA 4YAFA 5EHNA 1QBGA 3ZE9A 1U3FA 2WHXA 4MPRA 5LD2C 2HB6A 4JLMA 5IWAF 3UKJA 4C21A 3G0OA 3D3KA 2FQYA 3LLCA 4NCGA 4FYYA 4IH1A 1W88B 4JSRA 1GSHA 3DE7X 4PUOB 3J7YI 1V3QE 1KP3A 5CIQA 4MA0A 4YY3F 2QG9B 4PANA 3IVXA 4XAQA 1L5UA 4V03A 4GQIA 3TVTA 1WF2A 1NNI1 3Q0EA 3OE7A 2ALJA 2FGJA 3UZUA 3RGWS 2JRCA 4UOGA 4CI0B 2R5FA 5AXNA 3R3XA 3DQZA 1RTIA 2QXTA 1COWA 4WY5A 1UWBA 1EK2A 1JTEA 4H4DA 3B6BA 4FHCA 4M63A 2IW1A 4XYBA 5EZYA 1MAVA 4MRVA 1EJBA 1PLKA 1I6MA 4TV8A 1GZ7A 1BN6A 1KKUA 3MJFA 2FHJD 1RQXA 1IBKB 2UXCB 5B30A 4TSFD 1JDSA 1F8YA 1TYAE 1ADGA 2J7PA 5AOCA 4HYYA 3RVRA 2OE2A 3G82A 4QTYA 2EK1A 4C89A 1KAMA 4GLLA 5A2QA 4KUEA 3PYDA 2NZ4A 3UVJB 1YT5A 1KQNA 2YV4A 4F9GA 2C7VA 3NYWA 2DFVA 2W2TA 3K57A 4OTZA 3E0QA 2MDTA 4FNIA 5IZCA 1KI1A 2W01A 5LXTB 3HE3A 4JI2B 2YV5A 1HFJA 5EE5B 1RAIA 3MCAA 1RBOB 1XXHB 2BBSA 4LOLA 3RKUA 4NSNA 1RT3B 1M67A 2AX1A 4U63A 2H2DA 4GC5A 3GNSA 3BO2A 4RY2A 3WWZA 3C8HA 5J5AA 3N8NA 1ZETA 5FTNA 3LBYA 2PPLA 3OX3A 1JFFB 1JP7A 4TZKA 1XR3A 3CX6A 1OFHA 4COOA 1W2BR 5U4XA 1WIWA 2HSWA 1Z5UA 4Z49A 3TIGA 4X9XA 2C2OB 4QEDA 5F2EA 3S29A 1C0PA 3NC1C 1XCMA 4BMYA 3IO3A 1FX2A 2OK7A 2B4PA 5JXSA 3THPA 2HJ9A 4FEYA 2YFYA 2L2QA 1FDAA 5IQQA 2QN1A 4FF4A 2RIPA 3D1QA 2QRLA 4V38A 3EPJA 3CEAA 3F8WA 2G0NA 1MLAA 4WINA 4JP2A 3O94A 1KRWA 3W8DA 4DPKA 1DFIA 3CTPA 1Q0QA 5DGCA 4R8MA 2HVEA 3R75A 2V74B 4L15A 2ZYAA 5B6JA 4JBHA 2J3JA 4HVAA 2OOKA 3EGDB 1IBKF 4IR7A 4JJ6A 3A3OB 4FYXB 3A8EA 4IXMA 3RRMA 4YMGA 3QX3A 2UXCF 3Q8UA 4JUFA 1OXTA 1QKJA 4ICLA 3I5YA 2G06A 1IPEA 4OB8A 1TUBB 1ACMB 1OH6A 1VKOA 1SC1B 3RBDA 4USMA 2GIRA 4FGJA 2GQQA 3L4KA 5M5BA 3NYRA 4OP2A 2V9ZA 1TQLA 3A9UA 3IGFA 4JP8A 5CFZA 3K7EA 5EPUA 2QHXA 3P27A 3GFRA 3SXPA 4UBJA 2ACEA 1A7JA 2FG5A 1LWNA 5L46A 4IKPA 5CCMA 5J2PB 4F04B 5LXTF 5KHLB 4HYTA 4DREA 4JI2F 2NACA 2YVQA 4YAGA 5TEWA 1D4ZA 2RARA 3Q9SA 2I8LA 5C1BA 2C42A 1JR3E 1GVHA 1PU2A 5LQCA 1SVLA 16PKA 1YS1X 3K9WA 1LWFA 2O7RA 4EY8A 2VUGA 2II6A 2GFIA 2X0DA 2P4QA 3LQKA 4Z2YA 1MO5A 3LWBA 1IVYA 5LXYA 2IF2A 1S97A 2HHHJ 3NHBA 4Q0BA 1UKCA 4S1VA 2YJ3A 1DJ0A 1Q0TA 1ZJZA 3W6PA 2DT9A 5LJLA 1QH0A 3TJAA 2QR5A 1KKHA 2CQ0A 1HRDA 2WD7A 3D0KA 2PCLA 1WSAA 2XVMA 2XLIA 4BBAA 2HBYA 1PEDA 2DTJA 1N2HA 2HHLA 2ZUTA 5C8ZA 4B71A 3CCRS 3KG0A 2DBQA 1DUIA 4RZIA 4G2TA 1HKUA 4PFJA 2Z5FA 4JU8A 4ZMRA 3W9YA 2G07A 1NW7A 1KQOA 5AE3A 1Z0AA 4K9NA 4H7KA 4NU0A 4YRFA 4BJ3A 4X4TA 2JFUA 5FA8A 3JALB 1EGHA 2Y99A 3GJRA 2KBEA 4NOHA 1CS4A 4OA5A 3GIJA 2ZE2A 3PA8A 1FDNA 5BW6B 4DVJA 4PX5A 4KKOB 3A1WA 2J3QA 1ILEA 4GM1A 8AT1B 4ZICA 1JJBA 4LXIA 1NUPA 4U2CA 2FVRA 4U4AA 1NM5C 4B6JA 3PX0A 3P9IA 1J1UA 3OIGA 4KPUB 2Z6AA 5KSZA 2H1IA 1EVEA 2XQKA 1HBJA 1UMKA 4R2LA 1F2DA 5D3KA 5IP5A 4XOUA 3IT3A 3ESRA 4DL3A 4Q7MB 4YACA 1YQ9A 5A3VA 1T2AA 5LU9A 5BV7A 1U2GA 5C34B 3VPFA 1BMDA 1EFHA 5HCUA 4TVSA 2DHEA 1X1AA 3EVDA 3YASA 5A8WB 2CFIA 1Q14A 2RNEA 1N1EA 4EARA 5JCPA 1L9XA 3AERB 4I14A 2XTJA 1BDJA 3NVKI 1PO6A 4YUVA 1PHPA 4MEAA 2FVPA 3E5MA 4DW8A 5K3BA 4KVFA 1RT5A 1FF2A 1TK8A 2GJKA 4QPZA 4FOPA 3E61A 3RC3A 2B1RA 1VGVA 5TARA 1MOZA 1RCXB 2VDUE 3EX7B 1G20B 4E8UA 3SBXA 2G3YA 2QAIA 1YS7A 3RPEA 1H0SA 5FJIA 4ZLPA 3WQBA 1UXJA 4B7CA 1S9FA 4L5AA 2JLUA 5BNFA 2BE2B 4MK9A 1SUDA 1N7JA 1QKIA 4Z3OA 1KNQA 5KFFA 1L5YA 5DBOA 1ST3A 5CAEB 1X8JA 3GGGA 2ZIEA 3UI3A 3BDAA 1TFWA 1ZD2P 4YR2A 3X2SA 3NNDA 4PIMA 4ND8A 1GZVA 4F8YA 1XCPA 2PEZA 1QIGA 4UJ5A 1UBMS 2OMLA 3NHKA 1U0EA 3QI7A 4KR0B 5HFAA 2IYGA 1EWYA 4JXKA 5LOQA 3KOMA 3DBLA 1SRQA 4WXPA 4BLOA 1T34A 1MEEA 1U2SA 3QTLA 1C0TB 1X7WB 3PW4A 3STUA 1J2JA 3KK1A 3LHSA 2H2AA 3VJMA 4MULA 4GPTA 1DWOA 2ZUUA 3UDEA 3CBQA 5BVHA 3QBCA 3OFKA 4JBCA 1GCGA 1ADJA 1E2DA 2WP8J 3X1WA 3WMGA 1NVTA 4Y2TA 4V0OA 2YNGA 4BYMA 3KXLA 3I09A 4P54A 4TYMA 1PV1A 2XVXA 3ROXA 1QLNA 4YXWD 1DJNA 1USKA 1H2RS 1XMOJ 4Q9AA 4N76A 3KE9A 5EJFA 3ZGYA 3E18A 4XLLA 4M5MA 3ZR4B 4BE9A 1K4MA 4HX9A 5AJ3J 1C4CA 2JEZA 4IQFA 4XPIB 4M8KA 2EP7A 3G0BA 1GA1A 1BEUB 2WIAA 1SXJD 3S1SA 2HFSA 4UUXA 2YWRA 2WR8A 3FI0A 1J9EA 2OBNA 3C2PA 1U6FA 4QOSA 3G0DA 2X5OA 4RJLA 5JO0A 2JJ4D 4I9FA 2UP1A 1EFVB 1WW2A 3B8EA 2OPRB 4WN3A 4CH7A 3AAWB 4CI9A 3K4HA 2DT8A 5AKLA 1RFLA 4UC0A 1NXOA 3WYCA 1XUOA 3BK2A 7FD1A 1ENYA 2NSYA 4GXNA 3G2JA 3UK7A 2UVDA 3WAJA 3ZV5A 2WF5A 4BCBA 3GBSA 1CQNA 4F2HA 3P8ZA 4MB2A 4X3OA 1B3TA 2HNDB 2CMGA 1EFRD 2R2AA 3BGWA 3OICA 3AGQA 3O8OA 1IN6A 2WKRA 2HPHA 2GX8A 3TB4A 4ENPA 4HPJB 3GYNA 3NWOA 4P4LA 4DV7B 5DFAA 2DUWA 6REQA 1JIQA 4B6PA 2MQQA 2Q5JA 3AHJA 4DAOA 3HWRA 5ITSA 4UMEA 5AUPB 2DNHA 1XKXA 3K0FB 4N49A 3SI7A 3W3AD 2GRAA 3FLAA 2Q1LA 2YVLA 3OAAD 1PDVA 4U9HS 4DR3B 2GO7A 1O6ZA 3GFYA 2NVUA 2QGFB 1DBQA 2QE7D 4FPIA 3C3XA 4EA8A 1F48A 2OPQA 2ZWMA 4TQ9A 4EUNA 2QTZA 3SC3A 4QPCA 4WNCA 4K8OA 1DB3A 2R2SA 4EJMA 2GWRA 1NOIA 4HVLA 4IEFB 2IY8A 1DARA 2IF0A 1IXYA 4HG2A 3R3TA 3U19A 3UANA 1Q7TA 4BC1A 1VRQC 2FZLA 3KHGA 3F4LA 2WVDA 1U0SY 1U0FA 4JYAB 3UY4A 4D0RA 5CBPA 3NEYA 1QP4A 4NE7A 3MUVP 1VL2A 2JH8A 1SO8A 2CG4A 1PZEA 2V45A 2LXIA 2BOPA 2OC4A 1UM9B 1ODTC 1TVKB 1I2DA 4USHA 1RM0A 3ZIDA 4EYKA 4TLQA 2ZQYA 3BXOA 3IAXA 4BNTA 4LBHA 1YWGO 5E6SA 1YDMA 5T4HA 5KDDA 4YQEA 1SCJA 1ZUNB 4D8TA 4IL5A 4LXHA 1V47A 2X1VA 4OQEA 4UY8T 1PVVA 3SYRA 1PYSB 4EHLA 1HLPA 3C4JA 1JWLA 1QIEA 4URQU 2V59A 3GSIA 2YCBA 1RI1A 3EGVA 5CYPA 3EIUA 1QZUA 5D78A 4B31A 3TAHA 2CL5A 2R8KA 1CYDA 3EVEA 2ZVSA 3JYNA 3EZXA 2HEGA 3JD3A 2BWJA 4RKRA 4DM4A 4H0FA 1AQIA 4HNHA 2AJFE 2XULA 4AD8A 4DV7F 1SC3B 1I51B 5JCJD 4BC0A 2KBFA 1GYPA 1W73A 4PYIA 2H48A 5H3CA 2WJ3A 4KFCA 3CFYA 2G0CA 2MSNA 3S0JA 4MV1A 3IPYA 2ROGA 4P22A 3RFFA 2FUG6 5TIIA 5GINE 4DR3F 3DFEA 4ZEVA 1GRRA 1UBFA 3GFBA 1ZISA 1PV4A 5KU1A 2AOWA 2VHQA 4WBNF 4FZRA 3R0QA 4UBKA 4F02A 4IMIB 5L95A 2MZSA 5L1LA 5HQ3A 4RK1A 4NHOA 3AIMA 4OX6A 2H08A 4D79A 4DUTA 3UOAB 2GUWA 4AWBA 3HHLD 5J2MA 4KWIA 1EQAA 1NLFA 3VPGA 1CUVA 3KLPX 3DOCA 3O9MA 5C53B 4JYAF 4DQPA 1E59A 3MRTA 3GE9A 2KX7A 3COVA 2JKYA 3FAZA 4EENA 1U8XX 2O14A 3LSTA 5A3SA 3NTLA 1BKDR 3ORRA 3ETMA 3LGMA 2J5XA 2KB2A 2GMHA 2Q5EA 3Q2OA 2Z9DA 4XIUA 3LKZA 1CYEA 3CINA 2IZ5A 3F1LA 5KX5B 1QAIA 3PQ7A 2IS4A 3KKEA 2IDEA 2PZGA 2FZWA 1C2PA 2RHGB 3FSGD 4WL0A 2FGKA 3LK7A 1N34B 5B5SA 3AIIA 2JGRA 4J6EA 4TWBA 4B43A 5CYMB 4XWAA 3SHQA 4EH1A 1ZD4A 1KI7A 1PJTA 2HS3A 2WSSA 4E88A 1XQ9A 2JCBA 2CJKA 4CO3A 2KM8B 2CC2A 4MZXA 2YV3A 2AOVA 2ZJ8A 1L7DA 3MEDA 5IJ0A 1XE3A 1C7IA 2AIRB 5GMEA 3RRJA 3PX3A 1P33A 5LMNJ 1P77A 1OXXK 1OH5A 1W5AA 2HWWA 5T8KA 3REFA 4EFAC 4K1LA 5EWFA 2W4QA 4TZ0A 3WAKA 1QTNA 3BIWA 4MQEA 3A13A 2OKGA 4B3BA 5AHOA 3FH0A 1HHTP 1REGX 3D4IA 3K1TA 4E5DA 3PJGA 1TM2A 1T5LA 4ZRNA 4GXTA 4RBVA 4PZAA 3KQMA 1PAUB 2ZB2A 1WXHA 4UULA 3K9GA 2EYQA 3GRFA 1P62B 1UXGA 1SXGA 1YS6A 5ELLA 3KJZA 1KZHA 2P68A 4ITUA 4EJSC 1N54B 3AR8A 3W5ZA 4DR5B 1T9HA 2MY8A 1M34E 1H2VZ 7GPBA 5F3RA 2PVCA 3I62A 3OX4A 1YLXA 2FFBA 1SN7A 3LPNA 1F06A 5I8ZA 1T5TA 2O07A 1C4WA 2BCGY 4ACAA 4HYEA 3NGRA 2JLEA 5CDSA 2K5UA 1P74A 3CD0A 5FA6A 5JXWA 4BMVA 5KX5F 1EETA 5L1IA 4QU7A 3KEQA 1WPQA 2ZRFA 4GYWA 4MHOA 3G8BA 4CHTA 2VRWA 2Y1OA 3D7SA 3O3CA 1ZZNA 1JQJC 2IP4A 5FWYB 1W93A 4IIYA 1N34F 3ON5A 3I3SR 1NBMA 1DBRA 1U31A 2AYYA 4WFAQ 3RFUA 1MU0A 1I8TA 4CMHA 1NYQA 1K5DA 2FPSA 1FFBA 3DM2B 4U67Q 1YBMA 3B36A 3C15C 5EHIA 4U6QA 5C37A 4ZVEA 2JLFA 2ZANA 2WKQA 3HMQA 3CMES 3L8GA 2I6XA 2X8JB 2F63A 3KP1A 4C7OB 1FD8A 1E4EB 4PBTA 5CDTA 5K6TA 4CH1A 2BGRA 3GJYA 4C3UA 4BWGA 5JZ9A 3PW2A 4X4UA 3CT4A 2VS1A 1GM5A 2I6WA 3R8XA 1TQDA 2HUPA 5H80A 1V9CA 4GW3A 3KUUA 3DE4X 2L9WA 3G6KA 1SD2A 4I6JA 2AZXA 4HT3B 4L3OA 2VTBA 5FKJA 1KNZA 2GCNA 1REVA 1Y34E 4NJMA 3PW5A 2PT9A 2R48A 1EIZA 2HREA 3NGXA 2RKIB 4A4JA 4HHHA 2A5GA 4LX8A 2RGEA 2VI5A 5HE8A 3MWYW 4OBBA 4XTRA 2RGUA 1RT1B 2PD6A 4DR5F 3H4DA 3GT7A 2ZLBA