3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
1T1IA 4AKTA 4CFYA 5FBZA 3DE6X 5JMOA 1Y33E 2XTJP 1BFUA 2PKCA 1SBNE 1TO2E 2W2OP 1R6VA 1SBIA 2X8JA 3DYBA 1SELA 2ZWPA 1ST3A 3CNQP 3QMPA 2DQKA 3AJ9A 2SNIE 3I37X 2XRMA 1TM3E 3WQBA 4LVOA 2QTWB 2DP4E 1GA6A 4HVLA 1PJ8A 1GTL1 5AQEA 3A3OB 3PRKE 2Z58A 4NE9C 2Z30A 1SH7A 1TK2A 3SQOP 1NLUA 1NDQA 4OV6A 1PTKA 1T1EA 5AVJA 2SBTA 3VV2B 2ZRQA 1WSDA 1ST2A 1KDYA 1OT5A 1S02A 2Z30B 2Z2XA 1ITPA 3ZXXA 4DJ5X 3UNXA 4C3UA 3L1KA 3VV3A 1SCDA 4B5LA 1SCBA 1TECE 1IAVA 3T41A 1BJRE 4RYDA 5FFNA 1SCNE 3VTAA 1TMGE 1C9NA 1LW6E 3BGOS 1UBNA 3BX1A 3DE7X 4LVNA 1TO1E 1AU9A 1BFKA 3Q40A 1JEAA 1SIUA 1SPBS 1SBTA 1SBHA 1R64A 4I0WB 3SQOA 2SECE 5JXIA 3LPCA 2IXTA 1MPTA 1ZVKA 5I9SA 1HT3A 2W2PP 3DW1X 4KPGA 3A3PB 3VV2A 3I30X 1Y34E 5B1DA 3GT3A 1SUCA 2X8JB 2DUJA 4DZTA 3P5BA 3CO0S 1KDVA 1P8JA 1WMEA 4YN3A 5ARBA 3CO0P 1SPBP 3I2YX 1Y3DE 2G4VA 5B1EA 3AJ8A 2XTJA 5JXGA 4AKSA 1GNVA 4KB5A 4ZOQI 1GA4A 4OMCA 1SUDA 3DE5X 2QTWA 3DWEX 1C3LA 3PTLA 1SIOA 2PMWA 1S2NA 1Y9ZA 4DWWA 2W2QP 2ID8A 1Y3FE 1YJBA 1EA7A 3TI9A 3GCWP 4NMXB 3BGOP 3AFGA 1C9JA 4NMXA 1YU6A 1AF4A 1ZVJA 5ARDA 1C9MA 1IC6A 3F7MA 1V6CA 3CNQS 4MZDA 2Z2YA 1WMFA 2Z58B 1EGQA 1P7WA 3F7OA 1OYVA 1SIBE 1CNMA 4NE9A 3DE1X 1SN7A 3H42B 4HX2A 3ZXYA 3DVSX 1A2QA 1NDUA 2PQ2A 1Y4AE 2Z2YB 5K7SA 1SUEA 2PRKA 3BPSA 3I34X 2W2PA 2HD4A 1SUAA 1GTG1 2Z56B 2P4EA 1GA1A 1P7VA 5FAXA 1BE8A 2WWTA 4FONA 3WIVA 2SICE 2E1PA 3VYVA 2WV7A 2HPZA 1TM1E 1WMDA 3DVQX 2Z2ZA 1BH6A 1KDZA 2W2OA 1KE1A 1AH2A 3D43A 1SVNA 4K8RB 3DE0X 4H6WA 2Z57B 3H42A 3DE4X 5ARCA 2B6NA 1V5IB 3VSBA 2Z56A 1YJAA 5SICE 1GT91 1THMA 3A3NB 5AMXA 3GCXA 5JXJA 5JXHA 4BWGA 2GKOA 4NE7A 1DUIA 4C3VA 3HJRA 1AVTA 2TECE 3DE2X 2PMWB 4GI3A 1R0RE 3EIFA 1Q5PA 1TM5E 1SCJB 2PWAA 1AQNA 1Y3CE 1GTJ1 2ZWOA 1Y1KE 1OYOA 2W2NP 3A3PA 4CFZA 3LPAA 1WVMA 2ST1A 3GCWA 3P5BP 4WOCA 3DW3X 2V8BA 3DVRX 4WOBA 2W2MP 1DBIA 4H6VA 3TI7A 1SCAA 2W2MA 3DE3X 5CW1A 1AV7A 1Y3BE 1SBCA 3EDYA 1MEEA 1Y4DE 3OSZA 3QTLA 4OMDA 3GT4A 1Y48E 1CSEE 1GCIA 3A3OA 3F49S 3SICE 2W2NA 3LXUX 2WUWE 4M1ZA 3WIUA 1SCJA 4K8RA 2ID4A 3DDZX 1PFGA 2Z57A 1TM7E 2W2QA 4J94A 5AVKA 3TECE 4Z2AA 1AK9A 4KG7A 3WHIA 2PWBA 3Q5GA 2PYZA 4H6XA 3A3NA 2WUVA 4ZARA 1V5IA 1SUBA 1S01A 1SUPA 4YN3B 3QFHA 1XF1A 2IY9A 3LPDA 1YJCA 1T1GA 3EE6A 3GCXP 1BE6A 3VHQA 1PEKE 1VSBA 4JP8A 4CG0A 1GNSA 4OV6B 1KE2A 3BPSP 3D9QX 1TM4E
chains in the Genus database with same CATH superfamily
1MJHA 2C3MA 4AXIA 3EULA 3U19A 4DV3J 2KO1A 4K0RA 1SFRA 3E3OA 3WGIA 4TM7A 1E1RD 3H2GA 3C15B 3OLQA 1QV7A 4XYLA 1SBNE 3EBOA 2Z1NA 2O8CB 3PJXA 2VG7A 4F2GA 5CPBA 4BO2A 2GBLA 4KHRA 3ABIA 2FRDC 5KUTA 3AJ9A 5GVRA 4MK8A 4FKYA 3RNOA 2JBWA 2B9YA 4RTMA 1EBBA 2E7ZA 2XZTA 1PC5A 2O3JA 1RJ9B 3N0TA 2CXQA 3IUPA 2VPIA 3ZCXA 4K2XA 3RABA 1E5VA 1RI4A 1Z0UA 2IEYA 1JQLB 4RENA 5L39A 1QQ7A 4HRYA 2XWXA 1S4QA 3L7OA 1WXQA 1JDVA 1FNNA 3FZYA 2ROPA 3GT7A 4Q0MA 1NU4A 1Y98A 2KVQE 4ACAA 4IH5A 1OC2A 4MQ5A 3KEGA 5CFOA 1DJLA 5CVJA 3V4OA 1AUPA 1Z37A 3JD0A 3M4ZA 1PWHA 5G0RB 2CCJA 1NPPA 1LWCB 1BDHA 2GVDB 5GAHI 1SHZA 3B7GA 3D4PA 3QMWA 4UTRA 2QK4A 4YRSA 2AX3A 4OQFA 3EK2A 2CL7X 1EXMA 1T9GR 5HFAA 3C2QA 2OD9A 3MRVA 2MKIA 2BFWA 3WBZA 4MUEA 2D2IA 3R6TA 3UT5A 2XMPA 3T7CA 1YRXA 2X8JB 3A37A 4B71A 2HW3A 4M21A 1KIMA 2H2AA 5CM9C 2UUPA 4AXJA 3ASYA 4KBGA 4OYMA 2AN1A 1HTTA 3GBSA 2MQQA 1WP4A 1PZNA 3A6ZA 5DNYB 1U0EA 4FZ3A 5AHOA 4XUEA 3CE8A 3RVLA 3RBAA 2VF8A 2PFGA 3T61A 1QJ4A 4PV7A 2L41A 5KG1A 3OP1A 4E5UA 3GI1A 2KI5A 1NBMA 1YJBA 2IDZA 4OJHA 1NRXA 4MPDA 4RSGA 1W4LA 2H0AA 1HWYA 1GUZA 3NGUA 3R5HA 3ISND 4KQ6A 4G0XA 4PPNA 4OOFA 2AYMA 2QGFB 1Z82A 2HLTA 5F98A 4JP3A 3LPLA 1VLZA 3H17A 5G0RA 1N32F 3D3NA 5IYZF 2X9QA 4ZYZA 1VHIA 4FGSA 4CU5A 1WHSB 2E5JA 2GSWA 2I67A 3TKYA 2RAUA 3KG0A 5BUCA 1YJTA 2AX0A 3ZI4A 3GPIA 3G2NA 5TMBA 3K2QA 5KQSA 3KEFA 4WIIA 4L8FA 1PEDA 1DHMA 1SB9A 5B7WA 2ASJA 2BYCA 3HO8A 1YBFA 2ISCA 4RSRA 3AEXA 2XCAA 1Z6YA 5CT4A 4C0JA 4MA0A 4KI0A 4MH0R 2PH3A 1U11A 1P0PA 4O4HF 5E3RA 2M7SA 1THMA 4QZVB 2IXGA 1TVKB 1ZR4A 3RD5A 3IQEA 2Q2NA 5E8RA 5F4ZA 2WHOA 2B0JA 4O3SA 2GC8A 3CCCA 3DM2B 4DUPA 4HKTA 5EHZA 1SXPA 4MSUA 1RWMB 4BEWA 4QT0A 1ZQ9A 2E4ZA 2W9CA 4CKZA 4EB6A 2EP7A 2QQEA 4EUKA 4CEHB 3PDHA 4QUIA 1M5KC 3VNAA 4Y9TA 1T8YA 5H8WA 1FA9A 1FB5A 3EGCA 3H5XA 5L3SB 3CLTD 1RXYA 2R8ZA 5THWA 4YUVA 2O19A 2V8BA 1Z63A 4IVQA 3EXIA 5KFJA 3FK4A 3DOOA 4P10A 1N5YB 2IYZA 1H05A 2PUDA 3TARA 1XQ9A 2R7KA 3RVDA 2V9ZA 2YIMA 3I28A 3WGLA 4NBSA 1OIWA 2W9BA 2NSDA 3NVDA 3PQ8A 2O0MA 5CPFA 2B51A 1QMGA 3LLUA 5AVKA 5LLDA 5CHCB 2VP6A 1EIZA 4JV2A 3N2GB 1G1XA 2GN9A 5BT8A 3I64A 3ZU3A 4K0KB 4J9NA 3THPA 1TKZB 4ENTA 3V32A 2GOYA 3AVYA 5EC8A 5G1PA 5IC4A 3MM5B 1D4OA 2DH5A 4WCDA 4BLOA 4LDZA 1VLHA 3PL5A 2RUGA 1T1GA 3GDFA 4P7VA 2XBUA 1FNDA 2CD9A 3N9IA 1XZMA 2FZVA 3FFWA 5L7WA 4CTJA 3VAKA 2H2FA 2YKMB 4IV8A 3HZEA 2R2RA 1WX1A 3THWB 3OA2A 1JLLA 4DCMA 1PIWA 3M30B 1G6OA 4P84A 4WKGA 1XVVA 4BO0A 1VGRA 4A8JB 2MKKA 1EQ2A 1FNXH 2X5JO 4RLFA 3TZWA 2BJVA 4RCYA 1SL2A 3VSCA 1JLMA 2PMBA 4HQ6A 1XP5A 1C0UA 3EIXA 2PG3A 5G0VA 2B4TO 4XI9A 4A0QA 2EKYA 1TK3A 2EBFX 2DAPA 4BLTA 3EGXA 2FV8A 4CQJA 1MC8A 1N0IA 3PVSA 2QUJA 3ZCVA 1G2IA 4M0EA 4Q4CA 2JBHA 1HORA 3CZRA 1TA4A 1WSDA 3HY6A 1T3SA 5HBGA 2VBGA 2FH5B 2EF0A 3WZMA 4YRIA 2F3SA 2IY7A 3OTIA 4DJ5X 3QVWA 3M8PB 3EF1A 4MWBA 2B4YA 3EICA 2FWBA 3LPEA 4D82A 2OM6A 4BP1A 2IK8A 1NI4A 3DEIA 2BZSA 1ESNA 4R16A 3JTEA 1T8EA 4DN9A 5BW4A 1XEAA 5CVDA 5KFMA 2RF2B 1H0SA 2WVJA 2WI8A 3LGNA 1VC0A 5YASA 2XTNA 5KOJB 4HVAA 2YNGA 3ANTA 2YOFA 3B7PA 3UYLA 5A4JA 3FFIB 3ZZYA 4XW2A 1OWXA 4JT2A 1QF7A 4O2LA 5BQOA 1KZGB 4B3MJ 4A8YA 2DYKA 1BKSB 4G0NA 3DXYA 3OVBA 2CVPA 2FMXA 1SZPA 4LHZA 2XQGA 4TMWA 2L82A 1QO0A 2E4AA 2HLHA 4AY5A 3E27A 1CUJA 2H8GA 3W5BA 3T5DA 1P1BA 3SFUA 5LNK6 1I3OB 2HWHA 3G8BA 1T6NA 3AUUA 2FHPA 4M60A 4AU1A 1Q12A 5E4FA 1O95C 2CXPA 3M9LA 5KFQA 2OTLS 1D5CA 2I1RA 3VQSA 2K2PA 1ZOPA 1G3IA 3FC9A 3D59A 2OFWA 1XALA 1FBTA 1L7QA 3WL7A 2CWWA 4DCVA 5IXJA 2A5FA 4E2ZA 1UADA 4WN9A 4C6RA 3OP4A 4ZPXA 1LFWA 3UDVA 1H0HB 2OXFA 4WFJA 1N36F 3CW2C 4UXJA 3FDSA 1T1SA 3AD8C 2D0IA 4WBSA 5EZYF 2WICA 3DH0A 4HY3A 4YJGA 2PGJA 3PCRB 5KJ1A 3PV0A 2C1XA 1P9RA 3L0ZA 4MVWA 1IOLA 1DEHA 2XVAA 3V81A 2EWHA 4NZZA 3LTNC 4I5EA 2I8EA 3WIVA 3FZGA 2EFDB 1PS0A 4PBSA 1IXSB 1ENYA 1L5QA 1IN1A 2FEXA 1RAGB 4KC5A 2XO7A 4TS9A 2AMJA 4P5DA 3SDEA 1SVWA 1T03A 2N7YA 5F3DA 1A8HA 3EM1A 4L6AA 5FF9A 2VAVA 2GCNA 1OXMA 1Z5WA 1QCZA 4GW3A 3ILXA 1ND5A 4FMDB 2HHHJ 4QGFA 4LIRA 3MW8A 3H1FA 4S0MA 1YVRA 4UARA 3MJHA 5K03A 4IXDA 1WQ3A 4MHTA 2QVBA 3H5WA 4PWZA 3TBFA 3FF4A 3BGRB 3TW8A 1EIWA 2X0IA 3PK0A 2HZAA 4BPBA 3V42A 2Q43A 1AUSL 4TV8B 4AIRA 3VALA 1E4VA 3AP1A 2V8OA 3WGKA 1NF8A 4BFXA 3O7WA 1DS6A 3ET4A 1X4CA 1SKSA 2YH2A 1Q53A 1D6NA 4RTKA 3P94A 3VOTA 1S1UA 4EYSA 5A9RA 1KY2A 5TPZA 2BHLA 3KLHA 2ZJ4A 2Y05A 1UPTA 1YVFA 4O3NA 3T7TA 3PEYA 1CSEE 1DG3A 3FCEA 4J43A 4UAGA 2BM1A 4GOXA 2XV1A 4ECRA 2YWFA 4TN2A 1POWA 2UUCJ 5D00A 3O1LA 3H5OA 3VAFA 1P9YA 1A8SA 1U8FO 1YFZA 4TY8B 4UVHA 3DOMB 4KSEB 5LZ2A 4XX0B 4NLDA 5GVSA 4O3QA 3E03A 1QHSA 3WFJA 3HLKA 4ID9A 3LHSA 3BZBA 4ZI7A 2Y0CA 3KNGA 4XTRA 3OKAA 1GL6A 3IAM9 2FZCA 4ENWA 3PC3A 3C8ZA 4RMNA 4O8ZA 2J6SA 4JI1B 2QNBA 2WBRA 5FOTA 4ETWA 1RWXA 2PZ8A 1U3FA 4MCAA 4FE7A 3ZIDA 3CJTA 1DZ3A 4YMVA 3WQQA 4BWFB 2OZVA 3JWEA 3AJEA 4EK9A 2GJKA 4KJZA 1EP3B 3L7NA 5DW0A 4HNAA 3PDNA 2Z6VA 3I3OA 4A8JC 5I5EA 5A4DA 1XLTC 1HSOA 2VUGA 1K7XB 1UR5A 3CZCA 2J6HA 1KEKA 4HVCA 4DF4A 1RU2A 3M1VB 3AERA 1R6AA 4RJTA 3O3NB 4Z3KA 4M1MA 4MAMA 3T9DA 4W8HA 5EZQA 5FWAA 1MHPA 2BLLA 1J0CA 3DVAB 2XI4A 2W9CB 4JV5B 1TQLA 1F8GA 3RG6A 2OMKA 3HCCA 2ACVA 1F60B 2IVFB 1SVLA 1O1YA 2H85A 2HJGA 2AZMA 2OELA 3RYTC 4Y9UA 4BO9A 1W75A 4RYDA 4ARVA 1QVFR 4EKYA 3S27A 4FEYA 4NOMA 1NKSA 5C8ZA 3KLEA 3CXRA 1MQ8B 2CPZA 4YRZA 2AEMA 5KI6A 3BCRA 3IVCA 2ZBUA 3H4MA 5E5NA 3HHNB 5IM0B 1N33J 3IVXA 3TZEA 1D2AA 4EPXA 2ZS8A 2IM1A 4L50A 1O96B 2J3DA 2A9RA 1JSLA 2VHCA 1L1EA 3OJLA 1E4EB 1UMDA 4QQRA 2H52A 2YVUA 4QREA 3P9YA 5FWNA 3TQEA 4IMRA 4Z4GA 5EMKA 1DSSG 1E7SA 2GCEA 3DV9A 4RZIA 3OFEA 1GEHA 3WC0A 4PQYA 3QG1A 1ZPVA 4MIAA 1DRJA 2DGXA 1PNQA 1F4VA 3DNPA 3INGA 4JL5A 1RJJA 2ZT6A 1SJQA 1NMYA 2V4MA 3QJPA 1Q74A 1SUQA 1M5SA 3EC2A 5FH9A 4ICIA 5TARA 3LDUA 5B0AA 2PMWA 1NFFA 1J0DA 2R751 3QT8A 3IP0A 3DO8A 1IWAA 3WB1A 4H0CA 1Z4IA 1NJGA 1OWLA 4L3NA 3FSJX 1MOSA 1PBTA 1MX3A 1NJXA 2AYYA 2D3OR 5JAUA 5D5QA 3L4EA 2NO9A 4RD4A 1D07A 1SXJB 1BW9A 4ND7A 4G3IA 3O38A 5SY4A 5IVHA 2A9OA 4PAQA 1KQKA 2IIHA 2QLBA 3J7YI 4EPWA 2EWMA 4IEEA 1SO8A 1IULA 1G41A 3ECSA 1M6WA 2PR2A 4PZUA 2O0LA 5DLFA 13PKA 3SQWA 2FF5A 1BXNA 5IYZA 2VTBB 2X77A 3ULHA 2OYSA 4H9GA 1RWWB 2ZBCA 4I67A 3QT6A 1R8XA 2IDJA 3F8TA 1L5HB 3T5CA 4K86A 1NXXA 5EXSA 2O07A 4HAUA 3LGSA 5KFRA 1E79A 1XWFA 4QUHA 4LRCA 1J25A 3HCBA 2MSLA 1V8PA 4NLLA 5JT1A 3H18A 5JH7F 1CG2A 3AB7A 2P8IA 5FPKA 2W9AA 3MB8A 2YNGB 2IU0A 4G2TA 2POCA 1FP6A 5A3VA 1DCMA 5FX2A 4D9KA 5I9MA 2C3PA 3NYIA 2IYPA 3ND5A 5EEGA 4YPVA 1EGVB 4JJGA 5JD3A 2M1XA 2QU8A 1O97D 3JQ8B 1MN6A 2HMUA 3IBSA 1WDWB 2PSHA 3K0JA 4ERNA 3OQNA 4AO8A 1R8AA 4LAFA 3HBLA 5G3ZA 5BQ5A 4ZOBA 4V1CA 2X3UA 1P0MA 4TL6A 2EG1A 3ZTQA 2OG1A 2V4ZA 1L5NA 3RREA 1YC5A 1D7AA 2WU3A 1PAEX 3O2NA 1O9HA 5T4FA 3B51X 4HDRB 5K9ZA 4F9EA 2GJFA 5KTQA 1SOVA 3N8NA 4JR2A 4C3LA 1ZEJA 5TMDA 1YSCA 1AQ6A 2DHHA 2IYAA 4K3VA 3VC3A 4R81A 2HA7A 1Q6YA 2QSYA 2PS3A 4FDVA 4K9SA 5EHGA 4JY7A 4L3VA 5BN4A 4YY3F 2ECQA 3LBYA 1CIPA 2QE5A 1RZRA 2WVCA 2Q1LA 4W5WA 4E51A 3TFOA 4RW6A 3SOPA 5ALRA 2F9LA 4WLFA 1CULA 4KFBA 1E66A 4RQAA 2HHVA 1YV9A 3S8MA 2E37A 3AM4A 4FFRA 3QU2A 1Z4OA 3A6GA 4BMZA 4P2MA 4LXTA 1A0OA 4RXUA 2EAUA 2V54A 5FBWB 2A6OA 4IDNA 2R87A 5C24A 3FYSA 4LVOA 1NR1A 1HR0J 4WFKA 1VI5A 4UHBA 2XAAA 4LNHA 5HK9A 5HCIA 5CVCA 3PRKE 2XCUA 1ZOOA 4L0QA 5DJBA 4G1PA 4ZHQF 2C2MA 1C1BA 5TS2A 1WUIS 3EXG1 3D7KA 4MRAA 5IWAF 1KAOA 3DA8A 1QD1A 3WLJA 2DLNA 2PD3A 3N2LA 3T9BA 1G291 3CPWR 5ILQA 4P0PB 1RWVB 2JZOA 5E3PA 3LQKA 3L0YA 2XZDB 2V3CC 1AU9A 2G1AA 5DHSA 1S96A 5U1PA 4IZ6A 4MEJA 1RLTA 3AA8A 3QLEA 5I9SA 2LEPA 3Q3GE 3I6PA 3TRJA 3VYWA 4CLXA 3PS9A 2IYVA 3UHJA 2AKEA 3MWFA 4KE7A 2M70A 1UEXC 3SIPA 4G0UA 2H5JB 2JGJA 3CUEF 3K9CA 2K1RB 3AUSA 3BM5A 3BSAA 3BUSA 1OHHD 4PPYA 5ALLA 4Y00A 2X0RA 1N9KA 3JTMA 4BCCA 3SSMA 2B6HA 4QPCA 5JSYA 5ETRA 3PPIA 3I45A 3HFJA 3V33A 3W5DA 4ZT2A 3O92A 1Q3KA 3IAHA 3TWOA 3OEWA 4OXKA 3ZHRA 3O84A 5FRDA 1L4FA 2BF7A 3RRJA 2XKKA 3S7ZA 1G3UA 1Y3FE 3U4QA 2XSZA 3U44A 2DH7A 2VJUA 3CRW1 1ACJA 3LKZA 4QBIA 3TZBA 1SQ6A 1EFCA 3EYWA 3O8RA 3L7UA 1LXJA 1F6TA 3AVWA 3FGPA 4U02A 3QQPA 5JE8A 2R2AA 2WSFC 4O44A 3BERA 4UOZA 2YICA 4FYWB 5FR1A 2X5XA 4FNMA 5CVVA 2PGLA 1I9CA 1TCBA 2CLLB 2VDPB 5LYYA 3DL4A 1A8IA 4RZ2A 4ZJYA 1J7KA 4KAIA 2ZRNA 3W2WB 3TGPA 3MD3A 3KJFA 1XCJA 2EK1A 4PYKA 1VM6A 1N5SA 3FDJA 3NY0A 3TQOA 1P6XA 4Z4CA 1M83A 1MC4A 4KUGA 4N49A 3H9BA 3NNDA 3CTRA 3UTDA 4MV4A 1L7VC 4OL0A 1SPXA 4WTOB 1PFWA 3DOHA 1HR0F 4MVJM 1CC8A 1UMBA 3E2IA 3GPBA 1HOXA 5JEDA 3HZRA 2XSZD 2EBEA 1YJ9S 2R2UA 5JI3E 2ZJBA 2XMGA 1HNNA 3MYRA 2DRDA 3OBBA 5DOVA 2A78A 3ENKA 1MSWD 1C7RA 4M9ZA 2PUAA 2EI5A 2DPXA 1NJYA 2MKYA 5JADA 3EGNA 2ZTLA 5CG2A 2KB0A 2FIUA 5COBA 2J5XA 5IDVA 3V3KA 3KUXA 3RUEA 2R1VB 2EFNA 4Q4LA 4MQ6A 5BPHA 5E0OA 1RRFA 5KTNA 4NEQA 3L4BC 5CEEA 4UD6A 3BD7A 4XVRA 3V2UC 4YJDA 2B1GA 2VTVA 4ENSA 2C83A 1PNVA 2VDJA 3PC6A 4NHEA 3JXEA 3MD9A 1YTUA 1Q0NA 1Z56C 4FK8A 1CQJB 1H6CA 3VYSB 4RZRA 2J0EA 5B2ZA 1AX9A 1S12A 2A1TS 3CULA 2H5IA 1VPDA 3R3JA 3MINB 4PCLA 5JJKA 5F9MA 2DHXA 4RAQA 5I7RA 4Z2YA 4P58A 1YI8A 1GTMA 2CLOB 1HPZB 2AK2A 4BMXA 4LF9F 1C41A 3TECE 4YP0A 2PPVA 1SKBA 4ZVEA 5HLFA 4NLPA 3KLGA 2ECFA 4JI8B 2RK6A 4U6SA 3ZHVA 2XECA 4DLPA 2ZJFA 3V46A 4C4WA 1HDEA 2HW8A 2XB2A 4RK6A 3PJRA 5C7PA 3RT9A 4N5MA 3GV7B 1IEXA 3ESQA 4UE2A 4NX9A 4G0VA 1WKVA 4N40A 4ZEVA 4DJDC 3EPJA 1U8ZA 1V1JA 3ZNQA 1WD7A 2DJ5A 1G16A 4Z7QB 4U7UD 5BMOA 5C42A 2CADA 3WDOA 4ZVOB 1OASA 2OAGA 2ALYB 2QMXA 4R3UC 3MUMP 5J43A 4AIIA 2EW9A 2JASA 3BE5A 4UNPA 4RKRA 3C5WP 3FY4A 3W2GA 3RYCA 2FC8A 2OKGA 2RG7A 4M5MA 3KWFA 2VDMB 5K4HA 4OA5A 1P31A 3RCBA 4GC7A 3SQOP 1E2PA 1NASA 3WWZA 1CP2A 4U9IS 2QM0A 1GAEO 1VA5A 4NYMQ 1UZAA 4LW8A 3AOEC 3I42A 2VHTA 2UUAF 1N2GA 4ZOLA 4YASA 2CVFA 1ULBA 4H7HA 1QE5A 1X42A 5D1HA 4ERXA 4PAWA 3D7RA 1NQVA 4DSIA 4OP1A 4RHUA 3OT1B 3A1UA 1VJDA 5J2UF 3D3CJ 4RH0A 1RQXA 3MT9A 1IKXA 5TJ9A 2G17A 2XOXA 5ESXA 3X3HA 3BRQA 3NFRA 2V65A 2ZHOA 1V3SA 5IM4F 3CB2A 2QLMA 4JCOA 2ZR9A 1X9HA 3TZQA 2FDCA 4ZOLB 3QVXA 5F9FA 4J9SA 4Y6GB 4MRSA 1RKIA 1KRHA 3AXTA 2IP1A 3T5HA 2X22A 2E0IA 3JPWA 5HSPA 5DM4A 4Y2QA 4WD3A 3G7NA 5JFGA 2NT4A 2HNAA 2BFPA 1XD2A 4AFNA 4C01A 2PLRA 1KU6A 3UDCA 4NOJA 5DBGA 2C92A 3QY9A 4NZ7A 4GKJB 4H4OA 1U3CA 5A5DA 2Y1LB 1Z3IX 2YKGA 4LF9J 2ZRLA 2CDRA 2UYGA 4IHJF 2RIJA 2LBPA 4HFNA 5IT0A 4HNUA 4O8CA 3FBEA 1PR6A 2C8KA 3KOMA 3QSYB 2QLNA 1EVLA 3QX8A 5IQQA 3EVTA 3K09C 3F7OA 3FJOA 3H3XA 3QBVA 3BGFA 4N01A 1WOYA 3HRKA 1DKLA 1JYSA 3CNNA 1MWQA 3AD9C 1ML3A 1GT6A 1O0PA 3QQ5A 4OAOA 3DP7A 1TCAA 1U80A 3IS3A 3NVAA 1NRIA 4NI5A 1BCSA 2BFAA 2H1WA 2P65A 1ZZGA 1COZA 1M72A 4AYTA 4IWXA 3HPOA 4DLSA 4JUDX 5CCMA 1X13A 1USWA 3KHKA 4BMNA 3JQJA 1QHFA 5LQUA 1JHDA 2JC0A 1FEZA 2DSTA 4QDUA 2K87A 5HZGA 2PMDA 3QKRA 4DV1F 4PSVA 4OO3A 4G25A 5C25B 2MGZA 3GJTB 4F4CA 4O3RA 3KS9A 5DDOC 4BFUA 1FMCA 1NYTA 3KL4A 5DGCA 1KFDA 2O6LA 2EJWA 2CJXB 5DDQC 2DNGA 1B2RA 1EAYC 3C8HA 5C8DA 1RB0A 3RUPA 3DOUA 4ZN6A 1T5LA 1I4DD 3ESDA 1DNPA 3RFTA 1GTSA 2OK8A 1YACA 1X7WA 2Y1LA 1VPTA 2V4RA 1YQWA 2AG1A 4WESA 2VBCA 2V8PA 4X3CA 1VYAA 1EFPB 2ZYRA 4GICA 4CGZA 3I6BA 1A4UA 1A1VA 4CFZA 1NDHA 2FI1A 3P5BP 1L4UA 4DS5A 3IULA 3WRXA 1TU0B 3PA6A 1A9XA 3HG7A 2W58A 5KO2A 2YNFA 1NUHA 2J9FA 1WD6A 4O0MA 3GF4A 1GPAA 2RD5C 1AUQA 5SZKB 4CI0B 4WZBB 3EB9A 5FV4A 3GVPA 4YCLA 1EE9A 2KZZA 4TUYF 1TFYA 3KOUA 1XR6A 2DOKA 4UEOA 1Y8CA 4OMFG 3GMDA 2Q9CA 5IT5A 1A8QA 2BRLA 1QANA 4O33A 3M0EA 1TW2A 1H3EA 4HTIA 3PW5A 3IAS6 5I45A 2OEPA 2OQIA 3VAJA 2OILA 4USVA 4ZDKA 1N9GB 3INRA 4Z1MD 2YNFB 2BHRA 4AMVA 3G8SA 4HCJA 3QO9B 4GWKA 1KC3A 3CPHA 4DR3B 3FTNA 4KLCA 1XEFA 3MPYA 1GEEA 1E20A 1VA4A 2PT9A 1EU1A 2QMZA 5GMOA 4CIDA 3RSSA 5BOVA 2LQJA 1C9YA 4PHFA 2VSOA 3HP1A 4ZU6X 1YIAA 5KINB 3RVSA 3NL0A 2D0OB 5K01A 4C9DA 3ZZTA 3SX2A 1Z5PA 2JS7A 1Q1BA 1FDIA 1JKHA 2J31A 3U3ZA 3JZDA 4ER7A 1WF2A 3QJ5A 4PWYA 3R5SA 3PX7A 4YO7A 1YQQA 3HHDA 4ZYLA 3MLAA 4YWHA 3LPMA 2BGWA 1ZICA 3EQZA 4TV8F 2Q8NA 3WFZA 1HD0A 1R31A 1ESEA 1WHYA 2HUPA 3PYXA 3MAJA 4M5KA 1TPYA 1NZFA 1D2RA 4U67Q 5CDYA 1KC1A 3IUSA 4OZ5A 3RSCA 1H2ZA 3HLTA 2Z6UA 3IMGA 3E4CA 5HX7A 2OD7A 3OIGA 4J9PA 4IMPA 2IJGX 3RG2A 3WZ2A 3ZXXA 1KAEA 1PZEA 1B0UA 3OI7A 2WZQA 3X1XA 5C53B 2BFNA 4OHYA 3GHHA 2PNJA 2OD4A 2GO1A 1BC5A 4OGKA 4NA1A 4WXWA 1BJRE 1SJ1A 4CH7A 4OYOA 2DEUA 2QE7A 1L4YA 4OHKA 5KWIA 2X4LA 4E5MA 4BC7A 3J81j 3KFLA 3T19A 3RK4A 5JR3A 4U2FA 2B1QA 3ME5A 2NXEA 3SOZA 5I7FA 1S1TA 5AI0A 1KOHA 1R2QA 1Y34E 4AZ0A 1X60A 1WXGA 4KBIA 5IJ0A 2YZGA 3H7HB 3EOAI 1ZJ6A 2JOQA 3D8RA 3FUCA 4YLGA 4MMYB 1B73A 1Q3TA 3BFVA 3ANMA 2XY7A 1M10A 1UQTA 2WJZB 2NYVA 5E4TA 2XTJA 1J5EB 3K70D 2UZ1B 3REOA 1YNSA 3LVRE 1V47A 4X8HA 4WCVA 4UUBA 1WF6A 1D6SA 1SKAA 1T3ZA 4Q1EA 3DOLA 4O4HB 2HRYA 4UT4A 4EO7A 4ZKDA 4HPWA 1QGYA 4YHBA 4H17A 4UTXA 1U2QA 3IIJA 4FF2A 1X7ZA 1A69A 4IR9A 3RB3A 3MUOA 1HYEA 4RVOA 2OCKA 2CYCA 1U98A 2I4TA 3H4VA 1T8UA 3OZWA 4YFUA 3MECA 1RXVA 1NXQA 4M87A 5F4BA 3L6CA 2C9YA 1SQEA 5ESDA 4O4IF 4DC9A 3ZUGA 3PCOB 2QHXA 3BYRA 2V4JB 3AG5A 2ECPA 4JT4A 4U2DA 1HUQA 2KFZA 3K70C 2E87A 1TJ5A 1OH6A 1P2UA 4LZNA 2R1TA 1N6OA 3ND6A 4BO7A 2ZE2A 3GQBB 3IH5A 1QYVA 3F2VA 4WZZA 3IDFA 2EEYA 2JNWA 2ZZKA 3MJVA 4DCJB 3G2PA 5KYXB 4DMUB 2AA3A 1B3TA 2QM3A 5EY5B 3B2EA 4DTIA 4C11B 3DAPA 1S77D 2GX6A 3PRYA 3THXA 4YAWA 2NSBA 4D7AA 3PPXA 4S2EA 4OH1A 3MCVA 4E1BA 4QODA 3PU6A 4UQPA 2NCKL 1N5JA 3D3WB 1YUNA 3HJRA 4DEXA 2ZDQA 5A8WB 3QK7A 3WLHA 1WW2A 2Q66A 1OFTA 3AAWB 3Q72A 4N03A 4QPTA 1AY0A 3LS2A 4HT3B 4O0NA 3GONA 4TXSA 1XHFA 5ES3A 1U2GA 4KHPB 2RFLA 4P4SB 1M6HA 3MEGB 4F11A 1FSFA 4L5JA 5HATA 1TRKA 2P40A 3K96A 2I5JA 1G98A 3EPHA 3CYFA 4BO8A 3BMXA 3C3DA 4PXDA 3F47A 4TLCA 1A9OA 3CF2A 3DTVA 4O2BA 3EZ7A 4RR5A 2R66A 3FBCA 3TOCA 3R6GA 4IRXA 5BNWA 5L4SA 2IKSA 2XJ4A 3NZEA 3SYLA 3TX6A 3PGMA 3EGWB 1PFYA 3LW8A 3RVQA 4E4YA 3K0BA 2W4DA 4J6EA 1WVIA 1WY7A 2DJIA 1RTZA 2MZQA 2JH9A 1XAIA 3GEGA 2D59A 1PT7A 4TYNA 1NKCA 4R1OA 3OZEA 3U39A 4FWTA 4B2YA 1NKVA 4D8UA 4DSUA 4IVRA 1VSVA 4BECA 2FZGA 1TKBA 4F4UA 3A3NA 4ZO4A 4DA4A 1DQSA 1UZHA 2AFHE 5KQMA 2HQDA 2JD2A 2AJFE 2MJNA 4P22A 1ZHOA 2WJWA 4FBGA 2C94A 3OZCA 2V2ZA 2NZJA 4B3SJ 1VHLA 1NJSA 4XGIA 3ISJA 5TR9A 1M2OA 2Q1YA 2UVPB 2ACEA 3CURA 1HLWA 2VATA 4ECTA 3LBFA 4KPFC 5DYYA 3DOCA 4PAOA 4FDFA 2ZBPA 3IEUA 3DYIA 4FLEA 1J70A 2UUCB 1N6QB 4A6DA 5AOAA 1P9NA 5FTKA 1B1CA 4E1AA 4OTZA 4LKOA 2BEFA 1NQOA 2B35A 3HA3A 4F60A 5DHQA 2ZM6B 4KGVA 2VZ0A 3G0GA 1JHXA 1K4YA 1Z75A 3E48A 1JDTA 3PPYA 1U1PA 1VYVA 5KTKA 2QTWB 2ZAIA 1NPTO 5AVUA 3D6NB 5ABPA 2JIDA 4I81A 3FHOA 4B34A 2V8HA 4BNHA 2RJOA 5AVJA 1UJ2A 2UVPA 4ZJLA 3S6JA 4HEQA 3OTOB 1FDAA 3JR7A 2WU0A 2V6IA 3FOCA 3RROA 4FB5A 1H73A 1X5PA 3QEMB 3RC3A 4ZHQA 5DRKA 1XK6A 1RCXB 5ENZA 3UMCA 4YRGA 1FYWA 1QIKA 4M0KA 5KAMA 4BZPA 2Y92A 2HLDD 2COUA 5C8YB 1DIHA 1NN3A 3N0XA 4LGMA 5TY0A 3W63A 3Q8RB 2C5EA 2CF5A 3H6KA 2WNIA 3NC0C 2G1JA 3TOSA 3CF0A 3Q40A 3CF5Q 2J9FB 4JI2B 1XPJA 2D4HA 2XNDD 3BN3A 1T0TV 1SOAA 2F4NA 4XQGA 1CTQA 1U4NA 4CKXA 1U7ZA 2NXJA 4HEA9 2Z3VA 3SX4A 3OXFA 3QLVC 2HDWA 2NP6A 2C0PA 1HY3A 4NWBA 2NSYA 2JHCA 3HEMA 2NZ2A 4KQEA 4M1EA 3GARA 1RM0A 2ZSFA 1OBVA 5F3RA 3Q1LA 5CHYA 5BSVA 3CLKA 4JL6A 2PX5A 2W2LA 2PVCA 3RC8A 3EJWA 2KN4A 4XWKA 2AMCB 3DC2A 3HM9A 3W4IA 1NXTA 2AXPA 1KR2A 2O8EA 2O2ZA 3VU3A 1KF0A 2ID8A 3C3WA 4K9PA 2EX4A 3C3XA 4WOPA 2CFSA 2GEKA 4LTMA 4LSZA 1HLDA 4C9BA 1K6XA 3V4PB 2XCQA 3IUBA 1DFGA 4LREA 2RJZA 2XZLA 2XUGA 4FE3A 4G5OA 1DWOA 4C5CA 4B3HA 1U6IA 5KEIA 5CH3A 3IWNC 1ZI8A 4Y98A 4X92A 5AOCA 4DRXA 3D7MA 1MT3A 3MDFA 3L4KA 1FHTA 4RFLA 5I4IA 3EZYA 2QRKA 3HCNA 4BVBA 3FPSA 4USJC 1V3UA 1FFGA 3SDBA 3FSXA 1RWOA 4TMXA 1BSVA 5D1NA 1ZGJA 2F64A 4ZVSB 3VYVA 2C7GA 3UK2A 5EIHA 5KNCH 2AJ1A 2Z8XA 1U1KA 1BCSB 4TRMA 4JQSA 3T1HJ 2FW6A 1PZXA 2JI4A 3B54A 2QUBA 2AG6A 5JH7A 3FTCA 5IK2A 2JAQA 4FDAA 1HDZA 4NWIA 3C3PA 1AF7A 2FZ5A 2B99A 3OOEA 3WRVA 4USIA 1MXHA 4LKRA 2A9FA 5CA0B 4ZEXA 2ZIUB 4HV4A 2N46A 1Q16B 5LMUF 3M1VA 5KT4A 3OQJA 4DPTA 3KB2A 4MUGA 2VASA 1Q5VA 3PKYA 3QEKA 2YFHA 3QRQA 4QCLA 4MTLA 3QFTA 2HGZA 3HWSA 1LBTA 2QD4A 3ZQUA 1RZ3A 1FWPA 1QCCA 4A0FA 4C7XA 3F46A 3NHJA 3DPUA 3ZIUA 3N4WA 2PT5A 5A6PA 2XE6A 1NKTA 2G76A 4F3KA 5MFZA 2ZR8A 1S76D 2FNAA 5BN5B 3WAKA 3UR3C 4ZAVA 1MT0A 1CJTB 1QAMA 5D5PA 2P27A 3URMA 2NTVA 2D1RA 4M0PA 1AGXA 1U0SA 1F4PA 3SCIE 4NXMJ 6GPBA 1T9TA 3WP0A 2D2FA 2JIBA 3RARA 2POQX 1CS4B 5DCYA 1J8MF 4X4SA 3BJRA 4GLBA 4TU7A 3EVGA 3ROGA 4KO4S 5JISA 2D06A 2WM2A 4JGBA 3OFSA 1RYMA 4A26A 1A7UA 3OPNA 1N6RA 1RISA 1PSWA 1M1NA 2UXDF 5KG3A 2JIZD 3Q9LA 3DLLQ 1FA0A 5IJ9A 4DL9A 1VJTA 4DSLA 3RB6A 4QWAA 1NNDA 4CTAA 1NM2A 1PC4A 4B6EA 4B9AA 5GP1A 4P5EA 2RGAA 1C80A 3LUAA 1JTVA 1L0BA 3DTYA 1S1WA 3KFXA 4WE3A 2K8GA 1RAIA 3WLPA 3ZKWB 3IURA 1IQ0A 1JTEA 4M9XA 2ZQ5A 4JI4B 5KFBA 5FTWA 1QPZA 3TR0A 1XL1A 2ES4A 4RNDB 4MDHA 1TYDE 1UW9A 3B9BA 5A0FA 4TMVA 5U4XA 4KHPF 1S0NA 1EGAA 4AJJA 1SMKA 3A1WA 1ZU5A 2HK2A 3LC2O 4CLSA 2VVTA 2MJLA 2C5SA 2WDZA 3R3ZA 5CJPA 2IBMA 3F5MA 1OXSC 3K9FC 3V8EA 1CRPA 1JDJA 3K3PA 2HF2A 2BPOA 4IILA 3AKEA 4XAQA 1SWWA 2E1CA 1S0OA 4PRLA 5KG7A 2AQIA 2C3UA 4LXHA 1PGJA 3PFHA 4P33A 4NYOA 2PVSA 3P45B 1F0PA 2HG4A 1ZUIA 1VE7A 3RS8A 2HMSA 2L08A 4KKXB 4GKJJ 1TYBE 3UNXA 4IOMA 4DLWA 2JDJA 2XMVA 3P3DA 4DQPA 5B0EA 2QW8A 3GSIA 4KQCA 4LVOP 2B20A 4C5BA 5FL7A 5B0BA 1TTPB 3E7PA 2H1YA 2VUIB 3DEFA 4RTLA 3G5LA 3UBTA 4I6YA 1BZYA 1OFUX 1TA0A 5C3UA 2C78A 1CQIA 4JB3A 5DXJA 2PAAA 2VQDA 1ZC3A 1Z8DA 1XTTA 3TANA 1PL0A 1GAOA 2TMGA 4MRNA 1XQVA 1U04A 5JUMA 4FYWA 5KKAA 4G5GA 4WZBA 1NOJA 1YJ8A 1KO4A 1SJFA 1NHUA 3P32A 3NGRA 5KOXA 2VDQB 2MIIA 4LX8A 4U7PB 2I3ZA 1T0PA 1VKNA 1T6YA 1C4KA 4IIUA 2HBQA 1ZK1A 1PU2A 1U5CA 3WV4A 2P4HX 3K9BA 2P62A 5EIBD 2MHCA 3K1ZA 4USWA 1R8SA 3BO2A 3DUFB 4JUFA 1XN1A 4BBYA 5H02A 4DMCA 2PBRA 1C8VB 1PQYA 1US8A 1DMSA 2ERXA 2PLNA 3BGRA 1E7YA 1P80A 1QCDA 3HKDA 3FGVA 1U1OA 4TGLA 4ZQCB 4MMOA 1B8VA 3KG4A 4MUAA 5ITWA 1CZRA 4BX3A 4HTJA 1CUEA 3KP1A 4M63A 1TELA 4NLGA 1KVJA 5AKEA 3R8FA 4MAFA 2BA9A 5DLDA 3ICEA 5LKAA 3PO4A 4GLJA 3AOBA 5EIAA 2G0IA 1MG5A 3KQNA 2MQLA 3AOGA 4R31A 2AFHB 3J7A1 3JSBA 2GJIA 2Z56B 2CE2X 4FS8A 2BD0A 2NLOA 2B1IA 3O83A 4QL3A 1IBCB 4QJBA 4R9UC 2P9EA 3U80A 3GP3A 1Y5RA 3WGQA 3K5MA 3DPSA 2V4JA 7ADHA 4F36A 3T5GA 1IY0A 2AH5A 4OXQA 4I50B 3WFIA 1WSRA 1QF6A 3KKEA 5CM8B 4R8MA 2Q0XA 3NIDB 4RTOA 3KOWA 4BNKA 5E1BA 3C7AA 1I10A 3DE4X 5AVRA 4EYGA 3NGDA 5FLYA 3WB0A 2PZJA 5I7VA 4HDSA 1ZKDA 1DAPA 4KXQA 2PFKA 3TTVA 2QSJA 2H1RA 2GPJA 4NS1A 3LT1A 5ECYA 2OO5A 3OZAA 2XBLA 3SNKA 1XZAA 3BK7A 4NU8X 4CQLA 2B8EA 2HZBA 3ND9A 2F7SA 3K6KA 2VB6A 1O5IA 3EUNA 3HFGA 3HY4A 1GNQA 3OFND 3ISTA 5I9IA 4MW2A 2F65A 2XMJA 3LPAA 4KDFA 3AJRA 1T8SA 2IYOA 1T0UA 4P80A 3TLGA 4WFXA 2JGKA 4HYQA 1YZ3A 4GX1A 1GDDA 3GFBA 4TWAA 4EYIB 3O90A 2W5UA 3WNDA 2CN1A 5F9HA 1RC0A 3AVXA 4ON9A 4AT1A 4CMCA 4V0MA 4CLDA 1HWIA 2JAXA 3L9XA 1J2YA 5JMNA 1N8TA 5FNVF 2WUWE 3VMMA 3D3BJ 4X64J 2XMRA 3WBFA 3B5JA 4NOHA 3TL3A 3EGWA 4O2BF 2QL6A 3RS4A 4BV3A 5AI9A 2LCWA 3EIQA 3C7TA 2YKNA 3B3GA 1CS4C 3GU0A 1HWKA 1PTJA 1LK5A 3BRCA 1D9DA 3LA0A 5DZ6A 5IARA 721PA 4KH0A 2ATXA 3ZGOA 4N8SA 3A1TA 1EFHA 2QS9A 5E3AA 2CHFA 3BF8A 5JQGB 1JHYA 2DR0A 5DYNA 2W43A 4MV7A 1XPUA 3OJ0A 2M0GB 2MB0B 4UNQA 2BJWA 5AK6A 3I62A 4E7PA 2PUJA 2BRUA 3H5SA 4Q7JB 1JJHA 3RODA 3ITHA 3O8BA 4R98A 2FE1A 3HDJA 2WE7A 2P0YA 2P2ZA 3QJLA 4K6KA 1RXOB 2H8KA 4HTAA 1YFLA 2ZQZA 3JQDA 4DVJA 1GV0A 3ZV6A 1IRXA 2IYGA 1W59A 3R2JA 4KH0B 4RW9A 3V1MA 2DISA 2M1ZA 3WDLA 4PAAA 4IG3B 3VA7A 5F1OA 5AW4A 5GTDA 5K45A 5THQA 5CJJA 1G5PA 3DZGA 4PRYA 3PDIB 2I6TA 4UZFA 4R1SA 4C03A 2VQEF 3L0OA 2EERA 3ZE1B 3D2AA 3ZJ5A 1U6BA 1PWXA 3SHWA 5K4GA 2QTGA 2WF6A 1FFWB 2BR4A 4OATA 2DKNA 2XVXA 1QC5A 1NNUA 5H9VA 3NDJA 2NUBA 3WGUA 3A70A 5KJEA 1CZKA 3KVVA 4NH0A 3UHPA 1XERA 1DBPA 2ROQA 5BV7A 4NC9A 5DI3A 1Q2XA 4GR4A 4XARA 3D67A 1U02A 2A9JA 2WW4A 4F3QA 4YMGA 1BJTA 2WU1A 5EEHA 2WPDD 4E2YA 3GT3A 5J5VA 2QV6A 3AA9A 4MUNA 3SYNA 2AT1B 3GNSA 4IJ5A 2ZIGA 1K3FA 4JC8A 2Z3WA 2V8DA 5IK2D 3KHSA 3PRDA 3PB3A 4DQRA 2F3RA 4LPSA 2R6ZA 2W6ZA 5GM1A 1QO0D 1KSHA 3H8WA 4B3TF 1W4RA 4WY2A 2LKDA 5D0HA 3H86A 2ZWMA 2I9SA 1W5AA 2MSWA 5HZHA 2IAJB 2EKBA 3G6KA 3VX3A 1O54A 4ZCKA 1T34A 3I12A 2J3QA 5JYBA 4J91A 3EEQA 2F9MA 1N7IA 1RWQA 3LW5C 5M5BA 1JIIA 2VJBA 1VE5A 1PLJA 5TSDA 5DM7Q 3HUUA 5ADZA 1CK4A 4KBYA 1WEXA 4OJKA 3KB1A 4HQLA 4D8XA 2XHWA 5J2QA 3DVLA 4FUQA 4MGZR 3FKBA 1W8IA 2DNMA 2QE6A 2ZJPQ 4D9IA 2GZSA 1QUFA 1Z13A 4EGAA 4LRDA 1F6BA 1YOVB 2ZJ6A 3G9XA 4LGYA 1UBHS 4B6PA 3TIFA 4ZOAA 2VOEA 3JYNA 4ZICA 1YR7A 5E7MA 3RVJA 4DMHA 1RHJB 3VZPA 4X66F 3IPXA 4HUTA 1J09A 4FWIB 4F4DA 4QTUB 2F43B 5KJ6A 2EG5A 4UY85 5AVYA 3OZTA 3RPEA 1E2KA 2R4QA 3II6X 4DA8A 5HJEA 4FTWA 4KN9S 1ZHFA 2DFKB 2O0JA 3PHLA 2ID7A 1D8AA 3R0ZA 5FHRA 3D66A 3ZHYA 3UN2A 3KXIA 5IWAJ 1E1KA 2FSUA 2CZQA 3QGHA 4FFVA 4XDGA 1LCIA 1IBRA 4YA6A 3ZQKA 4L08A 4ZP6A 4L95C 3I2IA 4D41A 4K59A 3VDQA 5JCOA 5MF6A 1XNQJ 3LQQA 3GVXA 1K2VN 1KDOA 4F84A 4WVLA 2DY9A 4NLRA 3M8YA 2V67A 3HFRA 4NDZA 1NUAA 3AU9A 3RGGA 4DBLE 3QITA 3W9UA 3RW9A 1JIVA 3PX3A 1VDHA 2CQDA 2ZH4A 1N1EA 1DJOA 2O3SA 2LP4Y 4UM8B 3FTDA 1EJ6A 1X4EA 4IH4A 4KPUB 4M5GA 3A4LA 5JH7B 4E1VA 1N2SA 1J9EA 5DM2A 1F1JA 1DEXA 1KMHB 1T2AA 2BFFB 1AZLA 4YBZA 4DUYF 3DHXA 4J90A 2XHZA 1W29A 2IYWA 3GZ4A 5ETVA 2GM9A 5JNTA 1B7YB 4MW0A 4QTTB 1YZHA 3NKVA 2WP8J 1U0OC 3D6MB 1RWKA 4DV4F 4M83A 4A0HA 1Z22A 2ZIAA 3AUFA 4PRFA 1JZQA 4UBOA 4H4OB 4BJ3A 2R00C 4II3A 1VHDA 3Q0TA 4JI7J 3KSUA 5K9FA 1E9RA 3I09A 3CJ8A 1UXKA 1HDYA 2JJ2A 2ASYA 5DEOA 4BMDA 4ACBA 2HSEB 4HQNA 2CMHA 2C2WA 1RIIA 4LK2A 5CB6A 1NRJB 3CRQA 1OU4A 1NBEB 4BQSA 3EWAA 4QIVA 4DRZA 2HEKA 3IEVA 1MABB 3NHBA 1AZSB 1K3TA 5J4LA 1XNGA 3EVFA 3TRFA 3GJ3A 2YWHA 4KPUA 3QW4B 3HABA 5B3JA 1SZJG 2CXHA 4KR0A 2HAIA 2BGUA 1LQ9A 2Z58A 2XYGB 3GQVA 3O4IA 4G9GA 4F4KA 1PQUA 1FEEA 2QTRA 4KGMA 1S1WB 1D1SA 3S1AB 3CD7A 5KFEA 3ETHA 1K8AT 1A5TA 3EGEA 3W1WA 5JAOA 3FGOA 2AGQA 4GOMD 2CQ4A 3P9RA 5FTMA 1QNFA 1QYRA 4WJKB 1A8UA 4DX8H 2PXCA 3OHBA 4P52A 3MUNA 5GMKa 2JVOA 1VQYA 3VR3A 4Z7JA 5TEVA 4DM7A 1B6GA 3TYXA 5CAEB 4LF7F 3PFGA 3KETA 2WLSA 3IDAA 3S2IA 1L8XA 2ADCA 4JT8A 1SBHA 4G1QA 2WB2A 3OWOA 5JXIA 2VRNA 4UHDA 2ON6A 1UQUA 1EFLA 2PX8A 1K1EA 2WT9A 1GRVA 4HR7A 2O8BA 1V9CA 3L77A 4AX8A 1BMFA 3BJMA 4D97A 2Y71A 3AWIA 5T4BA 3CX6A 1D9XA 2ASLA 4PNZA 4FGJA 5CX1A 3VPAA 3WMXA 2AMYA 3QT5A 1T9GS 2RQCA 3UH1A 4DDKA 9ABPA 2HDNB 4AKSA 2X7IA 4H54A 2WQ6A 9RUBA 1Z47A 2PIAA 4X1YA 3QKTA 1SUDA 3SK0A 1T3TA 1J22A 2XHCA 2G9VA 4YS6A 2GYWA 2H17A 5LP6A 2XD4A 1E4OA 1YCDA 4D02A 3Q24A 5H59A 4NXNJ 1T02A 4IINA 5JVDF 3OPYA 1EDZA 1EXNA 5FBRB 2FEMA 3EG9A 4Y65A 5CG1A 1AA9A 4A2WA 1H2YA 3TB4A 2FQYA 3DLKA 1E7MA 3T15A 1E77A 2P3OA 1ISHA 1SC3A 1FFBA 4AW9A 2FW1A 3IMFA 4ED0A 3I04A 1JWAB 5GV8A 2GN4A 1DBSA 3EBPA 1FDSA 4ZU3A 3ROXA 1ZNXA 4E33A 4IMIB 1YZVA 1PT5A 4HGZA 1T5BA 2X6QA 1R4MA 4TV9A 3NVKI 2RAFA 3LWZA 1UT8A 1R4NB 4J9LA 3A9TA 3RTAA 3ETLA 4TYYA 2I80A 4Q4HA 1Z16A 4YCJA 4GRSA 3ANNA 3UY4A 1UPXA 3DE0X 1QGED 3ERCA 2VPWB 5ECGC 1FKPA 2RK3A 5TQVA 1VRUA 4ELTA 2CJPA 5TDHA 4XRRA 2HTFA 2VTDA 5TQ0A 4B48A 5BVHA 3A25A 3GFRA 4JI0F 2P41A 1L6RA 3BWCA 1A5ZA 2QQFA 3NOQA 1S2DA 4NV3A 3P2JA 1B16A 3Q3HA 4PY2A 4JGGA 3ER8A 1QX4A 4DQUA 1CYDA 1SA0A 3IXLA 1F6WA 4B7AA 5AXNA 3CT4A 1C7FA 4P5PA 2AYEA 2A1TR 4I7FA 5JTTA 5IXUA 4BO4A 4LSLB 2EFEB 1H74A 1N34J 1EYZA 1MKYA 3DBRA 1LLCA 4EO8A 5AJYA 1RCUA 3JQ7A 1LS6A 3F3YA 3W0LB 1HDGO 1NYRA 4XIJA 1Y5LB 4KO2S 2JFYA 4ENRA 2IEBA 5KQRA 1E2IA 3THSA 4P2SA 3OSUA 5HF9A 2CQGA 2IZOA 2IODA 3E7DA 1DZIA 2ZEJA 4P4GA 1PQWA 5JPIA 4HR2A 2ZOGA 1N8NA 2J9CA 3WGTA 3MUVP 3EVEA 2XIJA 1PR1A 2YJ4A 3AERB 2Z5VA 4RTSA 4QDZA 2LA4A 2WZ1A 2OBMA 5CZXA 1L5YA 2UV8A 2INGX 3Q5GA 4RZSA 4JSRA 1ZL0A 3EXG2 1T0BA 2E5LB 2QN3A 2HK6A 1G19A 1D8TA 3W8PA 2EFYA 3RAFC 3LLMA 1ZXBA 1QYIA 3HVUA 4I6WA 4OLPA 2IYYA 2WB4A 4PPFA 2ZOSA 3M4NA 4L4SA 2WBLC 4QRDA 1GAQA 3ECAA 2J9EA 1BGVA 3IT2A 3L1JA 1WKJA 2X7HA 1N5MA 1K5DA 1J2RA 3INYA 1UZUA 3KSMA 2ILZA 1L8QA 2EC5A 3HDYA 3OTGA 2OFHX 2G0JA 2VPPA 1GRCA 2YHUA 5CNKA 1RWPA 2VH2A 2ETXA 5B3AA 1T9YA 1JNXX 3MR2A 4URZR 1PYSB 1A95A 1KVUA 2WR8A 5KDOA 1RHMB 1SH7A 3PVZA 1YE5A 1UPMB 1GKUB 5BXIA 4EY4A 5G40A 4X9XA 1SXJC 6Q21A 3L46A 3OOJA 4LS3A 4RPFA 2QIFA 1UMKA 3NBKA 2XZPA 3VV3A 1QHHA 2QG6A 4HRVA 2I1QA 3W04A 5EKUA 1FDTA 3I2HA 5FUQA 4DQSA 1OY1A 3L43A 5IP5A 4BEBA 3CVJA 4J4TA 1HMYA 4B1FA 1XMVA 4NBRA 4NASA 5JY1A 4EX7A 5IN4A 1RRMA 2H1OA 2MHEA 2HX1A 3R6DA 2EZ9A 4MV3A 4OV1A 4EGCB 4KL8S 3BS4A 1FX0B 3QGIA 1UJNA 3B6JA 4I0WB 2BOVA 3H83A 1EWTA 2R6R1 3H59A 4NLTA 2QA4S 3ELYA 3O4RA 5EIXA 3Q8YA 3HCXA 3A7EA 3SXLA 2E7VA 4GEKA 1NFQA 2O01C 5JYEA 4UQLA 1NBAA 5HKKA 5E2BA 4DZTA 4TQRA 2P9QA 3H4BA 1IN0A 4HH1A 3ESBA 1BD6A 2XDYA 1AXGA 4ECAA 2QA5A 5ITHA 1IZ0A 3C6XA 4AXBA 1GN8A 1FZQA 3RVKA 2G88A 4WV3A 3Q0EA 3Q11A 1VP9A 1S48A 4KR2A 1KY4A 3DWEX 4TRNA 1RI1A 2ICAA 5LLTA 1IHDA 2WJVA 4W9NA 2IUEA 2AZDA 5I5GA 3ZK8A 1J2EA 3EQ7A 1TEHA 3T1OA 3H5RA 2VDWB 3RE1A 5HVNA 1GPKA 2C4MA 4EQZA 1IC6A 5CA0A 3SS9X 4ZQHA 3CU5A 3ILYA 1WC1A 1W0JA 1ORVA 3BJZA 4GRAA 1SN7A 3KK1B 5BNTA 4ZN3A 2NTYC 1C3VA 2ONZA 2V5HG 3F5FA 2HXGA 2C28A 2UYOA 5BXQC 4IUYA 3V8QA 1U2FA 2G7ZA 1XMOF 5J4VA 3Q2SC 2X3FA 3P49B 2FOXA 1HARA 3E9DA 1RU1A 4FEAA 3MCMA 3HB1A 3GP5A 3SP1A 4IFVA 4MS1A 4P3KA 4ECXA 4C6TB 4D4GA 5BN5A 2HNDB 4TT8A 3QM1A 1KMHA 2FMTA 3WGVA 4D3SA 2ZVIA 1U2DC 1JJ7A 3KOAA 5B37A 1FNMA 1W36C 3AR8A 1CVJA 1RYDA 2CCKA 4X6UA 4EG1A 1RWOB 2AS0A 4A0RA 5B12A 1Q14A 3QVMA 3HXPA 3I61A 1O3YA 4WBNF 3PUKA 5FWYA 1OKKA 4P75A 1Y9EA 2GW8A 1U31A 4W5RA 1XRMA 2LIPA 4N9QA 4NE7A 3HSZA 1LFDB 4ID8A 3DE2X 3NHSA 4HXEB 1RI2A 2FMIA 3NC4A 1E1MA 2RGWA 1F0KA 2IBTA 3K58A 1MLDA 4GLOA 2G28A 1AB5A 1S79A 1HQYE 5TVGA 4EUSA 2C22A 1TXGA 1ODFA 2PEYA 1S2MA 3O6VA 5CYJA 3A58B 2MINB 3IOYA 1P2GA 2IOHA 4FGUA 3RIHA 3RB8A 4BE4A 4HQ0A 4I8XA 4G8JA 3LQ4A 1WC0A 5FDLB 4PXCA 2DR6A 3HCRA 3SYKA 4FFLA 3M2VA 2YWBA 4R0MA 3P52A 2QMEA 2JFPA 1V3TA 3JASA 3U6BA 2LXIA 2I6FA 3ABQB 2XUJA 3MERA 5FB3A 2HWKA 1T4DA 5EWLA 2AZXA 1N36B 2NV6A 1V9OA 2A1UA 5LMNF 5A3QA 3U13A 2DR9A 3GP8A 1WWKA 1G55A 2OFOA 5G4KA 1QU2A 5B0CA 3EGOA 2HNYB 4B3CA 3FKSD 3WLSA 2X15A 1P8AA 4ZMSA 2ZNYA 4LE1A 1EZ1A 1KEUA 2P30A 1NUSA 2ZYHA 4B7ZA 2B7BB 5F5LA 2IXEA 3EHEA 3RWOA 2WTFA 3EDQA 5EWFA 2QY6A 4NXMB 2WJHA 1B1AA 1XZNA 2ZETA 2DWUA 3H2HA 2JCBA 4ZDWA 3QPAA 1G9XA 3K1TA 2CLSA 2WM8A 2W4QA 3ZV3A 2Z6QA 5MFPA 5AT1B 4E4RA 2EFQA 2DJWA 1KL7A 4JDPA 3MWBA 4NPCA 3VKHA 5CMLA 3R9WA 3M2UA 3H4TA 3OY7A 3DMTA 1R8PA 3C14B 2RT3A 4I4BA 2QGNA 5G0WA 4EPRA 2VBXA 4J16A 2VAMA 3K0SA 3DJYA 5LA6B 4Q02A 2G4CA 5EFZA 2ZE7A 2KFYA 5HMWA 1JLLB 4KFUA 1UZLA 4O2AA 1NDQA 3VTKA 5IDWA 2ZRQA 3IAEA 4LF8B 1JFFB 1XNJA 1W34A 5CA0F 3JQGA 5EXDA 4Q05A 2D1SA 3UAYA 2BT4A 5CRIA 5FA6A 3HVHA 4TKVB 1CJUA 4NATA 2H48A 5JHGB 2G63A 3FSGD 1WF3A 5BORA 1EHIA 4TVKA 4TLBA 1UFKA 4QELA 1VECA 4BFYA 1G38A 2AD5A 3ELWA 3FMPB 3T9CA 5GZ3A 2GEVA 4BGVA 2QRUA 3GFYA 2BOPA 1V6HA 3SFZA 3D7LA 2UZ3A 2X8WA 3JVDA 1HQUB 3UUEA 1L1QA 1N7HA 1IR1A 3AP2A 3EQ9A 4DPWA 2D3WA 3B6EA 2ODEA 3K0EA 2HZCA 2R8XA 1ESCA 2YZKA 3J81k 1MJFA 1EX7A 5HXAA 2QG4A 3MG9A 4ZVQB 1M5PC 2AU0A 2O59A 1KKMA 3ZV7A 3DS8A 1J8DA 4GOOD 3KUDA 1A0OB 2XS5A 1Z12A 2ZB4A 4BKPA 3GV0A 2CF6A 1XXHE 1AN9A 1RADA 1XE3A 2PGOA 2PZKA 2UUAB 1SOUA 3JU3A 1SCQA 5L3SA 1C0UB 1V3QE 2E29A 4HPJB 2CBXA 1OXVA 4CEJA 4LF4J 1SKRA 1X7XA 1R5BA 1QAYA 1Z2PX 1PJ2A 3C4JA 1LRLA 3RTDA 4ROSA 5BR8F 2UYCA 3H4DA 5J58A 2GAIA 4LFAF 4IS3A 2IUSA 1KI4A 2GVNA 2YQ1A 2BR3A 5J1EB 2QVGA 2V96A 2GDZA 2V7WA 2UU9J 2CMGA 4JI3J 1EAMA 5IT4A 3FVWA 5DT2A 3JQ8A 1P0QA 2RMLA 4C07A 3M4XA 5LWHA 5ITZB 3G2LA 4U7DA 4JD5A 5E3CA 3NTQA 1FUEA 1F0NA 3DGEC 3R7WB 4O4LA 3CE6A 5AVSA 2WIFA 5I3UA 5KYGA 2K3IA 3GIKA 1GV1A 4QSMA 3UDEA 4O02B 3U02A 1HE3A 1EE1A 2FN9A 2RAPA 4RPCA 2HIQA 2HIHA 1STOA 1Q91A 1U3GA 1EEHA 3LK7A 2ILVA 2JAOA 1JECA 2CQ3A 4HN4B 2IYQA 4AJKA 1SCJB 3OIUA 4Z86A 2XCTB 4LRAA 2FUG6 2NU6B 3FGZA 2HA0A 1OGIA 3ZDFA 4JI1F 5JJCA 2FVPA 3NTLA 2M2BA 3NBZC 8GPBA 2VFRA 1GPBA 3MM4A 4DLLA 3SKVA 2C9MA 5KHLB 4ISBA 1M76A 3UXYA 4EHLA 2NV2B 2F4VJ 1H72C 4R51A 1E3QA 1R0SA 2IYSA 1I3LA 5REQB 2FPSA 5E9QA 4N0DA 3NWGA 1FUKA 1SCJA 3DDZX 2EKPA 3EX7C 1PFGA 4YQZA 2GN8A 5AKGA 3CEAA 4ECYA 1I1GA 1WNFA 2NXCA 5KC9A 1C0EA 2QY9A 1N36J 3GUCA 3NONA 2HB6A 4ZAYA 3D1JA 1IM2A 2C31A 3AHIA 4KG7A 1ZINA 2HHHB 5KFIA 4OHMA 4NBLA 3W2VA 1NJZA 3K6SA 1KMIY 1RZRD 4ZARA 1U3DA 4NLXA 1TUBB 1WBJB 5A8KB 5JC8A 4KTTE 3P8BB 1JQKA 3O31A 2X1LA 4UU7A 4P34A 4C08A 1TU3A 3GEMA 2BFBB 3OTEA 1MB0A 1L7PA 4KXVA 5INTA 4B3RB 4QO7A 5HM8A 2VEOA 5JPCA 1JFLA 3NP9A 821PA 5B1YA 2JDIA 3KWMA 1RJFA 3HGQA 3WHPA 1FX0A 2A0WA 2KJQA 3KPWA 1PUJA 2WYIA 1EKXA 1Q8IA 1O6BA 4MYDA 3IP8A 1G2QA 5F8LA 4QXRA 3BFJA 2IC3B 3S2EA 4UE3S 1HLPA 3RUFA 4PR3A 3OTBA 2NUUG 4JSYA 3NHWA 3RIMA 3OFVA 2GS8A 3W3SA 3ZW8A 1RK8A 1LPOA 1WL8A 4UUWA 4W98A 2C2YA 3TPCA 1TCUA 2QXYA 3ZOKA 3CRMA 3DQQA 5A8WA 5M3BA 1GN9A 3T1YB 2NYHA 2ZYWX 4YRLA 1ITPA 1MNQA 2H31A 4L73A 2Q7OE 1ISPA 3CWJA 4F0KA 2AN3A 1ZS9A 3FKJA 3AY3A 3A12A 1RP1A 1CUYA 4C6SA 4JLOA 4BC1A 4IGKA 3OR2B 3CZQA 3VGJA 4H7KA 4U7JA 2BZ2A 1TMGE 1UC8A 4KE8A 3FCSB 2JLQA 3LQVA 5GZ1A 3DOIA 4C8ZA 4ND8B 5IM5A 1XSEA 1SHUX 2NUAB 3VOBA 1HL6A 2I6GA 3W9JA 1G7CB 4H7PA 4HAVA 3TDKA 3GJQB 1M8GA 1OT3A 3G7UA 4Y7CA 3TRGA 5IG2A 4U2BA 2LDYA 2IBOA 1IZ8A 2ZR7A 4OQDA 1G0OA 1CQJA 1JXAA 1Q0ZA 2AK3A 5K20B 5H7XA 3MGKA 1KPGA 3WKBA 2ERRA 3M33A 4G0QA 3LDAA 2G0CA 4GVPA 5E7QA 4LVUA 3PW0A 2F3JA 2FHJA 1OFUA 2QM7A 4B3GA 1OGYA 4IDCA 1TK0A 1MR3F 4YRMA 3WLMA 3EDCA 2PXHA 3GJXC 1BHJA 2ZE5A 3M05A 5D3QA 1AKRA 1I1QB 1NDKA 3D28A 1TAUA 1LPNA 3SN6A 1VZ2A 4XYEA 3QI2A 3RTCA 3HJUA 3SJBA 2LECA 3NEPX 2P2LA 4P08A 5KKNB 1P7WA 3NHMA 3ER9A 4C4ZA 3R3WA 3GFGA 3BWXA 3H42B 3ZBTA 4UUMA 4MRVA 5MN6A 2ZI6A 2HRCA 4RPGA 3SCKE 3PQFA 4J4HA 3PX0A 2ZRHA 1YB4A 1J24A 2CNKB 4YRRA 4LZLA 1S6PA 3M83A 4EBFA 4ZZ2A 2J5KA 5GJVC 2QTVA 1HEUA 1Z7BA 2VQ6A 4M95A 3MJFA 4W9RA 4ZEOA 1NCLA 4QVGA 1KO5A 1X87A 5FOVA 1E1QA 4FFDA 1FFAA 3ZY5A 1D5WA 4KIWA 3ORSA 1QVGR 4LV5B 3F67A 1M2GA 2D7JA 1O87A 3L8YA 2C4UA 2PCJA 1YZTA 1ZP6A 5SICE 5B7NA 2DPHA 5DN6A 4B76A 3K8WA 3KUHA 3JQBA 4DLXA 5AK3A 1TMMA 1SKUB 5ETNA 2ZTSA 3ZTRA 3B9PA 4MIKA 3CT6A 1IONA 1MFPA 3RSHA 3HJGA 1H1TA 5JSHA 4NCXA 2QO3A 4UUXA 4FFBB 5L3ZA 5JVDA 2MZSA 3OESA 3OJOA 1R7IA 3G9TA 5TVKA 5JIBA 3TUPA 4M9QA 1PS8A 1DRKA 1XLTA 4JN6B 1XCBA 3C4QA 1J42A 4DFPA 1R8BA 2W42A 3GCWA 2FFRA 2XDQA 3EGDA 3GNLA 4WN3A 3OA0A 3C19A 2CCGA 1E2FA 1V3VA 3NKFA 1L4EA 3MA0A 2CFXA 7REQB 1YJWS 5FWXB 3DE3X 1JFVA 3VVBA 5CH5A 4H4EA 4XGKA 2HZ7A 3MHTA 5H80A 4CVNA 4EELA 4EHAA 1T2EA 5HJ2A 4I6EA 1QP7A 5K5EA 4D79A 3OPXA 3HI9A 2RGUA 1UPBA 3M6XA 2IPAB 2XCLA 1DXHA 2H51B 2B9EA 4LSZB 4AKIA 3RS2A 2JWNA 4EY3A 3I0MA 2ZU6A 4D9JA 4U39A 2XCIA 2GPWA 1PE0A 3F90A 4RVGA 3I0SB 4KR6A 2I71A 4HQRA 4TXMA 1ZAWA 3R5CA 2Q5OA 4NRTA 1MO4A 1XO1A 5CFMA 2G77B 4OLAA 3MNFA 2FETA 2E48A 4V1CI 4S1VA 2IPNA 2GK6A 1DAEA 3ZCUA 2WAAA 2VSNA 3WO1A 3IBFB 4CT9A 3AB2B 5BQ3A 3L82B 3PY8A 3EWIA 3BGSA 2XWYA 1E3WB 2ZYUX 3GB0A 3FOWA 3SC2A 4MVJH 3OZVA 4BU1A 2X8JA 1X0VA 4YO8A 3RJTA 3C97A 1NEEA 4P92A 3O7MA 5CURA 4BLPA 4I4TB 2WABA 3IA7A 5LWQA 2ZI3A 3RSGA 1JKFA 2B4PA 4GKKB 3P9QA 4TMYA 4PQGA 3SC6A 2Y0BA 2C2KA 2X9LA 1RJGA 4G8CA 3IPCA 1RRKA 3FOBA 1R0CB 3AEQA 3UA4A 5F64A 3VPHA 2RHRA 1PTKA 3K17A 1IBLF 2PUTA 1VJGA 4UOFA 2AHRA 3DM9B 4AF8A 2RHDA 1JE0A 4KQ9A 2FW7A 4ZVNA 3GSDA 1E3WA 3G1UA 3VO2A 3K5LA 2PO4A 2AKWB 2F9JA 3D0OA 5JZSA 1YKGA 5EKTA 3PRHA 4GLFA 4C2TA 4I1PA 1OXXK 1YTLA 2F9FA 2W70A 4GC9A 5FYQA 5M04A 5H82A 5JATA 5K5MA 1DFHA 4Q12A 1VQNS 4YRAA 4XYGA 3BICA 3I4LA 2HHTA 4GOJA 3V6LA 5SV2A 3KLMX 1HT3A 1HTBA 5D0EA 2BACA 1SL0A 4PZYA 3VPGA 1GG9A 2JGNA 8AT1B 2DHGA 1DTWA 4MH8A 5DEIA 1NJ5A 3U17A 2C8LA 2ZSEA 3Q3CA 2EKZA 1HR0B 1M5UA 4Y2IA 1Q78A 3P5SA 4QUKA 4LF5F 4GO5X 4J9VA 4RADA 3LLVA 3AVPA 1GMUA 4BLGA 2HGSA 2FSGA 4PNEA 3FRZA 3BGLA 1M1ZA 3E15A 3GYBA 1RU3A 5CYQA 5A8KA 3GJSA 1T13A 1DDGA 2N9UA 3S29A 2YQZA 2GNOA 3G8TA 2QTNA 3VWSA 2HF7A 1MBZA 2QV0A 2MTBA 4U2KA 2G9NA 2V2KA 1Y10A 4MKHA 4V3CA 3P20A 1SQGA 2OMLA 1QIDA 2QDKA 1YULA 2Z4RA 2Q4RA 1JVNA 3I52A 1VIDA 5CT5A 2SKDA 1PKUA 1C81A 1H6BA 3CZMA 4MIEA 3DDNA 2V7PA 3NS5A 3PJEA 2PEHA 2C4KA 1P3JA 4CLYA 1T10A 1TLTA 4ED5A 1P62B 3ZD9A 3T4XA 2WM9B 3EX7B 2FYXA 1LC3A 2FX5A 3F2IA 1XZFA 1L9KA 3MAHA 2M4MA 4RL4A 1CLEA 1SHTX 3RUIA 1NOKA 2AR9A 3FDFA 1N8KA 2PO7A 2VG5B 3CDUA 2UDPA 1YIDA 4MKGA 2CUYA 3F0NA 4JJKA 4UJ5A 5L1IA 4J37A 1ZIPA 5L1LA 2CD7A 1JB0C 2XI2A 1UT5A 1ACLA 4G4JA 4Q9NA 5DTQA 5KFWA 3F6PA 5B6IA 2BFEA 1JMVA 2GHIA 3K57A 5HKAA 4COOA 4W99A 4YJ2A 1GT91 4HWSA 3E22B 3JSRA 3VDMA 1IBLJ 4TKUB 4S12A 4W5HA 4FT4A 1HMVA 5F8HA 3VPXA 2EOAA 2XPCA 5FULA 3UFBA 2VONA 3IR6A 1U3TA 3A1NA 2YWRA 4LJAA 1C3JA 2G72A 5H4GA 2GESA 4ZVPA 3CJQA 2YBVA 3PFBA 3D9BA 3OUYA 2N4CA 4JXJA 1LI5A 5J3JA 1T9CA 1BA2A 3PO5A 4K88A 4DA0A 1FSZA 1PZHA 4B2PA 2B8PA 2YQ3A 3JV7A 3KV1A 1KP9A 4M98A 1R74A 3DEZA 1X5SA 4YGXB 1N2XA 4IF4A 3LX5A 2H5IB 5IAAA 4CLUA 4C1NA 2V6MA 3AV3A 3ILJA 2B5WA 1NJ1A 3FYDA 1YH3A 3FDZB 1NK7A 1GR0A 2W6MA 3CEHA 4RF5A 1X0PA 4R1TA 4P4TA 4L5AA 5HKLA 2O54A 1JJ2R 3CZPA 1AYEA 2DXEA 2JHPA 1NC1A 4M5DA 4EQ6A 2I3AA 1PFQA 1PP4A 5TQ2A 4MS4B 1HWLA 3NLLA 3ZE7A 4UTZA 1SUBA 1PJLA 4LJ7A 1WXDA 3F98A 1PL6A 3N2KB 3KQMA 1U0SY 4X4RA 4BBJA 4F0JA 4YP3A 3TE7A 4F50A 3G6XA 2W93A 1NJFA 5CXQA 1JSXA 4E3WA 5HF6A 1ZSYA 2J5AA 3HZHA 1YD7A 5KYUA 3DE6X 5A1TA 3L79A 3THXB 1TK9A 3FZ2A 3KQOA 3C6UB 3SIPB 3OT5A 1FX4A 3A27A 3Q4GA 4M4SA 2V69A 1QPGA 3N0VA 1ANKA 3OE5A 4TTJA 3VPFA 4FN4A 4JQYA 3QRPA 3MQ2A 4UTGA 1WMAA 5I7EA 4DR7B 3CC2S 2JCXA 2AJDA 3QEBZ 4HNAB 2DGUA 3SKYA 1FTNA 3HVIA 4K87A 5A9SB 3UOAB 3LSTA 3PL1A 2R6HA 2H4XA 3AIOA 3CW9A 3PFEA 2GM5A 3D6VA 2XBMA 5IAOA 2HFUA 5CT8A 2GT1A 4BEVA 2IX3A 4DL2A 1H0RA 1GLVA 2BGMA 2QSZA 1UKUA 1UJ6A 4YHHF 4LFAB 2WD7A 1FVSA 1U2TA 4IXMA 4B5LA 3X2FA 5KYKA 1U9YA 3E8SA 2WVBA 3R7LA 3NTXA 2ZJ3A 2ASDA 4FYMA 4Z8YA 2JVRA 2VC0A 1SXQA 1LJUA 3G2HA 3I9JA 5F2KA 1ZTWA 4OAPA 3A1VA 5JYCA 3L7LA 2Z5FA 1KO1A 4Y0FA 3DJFA 3PFNA 2QSUA 3ORFA 3SYTA 1ZOSA 3L7AA 1SPBS 1SBTA 4DIEA 3UMBA 5LU8A 3H1EA 3LPCA 5L7YA 1GADO 4G9BA 4NCBA 4CKEB 2IMOA 3THTA 1A4IA 3N1UA 2ZD1A 1OJLA 4I9NA 1XVAA 4UF4A 3WYNA 3OFGA 3NWEA 5KTMA 3QE9Y 2YJ6A 4RGBA 3UAXA 3UKJA 3N0RA 4PCAA 2P67A 3L01A 4FPIA 1R0ZA 2VK1A 1O03A 2PV0A 3VR5A 1XAGA 2EW2A 4HD8A 1KYQA 1R12A 1RTIB 3WLTA 3INNA 3O4HA 2Q6BA 1ZBQA 4BLSA 4EGSA 2I4MA 1UVLA 1WWHA 4RUAA 4MKYA 1OX5A 5ED4A 4MR8B 2GFFA 3K6SB 4UBMA 3EVDA 3TIIA 5EJAA 4YAOA 1XC7A 1ESZA 1GK8A 5FWYB 4URXR 3ZS8A 1ARZA 4X71A 5DG9A 4MIYA 4NE9A 4BQOA 4TVSA 3TQIA 5HCUA 1PT9A 2VRCD 2GKGA 4J0DA 1GMVA 5DS7A 4HT7A 3QUTA 3MMJA 4Q3AA 2CQCA 5J2MB 3GJ0A 2CNNB 3UQZA 2JZ5A 2J3KA 4QWCA 5FWXA 2X1HA 2VIHA 4X4QA 1TC2A 5SUHA 5KTSA 3Q87B 1C1XB 4B3FX 2W8ZA 5DWVA 2Q46A 1ZFNA 2YYSA 2AN9A 3QBEA 3BQ2A 1UF9A 2ZH9A 5K14B 1GPDG 1Y89A 2QTFA 3IFSA 4OFWA 5ETSA 3ZZ0A 1XLUA 4OK3A 2YBEA 4JLNA 1CE8A 5L53A 2W48A 4U8YA 4HPXB 3SU8A 3WLLA 7FD1A 3CMES 1Q6ZA 3EEBA 4X90A 3NIWA 5JWRA 4QFMA 4B9LA 4ES6A 5TQJA 3K94A 4G84A 3PLAE 2J67A 4NEYA 2QNIA 1ZGZA 1FRQA 1JR3A 5B6PA 1JH8A 4KV8A 4TY9A 4I3FA 1QG6A 3ZDYB 3ET6B 1QTMA 2PJZA 2RARA 4YP6A 3GGOA 1K97A 4Y1FA 4L4UA 5HNKA 1DBIA 1G1AA 3Q7TA 2YMQA 2OXRA 4ALKA 5FTNA 4BV2A 2W2MA 3EFEA 4JJIA 2OGUA 1QFYA 1RTHB 4ND3A 1TL5A 3CO5A 3QTLA 4YVFA 4JLJA 2L18A 2VT3A 5CDFA 1VBMA 1Y9OA 4N0QA 4YC7A 1XR7A 2PRIA 3W3ZB 1GRNA 3QY0A 3CSKA 1VCNA 3C3LA 4DV5J 5HJ7A 1TM7E 4OHZA 4ZALA 3HVJA 5FL3A 4DJAA 5HGXA 1SKUA 3A4VA 1YS2X 4J0CA 1SKYB 1CUFA 1E3SA 3RKRA 2MR5A 2C5FA 1U7LA 3EPGA 2I7XA 3GQCA 2IIPA 4DIBA 1YCHA 4WCEQ 1N48A 1ECPA 4HKQA 4M6WB 1YMQA 4FYYA 3B3FA 3CEDA 4D8WA 1RFGE 5H3CA 2KH9A 1U1LA 2KQUA 2B4QA 4QGBA 4LC9A 3CCTA 4PYDA 1Z5OA 4AKTA 4B3SF 1XHEA 2J3JA 5B0FA 3TFQA 3GFOA 3U61B 3ZU6A 3DP9A 2CRLA 2OQVA 2CSXA 3IOMA 3W2IA 1JDNA 1R6VA 1QUVA 3DAHA 1TQDA 3IAXA 1LSUA 4MITA 1YZ6A 1P17A 2XYRA 4CDMA 5T7LA 2DQZA 3T38A 4JKOA 1TM3E 1SRRA 1RHQB 1NBME 1EKSA 5C5DA 1F2HA 2LFVA 1ZXXA 1NP6A 4DCSA 2DNQA 4B4WA 3L7IA 4X00A 2VHZA 5AJ3F 4QYZJ 4PLCA 1N6KA 1GZVA 4LJSA 3GYGA 1Q17A 3ESYA 4RY8A 3NPAA 4Q4AB 3CCUS 4HL6A 4NV0A 3S5UA 4MYSA 4X4UA 1YK9A 2E82A 1U7PA 1GLGA 3HHLD 3NT2A 3P9NA 5G0UA 5A2GA 5LA6A 4A0SA 1NI5A 4HBZA 3IA2A 3DZDA 1TEZA 4LMPA 4NZMA 3MMBA 1VLJA 4FYXA 3TTYA 1TZCA 4AJOA 5K3AA 3PW4A 1Z5NA 4HB0A 4MXDA 4YT2A 1SXJD 2Y8YA 2ZH3A 2V5VA 2NV0A 1LWXA 1ZGGA 2OD6A 1MX1A 3DSRA 1P4SA 5F8NA 4C0HA 4ZQGA 1BO6A 3NWRA 2NR0A 3EVZA 3HK2A 2ZAOA 3KFVA 1RWWA 2G4VA 3C5HA 5BRJA 1KBZA 1WMBA 3K15A 1DRZA 3I0RA 3SQDA 2L17A 3G2OA 1BE4A 3CH5A 3B6BA 2IRYA 2YNMD 3L6RA 4CF3A 4YUWA 3CW8X 5CLGA 3QXGA 4B4VA 1CY7A 3P4XA 3ODPA 1MHTA 1LV8A 2ABWA 3QNMA 2EFCB 1LW2B 3VPSA 1YHZA 1ZVQA 4FOTA 4DMFA 5K1ZA 3A6LA 2HGMA 2XW6A 3H5TA 1QHIA 2IFTA 3HVTA 1DWQA 3Q9SA 3DZFA 4EF6A 3ST7A 1DAOA 3KUEA 3V4VB 1TGYA 2W9XA 2B4RO 4LISA 4OX9Y 5E95A 2B5JB 3U7FB 3ILOA 1WM1A 2O8DB 4LOIA 3TCXB 1L7DA 2GRAA 3M6WA 2XUPA 1NQTA 4A16A 4QEDA 2WD9A 3CVXA 1J5XA 3G0IA 4BB6A 5JNVA 4EKIA 3UCFA 5BR8J 2G25A 3GAZA 4J1QA 3FBBA 1JA9A 1PFUA 5T67A 1UPFA 1HDOA 3AR4A 2Z8QA 2VNJA 5SZTA 3AJDA 1JI3A 1TLFA 1UKCA 2BCGY 1TL3B 4BCDA 4TMZA 3LHDA 2AGOA 3JQAA 4RF3A 4Z4FA 4YJ2B 1JLFA 3MCTA 4F06A 1B70B 4LBIA 5AKZA 2H2IA 2I4LA 2HCTA 3E61A 1K4MA 2QLJA 3I8OA 1MDBA 3UNGC 2AQHA 4CEIA 4KYZA 1YJXA 3AJAA 3GIJA 4ICLA 5TLSA 4RESA 2FWNA 1E1RA 1RWPB 3T5KA 4KKOA 2JATA 5DYWA 1WZEA 1U8CB 1P45A 2TMDA 3OKFA 4RKEA 1TL1A 2ZR0A 1H2RS 4IHAA 2QENA 3E70C 1OYEA 3T1TA 4NLUA 1UL1X 5I4KA 2MOKA 3V1NA 2FPKA 1RHKB 1NULA 5BUZA 2CB0A 4HG2A 4DQQA 2ZSDA 3KYDB 3HB9A 4MINA 2GA9A 1YSJA 1XNRF 1JGTA 1VL0A 4OX9B 2HZVA 2XNJA 2Q1UA 3MPOA 2VRBA 1AHIA 3U3KA 4FLFA 3AF2A 3BBPA 3P4YA 2OAEA 1Q1QA 3M32A 3AR3A 4BB9A 2EEZA 1XBTA 3SG0A 2KJVA 4FT2A 3O4FA 4KHZA 1FK9B 2FDNA 1ACMB 4PR6A 1IIRA 5KBYA 3ENWA 4JJ4A 4K5SA 4H27A 2Z4SA 4CFYA 5JO0A 2MQ8A 4HDSB 2YUIA 2B3DA 2OHHA 2WAQD 1X7XB 2FPUA 2J6BA 5KOJA 4UHJA 4LHVA 2VKZG 2ERYA 5DX0A 2NO7A 4PLWA 1TKTB 4WI1A 5K8JB 1I5EA 3JSAA 3OD2A 2IWRA 3BSYA 4CLTA 4KGXA 1I4TD 2C42A 3H8YA 1ENZA 3MEEA 4MULA 3ZYCA 1QSYA 5BVHB 2QTHA 1E2EA 1OLXA 1ZJ5A 1JWWA 3JAMU 2RHJA 2OGWA 4CNBA 4J1TA 2UYHA 5CXUA 2P4QA 4F96A 1RPZA 4FOLA 4YAGA 1GCAA 3W4KA 2PLWA 4D9EA 4CLOA 2OPSB 1ZETA 3IMQJ 4LJ4A 4AT1B 4G36A 4LOKA 2RS8A 5B2EA 2PC6A 4A73A 2B8TA 3DLIA 2VG6A 2L9DA 3BGOS 2R5NA 1LSJA 5ETKA 4ND4A 2MZ1A 2V7XA 4IFIA 5JD4A 3IMKA 2IXTA 1MG7A 4CP5A 1T03B 2HA4A 1DT5A 2RDMA 3SBMA 2CPIA 4QYXA 2XY4A 3LHKA 4WVFA 4MKAA