3VHQA

Crystal structure of the ca6 site mutant of pro-sa-subtilisin
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
395
structure length
385
Chain Sequence
NTIRVIVSVDKAKFNPHEVLGIGGHIVYQFKLIPAVVVDVPANAVGKLKKMPGVEKVEFDHQAVLLGKPSWPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADALGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Requirement of Ca(2+) Ions for the Hyperthermostability of Tk-Subtilisin from Thermococcus kodakarensis
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 134
structure length 385
sequence length 395
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 2011-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.80 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Peptidase S8 propeptide/proteinase inhibitor I9 3vhqA01
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vhqA02
1SUAA 2WWTA 4AKTA 1GTL1 1TK2A 1GA1A 1UBNA 3OSZA 1EGQA 3WQBA 4CFZA 5K7SA 2ZWPA 1OT5A 1CSEE 3BPSP 1MEEA 4C3UA 2ID8A 3BPSA 5SICE 2QTWA 1C9MA 3F7MA 5AVKA 2W2MP 3Q40A 3HJRA 1SCJB 2W2MA 2WV7A 2ST1A 5CW1A 2QTWB 5JMOA 1AQNA 3A3OB 1R0RE 1SPBS 2G4VA 1PEKE 5AMXA 1GNSA 2Z58A 1PJ8A 3VV2A 2V8BA 1SVNA 3DE1X 3EDYA 4GI3A 2SBTA 3I34X 4ZARA 2W2PP 1NLUA 2W2PA 2IXTA 4JP8A 3VV2B 4YN3A 4I0WB 3I37X 4FONA 1GNVA 1YJAA 3I30X 1SCAA 2Z2XA 3H42B 3A3NA 3VYVA 2Z58B 3EIFA 1AH2A 3CNQP 1WVMA 1SBNE 1VSBA 2W2NP 1TECE 4NE9A 1AV7A 4KPGA 1ZVJA 2Z30A 3DE5X 1KE2A 4OV6A 4DZTA 2PKCA 1TM5E 4HX2A 1WMDA 3Q5GA 4H6VA 1LW6E 2W2OA 1V5IA 1TO1E 3D9QX 3WIUA 4J94A 3DWEX 3DW1X 3F49S 1DUIA 1THMA 4BWGA 1GCIA 1GTG1 2Z2YB 3GCWP 1SUEA 2GKOA 3SQOP 3L1KA 1Q5PA 1TM4E 3DE4X 3QMPA 2E1PA 1S02A 1TM3E 4HVLA 1TM7E 1ST2A 2PWAA 4C3VA 1Y34E 3DYBA 1TMGE 4NMXA 5AQEA 5FBZA 4H6WA 1KDZA 3P5BA 1Y3FE 1SUDA 1C3LA 3P5BP 3GCXP 1BE6A 1ST3A 3AJ8A 2SECE 1DBIA 5B1EA 3BGOS 1SCDA 4NMXB 2Z56B 3DW3X 1PTKA 3H42A 1Y3DE 1IC6A 3DDZX 3DE7X 3EE6A 1SBHA 1TO2E 1GA6A 1Y48E 1SUBA 3DE3X 1SH7A 1EA7A 3A3NB 3LPCA 3QTLA 2XRMA 3UNXA 1CNMA 3VTAA 1T1GA 3BX1A 2DP4E 3DVSX 2SICE 2ID4A 1ITPA 5FAXA 5ARDA 1XF1A 3GT4A 2ZRQA 4B5LA 4CFYA 2W2QA 1R6VA 1KDYA 2IY9A 1SELA 3A3OA 1SBTA 2ZWOA 1V5IB 5FFNA 5I9SA 1Y1KE 4KB5A 3DE0X 1SCJA 1SBIA 1SIUA 2WUVA 1T1IA 1P8JA 1Y3BE 3WIVA 1ZVKA 1Y3CE 4KG7A 4H6XA 3T41A 4OMCA 2DQKA 3DVRX 3DE2X 3CNQS 1KE1A 3QFHA 3PRKE 2W2NA 1KDVA 3DVQX 3I2YX 4CG0A 1JEAA 1Y4AE 4K8RB 3SICE 1WMEA 1BE8A 1MPTA 5ARCA 4Z2AA 2P4EA 2X8JA 2WUWE 3A3PA 3TECE 3VHQA 5B1DA 3ZXYA 4OMDA 2Z57B 3PTLA 4OV6B 1IAVA 1S2NA 1BFUA 1BFKA 2Z30B 4K8RA 4DWWA 2Z56A 5JXIA 1PFGA 2DUJA 4LVOA 1WMFA 1AK9A 4LVNA 3SQOA 1V6CA 4M1ZA 2PQ2A 1NDUA 2B6NA 3WHIA 1SPBP 4AKSA 3TI9A 1AU9A 1SCBA 1GT91 3VV3A 1AVTA 1SBCA 1SIBE 4NE9C 3LPDA 1P7VA 1GA4A 3F7OA 1SCNE 3GT3A 3LPAA 1P7WA 1Y33E 2X8JB 3GCXA 4MZDA 5AVJA 4ZOQI 2Z2YA 1AF4A 5JXHA 1HT3A 1YJBA 1TM1E 2PRKA 2XTJP 2XTJA 1NDQA 4NE7A 1S01A 3VSBA 5JXGA 1T1EA 3DE6X 3LXUX 2HD4A 1SIOA 2W2QP 2PMWB 2W2OP 1A2QA 1OYVA 3BGOP 1WSDA 2PWBA 1SN7A 4WOCA 1GTJ1 3ZXXA 3CO0S 3TI7A 3CO0P 1C9JA 2PMWA 2Z2ZA 1BH6A 1SUPA 3A3PB 2HPZA 2SNIE 3GCWA 1OYOA 1YU6A 4RYDA 1YJCA 2Z57A 3AJ9A 4DJ5X 1SUCA 1C9NA 1R64A 5ARBA 2TECE 1Y9ZA 4YN3B 4WOBA 5JXJA 1Y4DE 3D43A 1BJRE 3AFGA 2PYZA
chains in the Genus database with same CATH superfamily
2BGIA 4GM0A 5I8WA 4FYYA 3CF4G 2W9BB 2C2KB 3UATA 2GA8A 3STYA 1OY6A 3DF7A 2YZMA 4CVNA 2XGSA 2V8DA 5LJ5Y 2OBLA 4R2KA 4LF9J 4XIFA 5L51A 1OLSA 1JDPA 5D86A 4Q01A 1G2EA 1N33B 4XQGA 2MQQA 2CK3A 4UY85 4Q1FA 4TZ6A 1WNFA 3OWXA 1LRLA 3CRW1 3OM8A 4I8XA 5KG3A 1UETA 2ONJA 3HBAA 2VJKA 3I92A 5H1YA 2ZRMA 2VUTA 5AK0A 1UMBB 1DPGA 1E6YB 2XCLA 4MEAA 2ZU6A 4LYHA 4HDKA 5DZSA 3DUFA 4X4RA 1YIJS 1UC9A 1DKUA 2RARA 2CQ3A 3F5QA 3L6EA 2HHXA 1VRTB 4B4UA 2YHUA 1O6XA 2ZS9A 4DFJA 2WWIA 3QFCA 4LY3A 2GILA 3L0IB 3TCXB 1BU8A 2BCEA 1XLTC 5BW6B 3EISA 4PC3A 4NYJQ 1UMCA 1P9OA 1AH2A 2JIQA 4JC4A 2ZAIA 3LT1A 4NPHA 1OKKA 3AVPA 1IN1A 3N70A 4F4YA 2V74B 3U4CA 1Z6GA 1M5OC 5ETJA 1KFJB 2FFAA 4N3GA 3ZBPA 3OL9A 2PT7A 5FBLB 3L0PA 3OVSA 2X8AA 3ROXA 1G59A 1SU6A 1Y6JA 2EHDA 1FK9B 1E96A 2ZDOA 3F4BA 3NW9A 5TQVA 2YWCA 4XSVA 2XMCA 4ID3A 1THMA 1IZYA 1G55A 3JSMA 4JEHA 4P3KA 3ZV5A 1P91A 2HA5A 3KK3A 1C4WA 4PSUA 4WK3A 1WDLA 4P53A 5IDXA 2GPSA 3DYBA 4YY3F 4ETNA 4NXNJ 2R8PA 3NBXX 4RCYA 3NWRA 1I7QB 1NK0A 4LRTB 2OO4A 1LOUA 3CULA 4IJMA 3U7EB 4E98A 1NPTO 5HMMA 2VT7A 1NKEA 1DC8A 3PXAA 1ZD3A 1W19A 4QBFA 1SCDA 4GGPA 4UBJA 2Y3IA 4B4DA 4ER5A 3EG9B 4DCVA 3MTIA 1IM4A 1SBHA 1SCIA 1KRPA 3GFHA 1L1RA 4IIUA 3RWMB 2XR1A 2VJUA 2UXCJ 1YA6A 1QG4A 2JFBA 1CP3A 3MGGA 5AKHA 1TJ4A 1LC3A 1T2FA 3S70A 1BHJA 3LBNA 2ZUUA 1PR0A 3PRVA 4JMLA 2J9RA 4R1QA 4AIIA 4Z7NB 2R1TA 1RRVA 3FBBA 1RXEA 1WELA 3LHFA 2WVEA 3R1HA 2BW7A 2XMZA 1RQ0A 3GV5B 1BKSB 2F1IA 3UXMA 3UAXA 1GKKA 4X1IB 1FYXA 3Q87B 3RD5A 4AJKA 2NAFA 2WRZA 2HAIA 1UQRA 2DHRA 3IIKA 4K9DA 1LQ9A 4CTJA 1AQYA 3MT7A 1KRXA 5CA0A 2QSZA 1C7FA 4MV0A 3AVQA 5EUCA 5EC8A 1KOLA 4QO8A 2PH5A 4YB1P 2QBYB 1I5RA 1U7OA 3ZCQA 3IT3A 1KNQA 4CMGA 1WXHA 1M1YB 3ZHZA 2GNOA 1M7HA 4CLWA 1E79A 4F86A 1A4XA 2AX0A 2L17A 1JLQB 4AN1A 4TUYA 3VBEA 1S1WA 2VASA 2HFNA 1GUDA 3MAGA 2OC9A 2CXXA 1LRJA 5LZ7A 2QL7A 3M9WA 2G76A 1ZUHA 1KRHA 2AOXA 3ELWA 2FDXA 3LP1A 5G1NA 3QXHA 2WW4A 3OUYB 4EMUA 5AICA 1A6LA 4MVJA 5J2MA 2BZ0A 1QAXA 3VCDA 4FF1A 4MRMB 4O1HA 4EYQA 3F56A 1OU0A 5DGHA 4X66B 1YQWA 1VIOA 2ZYGA 3I01M 3OZDA 5FTLA 1ZY2A 2MHNA 4KT0C 5CVVA 1YJUA 4U02A 3E53A 2F9FA 3JYTA 3HXPA 2PRKA 3ND7A 5I7UA 5K0BA 3SZMA 3KEQA 4M9RA 1YI0A 4BC0A 1GV0A 1M2OB 2QMHA 1G5QA 1R5NA 2PMDA 3REGA 2PG3A 3I0RB 1EESA 1X31C 4UUXA 1LI7A 1K44A 1CY2A 2JD0A 3ORRA 4LGMA 5CA1F 3MT8A 3CD5A 4U9HS 1TCAA 4RHXA 4YC7A 5CDFE 4PLTA 3RG8A 4EFNA 3KJHA 2V58A 1ZCZA 4TGLA 3RIXA 3RTEA 4ANFA 3BZQA 4K9SA 4R25A 3HSYA 1I51A 2UXBB 2RCYA 1YQHA 5EP3A 1Y9AA 2W9AA 1MHPA 4OXXA 5MGNA 1HYBA 5CCEA 3BCUA 2XMQA 1ZK2A 4MITA 5L7WA 4FB5A 4CM5A 3LQ1A 3CLUD 4K3VA 3V4RA 1PV2A 4CW7A 4C8LA 2P1RA 1VB5A 2JK0A 4R9UC 5AT1A 3R7FA 2JLXA 5T6BA 1MZPA 2Z0MA 1L7DA 3CCTA 4M55A 3X1KA 2HQFA 1QC5B 3FUCA 3NCQA 4NOHA 1NRKA 4D4KA 1U2SA 4L4SA 3RYTC 1QZZA 4L8GA 4XYBA 1OPZA 1NZ8A 3KHRA 2Q5QA 4TLLB 5H3HA 1CDZA 1OGJA 4TT8A 4RUBA 2J9FB 1XVIA 3KJVB 4TMTA 4QTTB 5FQNA 3GJRB 2O2GA 1EK2A 4RJLA 1NR7A 5AM3A 3L93A 1TQHA 1UBJS 1NQVA 2D7SA 3OFKA 3GDFA 3TZKA 1JIVA 3OFFA 3IOBA 2CVHA 4BNFA 5I3CA 1VQ9S 1JDSA 1U0JA 4K28A 3I37X 1I3OB 2C2YA 2KT5A 3K09A 3RJ5A 3CRQA 1ISRA 1N1MA 2BI7A 4FBTA 1EBUA 2OLWA 3LNTA 1NZDA 2CLLB 1YWXA 1YQXA 4RGYA 4AL5A 5BN3B 3PGJA 4K81B 3GNLA 4MUXA 4QR0A 4R01A 2HIQA 3CZPA 2WNIA 4X8HA 1USVA 4TTRA 5JSZA 3KVYA 4BPRA 4MK9A 2VBFA 3DHEA 3CNNA 1SQ6A 5C25B 1Q7CA 4WDQA 3LW7A 4K0RA 2C94A 4O33A 2J9EA 4JIMA 2AXQA 1MKYA 3UGKA 3U4QB 2HBRA 5D00A 2CWDA 3RIYA 4X1YA 4BWGA 5B7GA 1GTG1 3LUAA 1E7WA 2XDQB 4V0ME 3AI2A 4CDNA 3Q83A 1MLDA 4G01B 4KE8A 1LDGA 2V7GA 3ECAA 5EJFA 3IPXA 1GM5A 3OT1B 4R7GA 3K3PA 4HVLA 1RAGA 1CUVA 2I22A 2HL6A 1B99A 1M2HA 3RF7A 2UUBF 1R43A 5CXXA 1AB8A 2RJ3A 4ZJQA 4ETIA 3Q86A 4M6WB 3SBMA 2EFCB 5LKRA 3C4VA 1ST3A 4QU9A 3GIMA 5CA5A 1KP3A 4K87A 1YQTA 4RPCA 1Q7GA 1A9OA 2WONB 1R0BA 3QIAA 4OSOA 2WZQA 3EVBA 2YX7A 3QT5A 4K4WA 3IAEA 2CUYA 3AF4A 1QAYA 2OD7A 2PQ0A 3H16A 4GE0A 3T1QA 1FRJA 1X7ZA 2XRMA 3KLOA 4XVUA 1J56A 4JV5B 1S1UA 5DX1A 4HTFA 4E46A 4ZTUB 2ZQ5A 2UUCF 3WJAA 5T6MA 2GKSA 1Y7TA 4EKEA 4OL0A 1ADBA 2AQHA 4AN0A 1S8OA 1KTVA 5DYYA 4Z2XA 1OFVA 4ESEA 5KT4A 1PUIA 2QROA 1Q16A 4M21A 5GMEA 5AXNA 4M1SA 3Q3JB 4ED9A 4TMVA 1Q7TA 1LW0B 3H2UB 2ETVA 3ZE8A 1QCCA 3O8BA 4EO4A 4PXBA 3OAAA 2O57A 5C4MA 1XELA 4IKAA 3ZGZA 2BRUC 4PQEA 3NASA 5JRJA 3U3XA 2O4CA 4C9BA 2FEOA 5D51S 4IJVA 1KSFX 1R0SA 2AZ4A 1WZIA 2XI2A 2IFXA 1IONA 1X4AA 2R1VB 2H48A 3U3MA 1RAHB 3A8JA 5LXTF 1RT2A 4ZVUB 1SJRA 1W0JD 3FYCA 3G49A 3LP0A 3E15A 4PGMA 2GAFA 3VZBA 3TPZA 3A4YA 4Z8XA 4UBLA 2JHCA 3GEMA 5LYJF 3LHDA 1RQRA 3R0IA 3HDVA 2E18A 2XCQA 4XQ0A 1L5HA 4P32A 4MVXA 2CG4A 3SJCA 3LPAA 3TUJC 3WYBA 4KC5A 4ASUA 1VFPA 3D8HA 1SGWA 2V6MA 1P60A 3S3TA 4TVKA 4MKBA 1K4KA 2AOWA 1TLFA 5EYPA 2IH5A 4F96A 4OJHA 2PRSA 1NK6A 5DNWA 3ZTQA 4I1SA 1XYGA 1VI6A 1QLWA 3WLNA 1WEKA 3K0SA 4OHFA 1XEWX 3GLHB 4INPA 2MKIA 3VPAA 2AKEA 3V4SA 2B9VA 3TNLA 4MEBA 1QAOA 4NULA 1MDFA 2AIRA 4Q7QA 3MLAA 1GHTA 5I42B 2HSGA 5HIAA 2R5FA 4E2XA 3LKDA 4C3LA 3SSOA 1IHPA 3RUEA 1RZ3A 1U9ZA 1QIEA 3HDSA 4C0SA 3EGWB 2FSPA 3P2YA 1CQMA 2M2BA 1NN3A 2I9KA 1IYZA 1OV6A 5E9WA 2BELA 2GN4A 4HEA9 1FDBA 7REQA 4LAFA 2GVDC 3AKDA 4XAQA 2WHQA 3Q8LA 3QOWA 1XZLA 3JQGA 3OOEA 4QE3A 3TQCA 1YB2A 1J24A 1HE1C 1W9MA 2YKMB 1CBUA 3EDRA 2G2ZA 4B84A 1BXRA 1Z0AA 5FUQA 4A36A 3LCVB 4X5OA 4DBLC 3U4GA 3VNVA 1PT8A 4AWBA 3JVUA 1W2BR 4BO1A 3TZCA 4CTNA 4YP3A 4I9UA 1Q91A 1SJ4P 1G0OA 3D2LA 3CY6A 1FHTA 2DX7A 5M2PA 1WCIB 4UULA 3FCSB 3L4EA 4NCBA 4BBPA 1DG3A 3D3CJ 4IO0A 1RXYA 4DLKA 3OIVA 3DLHA 2VK2A 3ESXA 3HHLA 1KO1A 3MYYA 4MLCA 2IYXA 4IFYA 2J5RA 4A8KA 1HE3A 1IQ0A 4BFVA 3NHSA 2IITA 4RNFA 3KOYA 1NURA 3C1UA 5T57A 1UCFA 1LA2A 1SPXA 3KJZA 5DN9A 2A0WA 1YQGA 4E13A 1ZH2A 1KYXA 4ILEA 4JKIA 1V9SA 2BUBA 4JJAA 1V39A 4YI3A 5L4LA 5AJYA 1NTOA 1Y8RB 4EVRA 4J94A 1FRHA 4Y2XA 1JTFA 3PE4A 1Z6YA 1GCIA 1T4BA 1L8AA 3BWEA 4KTTE 5BSMA 1CJKA 3HFZB 1U1MA 1OJ4A 3D68A 2B94A 5KCZA 1KZHA 3E01A 2OO7A 4RK0A 2NV0A 3UQSA 1H0HA 2PUVA 3RBEA 3WNZA 4F3NA 5DI3B 1ANKA 2G0IA 2B6HA 3PNQA 2I1RA 4ZI3A 1GZVA 3VPSA 3BDVA 2Q5IA 3NCRA 1M2GA 5CDHA 1DAPA 4URGA 2VOPA 3CZQA 3GC6A 3GDWA 4YONB 3LOUA 3KKZA 2XNCA 3R77A 3IPRA 3DB2A 4DPMA 1G63A 2QLFB 3GFFA 4GFDA 1BCSA 2C5FA 4O4LB 2V4UA 2FZGA 1JR3A 3O5AA 1M8GA 1I6LA 4I3GA 1CJVA 4MK8A 1FFGA 2H8KA 2FB9A 2IA5A 2MSCB 1WCV1 3P9QA 5HBGA 1EUCA 2C2BA 3EVCA 1R6VA 2HV9A 4YRRA 1EHWA 3K2YA 5FRDA 3U61B 5BV8A 2WF7A 4FZ5A 3GB9A 2JLYA 4GPTA 3R8FA 3RUFA 3KQYA 3O4GA 2YXLA 3LK6A 3NV7A 5CNMA 1R5JA 3AT1B 4PYOA 3MMCA 1E6KA 5C8ZA 3SF0A 3VJRA 4O23A 2YVUA 3VMFA 1TU3A 2RHDA 4R1TA 1HYHA 2B9XA 4DQVA 5CVDA 2YNFB 2VP4A 4KK4A 3ZEIA 2QP4A 3V4IB 2HQGA 4REQB 3OPYB 2P3SA 1BE8A 2XJ4A 4BNJA 1UR5A 2GYVA 4WACA 3N2GA 2FUEA 4JC8A 1AA9A 2B7LA 4CMAA 1MQAA 5HIKA 2GXUA 1GVHA 1MBZA 4PWDB 4G1IA 5M2UA 4YBZA 3AXSA 2DUJA 3ANSA 3BSWA 3EZGA 2XF8A 1S9DA 1YA8A 3MI7X 3GFRA 3AJ2A 2DC1A 1YFZA 2HMUA 3O2SB 3CC4S 3O7WA 2MXYA 1M1XB 2AU0A 4A0HA 2Q8NA 4CMEC 1D9XA 1PJ2A 5E0KB 3VHXB 3M2TA 4BEJA 3NOXA 2O6LA 1E9RA 1W25A 4AJOA 1DCTA 2BABA 1YR6A 1JFRA 4RKEA 2CVPA 2O0MA 4FDAA 4A4DA 4JYPA 1GFSA 1F5AA 3K0FA 3IHLA 1VI2A 4MUKA 3A9WA 5F8JA 3KE8A 3ELUA 1VBYA 5GQSA 3U7IA 4REOA 1T1SA 1LLCA 5D3ZA 1R6YA 3K6SA 1OF1A 1UP7A 2XMTA 4FYXB 1NE7A 1U2ZA 2XYGA 2J3DA 4Q1VA 4YCBA 1JDBB 2LU2A 1WSDA 2GZRA 1W93A 2N3ZA 4UHEA 2F3RA 1SN7A 5TE9A 2BR5A 1KI6A 3G2PA 2OVBA 4LVCA 2H3HA 1E7QA 2GEBA 3OG9A 3UANA 4ZTBA 1QOZA 3PR5B 2PM8A 2XSZA 5LZ4A 1XAGA 4HQKA 2NPIA 2GJ2A 2E49A 4Y6OA 1P19A 5IAOA 2I4LA 3K5WA 3VR6D 3T5MA 4B3MJ 1TL4A 3KJVA 4WN9B 4YJFA 2C58A 1H6DA 4MI9A 3D0IE 2QLXA 4NZPA 2BKLA 3WQRA 3CHYA 3TA2A 3QRQA 5EHIA 5HCUA 1YSJA 1VSTA 3OSPA 4TXNA 3M8YA 1ZVQA 3KLFB 4GM1A 2CNKB 3W5XA 2JJ1A 4Q3NA 4B7UA 3FVTA 2AJ1A 1GTMA 1KZ1A 4J90A 4L73A 1NMQA 3G82C 4OB8A 3WRVA 3E8MA 2GF0A 4YIKA 1C8BA 4TVSA 2GVDA 4L0CA 4J2HA 4CG3A 3M4ZA 2AYEA 5KFMA 1Y8QB 4IYRA 5IEBA 4C4WA 3EZUA 1KC1A 5E6SA 1IUNA 1B6RA 5EI5A 3SSAA 4CKBB 1XR5A 3KALA 3SI7A 1JR6A 2NO9A 4DG1A 5HVNA 4U2FA 1UDWA 2ZYAA 3K30A 3AJRA 5HSPA 1H8EA 1B43A 1JI3A 3IO3A 1SCAA 2Z2XA 4DL2A 4MCAA 3HEAA 4IR1A 1KIFA 5AKIA 1S89A 2ZI6A 4E5NA 2ZIWB 2JLZA 4EI8A 4OPMA 3TVZA 4LF5B 3C5EA 4EEYA 3SR4A 2XCAA 1IBKF 1VECA 2OAUA 3C6YA 3UJ3X 1ZCAA 4ALIA 2XMDA 1B2LA 1GCUA 3LSYA 4XPIB 1ZK1A 1T24A 3PQ6A 4I2PB 3GA0A 1FX1A 2QL9B 3HJCA 1XXLA 4OHZA 3DR3A 4PICA 5C51B 2WUDA 4WUTA 2O0LA 1IEQA 1IH8A 1L5VA 3DBHA 4CLTA 3EW7A 4E09A 3GIDA 2RG1A 4LJYA 4Z3OA 2E89A 4F56A 2ZOGA 3GFSA 4TRNA 2W1BA 4N82A 4F8EA 4CLSA 4P33A 3VXKA 3QE9Y 3VYSB 5D4NA 2PWAA 1ZJ5A 5JVDA 3UJDA 1F1BA 4FLFA 1U6ZA 3T9NA 1DQNA 4NMXA 1A7AA 3F5SA 1JKMA 3GNSA 4ARBA 2ZQZA 4F72A 2HLDD 4PU0A 2A9VA 2JHEA 1JTVA 3NLCA 4CM4A 1JRLA 1SV5B 1PX0A 3NPAA 5I7VA 2VQFJ 5KVAA 4OREX 3NNSA 3FKJA 1VSVA 1MRNA 3GX1A 4P4NA 4LF9F 3BRQA 1U7LA 3QTLA 4L08A 4O4HA 1U24A 2G7MC 3N86A 4BZZA 1JVSA 4PGGA 1FMCA 2VG7A 2H4FA 4ZTZB 2XV1A 4WZAA 2EV9A 4FZRA 3QNWB 4HWPA 2C2MB 1H0SA 2CXTA 2HJSA 3CJSA 1Z0ZA 3ND9A 2GPWA 3IGFA 3ITKA 4JBGA 2DJ5A 2RAPA 4DADA 1CIPA 1JG1A 5AOBA 1JIKA 3OO0A 1QK3A 3CGIA 2NWQA 3RW9A 1FE8A 1KOOA 1A2OA 2QVZX 4M49A 3HDGA 4D8VA 4KG7A 2CQHA 1A9XB 3OHBA 2X14A 2BW2A 2HURA 5KMGB 3LALA 1FYFA 1ACJA 4YMIA 3KB2A 1SOWA 2RU3A 3GV8B 1IJFA 5DCWA 3E9CA 5DM60 4Z4QA 4B9MA 3NZEA 3HV0A 3LY9A 1TZKA 4ZHQA 5ECGC 3ZOKA 3OC6A 2V9KA 3FQLA 4BTVA 4Q1DA 4NLVA 3JVVA 4XUGB 2BKXA 4OQQA 4Z9XA 4LMBA 2N1BA 2FQWA 3CCBA 1T6ZA 3ICWA 3D31A 5FPYA 3QX8A 1VCTA 2CQ1A 2CNLA 1V6CA 3EA4A 3CJ4A 4DL9A 1NVMB 1LWOA 3Q8RB 3HBJA 1YDEA 3EPRA 2KYRA 2BOAA 3I5BA 4M83A 5FI5A 1I10A 2WFLA 4H7PA 2F1JA 1IKXB 3C3JA 4Z86A 1DRJA 1WY7A 4X63A 4XWTA 3VPGA 1QIJA 2ZZKA 4HC4A 3BILA 4LF1A 1GXUA 1N32J 1B6GA 2C9DA 3RVJA 1M1KT 1YI1A 1YZTA 3CU5A 1Y10A 3VC1A 1A2QA 5KT5A 4TLCA 3HJGA 1OFUA 3FRHA 2A3NA 5HN0A 1T9HA 4UZCA 4LFBF 3PJGA 2QPOA 2QF7A 1I36A 1KH1A 4FPRA 4BO3A 4IH9A 2PBFA 1SEPA 4IVQA 5EKDA 4U9IS 1FE4A 3HO6A 2VJQA 2L3MA 1SUCA 3DTYA 2VSYA 1C7QA 2CJXA 3GJ3A 4FGSA 1JPUA 3L1IA 5IN5A 1UW4A 3Q7TA 4TUYB 1L9KA 4YIHA 1LXJA 4LT6A 3CUSA 4DSFA 4AJ1A 5AW5A 2Y6UA 2V65A 1TKZB 1DKPA 4N77A 3D1QA 1BXNA 1VP9A 4GMHA 4DDFA 1PVVA 5I5GA 3LLUA 3CCLS 3FNNA 4DQDA 5EZYA 4UNRA 2HMVA 1QO9A 1ORRA 5B1SA 3RANA 1QYVA 2FX5A 2GYUA 1JAZA 4I50B 2YASA 1T5HX 1KEWA 4S1WA 1NRXA 1ZOIA 4XGQA 1TVCA 5SZIA 4F84A 1PYOB 1T10A 3K5NA 1M9NA 2A6PA 4XB2A 2OO3A 3VSCA 4Q15A 2IHNA 3O8WA 4F93B 2Z95A 5T41A 1FYDA 3OQJA 3SYTA 5KFEA 2SXLA 4EFMA 3COSA 3UN5A 4DV1J 1S4FA 2EFVA 1E1RD 4YUYA 4OYHA 1QM9A 3OJ0A 4Q24A 4BQFA 3QUBA 1HL3A 4JKOA 4DJDC 4F4HA 1TF5A 3H0KA 2I0XA 1W4ZA 3B1WA 3REFA 1B8VA 3W2HA 3W2GA 4EG7A 3ABQB 4PX2A 2VV5A 2R65A 3I58A 2HHWA 4ETXA 3AUTA 2J45A 1WUHS 3KT3A 2Z6QA 1O94D 4RHCA 2V8PA 1S7GA 1QYRA 1ZH0A 4OQEA 1WDKA 4RK7A 1JFVA 3FOFC 3JAMU 4P5DA 3UW1A 1FRQA 4MQUA 4OJ3A 4TKLA 2P2GA 2GSDA 1VM6A 4N5IX 4W5NA 2RG7A 2VEOA 2NXNA 3FSGD 3L1KA 5JS6A 3A1DA 4D7AA 2B4RO 4B9NA 2VG5A 3F98A 1EQ2A 5DJ5A 5J2QA 1TM7E 3FIJA 3WYEA 5ENDA 1R37A 4UVIA 5ITWA 1TMGE 4OH7A 3U4DA 3DSRA 3I56S 5AKYA 3QI2A 5C7LO 5J4KA 1UAGA 3SKYA 5DLQC 3ELDA 3DFZA 3WICA 3D2CA 4LDJA 4DR1F 2D3OR 2A7XA 3WTBA 5EMNA 1PD0A 3TBKA 3KB8A 1UBTS 3TW6A 2ZULA 4F4IA 3ZU3A 4AJEA 2NPOA 1DQ9A 2CPIA 2N7CA 3ZV7A 1YZKA 3TZBA 3ZV3A 1LD3A 3SIPB 9LDTA 4JVOA 5F1PA 2XY5A 1K4MA 4LV5B 2O5VA 5IN4A 1XF1A 4ID9A 2H4YA 3IB3A 1LCIA 3G0OA 1JWAB 1YFJA 3V46A 1GTSA 4P08A 3O9ZA 4U7UD 2NZYA 1HETA 4YP6A 2O59A 4I6JA 4RWXA 1H2HA 3DBVO 1H6BA 2GK7A 2PEZA 4M5NA 1GG8A 5L3RA 2BBSA 4R2IA 1RT7B 1MQ9A 1NY6A 5AWFC 2YVAA 5GIOE 3IHTA 4X6XA 3FDIA 2NVUA 3SJAA 4J16C 1YI2S 4ALMA 5AUOB 4IQ8A 3Q15C 1Q57A 3VZCA 3R1LA 3G6VA 3VFDA 1LJ8A 1XMOB 3QAUA 1IK4A 3FHLA 5ARCA 1DTEA 2HBZA 3UFXA 3ML1A 4UW2A 1L6IA 3IRXB 2WMDA 1L5LA 3IAS1 1UKEA 3H0EA 4Y7CA 3I9V6 4OV6B 3GLRA 4L2IA 1GPNA 2PZ8A 5E3AA 3VR2D 1ESZA 3VPCA 1T2AA 3RIEA 3V80A 2WONA 1DQ8A 4FUQA 5TGTA 1D2MA 1F0PA 1M2WA 3HABA 1G7RA 4Q8FA 1X7GA 2PD6A 4HYEA 1GZ5A 3NBPA 4TXSA 3T7TA 4P4UA 4J0JA 4JEMA 4JYBA 1LQTA 5MGBA 3AONB 3R3ZA 5JDCA 4K4ZA 1FUYB 4F9FA 2M6KA 1X14A 2P35A 4GI1A 1RYRA 5JPIA 4R71A 1NDCA 3LT4A 2C5LA 1JN0A 4K7QA 3GROA 1HD0A 3N8IA 1QF7A 4JLVA 4UEOA 2QQFA 4OL9A 5ULLA 1PLLA 3Q1LA 2WW8A 1DKMA 2NYHA 4GLFA 3U39A 4D97A 2VRCD 2B43A 2HVHA 4P83A 2MIIA 2K7ZA 3K4PA 3NOCA 2KQUA 3GRPA 3DKRA 4TT3D 4NJEB 3B20A 3IRVA 2IBTA 3ADOA 2ZPUA 3BWYA 2CHQA 3THRA 1QAMA 2I7DA 5K14A 4E1BA 1YG0A 3V32A 1X86B 1ONOA 4QT0A 1KWKA 4BHTA 4DL0C 4BP3A 3PNOA 1TJPB 5FHQA 2RGAA 1W5FA 3IXMA 2XO7A 2OPRA 1HMVB 3IPCA 3BJZA 2MSLA 1NR5A 3KTAA 1UM8A 1YZHA 1C4CA 5I9NA 1MB0A 3PJXA 3DCJA 2VG6B 3SBOA 4BO9A 1OT5A 4D44A 1JB0C 3RU2A 5TQ0A 2OPHA 5EZSA 1AZLA 4XDGA 2J08A 2J9GA 2GK6A 2W2MA 3QPUA 4ASUD 4WDRA 1XJWA 4ECEA 1TD9A 2GERA 2FWBA 3EYAA 1IR0A 3WWCA 1U2CA 1SPBS 3O3OB 4KXLA 1PW7A 4TRMA 4F3OA 2I66A 1ZZGA 4RW9A 3O8OB 1VP3A 1JKIA 3T99A 3ZDZB 1YZ7A 1P2VA 1L3IA 1L0BA 2VSNA 5AVYA 1THTA 3LDUA 1GR0A 4YJKA 2OTLS 3H4BA 4O8ZA 4HAIA 2GQ0A 3UK1A 2YDYA 4X0EA 3KZVA 1UT5A 5F4ZA 4Z4EA 4KQKA 4BGIA 1L3TA 3HTXA 4L85A 1AX9A 2QX4A 4N0QA 2VSXA 4D43A 4HI1A 2ACYA 2D1YA 4XFJA 3GIWA 2VP6A 3N2KA 3ADBA 3HU3A 2Y1XA 2W6MA 1I1OA 5A8WB 5IP5A 3ROGA 1T43A 1H8HD 2F43B 5EQFA 2R11A 4A48A 2J7UA 1NOJA 2CLMB 4KVFA 1N33F 3SC3A 3H5WA 3VI3B 4Z51A 1MN7A 3O73A 2AI1A 2EJWA 2HRRA 3ZNUA 3V8QA 3FCCA 2PZBA 6GPBA 4MUFA 2ZH5A 4GL4A 3R6GB 4JI4B 4GBED 3JARA 1W26A 4EYEA 4HTIA 2IC3A 3X1ZA 1YACA 1BXRB 4BTLA 4OZ5A 4G23A 4GKAA 2XLBA 4ICLB 5AI6A 1S3FA 3K72B 4IR7A 2ZBPA 3SC2B 2EJCA 1EFAA 3I28A 1KRWA 1HK7A 1RE1A 3CR3C 1CY7A 4W4TA 1B7GO 4HXFB 1WWHA 3RG6A 1FK8A 4CM9A 3ENVA 1TADA 4JFAA 2JEOA 1Y6ZA 4YJ2F 2ZDGA 5FTKA 3K5PA 4F4XA 1GZSA 4HXYA 4AU1A 2CNOA 3HCWA 3DMFA 3AGQA 4IIVA 1FBTA 1X8JA 1OAOA 3VAFA 4F91B 2VTKA 1LEOA 2ZBFA 1N7JA 4BCCA 4G8DA 2WMOB 1ZD5A 1NNLA 2JD2A 2ZHOA 1CG6A 3GW8A 5FOTA 2GH1A 4W1RA 5JQGB 1AGRA 2QGZA 2Q0QA 1RMQA 1UPCA 4PPYA 2FMUA 2F1OA 1B2RA 4OQMA 4X97A 3QT7A 4XVHA 1AFIA 1NW4A 3I53A 4HAYA 2ZB4A 1X42A 2JRSA 4KAXA 1R18A 2BM9A 2N0SA 3C3AA 4C11A 3PRKE 4B02A 3UIEA 3GUVA 5IV3A 3D81A 4YY3B 4Z0TA 3PYEA 1L4HA 4CG0A 2O3JA 1YONA 2CJBA 3OIFA 4P7JA 4CE6A 5DBFA 1GFWB 2X8JA 4N0EA 2CL7X 4TL6A 4NAVA 2CHVA 4LR7A 2Z57B 3DXXA 1FL9A 3GLUA 1DJLA 1BWEA 4MYDA 1HR0F 1SHTX 4BV9A 5DNAA 3M2VB 3KV1A 4OX9F 5JCOC 2FZGB 1HNWF 4LVNA 3ECSA 4MGEA 1FXWF 3EIQA 1UPTA 4V0SA 4WCVA 4KV7A 4I4TB 3DS8A 1SJ9A 2GGSA 5JR3A 3P2OA 1HTTA 3OXFA 5HMLA 4G1QA 2NXWA 2XB9A 4KQ2A 4WLVA 2FXVA 3GR0A 3RYLA 3EPHA 4AUEA 2MCFA 4EPXA 2YJ6A 3PYGA 1NSQA 1SR8A 1XA0A 3OZTA 3CD0A 4A8QA 3I9LA 2MZTA 5J1EA 3DBHB 1F8UA 2AC4A 1YASA 5HBRA 3MQ2A 4WAUA 4J9MA 3FRYA 4M7RA 3ZE9A 3EGEA 1RCUA 2GS8A 2B1JA 3KQSA 4N3AA 3OTEA 1T4DA 4LDRA 3IUQA 1ARZA 3CEPB 1VC0A 4TYMA 1QSLA 5KFJA 2VBGA 4BVEA 3W04A 4EDHA 3AL3A 1BWSA 3G96A 1GOTA 4OHRA 3UV7A 2YOHA 3HVTB 3UAYA 2YWXA 4YUZA 2ZUEA 2IDMA 2VT3A 1BLUA 3ETCA 1YR2A 1N33J 1H9BA 3GQCA 2I3DA 4NBLA 1QYCA 5CU7A 3ZZOA 1XP8A 2ISSD 4PCVA 2VU5A 4A5OA 2PN1A 2M7SA 1L7VC 1R66A 3E48A 2J3HA 3TOZA 3PFHA 3VSEA 1YS6A 3CW2C 4BQRA 3SR0A 4DSLA 5IXJA 2C8LA 1GPDG 5CXTA 1U2TA 4G25A 4PY2A 4PZUA 1GXSA 2FVRA 1G9SA 4G09A 5CD9A 3HCNA 3N0WA 1QH0A 3IX7A 5HM8A 3F7MA 1M6YA 1NIJA 5JZVA 5KFTA 1UFOA 3PCXA 3WGYA 2BCGY 5A5EA 2QJRA 1TYZA 1U9JA 2VAXA 4LPSA 2X2EA 2DQZA 1H2VZ 1KVUA 5KVSA 2Y27A 1XEWY 4WKPA 1U6KA 2IXTA 2DHEA 3PRHA 1U2DA 3GJRA 3ICCA 3GVIA 5D6GA 2YINC 1C8VB 2AMFA 2HLHA 1TZBA 2B1RA 3VYVA 2VG8A 3MWEB 3KZCA 2UZAA 3PNKA 2J7KA 4IUFA 5BR8J 2VKZG 5KTTA 4EY4A 1BA2A 2UZ0A 1W6RA 3KTFA 1MVLA 4DZTA 3BN7A 4KAIA 4X6UA 3SI8A 1H6AA 3QELB 4MW4A 3UV6A 4JB2A 2VUHB 2EAUA 1KO4A 2CNKA 5AJVB 4HGRA 2OV3A 5EWFA 4FYVA 5DGTA 1CUWA 2HBQB 2H0RA 5IC4B 1H3NA 3KQPA 3IVGA 1NPPA 1IN7A 1V8FA 2QT9A 3ETGA 1UJNA 4H3KB 2DPJA 2O5DA 1GMVA 2RI6A 3RJZA 1CV2A 2I29A 1E66A 4X1YB 2Y3YA 4Y2CA 5T3UA 3O91A 4CLKA 3Q0EA 3GVXA 4NIMA 1MOSA 2W8BA 3GFOA 2OBFA 5LN1A 2ZIXA 1BE0A 4F2PA 1TAUA 4DVJA 3BCSA 1SC1A 4EQ6B 3ANTA 4X8OA 2JCVA 4ESVA 3F0TA 2B1QA 3CN9A 3NGLA 4NDAA 4EEKA 1A9SA 4H4MA 5EIAA 2X5KO 2DH6A 2B8QA 2Y2UA 3HCRA 1E1KA 3AEUA 1NBMA 4IHJB 1VC2A 1NN0A 1EYZA 1DS6A 4X1OA 4J1TA 2IDJA 3VX4A 2ZR7A 1TGYA 4EKGA 4G56A 5AYVA 3WFIA 5ENVA 3L7MA 4KNYA 1P44A 3NGXA 4N7RA 3M9MB 5CPFA 1GAJA 2MWMA 4KFCA 1XMJA 3K17A 2I5JA 5CCDA 4JHXA 2HZVA 2NX2A 1L3UA 2VPIA 4ES3A 1CW2B 1YCHA 2IIBA 2MQ8A 1KYZA 1D0SA 5DM1A 2RAQA 2ET6A 2UUBB 2CXQA 3R4CA 3QAEA 4HFMA 5B55A 4EHJA 4B4VA 1VFNA 4Z4IA 3RJTA 2BEVA 1RTDA 5FJIA 4MH0R 4A8MP 3UMCA 1KZ6A 2GHIA 2UKDA 3QVKA 4P71A 1A4RA 1C0KA 2B5OA 3RSCA 4P98A 4D0GA 1ZM2A 5JY6A 3EWIA 3GLHA 1UMJA 2I4RA 2WD7B 1XAJA 2CJXB 3PHEA 1IHYA 3DOJA 4F12A 2AIRB 2Q3CA 2XUDA 1OVMA 2OPBA 1U0HA 3L95X 4IUDS 2E5HA 1U4NA 2EKLA 3QOFA 3WS7A 4F2RA 4RNDB 4ALNA 4MUAA 3GLGE 1HI9A 3OU2A 1OH8A 2B4PA 2HSJA 3GT3A 1HPZB 3FTDA 5EP1A 1EXWA 1VJGA 1CUEA 1EFLA 3GGOA 3TR5A 4WD3A 4ES1A 1E9VA 1SOMA 3EJMA 2CUKA 4IICA 2Z5FA 4Y1FA 4BEVA 3UYKA 2VDVE 3BHNA 5I5EA 1P80A 3KHSA 3WLLA 2MQPA 4LIWA 4NLYA 1FNBA 2JLFA 4HS4A 4KGMA 1BDMA 1JLGA 1HY3A 2RS2A 4KR0B 4TLEA 2BFFB 2NNWB 2BT4A 4KTVE 5AK6A 1TIKA 1WEZA 4AN4A 4LYAA 2JI7A 2ZCUA 1PS9A 2KS6A 4G4SO 1HWJA 3HD1A 2L9WA 2JZCA 4DMLA 3P2JA 3BKTA 4IUYA 4LSLB 1NSAA 4F5ZA 4N03A 2FW1A 4NU8X 1BQEA 1ML3A 2QA4S 4D9MA 1O89A 1ZW1A 4C7MA 5JC8A 4HAOA 3EM1A 4ZVTB 5I6DA 3KSDO 1N2OA 4KJIA 2OSBA 2D62A 3CLTC 1JHZA 4PAQA 3M9OB 1MA0A 5DRYA 4TTJA 1Z7BA 1SQFA 1DIGA 4GXTA 3KG2A 4RORA 2CT8A 3LF1A 1E4YA 4RPHA 3EF0A 2WFLB 4HDGA 3CW2A 3PX0A 5LU9A 4KQZA 1HW8A 3NTXA 3FRIA 3NWJA 3QY9A 3U6BA 4PG4A 5GVQA 621PA 3DNFA 3WDKA 4TL7A 3RYHB 3MOGA 5A3RA 2KWIA 2ORWA 2PTGA 1P73A 1XZJA 2YNMC 4G86A 5H81A 4K1LA 4I08A 2JFZA 3UWOA 1X9IA 2HRTA 1O95D 2RF2B 5LUBA 1OB5A 5H8WA 2GHVC 5CBPB 4LYGA 3W3AA 3RARA 3T5GA 1FDDA 1TA4A 5T14A 3MAHA 1X0PA 1UH5A 1UBGA 4W5RA 3B4MA 4DPXA 1E63A 1SC4A 4HPXB 1KF0A 4O29A 1CB7A 4IVPA 2FR1A 1ZUD1 3OU7A 3GCZA 4IIXA 2PGOA 2Q28A 1T0JB 4X7RA 5D3GA 1OPXA 2IXAA 5DK4A 3EIFA 5IXSA 2DXEA 2H59A 4NCHA 3KBOA 3AESA 1WG8A 1IWBB 2OXFA 1KBRA 2YWDA 2V9WA 3CRNA 2J0WA 5F23A 3TZWA 2O8DB 4QOJA 3TEMA 1WMDA 3RTCA 2V9PA 1NQTA 1HDOA 3C41J 3I2JA 5IM4F 1L5YA 3BYPA 5DWVA 1NRJB 4IV0A 4ZDNA 5CH8A 3CPWR 3FGNA 4LRQA 3KJXA 4CM8A 3Q11A 3BAFA 4FPXA 3MINB 1JHVA 2EBUA 1IDN1 2CQ4A 2VA9A 4ZKDA 1VIDA 4AYWA 2FHSA 4CIBA 2R3VA 1LBIA 5AIBA 5FLXU 4FSDA 1ZJWA 3I05A 3H2SA 1Z83A 4ZAGA 5HKBA 2GMLA 4OUKX 4DLXA 1MAWA 3BB5A 1ZGGA 1GXTA 2GX6A 3K6JA 2B1GA 2YFKA 3MR5A 3DFMA 2QRLA 5K8NA 1HYSB 1BWQA 2I91A 4NLXA 3CEHA 2MSEB 2OV6A 1E32A 3PFNA 3ZOZA 5C42B 3HN6A 2IHZA 4XJTA 1FQWA 5EIEA 2C8JA 3KSAC 2J09A 1MU0A 1YS2X 3ZWCA 3BB4A 3QPDA 2ZNZA 4M1WA 2QAIA 2L08A 4ZP7A 2REOA 4NC9A 1OXBB 1PE0A 3K9NA 1T2NA 3D3EA 3GWCA 5B4VA 1K68A 2CFIA 2HIHA 4KYIB 3C6UA 1RRPA 3MFQA 2FLPA 3U26A 1EDOA 2JLRA 4NECA 1EARA 3P8BB 2G77B 2ZJAA 1TL1A 3I83A 5DRKA 2P2ZA 3KT6A 1NJFA 4KPUA 4F97A 1FFWB 3KRTA 1DJOA 3DV9A 4LR8A 2RHWA 2E3JA 1NBMD 1O6BA 2I6QA 1RXVA 2P1ZA 4DDWA 5KSPA 1W4LA 1XCLA 4WE1B 4D42A 1VJTA 5IX8A 3CUYA 1A4UA 3FCEA 4ISBA 1D8TA 2WWXA 3ORQA 3RC8A 1QUFA 1B0TA 5CTJA 2VPXA 3H1EA 2VF8A 1USKA 4E2ZA 1CJUC 2UDPA 1X4CA 5ALEA 3GJZA 3H4VA 4JWTA 1FE0A 2CQ2A 3TEFA 4OFWA 4BQQA 1CTQA 2BMEA 5KFQA 1PT6A 1O5IA 3D0RA 3T1HJ 4MPRA 2I8EA 2Z5LA 2K7FA 1SU7A 4ZVPA 1XWWA 2P4SA 4HH3C 1E5LA 4Q6BA 2PBZA 4YR3A 5AVJA 2CZ9A 3O4IA 1HE8B 3LSTA 2QL6A 2EYQA 2NGRA 1F06A 5KSOA 4A0FA 1XVAA 1MABB 3I4PA 1W85A 5TVGA 2XTJA 5A7FA 4IH6A 1KVIA 1Z2ZA 4MI3A 5F5LA 3LWMA 3HR7A 2HXYA 5LQJA 1C7JA 5K6AA 3HMJG 3GMDA 1RT6A 2NS1B 2WPDD 3PQ3A 2GLXA 3ESBA 4X65J 4AROA 5FUVA 4AO6A 2YKAA 2AEEA 4YCLA 5HQTA 1FXLA 3J7TA 3GR1A 5I3PA 3G13A 3C4JA 4DEZA 1YS1X 1F8YA 3PIRA 5F3RA 1L5UA 1RJJA 3T4UA 2BBTA 1YT5A 1T3NA 3AHGA 1FDUA 2R7VA 1TK2A 3VAGA 1FNNA 1KFCB 4D0SA 2B7BB 3GIJA 5MAOA 2GN2A 1TZJA 5TS2A 3GZTB 4NXNB 4DSUA 2QLFA 1T5TA 2QQGA 1USGA 1Z4KA 2XECA 1BGXT 1S6QB 4M1EA 1GWNA 1BJTA 3M4NA 4JQOA 1UBEA 5IYZB 1XCGB 4HDSB 1UWBA 3J81U 4LHVA 4V0OA 4LCJA 2KM1A 1X0FA 4P3XA 1B6SA 3SK0A 2W2VA 3AM5A 4DXLA 3A9CA 5HKOA 3C15C 3OCJA 2X7IA 3TG8A 3MERA 3BE8A 1J42A 3RJ9A 4Q7AA 4CIOA 1OIWA 2R5NA 4J9NA 3FSRA 4GRIA 1OAKA 4N5NA 3PNIA 4ZOLA 3IQHX 4FNMA 1N4AA 2H51B 3GD7A 3GDHA 2A5GA 3R24A 1HNVA 4BWJA 3H5TA 5CH5A 3T3HA 1XE3A 2RHHA 2RKIA 4OM8A 4V2UA 3G82B 4KAAA 1FJXA 3R5BA 2IBMA 4QQNA 1UDCA 3RODA 5EWLB 1W9HA 2NO6A 5CP8A 4YMWA 3D4NA 2P3QA 2V34A 2WTXA 1A5AB 5JJCA 4NEZA 1X9MA 3KR9A 4JLOA 5T4HA 2MLZA 4F60A 3MJFA 2YN0A 3PUYA 3BWXA 1KFDA 1UZHA 3K20A 1U0OC 1UXHA 4CQMB 3H8JA 1X4DA 4H6VA 2B6AA 4Z7OB 3NAIA 4OVKA 3IAUA 4EYIB 4JVMA 3K6RA 3BQ0A 1WB5A 2CQGA 2WINI 4GGMX 3SP1A 1MWQA 4GNRA 4QFMA 4ZC1A 2AJTA 2P67A 5EHQA 2AF4C 2F67A 1Y6GA 2RHCA 2E9RX 1QCYA 2JASA 1ZAKA 2MINA 5COQA 1P1IA 1PG5A 4UREA 3L8HA 1ULRA 3TTSA 2FP4A 3HVTA 5DT9A 2WZDA 3N7UA 5DEOA 2FSIA 1HE2A 4ZO7A 3BSAA 1FSPA 4LBHA 4OQJA 3GPCA 3ZDEA 1DEXA 4BVFA 4CMEA 1BJKA 2IHJA 4NMXB 3H1TA 2CPXA 1NKVA 1ZGZA 4YAIA 4OGWA 3VU9A 2BUNA 3EVTA 4DUPA 3A1CA 2Q6TA 1O58A 1IBKB 5KU1A 4NPOA 4J1QA 5AW7A 1A9YA 2I5PO 1FTYA 1EFVA 2O8FA 3ZWKA 2HM7A 3HBLA 4ARUA 1YC2A 3VKGA 4DMFA 3VAYA 1ZGJA 3RFTA 2PZJA 2AJ8A 2GD6A 3OKFA 4I1UA 3PI6A 5FA5A 2EJVA 1MEOA 3RR7A 1E79D 2GASA 1F8XA 1SVOA 3N5KA 2OHDA 3TVKA 2FEKA 2B82A 2O2DA 5CYPA 3HFVA 5L4SA 3L9ZA 5DT2A 3BF4A 4Q3CA 4HDNB 4RFSA 2DR7A 2HEGA 3UE2A 4QYIB 5HWSA 4A2CA 2HT1A 1GY8A 4ZQEA 5DTEA 3PHIA 4QTXA 3VHQA 2PR7A 3PHGA 4D3DA 2ATLA 2GCFA 5ALNA 1KIMA 4ME6A 1NBIA 1HWLA 4DR5J 3IIJA 3U31A 1YZGA 3HHKA 2SCUB 4FGWA 3EWGA 2XBUA 1IOLA 2IRUA 2IUFA 3DLCA 3ZKWA 2PMKA 2J4CA 3DOFA 5AVZA 1NAHA 4ZO4A 1YKSA 2XITA 4J7CA 4CZCA 4DNPA 1CJUA 5JUMA 2W6JA 3I61A 1W30A 3SE0A 4C4OA 1M5UA 1NY5A 1RZRA 3VU1A 3KKMA 1CF4A 3S6EA 4CPDA 2IFTA 1XTJA 4J75A 3D0KA 1Z0UA 2X3GA 2XNRA 1IJKA 3JD3A 3QG5A 3JWJA 2P2DA 3LRPA 3GG9A 4Y9DA 3JWHA 1FJGJ 4WEQA 1ODIA 4GLLA 4N7JA 2WVAA 4BAGA 3WGKA 2GA7A 3ZDAA 3N5CA 4M7PA 4P81A 3GJQB 1QS0A 2BKEA 5TF0A 3IVMA 2J32A 1J2RA 1HOXA 2W25A 2HREA 3TQTA 4QIEA 1ADCA 4OQDA 3BK2A 5FXMA 2MPUA 4TLMB 2QYGA 2C2GA 1GTRA 2UZ1A 3TMKA 2COKA 1VJQA 3F6EX 3AUYA 4QU8A 4YAJA 3T9FA 1GRVA 1VG9B 1RHMA 3FOZA 3GYNA 2Z57A 1HDXA 3A6DA 4Q9KA 2M98A 1YWGO 4WNCA 3JPWA 2W90A 3SNKA 1RCTE 3PPIA 4RA6A 1JB9A 4MPPA 3OQPA 3JV7A 3TQQA 1P9YA 3ICVA 5HQ8A 1W5BA 3PFEA 1UKAA 3SQMA 4QXOA 3DV0B 4ZVGA 2EERA 1KEKA 2VNIA 1ZMXA 5B0DA 4K8OA 3C6MA 3N3BC 2ZSDA 1U3VA 5KEIA 3OQHA 4O4JA 4PEOA 2X3UA 4PHHA 4M94A 4RUKA 2ZVSA 2G1PA 4USVA 5D7BA 4OU5A 4UVEA 2YNMD 3GT7A 3VI4B 2XUAA 1TI7A 1YZLA 3UCFA 3WK8A 3O3LA 1VE3A 2DFDA 4IFTA 4NWBA 4FN5A 4QYRA 4HMQA 4AXIA 4RTMA 1JXAA 3FSIA 3M8ZA 2CVFA 3CZMA 2XQGA 2C5BA 4YHHB 2GD1O 1SRRA 5K0NA 3S0JA 4TKMA 2ZUCA 3PXUA 2DB1A 3A3YA 1YFLA 3C6TA 2JIPA 4QPCA 1N9ZA 4MCIA 4TX1A 4J3NA 1X7YB 4ZEOA 4IKPA 1CS4C 3FPSA 2ZUFA 4RF4A 5BSKA 3BSSA 3PLNA 4PQFA 1XKLA 3QGGA 2ZM6F 2BEUB 3SEFA 1NK7A 2EDCA 3ZKAA 5D3MB 2VHGA 1XI2A 3D3WA 1E2MA 4LBPA 4PHTA 2RQKA 3IA0A 3OFHA 4B9EA 4RW7B 3ME5A 4GKJB 3QMPA 1OWOA 2VQDA 2OM6A 2C4TA 1RHKB 3HXMA 3MJRA 3PT9A 3ZDDA 5K5EA 2O8NA 2FVPA 3JQGB 2L9NA 1K73T 1CDEA 2Y1CA 1JMYA 3M30A 3NVMB 2FFBA 3AV3A 4ZEMA 4DMMA 3W1YC 1JILA 3BRSA 4XM2A 2J0UA 3ABOB 2ZYSA 1REVA 2ZTMA 1SKUB 4RLQA 1I7LA 3LQFA 3Q5DA 1U9CA 4DWIA 1EA7A 4OJMX 3LJKA 3K5OA 3X1DA 5KFRA 3M2PA 5K0SA 1VQ7S 2J7WA 1XZPA 2YHIB 5LFAA 3UMVA 3R6TA 4JQSA 2MOKA 5FCDA 5C3MA 2QM0A 4JEUA 1J5XA 1C9YA 1TVKA 3MCVA 3Q8PB 2HHPA 2PU7A 1IPEA 1J1ZA 1JJHA 1X7HA 4V0RA 5AOVA 3IULA 2ZT5A 4C4ZA 3RW6A 2AEMA 4PM4A 1QP8A 3CTPA 2F65A 4P52A 2QTZA 4H77A 4MVYA 2P2CB 3AHCA 4CMKA 1FDRA 3KU4A 2DGWA 2HVEA 5E9AA 3UR0A 2Y2VA 5KJ6A 4FNOA 2YN2A 3O8DA 3A8EA 4QYWA 4B3JA 3DDCA 3ZNQA 1Y9OA 3ZHTA 1U8XX 4FMBB 3W34A 4BVKA 3QJLA 4QQBA 4Y6LA 5KYYA 2H9YA 1OIVA 4J0EA 3W77A 4FMCB 4AJ2A 2VYVA 2FPHX 1OLSB 4KXMA 4JEIA 5HGXA 4DF4A 2H1YA 2GBLC 1FSZA 3FFIA 3J81j 5DCLA 4DARA 1N8RT 2HB6A 3RAJA 4W4MA 1ECLA 5FL7D 1EWYA 4NU0A 4QBIA 3DJFA 3Q2OA 2YKOA 5HK9A 4AK9A 4X4TA 2NVOA 4OLFA 1R8XA 1WIWA 1JBEA 2WJJA 3UAVA 4M8NE 1NC1A 1QH8B 4W7IA 3U62A 3H2YA 2IP4A 4CMIA 5AJHA 2H18A 3WRXA 2NCKL 1AO3A 4KACA 3AHEA 3DL4A 3OP4A 1G66A 3D6FB 1TT5B 2G82A 5AKEA 3DE6X 5AVWA 1ZN2A 3OVMA 2VDJA 3GHYA 5BQXA 2WQ7A 1SVDA 1DAKA 2BN4A 4BO2A 5IANA 4GQAA 4ZVSB 5KYNA 5JS7A 5FBQB 4MHOA 2A1TS 1BH6A 2JATA 1UK7A 1XDGA 5HF8A 2ORYA 4PO1A 1O6CA 2PGCA 4PNPA 3UG7A 1K5GA 3F7NA 4TYBA 1VQNS 4L8YA 1Y4ZB 1WCIA 2B4AA 4PN7A 4WBNB 4PLCA 1Y6RA 4YT4A 1VYTA 1CZOA 5CT6A 3P4YA 1J2JA 2GGPB 2VUIB 2JJQA 4B35A 5HR5A 2RH8A 2DITA 3PBKA 4L3OA 4X4OA 2QYHA 1Y5LB 4KHPF 1PK8A 3QIPB 1YITS 1AOXA 1ILEA 1YBHA 1RTTA 3CX3A 3QLTA 3M82A 4BNXA 5HE9A 3RRNA 1EIWA 1RZMA 3HUEA 2W4PA 3K2IA 4MW0A 2OORC 3I2IA 4OMUA 4I46A 4C2BA 5F3WB 2RGNA 1H6KX 5I4MA 4C4XA 5IWAB 2P30A 2V8BA 3VM6A 5A2QY 2LCQA 4M0KA 5JSQA 4NLWA 4MQFB 3CLTD 4FS1A 1M7GA 4YCAA 4N0PA 3ZHSA 4O44B 5KFUA 3OMLA 2NU8B 2K5UA 4C0AC 2ZTVA 3EAFA 4YYEA 2HS0A 2A9FA 5CIWA 1BNCA 1ZOTA 3SYMA 3UJ6A 1CNEA 4LMZA 3HJUA 3QKSA 1M33A 3AGPA 5DWDA 3GV0A 3WLTA 3U7QB 1HLFA 1OXVA 1IEWA 3QFSA 2ATXA 2CB0A 3MWLA 1TC2A 3T7EA 3DAGA 4UTOA 1X8KA 4S12A 1IWGA 1JG4A 3ZI0A 3K9QO 3FDZA 1KLNA 1NBOA 2V69A 1T03A 3IR6A 5C4GB 5A8WA 3FDJA 5EJGA 4Z54A 4DCSA 4NCIA 3FBCA 5B0BA 1VHWA 1CULB 1TV6A 2Y6VA 4YCSA 1O94C 1RLUA 5A3JA 5IT5A 4Z9BA 1N2EA 3NU1A 2IELA 1VI7A 1KBZA 3PWZA 3UBTA 3G0DA 3M34A 3AD8C 4EZ9A 1TCCA 1FCJA 1N2XA 3BGOS 2PXCA 3EOZA 3C3EA 1SUSA 5JZSA 1ZRMA 3P0RA 3Q0IA 3IDZA 1SC4B 2N47A 4C05A 5DOVA 1NJ1A 1WP4A 4QSMA 3HM9A 1AG9A 8ABPA 2VBXA 1EK0A 1JNRB 5B64A 5KTQA 1IZ9A 1Y3HA 2G2YA 1E1QA 1W5SA 3AK4A 3R5FA 2KJVA 1HV8A 3DNPA 3BS9A 4P35A 3VKWA 4BLPA 4MDYA 1JQJC 3AFHA 4B2PA 5HILA 5JQGA 4OQXA 3I6QA 2ZRDA 1UFQA 2EFQA 1KPGA 1JDUA 1OJLA 1XDWA 1JEYA 4WXRA 5DQGA 5E3IA 4NFSA 3C8HA 3KOZA 4B3SB 1ZGBA 1Q1EA 2UU9F 4JI5J 3H5IA 1XTSA 1KQOA 4HMPA 5F77A 3TB6A 2IIPA 3CF5Q 2WABA 1E1CB 1WR8A 1FTNA 4TS1A 3F46A 4TZ0A 1UOOA 2P2YA 3FCVA 1VQYA 2D4HA 1BFKA 2ZBQA 2FPLA 4FD2A 3MEDA 4PWUA 4DMCA 4DCJA 1RNLA 5DDIP 5BT8A 4KSEB 2ATCB 1NJWA 3MAAC 3QVOA 4ZYTA 2O8EA 4FTWA 2H9ZA 2QL5A 2IQIA 2O0JA 1AVTA 2F8LA 2XHCA 4AYBD 3A0UA 1U99A 4GEKA 3QVXA 5A3VA 4H7DA 2V4ZA 4DA6A 2RHLA 2I3ZA 2DRBA 4IOLA 2PS3A 4A8PA 4FYXA 4DMZA 2GBLA 2WLSA 1CCWA 1ILWA 4EYSA 1ZNQO 3A12A 5DGDA 3LPEA 2MJNA 1WHTB 4ZVLA 3ZD7A 3MEKA 2E5IA 2FPRA 1YJBA 1OWNA 4ED5A 2GEJA 2I67A 4MCJA 3EUEA 3M2UA 4X20A 1WSWA 2WG1A 5M3BA 2IUYA 4CEHA 4NCNA 4PC2A 3MCNA 4MYRA 1B0AA 5HQMA 1OPIA 5JAQA 3FHOA 1E60A 3OR1A 1ZA1B 4D4LA 3T9ZA 1Z63A 3H2ZA 2RJZA 4F0MA 4NZ6A 2QY6A 3HVHA 3QBDA 3E8SA 2WKRA 4DLWA 3IP3A 4ICLA 4OX9B 2V5HG 4Y2AA 1SVIA 3X1MA 1T9ZA 1FRFS 4DLLA 5LNK1 1ZZFA 5FUBA 3NHFA 2QNIA 5EWJA 4KQ1A 3H2GA 3HNOA 5IQQA 3KUXA 3B2QA 5FLEX 5JS2A 1TEVA 3BR8A 2OWEA 2VCHA 2EKQA 4QVKA 2ZWPA 5BW5A 3HLKA 3HXTA 2QX8A 2FU5C 4RGQA 3CWZA 4GP7A 3M8WA 1Q0PA 4L27A 4OFBA 1NQXA 4XSHA 1ZIYA 4ODIA 4G89A 2CXUA 1FX4A 3VR0A 1A9QA 3H1PA 2PUAA 2R2RA 1NCLA 1JSXA 5K0TA 1NT2A 3TIIA 3M6MD 2WFMA 3PK0A 1UA0A 1W0CA 3L6UA 4O4IB 1JWWA 2GEVA 2G4VA 5E7MA 4BVHA 1RKJA 1RWNB 3MYRA 3EE3A 1P31A 3HWRA 3U2QA 1ESEA 3WZLA 4QREA 1JXMA 4OYYA 4TU8A 3SCIE 3CM0A 3AXKA 4EENA 3D8UA 4X9XA 1KKMA 1R0YA 3E81A 1PQUA 3JQMA 5IJ0A 4PKDB 5DTJA 3GEDA 3DLIA 2PGXA 4FDMA 4WXYB 4IRXA 2JFPA 3D3WB 3QW2A 1QE1B 2VKQA 3QYAA 1NXTA 1YRQA 3WL5A 1VGQA 3PX6A 5LJ3Y 1N56A 2MQMA 4AUNA 1FU7A 2EBGA 2WYHA 2LR0A 1JHUA 1NN1A 2JA1A 4GYKA 2FHMA 4XWAA 5LP6F 5KT7A 5I4KA 1W7WA 2DEUA 5SUHA 4DQUA 4UMDA 1KEUA 4Q37A 3Q89A 3E9EA 2P4QA 2GIQA 4YS6A 4ZMRA 1R8QA 3CMMA 4WKBA 3SQOP 4DV5J 4EGQA 5IOLA 3TKYA 2JZOA 3CLUC 2HTEA 4F6RA 2C0QA 1RXWA 2HA6A 4UUWA 3SD7A 1NGSA 3COYA 2NO7A 2XMBA 2AKYA 4H4CA 3GN2A 4JQYA 1NHKL 1L7AA 3BM7A 5ER9A 3GLIA 1AK2A 3KKPA 2HFZA 4I6EA 1Y5IA 2P90A 3A6JA 1C1CA 3IS3A 4MXDA 2CA9A 1ZD2P 2XGGA 3I0MA 3IVCA 2E2WA 3GEEA 3ZKWB 4KV9A 5GINE 1FA9A 3FCHA 1Q1BA 3MC1A 1JEOA 2ERRA 1RT5B 4O4JF 1PYOA 4S04A 4XQ9A 2Y76A 2YNHA 4L5BA 1LPBB 4EW1A 3C24A 3ZE7A 1R88A 4R2HA 1RP5A 3CSUA 4QJ3A 5CLQA 4JNCA 4JI2B 4JASB 4GVLA 4GGOA 4LNHA 2VF7A 3WZ0A 1UP1A 3Q2IA 3ZCXA 3HM2A 3EGDA 3DBRA 1NVBA 3C3BA 2VTEA 4MVJF 2RCNA 2IDLA 3IEKA 4OJNA 2KHZA 2R7SA 2J7PA 3C16B 1F5SA 1GGKA 2BZ1A 4C7OB 1D4OA 1UXJA 5CT5A 1VISA 2JLSA 4MWCA 3DWGA 1WTFA 4OP2A 1Q15A 4FC6A 2IUUA 3C6BA 3SXUB 4IIBA 1C7IA 4F3CA 1HQDA 4IILA 4XGKA 4ZKEA 1T5IA 4CM3A 2GCNA 4HDCA 2QG6A 4GKJJ 1IXZA 2HCJB 1SVLA 4J0GA 2ERXA 1NSYA 3B3GA 2QEXS 1JE1A 4QYZK 3EXG2 2P3OA 5BURA 2VATA 4J3FA 5KOYA 5LCXA 3GI1A 2Z2KA 3RVKA 1GL7A 2GJFA 1SIBE 2J5KA 3B7WA 4MV4A 1YSCA 1W0KD 4Z7YA 1B42A 1AE1A 3UXEA 1RQ7A 2VIHA 4H27A 3SXPA 2I38A 1GA4A 2Q1SA 4YRLA 1CQJA 4BNGA 5LMNB 2BHNA 3ZY4A 1ITZA 3NXZA 3BAZA 4ENTA 5JYEA 1NYRA 2H48B 2H5JB 1TUGB 5ALKA 4OYXA 1AZSB 4R8MA 1G19A 1W0JA 2FPPB 2I2AA 3BYRA 2HDNB 3TTVA 3H20A 5IC4A 1KZ7B 1KXZA 3GNQA 2M88A 2ZAYA 4ESOA 3VZQA 2GMHA 2YX1A 1RC1A 4E14A 1XDBA 2OCLA 2AJ0A 4TSFA 1HWYA 4B4WA 2HSDA 4BQSA 3BMXA 4ZQBA 2DHXA 2C9YA 2ZBRA 3OLXA 4MYCA 4DJBA 4B3MF 1EP4B 3CPJB 5CB4A 1JQDA 5AK5A 1U3CA 3V4FA 2YV5A 4ITVA 5IG2A 4ZVMA 1J2TA 5F64A 5DDQC 4B71A 1M83A 3K16A 1YQUA 4QC2A 1YZ6A 1K9SA 5I47A 4XYMA 3TLEA 5DXFA 2XMAA 3IR7A 2WE8A 4AX4A 1M5TA 4ZO9A 4DQXA 4JITA 5F1OA 1KMHB 2ZR9A 3PGA1 5HUHA 3QF7A 4PSAA 4J0IA 5KVQA 5TGZA 4TV8F 1LW2B 1F9EB 4QXAA 3DT6A 2CDRB 1JBKA 4OATA 3W9YA 2OPRB 3OEHA 1O54A 1YE8A 3PPXA 4ED1A 1K88A 2OECA 3DTVA 3W5YA 2A57A 1YOVB 3K0JA 3ZFVA 5EINA 3AIOA 3DU5A 4FQ8A 3GBPA 1XVUA 1OFUX 3WL6A 2QRPA 1JL3A 1UBKS 4KH0B 4OI2A 1YGYA 3WB9A 2MYUA 5JDIA 3CJ3A 4TU9A 3JVDA 2EQBA 2FOIA 4G3XA 1YMQA 3QW4B 5C8YB 4GR5A 3T5JA 3I4HX 5IT9Y 5JMPA 3AY3A 1OQ3A 2QLBA 3WGZA 3EZFA 1HDIA 3HP4A 3MPWA 3QVGA 4DQ0A 1W44A 1PVOA 2P77A 4KWCA 1Z5WA 2W2XA 1CR0A 5A0YA 2G1HA 1MB3A 1QCDA 4H1WA 1JQGA 1U94A 3AM4A 5KQGA 1CE8A 4ZN1A 4DR3B 5LOVF 4ZVRA 1TO1E 1G8HA 2YYZA 1A8UA 2RGRA 2APJA 1CPYA 2I1QA 1QH8A 1A7GE 2ZSFA 1DWOA 5CYMB 4WFQA 1GRQA 2YYYA 5B7NA 4J5OA 1V1RB 3WXMA 4EGFA 4WNYA 5IK2D 1Q0NA 2HHLA 3LDFA 4V0NA 1AB6A 2VQFB 4DCOA 4QPZA 1Y0HA 2ASDA 2HWYA 2R6FA 2DRIA 4I3HA 4EAQA 2PD1A 1VI5A 4B6JA 2I7CA 3PP8A 2QYSA 4EHAA 4CLOA 4Q4HA 3V1TC 2FUKA 4ZGBA 2QLNA 2J67A 2DY1A 5FO1A 1A4IA 3QVMA 1MROA 1Q4RA 2XADA 1OHHD 3W3SA 3TM4A 4RBTA 2PANA 5CUQA 3TYXA 1JDNA 4MLZA 5AW1A 2IYNA 1CR4A 2DR5A 4U6QA 1EETB 4RLHA 1TAQA 4ZEVA 2Y93A 1A98A 1L5WA 4KK3A 5EPEA 1ZPDA 3HZHA 2AUNA 2IF0A 3QBCA 2YWJA 2VNKA 2ZH1A 3CISA 2AX1A 5ILQA 3B3QA 4DL7A 4BP9A 4G4GA 3MJEA 3KEFA 1X1QA 2VK8A 2WJIA 2HHHJ 2C2ZA 4LF5J 1IDOA 3UXHA 4GKKJ 5A9TA 4NV0A 1RKUA 3ELBA 2QM8A 1OYYA 4JB8A 4JGBA 3VGPA 2JOQA 2E9ZA 3F97A 1JYFA 7MDHA 3T4PA 3NDRA 1OX6A 3L09A 1A8QA 2WJHA 3DOHA 4QW9A 1A76A 3T95A 1EFVB 3D6JA 4UATA 1E7SA 4ENOA 1QJCA 1CF9A 3LVFO 2VTBA 2F4FA 4M5DB 4RNMA 3FYUB 1ZJ4A 2Z3ZA 3ORYA 3WHIA 1T8TA 3W9UA 1SCBA 2O8CA 4I64A 1YDWA 3BB1A 4RL4A 4K6MA 4MFBB 2JHAA 2WIGA 1JKJB 1CQIA 3RE1A 5JYBA 2GD0A 3NC1C 2HVIA 5DX8A 3R5CA 5ADHA 3PXGa 1S4QA 2ZE6A 4K9MA 1G8KA 4KBYA 4ZT3A 2H07A 5LZ5A 2Z1NA 3VVBA 4USUA 4RM3A 4ETWA 4WFIA 1Z7GA 2V96A 2M0GB 3SQNA 4MSUA 2KT2A 1WDDA 3IMQJ 2MZ1A 3O1JC 2PKQO 1UBSB 4B9AA 3FMIA 3UVJA 4QHSA 4RKYA 1NMYA 1HLPA 2WG0A 2B2CA 5F2EA 4IIHA 2PT9A 5CT8A 4I1RA 1N36B 1TTPB 4A9AA 2XZWA 4O3SA 4RPGA 2A14A 5JALA 3CDEA 1QIKA 1IXYA 5DM6Q 3GK3A 4XB6B 3TZYA 3CE9A 2CXHA 3FB1A 4MV5A 4CJXA 3EXIB 4L8FA 1R1DA 3OQVA 1YJCA 5IJXA 3VKUA 3ZNPA 1M5HA 1I33A 2CE2X 1E92A 2ZWAA 2D06A 5BSEA 1T02A 4AQYF 2PX5A 3OCUA 1R27B 3TSOA 4AFNA 2PUEA 4H16A 3JQDA 1G21E 3DT8A 4EG4A 3BRCA 1P62B 5E1MA 2WYVA 1SZDA 2ZREA 1HYSA 1ZO8A 1NF2A 1LTHR 1OA1A 1IN8A 2OZLA 3MD0A 3GA5A 2FMKA 4E0BA 5KOWA 4DJAA 1HLDA 3CLSC 2WT8A 4WQMA 3HHLC 5KSYA 2CPEA 3T38A 4WXMA 4E6PA 1NB2A 1GAXA 2EW2A 1YD7A 3WKDA 4TRRA 3TOXA 3CEDA 1O96A 3V81B 3CIOA 1BXGB 3M0EA 3HCPA 4UNIA 4ZD6A 3CX8A 1SL2A 2HNBA 1LPSA 3GELA 3W2IA 4L5YA 3P0FA 1GNQA 2GPYA 1PZXA 4O3OA 2W8ZA 2FMTA 2OLJA 2XG8A 4KWIA 2A94A 4NAUA 3EOBI 2QW8A 2QIOA 1UINA 4HAXA 1SC6A 5HP4A 3U1VA 1ODLA 2NXJA 3HYSA 3T52A 2FJ0A 1XX6A 5AUNB 3QWAA 1PP4A 4ENRA 4ID8A 2MYNA 2GJ4A 3QU9A 4OYIA 3O92A 4U2BA 1TTHA 3QVWA 1CQIB 2K3IA 5DBHX 4ZCLA 1ICEB 2NUPB 3R7NB 1YIAA 3T1NA 3JAMA 1RJEA 4WE1A 5TNXA 4OYRA 2NQPA 1RIIA 4IQ4A 1KHVA 1WPQA 4RTSA 4DTCA 5HIIA 5BQPA 3BA1A 1LSUA 4DTIA 1HE5A 5SYAA 3TL6A 2QTNA 4YUDA 4G6ZA 4S0ZA 4CYUB 2W2OA 3FNGA 1TJ3A 2HA2A 4Y00A 1DE0A 1V3UA 4ZPAA 1ZI6A 2RILA 2C2XA 3DMJB 4BNHA 3RK0A 1L1QA 3KLIA 4U7PB 5EN1A 3QUSA 5DE3A 3SHOA 1Y42X 4H1TA 2R8XA 1TMYA 1CJVC 1QV6A 3KFWX 3P2EA 1X4HA 3QJJA 4I1OA 3GOQA 4JI6J 4QPDA 3RS3A 1SI9A 4ER8A 3L92A 3N8GA 1UC5B 2CFOA 3PQ5A 4BGDA 3VOSA 5L6LB 3NJ8A 4DSNA 2ZIAA 2DZDA 2J7PD 1E2PA 2SECE 4S1NA 3BSNA 4ZCPA 3ASVA 1M2NA 2HN9A 2ATCA 4IZOA 5AE2A 1WSBA 4P4TA 4J7XA 1Z2PX 1TO2E 2BANA 2J9ZB 1C1BB 1QANA 4FR5A 3UGQA 5CHYA 6ADHA 4LQ3A 1OE0A 4B3SJ 4C7BA 3HBFA 1A5ZA 4FS3A 1VMDA 2WIDA 3P94A 3D7MA 5FOSA 1MTOA 3M33A 5EE3A 2Q5OA 3IAXA 2NSCA 2VHYA 3C87A 1SCJA 3D0HE 3MMZA 3CJKB 4U5QA 3FX2A 5GM1A 3M1AA 4R8LA 1ISPA 3AQ4A 1R8PA 3PACA 1B64A 2AT1A 2WZCA 1NVWQ 1KOGA 1L4UA 2QAGC 1T8RA 3TW0A 1THZA 1UBCA 3PNBA 4HDMB 1LVUA 1QKJA 5IJZA 3ROPA 1KFSA 4HQRA 4HI2A 4YUAA 2IYZA 1Q1KA 3GFBA 4PFJA 1GRRA 5TT1A 2WTBA 4QGHA 1I3OA 3R27A 1ZUNB 3P45A 1RWKB 2WV9A 1K1SA 4WLNA 2FZWA 2J0SD 3LLSA 1HLGA 1BGWA 3GRUA 4EB3A 3MWFA 5JD5A 3F9CA 3LLMA 1Z12A 5IKXA 3PA8A 4BIIA 1X5PA 3MR3A 4JXXA 1CKEA 4BO8A 5EGSA 2AG1A 2XWYA 4GRSA 1QU3A 4B6SA 4EVIA 4UJ3A 5C24B 4URZR 4MWEA 1QQ5A 1YAHA 3PQDA 3USZA 1NJYA 1TFUA 2HW3A 4Y9UA 3G2XA 3T5KA 4OK5A 3VKVA 4D9FA 4EG5A 2CXPA 4CTOA 4B43A 3AX6A 2BYTA 3IT1A 4DPKA 1YZUA 1WOPA 4RWEA 4LFBJ 1AGPA 1CUFA 4LW8A 4IOAQ 2BF4A 2KH9A 3H3FA 2GBGA 5FPQA 1PJ4A 3E4CA 3B38A 3CMES 2FSSA 1W75A 1VPWA 4BKMA 4QECA 3HCXA 1FLNA 4DIUA 2XDQA 4Y9RA 1G5TA 3WR5A 2GDZA 2YZ7A 4MW5A 4O5OA 3L7OA 4UW9A 1JDJA 4ECQA 5AW4A 5LQKA 3IP5A 1K8XB 4WWSA 1MDBA 2GFFA 2KJQA 1ZJ6A 2E5LJ 5FX2A 3CNHA 2FX2A 4I0WA 3KHUA 1Q50A 1H65A 1P72A 3B51X 2RE1A 1AHPA 2ZJYA 4GICA 3D6NB 1QSGA 1JXOA 4EHNA 1V25A 3LP0B 1TKBA 4L4XA 3EAQA 2QTCA 2E6KA 1V4NA 1ZWKA 1GL9B 5DI9A 3L46A 3R4VA 1YGPA 4V1CB 2CJ9A 4IO1A 2HMIA 4F50A 1ONBA 1V1MA 1BX1A 5KFXA 2R7NA 2PPLA 3GSDA 4LOJA 3BPSP 4LFCB 1YNSA 3NBQA 5DWQA 1JMTA 3H6GA 4LJ7A 3V7UA 2XMSA 3EY4A 4U6PA 2YJTD 1I7DA 1ZW6A 2WWRA 1T0IA 2W98A 3DOKA 4G5XA 1V11B 4OHKA 1RAEA 2UVPA 1P74A 4EYKA 2XUQA 2XB4A 3ZLUA 3C5HA 5IVKA 1OWLA 2JKZA 4E4YA 3GIIA 2GUGA 5HRCA 2REXB 3OTGA 2GEFA 3P9ZA 4KDFA 4D3YA 1S2LA 1ZH5A 3NANA 1S7IA 1KQPA 3OHPA 2H16A 2IM2A 5A4DA 3OZFA 4GBJA 1PJ6A 4TVAB 1B7FA 3JQ8B 2HF9A 3L79A 2HNKA 3O6VA 3IV7A 3NC4A 2Q3LA 4WY8A 2V7XA 2WJZB 5GOTA 2XB6A 2Y1RI 3EPGA 3KSZO 2H1OA 4ICIA 3G79A 1EJBA 1GUFA 5K4AA 3N9IA 4E08A 1DC5A 3BK1A 3RIMA 1JQ3A 4FHFA 2LECA 2OYSA 4AT1A 3MS4A 2OESA 2B4KA 3ZE1B 1QHFA 3FNHA 3C7DB 3M8RA 5CCBA 2O2EA 4RS4A 5LOQA 1SVKA 2ROQA 1MW8X 4BUJA 1GPYA 4X7BA 1KQNA 3GCWP 3WC2A 2CJWA 4ZRMA 5DN6A 2QUBA 2C8KA 5BMVF 2GO8A 4B2IA 5KYWA 1ZZNA 4EF5A 1NYQA 1YBTA 3P5TL 5LLTA 1OB2A 3FTEA 5HVHA 3TLCA 3OFEA 3LMKA 1GZHB 3RHFA 4HDRA 3FE2A 3BZBA 1O77A 1PCAA 3UWPA 4CHTA 3QO9A 4K4SA 3BJMA 3U7QA 4ECAA 3HKCB 1A50B 1TJ5A 1CVJA 1QIGA 2XULA 3MTJA 2B0CA 4RWWA 4MZXA 1MUUA 4KHZA 1R4NA 5ELLA 2F3QA 5EXEA 2PIIA 3L5KA 1DXYA 3AQOA 3PKYA 2QTTA 2IJGX 2IKQA 1NASA 4ND5A 5SZKB 2W6JD 4WZBB 2PO4A 4DV0F 1PWHA 1R6XA 2EP7A 5AKLA 2ZYWX 2NAPA 3AFNA 4GRDA 1IQRA 3G7SA 1I5EA 1PR4A 1HWKA 1DINA 3F6PA 4CYMA 3EFOA 4IBOA 2XBMA 2GAAA 5A2QU 1RHMB 3SEOA 2W22A 4EPRA 1SK8A 2GPJA 4AQYJ 2RBKA 2FRVA 1S5PA 2I6XA 3A58B 4FHGA 3RH0A 5KDDA 2FRDA 1X13A 4Q4DA 1P4HA 5F9MA 2HSWA 3EIOA 1TVKB 3OEHD 5JZBA 4HAWA 2NSBA 4ZU1X 3WC4A 1KO7A 2PSZA 5EG5A 1XXHE 3AUXA 2RDJA 1SQ5A 4EGAA 1Z75A 3ZJTA 3L7LA 1CB0A 2DQSA 2WSFC 3SIPA 5LZ2A 3DEFA 4TYQA 4FBUA 4WZBA 4DYVA 1CLEA 3M6UA 1ISHA 3Q3CA 4BWMA 5THWA 2WSSA 3QSGA 3LDGA 4A0SA 5KPJA 1TPZA 3IGNA 4NOJA 3DL2A 4COKA 5I4IA 3JW8A 4U63A 4OH1A 4F04A 5LMUB 1KHHA 1AXEA 4EHDA 5KYYB 4C4PA 3GJ4A 3U3RA 2BJVA 3BBBA 3VSAA 4QR1A 4NZMA 3FKBA 1E9FA 5DHPA 3RHTA 1Y63A 3GAFA 3I0ZA 1DRWA 4QIFA 2C7BA 3UEOA 2HSEB 1Q74A 4ZP9A 1MB4A 3I3OA 1XKTA 4BASA 3CLVA 5FL7A 1T1JA 4I56A 3ZTSA 4UHCA 1IVSA 1NVXQ 2YWGA 1RCFA 5KINB 1JJAA 4PQUB 4X3PA 3EEBA 4KIUA 2PRZA 3BEGB 4Y9SA 5IAGA 4D46A 2H54A 4XUDA 4KXQA 4AWXA 3Q3IA 2FQQB 4PLVA 5JSUA 4RK1A 2JAPA 4MB6A 3SG0A 2ZP1A 4KMOA 4JCCA 1VOTA 2I99A 1LEHA 2NADA 2X3YA 2JFYA 3GY0A 3PXBA 4HUTA 4BE9A 3C46A 2PL1A 4G0ZA 3IUSA 3R3SA 1Z0JA 4NJMB 4HWTA 5DHAA 1WU8A 1AHNA 1VZ2A 4U7JA 1D5CA 5EJ2A 1JLFB 1XHEA 3VAKA 5FDFA 5ALQA 5JECA 3AHIA 2C7VA 2FNAA 4FMCF 4UM5A 2JGJA 3C3LA 3R0VA 1EDZA 2M6RA 1V8OA 5E8RA 4OZ1A 4MS4A 1SUQA 5HSGA 2XUHA 4F3RA 1HT0A 4LE0A 4N12A 1RTHA 5FNVB 1MAVA 3SM3A 3IKMB 5JADA 2O0KA 2REQA 1RSZA 4K9NA 1CQJB 1SZCA 121PA 2RT3A 1Q0RA 2VHCA 4C04A 3UR3C 4AJPA 4RTPA 3HFSA 4KE5A 2ST1A 4F06A 2Y0CA 1S79A 1B8PA 5BO5A 1RHJA 1RPNA 1G291 4PHGA 3P9YA 4V0KA 1R4MB 2P9CA 1P9LA 3NIFB 1NC3A 3DI6B 5IVIA 5J1SB 2CYAA 2YXPX 3CJ0A 3V6DB 2EEPA 1O87A 4QXQA 4C0OC 4FQ5A 3N2GB 3IJ5A 4PGHA 3PQ7A 1P6TA 1L4MA 4ZOLF 1Q78A 4WZMA 2C1ZA 1F2TA 1XDZA 2BMJA 4KRFA 5A5DA 4Q3KA 3FXAA 2W70A 4EPYA 9GPBA 3O4HA 4CTMA 2WC1A 3ZW9A 2V63A 2GSWA 1U9YA 3I76A 3U7RA 3E8OA 1TKRA 1GZUA 1G3QA 5CCLA 2VA8A 4U2CA 2G5PA 4K9OA 4F8YA 3R6GA 3PLRA 3ILVA 3QF4A 1XQ1A 4R0JA 3ZJYA 3VKFA 1YRAA 1S6PB 4WFBQ 4XIJA 4DV4J 3KLNA 4DX7A 2AW5A 3OFNA 1HZJA 4MUGA 2GQCA 1NXQA 5IWAF 3GAAA 3X2SA 3EXCX 4GMXA 4ER6A 3VVTA 3SMQA 4DLNA 2EKZA 4BFCA 5B4TA 5IZCC 4Z8YA 3N05A 5B1EA 1T15A 2OZPA 4PTYA 1D04A 3PNVA 2GHRA 1RYNA 3ZWWA 5LQMA 1DQAA 4HZIA 2AH5A 1E94E 3F71A 1LBEA 3JQAB 5KJ1A 1Y48E 1M75A 2J4DA 4DWVA 1A5TA 1SH7A 4ZQCB 1HZZA 1GDTA 3IP7A 1UA1A 1JSZA 2FJBB 1J2EA 3L6CA 3VDRA 4V0LA 4JV0A 3L9WA 1P0PA 5CIQA 3M2RB 2RDIA 1U3FA 1HNVB 2IOHA 2ZYDA 1EFCA 2HK3A 2MR6A 4P7VA 1NLKL 1MTZA 1WKLA 3LC0A 3U1NA 3H0PA 2Z04A 6REQB 2RB7A 1E1QD 2E87A 1RI3A 4OP3A 1RD4A 4EJSC 4JI7J 2Q3EA 2ZW9A 2I78A 2NVWA 4DR5B 1AM4D 1CERA 2NV6A 3LFTA 1FT8A 2ZRCA 1OI4A 2Q7XA 3UA3A 4JI1F 5KVVA 3O8LA 4II3A 5A7HA 2FJEB 1J49A 2Z0GA 2YIDA 4UOEA 4FYPA 1CEEA 1A69A 3R2JA 2FRDC 2R9LA 5DHFA 1EVYA 4CMHA 3FWHA 1TYCA 4MVWA 1K5PA 2WUEA 2VH7A 1RI7A 3ILJA 2R7LA 2GHQA 3QELA 3KTOA 2ZWIA 2EFDB 2D1CA 2JEZA 2CNOB 2Z30B 4BDPA 4E21A 4Q7JB 4YDDB 3ZD9A 4ZAYA 3OR1B 2ROPA 3W5IA 2B6NA 1Y9DA 3TI9A 3ORFA 1IJEB 3KHKA 4LXYA 3S2UA 4JBXA 1QTIA 3W0LB 1QX4A 3BRWA 1XD9A 1NV8A 2FP3A 2GN8A 4I1VA 5J1EB 1KY2A 2PZKA 3EGCA 1Z2OX 3LTEA 3P19A 4YDRA 5D8HB 3V6MA 1SCKA 3WXBA 2ALZA 5AM1A 4IGKA 2C2WA 4X95A 5DLGA 1W2IA 4BXOA 5C80A 4O2LA 1CWUA 3AJEA 1UWKA 2B30A 1UADA 4R3UC 2G1AA 4J8PA 2VUUA 1QC5A 5G4KB 3UMGA 1ZP6A 4WFZA 3KQMA 1SHLA