3VI5A

Human hematopoietic prostaglandin d synthase inhibitor complex structures
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
198
structure length
198
Chain Sequence
PNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGMSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKVQAIPAVANWIKRRPQTKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hematopoietic prostaglandin D synthase
publication title Human hematopoietic prostaglandin D synthase inhibitor complex structures
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 68
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.18: Glutathione transferase.
pdb deposition date 2011-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02798 GST_N Glutathione S-transferase, N-terminal domain
A PF14497 GST_C_3 Glutathione S-transferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1050.10 Mainly Alpha Up-down Bundle Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2 3vi5A02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3vi5A01
3VPTA 2UZ8A 2HRAA 1QUWA 4ZB9A 3CRUA 4GSTA 1TK5B 1F3AA 5L71A 4BA7A 3DRNA 5HQPA 2EIQA 2JU5A 1KNGA 2OJLA 2NPBA 6GSVA 1M9AA 2HRNA 4KSOA 3M9KA 2IFQB 2JSZA 1JZOA 4EUYA 3I6AA 4IQ1A 4WXTA 5IPGA 3UBLA 2QKEA 1ABAA 5JWOB 4L5LA 1ERVA 3GRXA 2VO4A 2IJYA 4FQUA 1TRVA 4WF5A 4JBBA 5CP1A 4HI7A 3EVIA 1IYIA 3F6FA 4MZWA 2H6XA 1QXHA 2IMIA 1JHBA 4MP4A 3IC4A 2GVPA 5IO2A 1Z5YE 3M0FA 2H1BA 3CRTA 2B5XA 3HZ8A 3E3EA 2K18A 2DJ3A 4RQXA 4Z7XA 3HVXA 5C00A 4TR1A 1SKWB 4TXOA 3KGKA 1EV4A 2C0EA 4WR4A 4K2DA 1ACVA 4NWYA 3HJMA 4KB3A 3GTUA 2WRTA 2VCXA 1TJDA 4K7IA 3UEMA 3QR6A 1SJ6A 2G0FA 2QGVA 2OBIA 5ECIB 1BX9A 1UC7A 2R3XA 4FH8A 2C0FA 1JZRA 2TIRA 2NBSA 3GL5A 4MMMA 1X9MB 5G2ZA 3LGCA 17GSA 3C1SA 1XWGA 1SKRB 5ECPB 5D9XA 3A5WA 2VCQA 1HNBA 1LU4A 3PR8A 3GUSA 3G7IA 3NIVA 3R3EA 4PUFC 4FYCA 1EGOA 1FOVA 2C4JA 3P2AA 5EY6A 2PVQA 1YJ6A 1XOBA 2DIZA 2N5BA 3HCZA 1B9YC 1WPIA 2FGXA 3ERFA 3TKSC 4WBRD 1BAYA 2V6KA 1SD8A 3GURA 4G0IA 3VLNA 2CAQA 4HEA2 3FK8A 4KDUA 1SKSB 3H1NA 4BVXA 4KX4A 1M2BA 4ILFA 3LORA 2VIMA 4G19A 1YEPA 1FB6A 3FR6A 2JZRA 1C72A 4JR4A 5IPHA 3CSJA 1E2YA 4MCUA 3EYTA 3H8QA 1A2LA 3L9UA 2FWFA 5IMCA 2GT5A 2WS2A 4OFNA 1ZZYA 1O81A 4IGJA 1FVKA 2N5AA 1E6BA 5JCWA 3LXZA 2HQTA 1RW1A 5D9WA 2P5RA 2J23A 2HFDA 4HJ2A 1TI3A 5G1KA 3LG6A 2MMNA 1G6WA 2XPEA 2DJJA 2LJAA 2YJ7A 4MZBA 2OKAA 4LA1A 1N2AA 1LJRA 3F63A 4IJIA 3C7MA 1GWCA 3WT1A 4F2IA 3BBYA 4MH3A 3TRQA 1WJKA 4K7OA 2K9FA 5ECLB 4AJ7A 1XZOA 2DC5A 2XPDA 1PGTA 2EIOA 3G7YA 4IQAA 4Q5QA 2L4QA 4POLA 4AJ8A 3GYKA 2V2GA 3A2VA 2MYGA 1GUKA 4JRRA 3W8JA 2LRTA 4TXVA 5DAKB 1TK8B 4MPFA 1GSDA 3CXGA 2O85A 6GSUA 3HVVA 4CHSA 2CVKA 1OC8A 2V6OA 3F6DA 3EMXA 3BCKA 7GSSA 2H73A 5B8AA 2YZHA 1SK2A 4IW9A 4XHMA 1GNEA 4HZ2A 1ZGNA 2GQMA 1NHYA 2K8SA 2C0GA 2WCIA 2VL3A 1OAZA 3D0ZA 3EC3A 3RHCA 2V41A 5B6MA 1TRUA 5J5NA 3C73A 1B8XA 4KA0A 3IHQA 4OWYA 3TKQA 3APSA 5DJLA 1FW1A 3ED3A 3ZMLA 1H4OA 1PX6A 13GSA 5JWRB 2AAWA 4HDEA 1XOAA 2FCHA 4D73B 1GSEA 3GV1A 4O92A 1PKWA 5IOWA 3U6VA 1MD3A 1GUMA 2P31A 5G5EA 4KGIA 1Y25A 1MDKA 3QFBC 5IMZA 1V57A 4TR0A 1Q4JA 1SK0A 3KMOA 5DQYA 4IS0A 1K3LA 4N0ZA 2VUPA 1SL0B 4YH2A 4BWQA 2E7PA 3RAZA 3QFAC 4ZIJA 1ERTA 2H6YA 4FIWA 1MDJA 3GFKA 3SWLA 2YWOA 2B5EA 4V2NA 5D8IA 1F9MA 1SJIA 3GHAA 3TUEA 3F9UA 2VL2A 2ALBA 5IOXA 1GH2A 2LSTA 5GAPD 4OMVA 10GSA 2L6CA 4K1FA 3GKXA 2LUSA 3K8NA 1HNCA 5GZZB 4CW9A 3IDVA 1GSUA 2FY6A 1AQVA 2LRNA 3GA4A 4XS4A 2B7KA 3FR3A 3E9JB 3DKSA 5DALB 2C3TA 2HZEA 1V40A 4DSRA 1Z7RA 3NZNA 4POBA 5EL8A 3WGXA 5H5QA 2XBIA 1SJZA 1THXA 5ID2B 2JSYA 4AF2A 2VCVA 3QOUA 4MJCA 3KH7A 1HNAA 4I6XA 3ZVJA 5G1LA 1JLVA 2DJKA 5FWGA 4F0CA 3GIXA 4KF9A 1V98A 5F05A 2V32A 1CQHA 2LRCA 4POMA 1V2AA 2R4VA 4YAPA 3DD3A 2B6MA 2HSNB 4ECCA 5J41A 1WE0A 2AB6A 4PUAA 5E4WA 1TTZA 2AV4A 3IAS2 2N5FA 2E2MA 2PPTA 4MJEA 1DUGA 5E59A 5DBQA 5G30A 2R6KA 5ELGA 1GULA 2C1YA 3HY2A 2NVLA 1TI1A 4V2LA 1SD9A 4XRAA 2GTUA 2FUG2 4K9ZA 1T4YA 2YNXA 19GSA 2M72A 5ECNB 3VWUA 4GLTA 3GKMA 2CVBA 3VI5A 2DLXA 5A5KA 2M80A 2EIRA 2CZ3A 3H4KA 2OE1A 4ACSA 8GSSA 2CA8A 3VURA 3HYPA 3F4TA 2OE0A 5ECQB 3FEUA 1TW9A 4HQSA 2A2RA 5J4UA 3F3QA 4EO3A 1GL8A 5COHA 5ECOB 3L0HA 2NDOA 2RIIA 4KH7A 4ML6A 5F0GA 2J9HA 1KTEA 4X43A 5CAXA 5IMAA 2AHEA 4LMWA 2O89A 1A24A 4TRXA 1AW9A 5F8BA 4WF4A 4E8EA 2HSYA 1J9BA 2DSAA 2PERA 3H79A 4YAVA 4KUNA 3TB2A 1PA3A 1X0RA 2H30A 2VL9A 2C80A 4ZILA 3UVTA 2E0QA 2CZ2A 5GAND 2VD0A 3ISOA 4USSA 3ZLPA 4G2EA 5C04A 1S3DA 2HI7A 2LNSA 1QFNA 2Z9SA 1MD4A 4DSSB 1J0FA 1THOA 2HZFA 1EWXA 4MJAA 2LTKA 4ZBAA 3RHBA 1PL2A 3RDWA 1ZYEA 2GSSA 3WT2A 5D93A 2RM5A 2HXKA 2H1GA 5AIXA 3UIWA 3UVHA 1VF1A 2X64A 2AYTA 4ZL7A 2MMOA 1Z7PA 4IP1A 3W6GA 9GSSA 3KP8A 3OR5A 2L57A 1GUHA 4F82A 1GSFA 2WDUA 2YN1A 1S3CA 2AJQB 3C8EA 5D9VA 1U88A 3NOFA 3TKRA 1NW2A 3F3RA 2YWNA 3VK9A 1DE1A 2MBSA 3QPMA 5JCUA 2H66A 2YV9A 4ML1A 4IJ3A 1XBSA 2VLVA 5AN1A 2HSMB 4ZBDA 1YEXA 1AUCA 2L6DA 3KD0A 2WB9A 4GXZA 1A8LA 1TOFA 3CSHA 1TRSA 1W89A 1EGRA 3HKRA 2TRCP 4MF5A 3HJPA 2OA7A 2HRKB 1O6JA 6GSXA 3ZTLA 2YOIA 3WGDA 1UA5A 2VL2C 3HDCA 2LJKA 3F8UA 4J57E 2FWEA 2YWMA 5D73A 3TRPA 3QMXA 4RI7A 1ST9A 2JADA 4HUAA 2PGTA 2FNOA 1U87A 2PBJA 2V1MA 1KEBA 4XS1A 4OFMA 4DVCA 3LXTA 4XRDA 3LYPA 5DVBA 3DEXA 3R2QA 3RPPA 3VWXA 1YQ1A 3LEFA 4MF7A 5GSTA 3WD6A 1X5EA 4BWSA 4GWRA 3O3TA 5G31A 1YZXA 2GZZA 5B8BA 4ID0A 2DMLA 3O76A 3UL3A 1X5DA 2H8LA 3TRXA 3IBHA 2H70A 5JCGA 4HU7A 4P3YB 4L5OA 2G2QA 2GQLA 3KZQA 5H5RA 2H0GA 5DCHA 3VPQA 3EU3A 2IN3A 1FO5A 4BVYB 5CO3A 1BJXA 1Z6MA 2VOCA 3ZIJA 4WETA 5FHIA 2JZSA 5HR3A 5F07A 3KP9A 4K6XA 3DGQA 4TR1B 2C8UA 3GX0A 4TXOB 4D73A 2YV7A 3HZ4A 1O73A 1R4WA 1ON4A 2VCTA 2MMZA 3CTFA 4WR5A 2CX3A 4BL7A 4JZQA 3DVXA 3FHKA 3LWAA 2IWTA 5DQSA 4YQVA 5CREA 3GX8A 3S9FA 4ZB8A 3F4SA 2DIYA 5LD0A 1GLPA 1U3AA 2QSIA 3KCMA 3PINA 3MDKA 4XIHA 4KW6A 5IO0A 5KEJA 1U6TA 4QL7A 2CQ9A 1ZL9A 2CAIA 14GSA 4I8BA 4MA9A 4MDCA 1AAZA 3UOMA 6GSYA 3L4NA 2H76A 2YP6A 1GSYA 5LNKe 2ZCTA 4K8MA 1HD2A 1B48A 2IMFA 4KDYA 3PGTA 1GTAA 2H0HA 2RLIA 11GSA 2TRXA 3TJJA 3D22A 4IBPA 4HU9A 1OC3A 2H19A 4ZB6A 12GSA 4EC0A 4BVXB 1XVQA 1PX7A 2H01A 3D4MA 3QAGA 3ZFLA 4LMVA 4G10A 3KEBA 4GF0A 3ERGA 2LEGA 4JU5A 2BJXA 2HNLA 2OADA 4KAEA 5AGYA 3TCOA 6GSWA 4TR3A 1R26A 2X99A 3GKNA 4FO5A 3I9V2 4NHWA 2R5GA 1URMA 1K0CA 3D6IA 18GSA 3C71A 1LBKA 5KN0A 3EWLA 2YPMA 1OYJA 2REMA 1TDIA 4OO5A 4KE3A 1EP7A 5ECMB 4G0LA 2K8VA 3FRCA 1AIUA 3DIEA 3F0IA 3M8NA 5LCZA 2DMMA 4WKWA 3DVWA 2XHFA 4RI6A 5HFGA 1GTBA 3DWVA 2JZTA 2C0DA 4FYUA 1M2DA 2PWJA 3Q6OA 3KMNA 2GQKA 3EE2A 4AJ6A 2VD1A 2IIYA 1OC9B 2FWGA 1SU9A 2LKUA 4MZCA 1USBA 1JFUA 3PPUA 2R37A 4TN8A 2GT6A 4NMUA 4G9HA 4GRFA 5ECRB 3V1WA 4EF0A 1XW9A 6GSTA 5CNWA 4IKHA 2RUFA 3ZFBA 1BEDA 5IMFA 1UVZA 1K0NA 1GRXA 2P5QA 4OCFA 3G7JA 3ME7A 3SBCA 5A4UA 4GQFA 2GS3A 4PXOA 4MJBA 1X9WB 4EE0A 4KCEA 2MBTA 4N10A 3UJ1A 5INYA 2O87A 4MPGA 2CV4A 1OE8A 3ZITA 5G5FA 2B1KA 5IM9A 1OKDA 4GQCA 3LFLA 3VWWA 1VGLA 3GH9A 3ZREA 4RQRA 2PN8A 4KCAA 2H71A 3DMLA 2GZPA 4GTUA 1YDKA 4YQUA 3JCML 2CT6A 4IN0A 4X1UA 3TOUA 2GLRA 4EKZA 1S3AA 2L4CA 2IFQA 4V2MA 4O5RA 1JZDA 3FZ4A 2KP1A 2IMDA 2H72A 3Q19A 1X5CA 4F03A 2DBCA 1FHEA 2GSQA 2O7KA 1FG4A 4MABA 1MDIA 1XXUA 5HR1A 2H6ZA 2NTOA 4PQHA 1M9BA 1YKAA 3TKSE 1NM3A 1OKTA 4XCSA 1A23A 2IPAA 4KSMA 3ME8A 1EOHA 5DJMA 5KN2A 1XCCA 2HRFA 2VCZA 1AQWA 2IMEA 5HFKA 3BD2A 1YKCA 4F0BA 5J3RA 1M99A 2H0IA 1T00A 2HZEB 3CBUA 4NXIA 3ZRDA 3LQ7A 3HA9A 3C1RA 2A2SA 2LJRA 1OVNA 1Y6EA 5KN1A 2YANA 4IVFA 3QCPA 2M46A 4KDXA 2R2JA 1O8XA 4BPYA 1SENA 1EEMA 3FY7A 1G6YA 5ECSA 3HD5A 2B3SA 4QL9A 2KLXA 3CTGA 3EMPA 4TW5A 5ELAA 1O8WA 1QMVA 2DJ2A 1VF3A 3QD9A 4QQ7A 3GL3A 3M1GA 3ZZXA 1YF1A 1WP0A 2XC2A 5CRWA 2I4AA 2RUEA 2FWHA 3VFIA 4I5QA 4J56E 5J9CA 3TJBA 4XTSA 1ERUA 4FYBA 2WZ9A 2MZCA 3TJKA 1V9WA 3ZIVA 4LL1B 4HS1A 5D9TA 1XIYA 2B1LA 5IMVA 2I1UA 5AISA 5ABRA 3A2XA 3J7Yb 1WOUA 2F8FA 3D5JA 3UAPA 2OBKA 2LQQA 1O85A 2H1AA 2F8AA 3FR9A 2WFCA 2MMAA 3A2WA 1X9SB 1SYRA 2ON5A 3IK7A 3MNGA 1Z9HA 2AUVA 3H93A 1QQ2A 2F9SA 3QDNA 3EURA 5HR0A 1T4ZA 1A8YA 3M3MA 5EVOA 1G0TA 3D21A 3US3A 1EEJA 1WWJA 1ZMAA 1VF2A 3FZ9A 3CSIA 4IHUA 3L78A 4MF6A 5B7CA 4BVYA 4ZBBA 4N30A 4OFTA 4PURA 1XW6A 2VLUA 4F9ZA 1U3IA 1JLWA 2I81A 1Z6NA 3HVSA 3W8SA 3N9JA 2O8VB 2JL4A 1KBNA 4HOJA 1QK8A 5CRDA 4ECIA 5CRHA 4Q5RA 4I2TA 3KTBA 2X8GA 2HE3A 2L5OA 1MEKA 2BTOT 2EC4A 2LS5A 3IRAA 2YZUA 3RPNA 5J9BA 3IK9A 3ERWA 1EZKA 4XS6A 2JACA 4ULXA 5F06A 3WGEA 4IELA 1PSQA 4MLYA 4DEJA 4HQZA 3D4TA 3DYRA 5DAKA 2H75A 5B6NA 1T8EB 3IPZA 5DCGA 2YWIA 4Q5NA 4RUVA 2PMTA 3FW2A 4PTSA 1G7OA 1CQGA 5FT3A 4ECBA 2WULA 3DXBA 2L5LA 1PRXA 5AIVA 2H1DA 4ZL8A 1B4PA 2FHEA 3KIJA 1AXDA 5A4WA 4Q5FA 1TP9A 4ZXGA 2OE3A 2IMKA 4IP6A 1QGVA 3FZAA 4N0VA 3TOTA 5GSSA 1J08A 3L9VA 2LV3A 3G9BA 4J2FA 4N11A 3TJFA 1ZYQB 1GSQA 1ZOFA 3GNJA 4DSQA 2GZYA 3IXRA 4NHZA 3GTUB 4WBJA 3IOSA 2K6VA 2VLTA 3MAKA 3GH6A 4ISDA 2YJHA 3BOAA 3IA1A 3F4RA 4X0XA 2FLSA 1XWCA 3CMIA 3QAVA 4ECJA 22GSA 4KNDA 3TDGA 1RQMA 3N5OA 3TGZA 1G7EA 2GSRA 4HZ4A 1TXXA 3GN3A 4K0GA 3IC8A 4LL4B 1R7HA 4OCEA 4GCIA 3ZYWA 3APOA 3VWVA 1A0RP 1GLQA 4TVEA 1XWAA 2B7JA 2KHPA 1VRSD 1OC9A 5DALA 2CVDA 4MK3A 1R5PA 1T3BA 5BMUA 4HJMA 3VI7A 3LSZA 4EDZA 1K0BA 4TKYA 2OACA 3IAM2 1EV9A 2GDRA 2HLSA 3GKKA 1IYHA 2XBQA 1NHOA 4NV2A 2VM1A 3HXSA 20GSA 4YQMA 5ID2A 1Z3EA 1XW5A 1SL1B 4GSNA 1GNWA 2HYXA 3O6TA 2LNTA 1XPVA 3TJGA 2FD3A 5D96A 4PQ1A 4JR6A 1GP1A 1R5AA 2F3MA 4V1Ap 1EP8A 1T7PB 2ZNMA 4E8HA 4OO4A 1EOGA 2YCDA 1GTUA 2ON7A 3WYWA 5IIZA 2WJUA 4EVMA 1A2JA 1PD21 1PMTA 4V1Ag 2DJ0A 4LLRA 3MSZA 4BL7B 1TKDB 3J7Yk 5IQYA 2E2GA 3UMAA 1OE7A 4I2UA 1FB0A 3ZL5A 1SYXA 1ERWA 1ILOA 1XWKA 1RK4A 1DBYA 3E0UA 4O32A 4POKA 4L0WA 1FAAA 1A0FA 3LJRA 1M7TA 1PKZA 3GSTA 3GSSA 2X8CA 2HSHA 3MWHA 16GSA 3LYKA 1O7UA 1A2MA 2VAFA 2D2ZA 1BYEA 5ECHB 2ES7A 1K0DA 5H5SA 3I69A 2H74A 3TKPA 1SL2B 6GSSA 3CYNA 4O7HA 1VF4A 1Q98A 3HHVA 4OD7A 1AQXA 3I43A 1JZWA 3ZMKA 1SK1A 3U5RE 1ZCPA 1UN2A 1YF0A 3FYGA 2KP2A 1F37A 3TKSA 4NV5A 2C3NA 3IV4A 3P90A 4PGTA 2PVOC 2VCWA 1K0OA 3APQA 2CX4A 1PL1A 3BJ5A 1I5GA 1TU7A 1HYUA 1K0AA 4K7NA 4PNGA 1F3BA 1XWBA 2LQOA 4WEYA 1XFLA 1M2AA 5CRGA 4EDYA 1H75A 4DSSA 5ENUA 3Q18A 1WMJA 1TK0B 5IMDA 4NPBA 3GMFA 3P7XA 3P8WA 2WGRA 4JEDA 3IE3A 4G0KA 4NAXA 4K0NA 2KUCA 2X8HA 4PX1A 1NSWA 5JWQB 4TR4A 1XVWA 3M9JA 4MH2A 3UBKA 2PU9C 1T1VA 5CYYA 4EL1A 1TRWA 1GTIA 1YY7A 3UARA 2HT9A 1M0UA 1K3OA 1FVJA 2A4VA 5ECKB 2I3YA 1W4VA 1WIKA 3QAWA 1DE2A 2FA4A 2GSTA 3FKFA 1HQOA 5A4VA 3A3TA 2I9HA 1K3YA 1F2EA 4XS4B 1N8JA 1MTCA 4GSSA 4AGSA 1V58A 1AC1A 2F51A 2HSMA 4L0UA 3AY8A 1BG5A 1K0MA 2GGTA 5HR2A 1DSBA 3L9SA 3KH9A 2FA8A 1I9DA 1B4QA 2IL3A 5DDLA 1B9XC 5KN3A 5HFIA 3KJYA 2QC7A 3Q74A 4ZL9A 2HRKA 2P0GA 3KM6A 4PNFA 1ML6A 1BQ7A 2RM6A 4PQIA 3EINA 1TU8A 3PH9A 4EXJA 1PQNA 3FZ5A 3KXOA 4JE1A 3ZVJD 1GSSA 3KTLA 2PUKC 3IR4A 1F6MC 2DJ1A 2L59A 3BCIA 2C3QA 4I97A 1WRYA 4H86A 3RBTA 4CDOA 4TOPA 2B5YA 5EPFA 2ZUPA 3EU4A 2KOKA 3HJOA 2BMXA 4L8EA 2VM2A 1PN9A
chains in the Genus database with same CATH superfamily
4K5RA 3VPTA 2UZ8A 2HRAA 1QUWA 4ZB9A 3CRUA 4GSTA 1TK5B 1F3AA 5L71A 4BA7A 3DRNA 5HQPA 2EIQA 2JU5A 1KNGA 2OJLA 2NPBA 6GSVA 1M9AA 2HRNA 4KSOA 3M9KA 2IFQB 2JSZA 1JZOA 4EUYA 3I6AA 4IQ1A 4WXTA 5IPGA 3UBLA 2QKEA 1ABAA 5JWOB 4L5LA 1ERVA 3GRXA 2VO4A 2IJYA 4FQUA 1TRVA 4WF5A 4JBBA 5CP1A 4HI7A 3EVIA 1IYIA 3F6FA 4MZWA 2H6XA 4O5QA 1QXHA 2IMIA 1JHBA 4MP4A 3IC4A 2GVPA 5IO2A 1Z5YE 3M0FA 2H1BA 3CRTA 2B5XA 3HZ8A 3E3EA 2K18A 2DJ3A 4RQXA 4Z7XA 3HVXA 5C00A 4TR1A 1SKWB 4AKHA 4TXOA 3KGKA 1EV4A 2C0EA 4WR4A 4YKFA 4K2DA 1ACVA 4NWYA 3HJMA 4KB3A 3GTUA 2WRTA 2VCXA 1TJDA 4K7IA 3UEMA 3QR6A 1I1IP 1SJ6A 2G0FA 2QGVA 2OBIA 5ECIB 1BX9A 1UC7A 2R3XA 4FH8A 2C0FA 1JZRA 2TIRA 2NBSA 3GL5A 4MMMA 1X9MB 5G2ZA 3LGCA 17GSA 3C1SA 1XWGA 1SKRB 5ECPB 5D9XA 3A5WA 2VCQA 1HNBA 1LU4A 3PR8A 3GUSA 3G7IA 3NIVA 3R3EA 4PUFC 4FYCA 1EGOA 1FOVA 2C4JA 3P2AA 5EY6A 2PVQA 1YJ6A 1XOBA 3HCZA 2DIZA 2N5BA 1B9YC 1WPIA 2FGXA 3ERFA 3TKSC 4WBRD 1BAYA 2V6KA 1SD8A 3GURA 4G0IA 1M3IA 3VLNA 2CAQA 4HEA2 3FK8A 4KDUA 1SKSB 3H1NA 3LW9A 4BVXA 4KX4A 1M2BA 4ILFA 3LORA 2VIMA 2WW0A 4G19A 1YEPA 1FB6A 3FR6A 2JZRA 1C72A 4JR4A 5IPHA 3CSJA 1E2YA 4GDFA 2VKZG 4MCUA 3EYTA 3H8QA 1A2LA 3L9UA 2FWFA 5IMCA 2GT5A 2WS2A 4OFNA 1ZZYA 1O81A 4IGJA 1FVKA 2N5AA 1E6BA 5JCWA 3LXZA 2HQTA 1YVLA 1RW1A 5D9WA 2P5RA 2J23A 2HFDA 4HJ2A 1TI3A 5G1KA 3LG6A 2MMNA 1G6WA 2XPEA 2DJJA 2LJAA 2YJ7A 4MZBA 2OKAA 4LA1A 1N2AA 2WVYA 1LJRA 3F63A 4IJIA 3C7MA 1GWCA 3WT1A 4F2IA 3BBYA 4MH3A 3TRQA 3RGBC 1WJKA 4K7OA 2K9FA 5ECLB 4AJ7A 1PFOA 1XZOA 2DC5A 2XPDA 1PGTA 2EIOA 3G7YA 4IQAA 4Q5QA 2L4QA 4YKGA 4POLA 4AJ8A 3GYKA 2V2GA 3A2VA 2MYGA 1GUKA 4JRRA 3W8JA 2LRTA 4TXVA 5DAKB 1TK8B 4MPFA 1GSDA 3CXGA 2O85A 6GSUA 3HVVA 4CHSA 2CVKA 1OC8A 2V6OA 5KOXA 3F6DA 3EMXA 3BCKA 7GSSA 2H73A 5B8AA 2YZHA 1SK2A 4IW9A 4XHMA 1GNEA 4HZ2A 1ZGNA 1N25A 2GQMA 1NHYA 2K8SA 2C0GA 2WCIA 2VL3A 1OAZA 3D0ZA 3EC3A 3RHCA 2V41A 5B6MA 1TRUA 5J5NA 3C73A 1B8XA 4KA0A 3IHQA 4OWYA 3TKQA 4K5SA 3APSA 5DJLA 1FW1A 4AI6A 3ED3A 3ZMLA 1H4OA 1PX6A 2OT3A 13GSA 5JWRB 2AAWA 4HDEA 1XOAA 2FCHA 4D73B 1GSEA 3GV1A 4O92A 1PKWA 5IOWA 3U6VA 1MD3A 1GUMA 2P31A 2WVXB 5G5EA 4KGIA 1Y25A 1MDKA 5J47A 3QFBC 5IMZA 1V57A 4Z2TA 4TR0A 1Q4JA 1SK0A 3KMOA 5DQYA 4IS0A 1K3LA 4N0ZA 2VUPA 1SL0B 4YH2A 4Z2UA 4BWQA 2E7PA 3RAZA 3QFAC 4ZIJA 1ERTA 2H6YA 4FIWA 1MDJA 3GFKA 3SWLA 2YWOA 2B5EA 4V2NA 5D8IA 1F9MA 1SJIA 3GHAA 3TUEA 3F9UA 2VL2A 5A1NA 2ALBA 5IOXA 1GH2A 2LSTA 5GAPD 4OMVA 10GSA 2L6CA 4K1FA 3GKXA 2LUSA 3K8NA 1HNCA 5GZZB 4CW9A 3IDVA 1GSUA 2FY6A 1AQVA 4PI2C 2LRNA 3GA4A 4XS4A 2B7KA 3FR3A 3CWGA 3E9JB 3DKSA 5DALB 2C3TA 2HZEA 1V40A 5J4YA 4DSRA 1Z7RA 3NZNA 4POBA 5EL8A 3WGXA 5H5QA 2XBIA 1YEWC 1SJZA 1THXA 5ID2B 2JSYA 4AF2A 2VCVA 3QOUA 4K2XA 4MJCA 3KH7A 1HNAA 4I6XA 3ZVJA 5G1LA 1JLVA 2DJKA 5FWGA 4F0CA 3GIXA 4KF9A 1V98A 5F05A 2V32A 1CQHA 2LRCA 4POMA 1V2AA 2R4VA 4YAPA 3DD3A 2B6MA 2HSNB 4ECCA 5J41A 1WE0A 2AB6A 4PUAA 5E4WA 1TTZA 2AV4A 3IAS2 2N5FA 2E2MA 2PPTA 4MJEA 1DUGA 5E59A 5DBQA 5G30A 1Y1UA 2R6KA 5ELGA 1GULA 2C1YA 3HY2A 2NVLA 1TI1A 3CHXC 4V2LA 1SD9A 4XRAA 2GTUA 2FUG2 4K9ZA 1T4YA 2YNXA 19GSA 2O5VA 2M72A 5ECNB 3VWUA 4GLTA 3GKMA 2CVBA 3VI5A 2DLXA 5A5KA 2O36A 2M80A 2EIRA 2CZ3A 3H4KA 4FXYP 2OE1A 4ACSA 8GSSA 2CA8A 3VURA 2WZSA 3HYPA 3F4TA 2OE0A 5ECQB 3FEUA 1TW9A 4HQSA 2A2RA 5J4UA 3F3QA 4EO3A 1GL8A 5COHA 5ECOB 3L0HA 2NDOA 3HMJG 2RIIA 4KH7A 4ML6A 5F0GA 2J9HA 1KTEA 4X43A 5CAXA 5IMAA 2AHEA 4LMWA 2O89A 2H1LA 1A24A 4TRXA 1AW9A 5F8BA 4WF4A 4E8EA 2HSYA 1J9BA 2DSAA 2PERA 3H79A 4YAVA 4KUNA 3TB2A 1PA3A 1X0RA 2H30A 2VL9A 2C80A 4ZILA 3UVTA 2E0QA 2CZ2A 5GAND 2VD0A 3ISOA 4USSA 3ZLPA 4G2EA 5C04A 1S3DA 2HI7A 2LNSA 1QFNA 2A4HA 2Z9SA 1MD4A 4DSSB 1J0FA 1THOA 2HZFA 1EWXA 4MJAA 2LTKA 4ZBAA 3RHBA 1PL2A 3RDWA 1ZYEA 2GSSA 3WT2A 5D93A 2RM5A 2HXKA 2H1GA 5AIXA 3UIWA 3UVHA 1VF1A 2X64A 2AYTA 4O5UA 4ZL7A 2MMOA 1Z7PA 4IP1A 4AKIA 3W6GA 9GSSA 3KP8A 3OR5A 2L57A 1GUHA 4F82A 1GSFA 2WDUA 2YN1A 1S3CA 2AJQB 3C8EA 5D9VA 1U88A 3NOFA 3TKRA 1NW2A 3F3RA 2YWNA 2DKIA 3VK9A 1DE1A 2X4AA 2MBSA 3CQFA 3QPMA 5JCUA 2H66A 2YV9A 4ML1A 3MIXA 4IJ3A 1XBSA 2VLVA 5AN1A 2HSMB 4CY6A 4ZBDA 1YEXA 1AUCA 2L6DA 3KD0A 2WB9A 4GXZA 1A8LA 1TOFA 3CSHA 1TRSA 1W89A 1EGRA 3HKRA 2TRCP 4MF5A 3HJPA 2OA7A 2HRKB 1O6JA 6GSXA 3ZTLA 2YOIA 3WGDA 1UA5A 2VL2C 3HDCA 2LJKA 3F8UA 4J57E 2FWEA 3HVNA 2YWMA 5D73A 3TRPA 3QMXA 4RI7A 1ST9A 2JADA 4HUAA 2PGTA 2FNOA 1U87A 2PBJA 3EPTA 2V1MA 1KEBA 4XS1A 4OFMA 4DVCA 3LXTA 4XRDA 3LYPA 5DVBA 3DEXA 3R2QA 3RPPA 3VWXA 1YQ1A 5A5HA 3LEFA 4MF7A 5GSTA 3WD6A 1X5EA 4BWSA 4GWRA 3O3TA 5G31A 1YZXA 2GZZA 5B8BA 4ID0A 2DMLA 3O76A 3UL3A 1X5DA 2H8LA 2R0PA 3TRXA 3IBHA 2H70A 5JCGA 4HU7A 4P3YB 4L5OA 2G2QA 2GQLA 3KZQA 5H5RA 2H0GA 5DCHA 3VPQA 3EU3A 2IN3A 1FO5A 4BVYB 5CO3A 1BJXA 1Z6MA 2VOCA 3ZIJA 1M3JA 4WETA 5FHIA 4EIQA 2JZSA 5HR3A 5F07A 3KP9A 4K6XA 3DGQA 4TR1B 2C8UA 3GX0A 4TXOB 4D73A 2YV7A 3HZ4A 1O73A 1R4WA 1ON4A 2VCTA 2MMZA 3CTFA 4WR5A 2CX3A 4BL7A 4JZQA 3DVXA 3FHKA 3LWAA 2IWTA 5DQSA 4YQVA 5CREA 3GX8A 3S9FA 4ZB8A 3F4SA 2DIYA 5LD0A 1S3RA 1GLPA 2EFEA 1U3AA 2QSIA 3KCMA 3PINA 3MDKA 4XIHA 4KW6A 5IO0A 5KEJA 1U6TA 4QL7A 2CQ9A 1ZL9A 2X49A 2CAIA 14GSA 4I8BA 4MA9A 3RFRC 4MDCA 1AAZA 3UOMA 6GSYA 3L4NA 2H76A 2YP6A 1GSYA 5LNKe 2ZCTA 4K8MA 1HD2A 1B48A 2UV8G 1BF5A 2IMFA 4KDYA 3PGTA 1GTAA 2H0HA 2RLIA 11GSA 2TRXA 3TJJA 3D22A 4IBPA 4HU9A 1OC3A 2H19A 4ZB6A 12GSA 4EC0A 4BVXB 1XVQA 1PX7A 2H01A 3D4MA 3QAGA 3ZFLA 4LMVA 4G10A 3KEBA 4GF0A 3ERGA 2LEGA 4JU5A 2BJXA 2HNLA 2OADA 4KAEA 5AGYA 3TCOA 6GSWA 4TR3A 1R26A 2X99A 3GKNA 4FO5A 3I9V2 4NHWA 2R5GA 1URMA 1K0CA 3D6IA 18GSA 3C71A 1LBKA 2HSNA 5KN0A 3EWLA 2YPMA 1OYJA 2REMA 1TDIA 4OO5A 4KE3A 1EP7A 4N3ZA 5ECMB 4G0LA 2K8VA 3FRCA 1AIUA 3DIEA 3F0IA 3M8NA 5LCZA 2DMMA 4WKWA 3DVWA 2XHFA 1FOHA 5BRTA 4RI6A 5HFGA 3A5IA 1GTBA 3DWVA 2JZTA 2C0DA 4FYUA 1M2DA 2PWJA 3Q6OA 3KMNA 2GQKA 3EE2A 4AJ6A 2VD1A 2IIYA 1OC9B 2FWGA 5BMUB 1SU9A 2LKUA 4MZCA 1USBA 1JFUA 3PPUA 2R37A 4TN8A 2GT6A 4NMUA 4G9HA 4GRFA 2WW3A 5ECRB 3V1WA 4EF0A 1XW9A 6GSTA 5CNWA 4IKHA 2RUFA 3ZFBA 1BEDA 5IMFA 1UVZA 1K0NA 2R0GA 1GRXA 2P5QA 4OCFA 5A34B 3G7JA 3ME7A 3SBCA 1SVMA 5A4UA 4GQFA 2GS3A 4PXOA 4MJBA 1X9WB 4EE0A 4KCEA 2MBTA 4N10A 3UJ1A 5INYA 4ZB7A 2O87A 4MPGA 2CV4A 1OE8A 3ZITA 5G5FA 2B1KA 5IM9A 1OKDA 4GQCA 3LFLA 3VWWA 1VGLA 3GH9A 3ZREA 4RQRA 2PN8A 4KCAA 2H71A 3DMLA 2GZPA 4GTUA 1YDKA 4YQUA 3JCML 2CT6A 4IN0A 4X1UA 3TOUA 2GLRA 4EKZA 1S3AA 2L4CA 3TU3B 2IFQA 4V2MA 4O5RA 1JZDA 3FZ4A 2KP1A 2IMDA 2H72A 3Q19A 1X5CA 4F03A 2DBCA 1FHEA 2GSQA 2O7KA 1FG4A 4MABA 1MDIA 1XXUA 5HR1A 2H6ZA 2NTOA 4PQHA 1M9BA 1YKAA 3TKSE 1NM3A 1OKTA 4XCSA 1A23A 4X4JA 2IPAA 4KSMA 3ME8A 1EOHA 5DJMA 5KN2A 4AKXB 4G01A 1XCCA 2HRFA 2VCZA 1AQWA 2IMEA 2EFDA 5HFKA 3BD2A 1YKCA 4F0BA 5J3RA 1M99A 2H0IA 1T00A 2HZEB 3CBUA 4NXIA 3ZRDA 4W66A 3LQ7A 3HA9A 3C1RA 2A2SA 2LJRA 1OVNA 1Y6EA 5KN1A 4QMKA 2YANA 4IVFA 3QCPA 2M46A 4KDXA 2R2JA 1O8XA 4BPYA 1SENA 1EEMA 3FY7A 1G6YA 5ECSA 3IHGA 3HD5A 2B3SA 4QL9A 2KLXA 3CTGA 3EMPA 4TW5A 5ELAA 1O8WA 1QMVA 2DJ2A 1VF3A 3QD9A 4QQ7A 3GL3A 3M1GA 3ZZXA 1YF1A 1WP0A 2XC2A 5CRWA 2I4AA 2RUEA 2FWHA 3VFIA 4I5QA 4J56E 5J9CA 3TJBA 2EFHA 1SVOA 4XTSA 1ERUA 4FYBA 2WZ9A 2MZCA 3TJKA 1V9WA 3ZIVA 4LL1B 4HS1A 5D9TA 1XIYA 2B1LA 5IMVA 2I1UA 5AISA 5ABRA 3A2XA 3J7Yb 1WOUA 2F8FA 3D5JA 3UAPA 2A2PA 2OBKA 2LQQA 1O85A 2H1AA 2F8AA 3FR9A 2WFCA 2MMAA 3A2WA 1X9SB 1SYRA 2ON5A 3IK7A 3MNGA 1Z9HA 2AUVA 3H93A 1QQ2A 2F9SA 3QDNA 3EURA 5HR0A 1T4ZA 1A8YA 3M3MA 4EIPA 5EVOA 1G0TA 3D21A 3US3A 1EEJA 1WWJA 1ZMAA 1VF2A 3FZ9A 3CSIA 4IHUA 3L78A 4MF6A 5B7CA 4BVYA 4ZBBA 4N30A 4OFTA 1BG1A 4PURA 1XW6A 2VLUA 4F9ZA 1U3IA 1JLWA 2I81A 1Z6NA 3HVSA 3W8SA 3N9JA 2O8VB 2JL4A 4CY8A 2WW1A 3MYDA 1KBNA 4HOJA 1QK8A 4HSCX 5CRDA 4ECIA 5CRHA 4Q5RA 4I2TA 3KTBA 1PN0A 2X8GA 1XG8A 2HE3A 2L5OA 1MEKA 2BTOT 2EC4A 2LS5A 3IRAA 2YZUA 3RPNA 5J9BA 3IK9A 3ERWA 1EZKA 4XS6A 2JACA 4ULXA 5F06A 3WGEA 4IELA 1PSQA 4MLYA 4DEJA 4HQZA 3D4TA 3DYRA 5DAKA 2H75A 5B6NA 1T8EB 3IPZA 5DCGA 2YWIA 4Q5NA 4RUVA 2PMTA 3FW2A 4PTSA 1G7OA 1CQGA 5FT3A 4ECBA 1ZYNA 2WULA 3DXBA 2L5LA 2WVZA 1PRXA 5AIVA 2H1DA 4ZL8A 1B4PA 2FHEA 3KIJA 1AXDA 5A4WA 4Q5FA 5J4VA 1TP9A 4ZXGA 2OE3A 2IMKA 4IP6A 1QGVA 3FZAA 4N0VA 3TOTA 4BIKA 5GSSA 1J08A 3L9VA 2LV3A 3G9BA 4J2FA 4N11A 3TJFA 1ZYQB 1GSQA 1ZOFA 3GNJA 4DSQA 2GZYA 2WVXA 3IXRA 4NHZA 3GTUB 4WBJA 3IOSA 2K6VA 2VLTA 4AKGA 3MAKA 3GH6A 4ISDA 2YJHA 3BOAA 3IA1A 3F4RA 4X0XA 2FLSA 1XWCA 3CMIA 1SVLA 3QAVA 4ECJA 22GSA 4KNDA 3TDGA 1RQMA 3N5OA 3TGZA 1G7EA 2GSRA 4HZ4A 1TXXA 3GN3A 4K0GA 3IC8A 4LL4B 1R7HA 4OCEA 4GCIA 3ZYWA 3APOA 3VWVA 1A0RP 1GLQA 4PI0C 4TVEA 1XWAA 3FMWA 2B7JA 2KHPA 1VRSD 1OC9A 5DALA 2CVDA 4MK3A 1R5PA 1T3BA 5BMUA 5A5HB 4HJMA 3VI7A 3LSZA 4EDZA 1K0BA 4TKYA 2OACA 3IAM2 1EV9A 2GDRA 2HLSA 3GKKA 1IYHA 2XBQA 1NHOA 4NV2A 2VM1A 3HXSA 20GSA 4YQMA 5ID2A 1Z3EA 1XW5A 1SL1B 4GSNA 1GNWA 2HYXA 2R0CA 3O6TA 2LNTA 1XPVA 3TJGA 2FD3A 5D96A 5A34A 4PQ1A 4JR6A 1GP1A 4Z2RA 1R5AA 2F3MA 4V1Ap 1EP8A 1T7PB 2ZNMA 4E8HA 4OO4A 1EOGA 2YCDA 1GTUA 2ON7A 3WYWA 5IIZA 2WJUA 4EVMA 1A2JA 1PD21 1PMTA 4V1Ag 2DJ0A 4LLRA 3MSZA 4A5PA 4BL7B 1TKDB 3J7Yk 5IQYA 2E2GA 3UMAA 1OE7A 4I2UA 1FB0A 3ZL5A 1SYXA 1ERWA 1ILOA 1XWKA 1RK4A 1DBYA 3E0UA 4O32A 4POKA 4L0WA 1FAAA 1A0FA 2QA2A 3LJRA 1M7TA 4E68A 1PKZA 3GSTA 3GSSA 2X8CA 2HSHA 3MWHA 16GSA 3LYKA 1O7UA 1A2MA 2VAFA 2D2ZA 1BYEA 5ECHB 2ES7A 1K0DA 5H5SA 3I69A 2O3EA 2H74A 3TKPA 1SL2B 6GSSA 3CYNA 4O7HA 1VF4A 1Q98A 3HHVA 4OD7A 1AQXA 3I43A 1JZWA 3ZMKA 1SK1A 3U5RE 4PHZC 1ZCPA 1UN2A 1YF0A 3FYGA 2KP2A 1F37A 3TKSA 4NV5A 2C3NA 3IV4A 3P90A 1ZYPA 4PGTA 2DKHA 2PVOC 2VCWA 1K0OA 3APQA 3BJ5A 1PL1A 2CX4A 1I5GA 1TU7A 1HYUA 1K0AA 4K7NA 4PNGA 1F3BA 1XWBA 2LQOA 4WEYA 1XFLA 1M2AA 5CRGA 5J40A 4EDYA 1H75A 4DSSA 5ENUA 3Q18A 1WMJA 1TK0B 5IMDA 2WW2A 4NPBA 3GMFA 3P7XA 3P8WA 2WGRA 2QA1A 4JEDA 3IE3A 1S4BP 4G0KA 4NAXA 4K0NA 2KUCA 2X8HA 4PX1A 1NSWA 5JWQB 4TR4A 1XVWA 3M9JA 4MH2A 3UBKA 2PU9C 1T1VA 5CYYA 5A1NB 4EL1A 1TRWA 1GTIA 1YY7A 3UARA 2HT9A 1M0UA 1K3OA 1FVJA 2A4VA 5ECKB 2I3YA 1W4VA 1WIKA 3QAWA 1DE2A 2FA4A 2GSTA 3FKFA 1HQOA 5A4VA 3A3TA 2I9HA 1K3YA 1F2EA 4XS4B 1N8JA 1MTCA 4GSSA 4AGSA 1V58A 1AC1A 2F51A 2HSMA 4L0UA 3AY8A 1BG5A 1K0MA 2GGTA 5HR2A 4ICYA 1DSBA 3L9SA 3KH9A 2FA8A 1I9DA 1B4QA 2IL3A 5DDLA 1B9XC 5KN3A 5HFIA 3KJYA 2QC7A 3Q74A 4ZL9A 2HRKA 2P0GA 1TXUA 3KM6A 4PNFA 1ML6A 1BQ7A 2RM6A 4PQIA 3EINA 1TU8A 3PH9A 4EXJA 1PQNA 3FZ5A 3KXOA 4JE1A 3ZVJD 1GSSA 3KTLA 2PUKC 3IR4A 1F6MC 2DJ1A 2L59A 3BCIA 2C3QA 4I97A 1WRYA 4H86A 3RBTA 4CDOA 4TOPA 2B5YA 4MNNA 5EPFA 2EFCA 2ZUPA 5KOWA 3EU4A 2KOKA 3HJOA 2BMXA 4L8EA 2VM2A 1PN9A
chains in the Genus database with same CATH topology
4K5RA 3VPTA 2UZ8A 2HRAA 1QUWA 4ZB9A 3CRUA 4GSTA 1TK5B 1F3AA 5L71A 4BA7A 3DRNA 5HQPA 2EIQA 2JU5A 1KNGA 2OJLA 2NPBA 6GSVA 1M9AA 2HRNA 4KSOA 3M9KA 2IFQB 2JSZA 1JZOA 4EUYA 3I6AA 4IQ1A 4WXTA 5IPGA 3UBLA 2QKEA 1ABAA 5JWOB 4L5LA 1ERVA 3GRXA 2VO4A 2IJYA 4FQUA 1TRVA 4WF5A 4JBBA 5CP1A 4HI7A 3EVIA 1IYIA 3F6FA 4MZWA 2H6XA 4O5QA 1QXHA 2IMIA 1JHBA 4MP4A 3IC4A 2GVPA 5IO2A 1Z5YE 3M0FA 2H1BA 3CRTA 2B5XA 3HZ8A 3E3EA 2K18A 2DJ3A 4RQXA 4Z7XA 3HVXA 5C00A 4TR1A 1SKWB 4AKHA 4TXOA 3KGKA 1EV4A 2C0EA 4WR4A 4YKFA 4K2DA 1ACVA 4NWYA 3HJMA 4KB3A 3GTUA 2WRTA 2VCXA 1TJDA 4K7IA 3UEMA 3QR6A 1SJ6A 2G0FA 2QGVA 2OBIA 5ECIB 1BX9A 1UC7A 2R3XA 4FH8A 2C0FA 1JZRA 2TIRA 2NBSA 3GL5A 4MMMA 1X9MB 5G2ZA 3LGCA 17GSA 3C1SA 1XWGA 1SKRB 5ECPB 5D9XA 3A5WA 2VCQA 1HNBA 1LU4A 3PR8A 3GUSA 3G7IA 3NIVA 3R3EA 4PUFC 4FYCA 1EGOA 1FOVA 2C4JA 3P2AA 5EY6A 2PVQA 1YJ6A 1XOBA 3HCZA 2DIZA 2N5BA 1B9YC 1WPIA 2FGXA 3ERFA 3TKSC 4WBRD 1BAYA 2V6KA 1SD8A 3GURA 4G0IA 3VLNA 2CAQA 4HEA2 3FK8A 4KDUA 1SKSB 3H1NA 3LW9A 4BVXA 4KX4A 1M2BA 4ILFA 3LORA 2VIMA 4G19A 1YEPA 1FB6A 3FR6A 2JZRA 1C72A 4JR4A 5IPHA 3CSJA 1E2YA 4GDFA 2VKZG 4MCUA 3EYTA 3H8QA 1A2LA 3L9UA 2FWFA 5IMCA 2GT5A 2WS2A 4OFNA 1ZZYA 1O81A 4IGJA 1FVKA 2N5AA 1E6BA 5JCWA 3LXZA 2HQTA 1YVLA 1RW1A 5D9WA 2P5RA 2J23A 2HFDA 4HJ2A 1TI3A 5G1KA 3LG6A 2MMNA 1G6WA 2XPEA 2DJJA 2LJAA 2YJ7A 4MZBA 2OKAA 4LA1A 1N2AA 1LJRA 3F63A 4IJIA 3C7MA 1GWCA 3WT1A 4F2IA 3BBYA 4MH3A 3TRQA 1WJKA 4K7OA 2K9FA 5ECLB 4AJ7A 1XZOA 2DC5A 2XPDA 1PGTA 2EIOA 3G7YA 4IQAA 4Q5QA 2L4QA 4YKGA 4POLA 4AJ8A 3GYKA 2V2GA 3A2VA 2MYGA 1GUKA 4JRRA 3W8JA 2LRTA 4TXVA 5DAKB 1TK8B 4MPFA 1GSDA 3CXGA 2O85A 6GSUA 3HVVA 4CHSA 2CVKA 1OC8A 2V6OA 5KOXA 3F6DA 3EMXA 3BCKA 7GSSA 2H73A 5B8AA 2YZHA 1SK2A 4IW9A 4XHMA 1GNEA 4HZ2A 1ZGNA 1N25A 2GQMA 1NHYA 2K8SA 2C0GA 2WCIA 2VL3A 1OAZA 3D0ZA 3EC3A 3RHCA 2V41A 5B6MA 1TRUA 5J5NA 3C73A 1B8XA 4KA0A 3IHQA 4OWYA 3TKQA 4K5SA 3APSA 5DJLA 1FW1A 4AI6A 3ED3A 3ZMLA 1H4OA 1PX6A 2OT3A 13GSA 5JWRB 2AAWA 4HDEA 1XOAA 2FCHA 4D73B 1GSEA 3GV1A 4O92A 1PKWA 5IOWA 3U6VA 1MD3A 1GUMA 2P31A 5G5EA 4KGIA 1Y25A 1MDKA 5J47A 3QFBC 5IMZA 1V57A 4Z2TA 4TR0A 1Q4JA 1SK0A 3KMOA 5DQYA 4IS0A 1K3LA 4N0ZA 2VUPA 1SL0B 4YH2A 4Z2UA 4BWQA 2E7PA 3RAZA 3QFAC 4ZIJA 1ERTA 2H6YA 4FIWA 1MDJA 3GFKA 3SWLA 2YWOA 2B5EA 4V2NA 5D8IA 1F9MA 1SJIA 3GHAA 3TUEA 3F9UA 2VL2A 5A1NA 2ALBA 5IOXA 1GH2A 2LSTA 5GAPD 4OMVA 10GSA 2L6CA 4K1FA 3GKXA 2LUSA 3K8NA 1HNCA 5GZZB 4CW9A 3IDVA 1GSUA 2FY6A 1AQVA 2LRNA 3GA4A 4XS4A 2B7KA 3FR3A 3CWGA 3E9JB 3DKSA 5DALB 2C3TA 2HZEA 1V40A 5J4YA 4DSRA 1Z7RA 3NZNA 4POBA 5EL8A 3WGXA 5H5QA 2XBIA 1SJZA 1THXA 5ID2B 2JSYA 4AF2A 2VCVA 3QOUA 4K2XA 4MJCA 3KH7A 1HNAA 4I6XA 3ZVJA 5G1LA 1JLVA 2DJKA 5FWGA 4F0CA 3GIXA 4KF9A 1V98A 5F05A 2V32A 1CQHA 2LRCA 4POMA 1V2AA 2R4VA 4YAPA 3DD3A 2B6MA 2HSNB 4ECCA 5J41A 1WE0A 2AB6A 4PUAA 5E4WA 1TTZA 2AV4A 3IAS2 2N5FA 2E2MA 2PPTA 4MJEA 1DUGA 5E59A 5DBQA 5G30A 1Y1UA 2R6KA 5ELGA 1GULA 2C1YA 3HY2A 2NVLA 1TI1A 4V2LA 1SD9A 4XRAA 2GTUA 2FUG2 4K9ZA 1T4YA 2YNXA 19GSA 2O5VA 2M72A 5ECNB 3VWUA 4GLTA 3GKMA 2CVBA 3VI5A 2DLXA 5A5KA 2M80A 2EIRA 2CZ3A 3H4KA 2OE1A 4ACSA 8GSSA 2CA8A 3VURA 3HYPA 3F4TA 2OE0A 5ECQB 3FEUA 1TW9A 4HQSA 2A2RA 5J4UA 3F3QA 4EO3A 1GL8A 5COHA 5ECOB 3L0HA 2NDOA 3HMJG 2RIIA 4KH7A 4ML6A 5F0GA 2J9HA 1KTEA 4X43A 5CAXA 5IMAA 2AHEA 4LMWA 2O89A 2H1LA 1A24A 4TRXA 1AW9A 5F8BA 4WF4A 4E8EA 2HSYA 1J9BA 2DSAA 2PERA 3H79A 4YAVA 4KUNA 3TB2A 1PA3A 1X0RA 2H30A 2VL9A 2C80A 4ZILA 3UVTA 2E0QA 2CZ2A 5GAND 2VD0A 3ISOA 4USSA 3ZLPA 4G2EA 5C04A 1S3DA 2HI7A 2LNSA 1QFNA 2A4HA 2Z9SA 1MD4A 4DSSB 1J0FA 1THOA 2HZFA 1EWXA 4MJAA 2LTKA 4ZBAA 3RHBA 1PL2A 3RDWA 1ZYEA 2GSSA 3WT2A 5D93A 2RM5A 2HXKA 2H1GA 5AIXA 3UIWA 3UVHA 1VF1A 2X64A 2AYTA 4O5UA 4ZL7A 2MMOA 1Z7PA 4IP1A 4AKIA 3W6GA 9GSSA 3KP8A 3OR5A 2L57A 1GUHA 4F82A 1GSFA 2WDUA 2YN1A 1S3CA 2AJQB 3C8EA 5D9VA 1U88A 3NOFA 3TKRA 1NW2A 3F3RA 2YWNA 2DKIA 3VK9A 1DE1A 2X4AA 2MBSA 3QPMA 5JCUA 2H66A 2YV9A 4ML1A 3MIXA 4IJ3A 1XBSA 2VLVA 5AN1A 2HSMB 4CY6A 4ZBDA 1YEXA 1AUCA 2L6DA 3KD0A 2WB9A 4GXZA 1A8LA 1TOFA 3CSHA 1TRSA 1W89A 1EGRA 3HKRA 2TRCP 4MF5A 3HJPA 2OA7A 2HRKB 1O6JA 6GSXA 3ZTLA 2YOIA 3WGDA 1UA5A 2VL2C 3HDCA 2LJKA 3F8UA 4J57E 2FWEA 2YWMA 5D73A 3TRPA 3QMXA 4RI7A 1ST9A 2JADA 4HUAA 2PGTA 2FNOA 1U87A 2PBJA 3EPTA 2V1MA 1KEBA 4XS1A 4OFMA 4DVCA 3LXTA 4XRDA 3LYPA 5DVBA 3DEXA 3R2QA 3RPPA 3VWXA 1YQ1A 5A5HA 3LEFA 4MF7A 5GSTA 3WD6A 1X5EA 4BWSA 4GWRA 3O3TA 5G31A 1YZXA 2GZZA 5B8BA 4ID0A 2DMLA 3O76A 3UL3A 1X5DA 2H8LA 2R0PA 3TRXA 3IBHA 2H70A 5JCGA 4HU7A 4P3YB 4L5OA 2G2QA 2GQLA 3KZQA 5H5RA 2H0GA 5DCHA 3VPQA 3EU3A 2IN3A 1FO5A 4BVYB 5CO3A 1BJXA 1Z6MA 2VOCA 3ZIJA 4WETA 5FHIA 4EIQA 2JZSA 5HR3A 5F07A 3KP9A 4K6XA 3DGQA 4TR1B 2C8UA 3GX0A 4TXOB 4D73A 2YV7A 3HZ4A 1O73A 1R4WA 1ON4A 2VCTA 2MMZA 3CTFA 4WR5A 2CX3A 4BL7A 4JZQA 3DVXA 3FHKA 3LWAA 2IWTA 5DQSA 4YQVA 5CREA 3GX8A 3S9FA 4ZB8A 3F4SA 2DIYA 5LD0A 1GLPA 2EFEA 1U3AA 2QSIA 3KCMA 3PINA 3MDKA 4XIHA 4KW6A 5IO0A 5KEJA 1U6TA 4QL7A 2CQ9A 1ZL9A 2X49A 2CAIA 14GSA 4I8BA 4MA9A 4MDCA 1AAZA 3UOMA 6GSYA 3L4NA 2H76A 2YP6A 1GSYA 5LNKe 2ZCTA 4K8MA 1HD2A 1B48A 2UV8G 1BF5A 2IMFA 4KDYA 3PGTA 1GTAA 2H0HA 2RLIA 11GSA 2TRXA 3TJJA 3D22A 4IBPA 4HU9A 1OC3A 2H19A 4ZB6A 12GSA 4EC0A 4BVXB 1XVQA 1PX7A 2H01A 3D4MA 3QAGA 3ZFLA 4LMVA 4G10A 3KEBA 4GF0A 3ERGA 2LEGA 4JU5A 2BJXA 2HNLA 2OADA 4KAEA 5AGYA 3TCOA 6GSWA 4TR3A 1R26A 2X99A 3GKNA 4FO5A 3I9V2 4NHWA 2R5GA 1URMA 1K0CA 3D6IA 18GSA 3C71A 1LBKA 2HSNA 5KN0A 3EWLA 2YPMA 1OYJA 2REMA 1TDIA 4OO5A 4KE3A 1EP7A 4N3ZA 5ECMB 4G0LA 2K8VA 3FRCA 1AIUA 3DIEA 3F0IA 3M8NA 5LCZA 2DMMA 4WKWA 3DVWA 2XHFA 1FOHA 5BRTA 4RI6A 5HFGA 3A5IA 1GTBA 3DWVA 2JZTA 2C0DA 4FYUA 1M2DA 2PWJA 3Q6OA 3KMNA 2GQKA 3EE2A 4AJ6A 2VD1A 2IIYA 1OC9B 2FWGA 5BMUB 1SU9A 2LKUA 4MZCA 1USBA 1JFUA 3PPUA 2R37A 4TN8A 2GT6A 4NMUA 4G9HA 4GRFA 5ECRB 3V1WA 4EF0A 1XW9A 6GSTA 5CNWA 4IKHA 2RUFA 3ZFBA 1BEDA 5IMFA 1UVZA 1K0NA 2R0GA 1GRXA 2P5QA 4OCFA 5A34B 3G7JA 3ME7A 3SBCA 1SVMA 5A4UA 4GQFA 2GS3A 4PXOA 4MJBA 1X9WB 4EE0A 4KCEA 2MBTA 4N10A 3UJ1A 5INYA 4ZB7A 2O87A 4MPGA 2CV4A 1OE8A 3ZITA 5G5FA 2B1KA 5IM9A 1OKDA 4GQCA 3LFLA 3VWWA 1VGLA 3GH9A 3ZREA 4RQRA 2PN8A 4KCAA 2H71A 3DMLA 2GZPA 4GTUA 1YDKA 4YQUA 3JCML 2CT6A 4IN0A 4X1UA 3TOUA 2GLRA 4EKZA 1S3AA 2L4CA 3TU3B 2IFQA 4V2MA 4O5RA 1JZDA 3FZ4A 2KP1A 2IMDA 2H72A 3Q19A 1X5CA 4F03A 2DBCA 1FHEA 2GSQA 2O7KA 1FG4A 4MABA 1MDIA 1XXUA 5HR1A 2H6ZA 2NTOA 4PQHA 1M9BA 1YKAA 3TKSE 1NM3A 1OKTA 4XCSA 1A23A 4X4JA 2IPAA 4KSMA 3ME8A 1EOHA 5DJMA 5KN2A 4AKXB 4G01A 1XCCA 2HRFA 2VCZA 1AQWA 2IMEA 2EFDA 5HFKA 3BD2A 1YKCA 4F0BA 5J3RA 1M99A 2H0IA 1T00A 2HZEB 3CBUA 4NXIA 3ZRDA 4W66A 3LQ7A 3HA9A 3C1RA 2A2SA 2LJRA 1OVNA 1Y6EA 5KN1A 4QMKA 2YANA 4IVFA 3QCPA 2M46A 4KDXA 2R2JA 1O8XA 4BPYA 1SENA 1EEMA 3FY7A 1G6YA 5ECSA 3IHGA 3HD5A 2B3SA 4QL9A 2KLXA 3CTGA 3EMPA 4TW5A 5ELAA 1O8WA 1QMVA 2DJ2A 1VF3A 3QD9A 4QQ7A 3GL3A 3M1GA 3ZZXA 1YF1A 1WP0A 2XC2A 5CRWA 2I4AA 2RUEA 2FWHA 3VFIA 4I5QA 4J56E 5J9CA 3TJBA 2EFHA 1SVOA 4XTSA 1ERUA 4FYBA 2WZ9A 2MZCA 3TJKA 1V9WA 3ZIVA 4LL1B 4HS1A 5D9TA 1XIYA 2B1LA 5IMVA 2I1UA 5AISA 5ABRA 3A2XA 3J7Yb 1WOUA 2F8FA 3D5JA 3UAPA 2A2PA 2OBKA 2LQQA 1O85A 2H1AA 2F8AA 3FR9A 2WFCA 2MMAA 3A2WA 1X9SB 1SYRA 2ON5A 3IK7A 3MNGA 1Z9HA 2AUVA 3H93A 1QQ2A 2F9SA 3QDNA 3EURA 5HR0A 1T4ZA 1A8YA 3M3MA 4EIPA 5EVOA 1G0TA 3D21A 3US3A 1EEJA 1WWJA 1ZMAA 1VF2A 3FZ9A 3CSIA 4IHUA 3L78A 4MF6A 5B7CA 4BVYA 4ZBBA 4N30A 4OFTA 1BG1A 4PURA 1XW6A 2VLUA 4F9ZA 1U3IA 1JLWA 2I81A 1Z6NA 3HVSA 3W8SA 3N9JA 2O8VB 2JL4A 4CY8A 3MYDA 1KBNA 4HOJA 1QK8A 5CRDA 4ECIA 5CRHA 4Q5RA 4I2TA 3KTBA 1PN0A 2X8GA 2HE3A 2L5OA 1MEKA 2BTOT 2EC4A 2LS5A 3IRAA 2YZUA 3RPNA 5J9BA 3IK9A 3ERWA 1EZKA 4XS6A 2JACA 4ULXA 5F06A 3WGEA 4IELA 1PSQA 4MLYA 4DEJA 4HQZA 3D4TA 3DYRA 5DAKA 2H75A 5B6NA 1T8EB 3IPZA 5DCGA 2YWIA 4Q5NA 4RUVA 2PMTA 3FW2A 4PTSA 1G7OA 1CQGA 5FT3A 4ECBA 1ZYNA 2WULA 3DXBA 2L5LA 1PRXA 5AIVA 2H1DA 4ZL8A 1B4PA 2FHEA 3KIJA 1AXDA 5A4WA 4Q5FA 5J4VA 1TP9A 4ZXGA 2OE3A 2IMKA 4IP6A 1QGVA 3FZAA 4N0VA 3TOTA 5GSSA 1J08A 3L9VA 2LV3A 3G9BA 4J2FA 4N11A 3TJFA 1ZYQB 1GSQA 1ZOFA 3GNJA 4DSQA 2GZYA 3IXRA 4NHZA 3GTUB 4WBJA 3IOSA 2K6VA 2VLTA 4AKGA 3MAKA 3GH6A 4ISDA 2YJHA 3BOAA 3IA1A 3F4RA 4X0XA 2FLSA 1XWCA 3CMIA 1SVLA 3QAVA 4ECJA 22GSA 4KNDA 3TDGA 1RQMA 3N5OA 3TGZA 1G7EA 2GSRA 4HZ4A 1TXXA 3GN3A 4K0GA 3IC8A 4LL4B 1R7HA 4OCEA 4GCIA 3ZYWA 3APOA 3VWVA 1A0RP 1GLQA 4TVEA 1XWAA 3FMWA 2B7JA 2KHPA 1VRSD 1OC9A 5DALA 2CVDA 4MK3A 1R5PA 1T3BA 5BMUA 5A5HB 4HJMA 3VI7A 3LSZA 4EDZA 1K0BA 4TKYA 2OACA 3IAM2 1EV9A 2GDRA 2HLSA 3GKKA 1IYHA 2XBQA 1NHOA 4NV2A 2VM1A 3HXSA 20GSA 4YQMA 5ID2A 1Z3EA 1XW5A 1SL1B 4GSNA 1GNWA 2HYXA 2R0CA 3O6TA 2LNTA 1XPVA 3TJGA 2FD3A 5D96A 5A34A 4PQ1A 4JR6A 1GP1A 4Z2RA 1R5AA 2F3MA 4V1Ap 1EP8A 1T7PB 2ZNMA 4E8HA 4OO4A 1EOGA 2YCDA 1GTUA 2ON7A 3WYWA 5IIZA 2WJUA 4EVMA 1A2JA 1PD21 1PMTA 4V1Ag 2DJ0A 4LLRA 3MSZA 4A5PA 4BL7B 1TKDB 3J7Yk 5IQYA 2E2GA 3UMAA 1OE7A 4I2UA 1FB0A 3ZL5A 1SYXA 1ERWA 1ILOA 1XWKA 1RK4A 1DBYA 3E0UA 4O32A 4POKA 4L0WA 1FAAA 1A0FA 2QA2A 3LJRA 1M7TA 4E68A 1PKZA 3GSTA 3GSSA 2X8CA 2HSHA 3MWHA 16GSA 3LYKA 1O7UA 1A2MA 2VAFA 2D2ZA 1BYEA 5ECHB 2ES7A 1K0DA 5H5SA 3I69A 2H74A 3TKPA 1SL2B 6GSSA 3CYNA 4O7HA 1VF4A 1Q98A 3HHVA 4OD7A 1AQXA 3I43A 1JZWA 3ZMKA 1SK1A 3U5RE 1ZCPA 1UN2A 1YF0A 3FYGA 2KP2A 1F37A 3TKSA 4NV5A 2C3NA 3IV4A 3P90A 1ZYPA 4PGTA 2DKHA 2PVOC 2VCWA 1K0OA 3APQA 3BJ5A 1PL1A 2CX4A 1I5GA 1TU7A 1HYUA 1K0AA 4K7NA 4PNGA 1F3BA 1XWBA 2LQOA 4WEYA 1XFLA 1M2AA 5CRGA 5J40A 4EDYA 1H75A 4DSSA 5ENUA 3Q18A 1WMJA 1TK0B 5IMDA 4NPBA 3GMFA 3P7XA 3P8WA 2WGRA 2QA1A 4JEDA 3IE3A 4G0KA 4NAXA 4K0NA 2KUCA 2X8HA 4PX1A 1NSWA 5JWQB 4TR4A 1XVWA 3M9JA 4MH2A 3UBKA 2PU9C 1T1VA 5CYYA 5A1NB 4EL1A 1TRWA 1GTIA 1YY7A 3UARA 2HT9A 1M0UA 1K3OA 1FVJA 2A4VA 5ECKB 2I3YA 1W4VA 1WIKA 3QAWA 1DE2A 2FA4A 2GSTA 3FKFA 1HQOA 5A4VA 3A3TA 2I9HA 1K3YA 1F2EA 4XS4B 1N8JA 1MTCA 4GSSA 4AGSA 1V58A 1AC1A 2F51A 2HSMA 4L0UA 3AY8A 1BG5A 1K0MA 2GGTA 5HR2A 4ICYA 1DSBA 3L9SA 3KH9A 2FA8A 1I9DA 1B4QA 2IL3A 5DDLA 1B9XC 5KN3A 5HFIA 3KJYA 2QC7A 3Q74A 4ZL9A 2HRKA 2P0GA 1TXUA 3KM6A 4PNFA 1ML6A 1BQ7A 2RM6A 4PQIA 3EINA 1TU8A 3PH9A 4EXJA 1PQNA 3FZ5A 3KXOA 4JE1A 3ZVJD 1GSSA 3KTLA 2PUKC 3IR4A 1F6MC 2DJ1A 2L59A 3BCIA 2C3QA 4I97A 1WRYA 4H86A 3RBTA 4CDOA 4TOPA 2B5YA 4MNNA 5EPFA 2EFCA 2ZUPA 5KOWA 3EU4A 2KOKA 3HJOA 2BMXA 4L8EA 2VM2A 1PN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPT A;  2UZ8 A;  2HRA A;  1QUW A;  4ZB9 A;  3CRU A;  4GST A;  1TK5 B;  1F3A A;  5L71 A;  4BA7 A;  3DRN A;  5HQP A;  2EIQ A;  2JU5 A;  1KNG A;  2OJL A;  2NPB A;  6GSV A;  1M9A A;  2HRN A;  4KSO A;  3M9K A;  2IFQ B;  2JSZ A;  1JZO A;  4EUY A;  3I6A A;  4IQ1 A;  4WXT A;  5IPG A;  3UBL A;  2QKE A;  1ABA A;  5JWO B;  4L5L A;  1ERV A;  3GRX A;  2VO4 A;  2IJY A;  4FQU A;  1TRV A;  4WF5 A;  4JBB A;  5CP1 A;  4HI7 A;  3EVI A;  1IYI A;  3F6F A;  4MZW A;  2H6X A;  1QXH A;  2IMI A;  1JHB A;  4MP4 A;  3IC4 A;  2GVP A;  5IO2 A;  1Z5Y E;  3M0F A;  2H1B A;  3CRT A;  2B5X A;  3HZ8 A;  3E3E A;  2K18 A;  2DJ3 A;  4RQX A;  4Z7X A;  3HVX A;  5C00 A;  4TR1 A;  1SKW B;  4TXO A;  3KGK A;  1EV4 A;  2C0E A;  4WR4 A;  4K2D A;  1ACV A;  4NWY A;  3HJM A;  4KB3 A;  3GTU A;  2WRT A;  2VCX A;  1TJD A;  4K7I A;  3UEM A;  3QR6 A;  1SJ6 A;  2G0F A;  2QGV A;  2OBI A;  5ECI B;  1BX9 A;  1UC7 A;  2R3X A;  4FH8 A;  2C0F A;  1JZR A;  2TIR A;  2NBS A;  3GL5 A;  4MMM A;  1X9M B;  5G2Z A;  3LGC A;  17GS A;  3C1S A;  1XWG A;  1SKR B;  5ECP B;  5D9X A;  3A5W A;  2VCQ A;  1HNB A;  1LU4 A;  3PR8 A;  3GUS A;  3G7I A;  3NIV A;  3R3E A;  4PUF C;  4FYC A;  1EGO A;  1FOV A;  2C4J A;  3P2A A;  5EY6 A;  2PVQ A;  1YJ6 A;  1XOB A;  2DIZ A;  2N5B A;  3HCZ A;  1B9Y C;  1WPI A;  2FGX A;  3ERF A;  3TKS C;  4WBR D;  1BAY A;  2V6K A;  1SD8 A;  3GUR A;  4G0I A;  3VLN A;  2CAQ A;  4HEA 2;  3FK8 A;  4KDU A;  1SKS B;  3H1N A;  4BVX A;  4KX4 A;  1M2B A;  4ILF A;  3LOR A;  2VIM A;  4G19 A;  1YEP A;  1FB6 A;  3FR6 A;  2JZR A;  1C72 A;  4JR4 A;  5IPH A;  3CSJ A;  1E2Y A;  4MCU A;  3EYT A;  3H8Q A;  1A2L A;  3L9U A;  2FWF A;  5IMC A;  2GT5 A;  2WS2 A;  4OFN A;  1ZZY A;  1O81 A;  4IGJ A;  1FVK A;  2N5A A;  1E6B A;  5JCW A;  3LXZ A;  2HQT A;  1RW1 A;  5D9W A;  2P5R A;  2J23 A;  2HFD A;  4HJ2 A;  1TI3 A;  5G1K A;  3LG6 A;  2MMN A;  1G6W A;  2XPE A;  2DJJ A;  2LJA A;  2YJ7 A;  4MZB A;  2OKA A;  4LA1 A;  1N2A A;  1LJR A;  3F63 A;  4IJI A;  3C7M A;  1GWC A;  3WT1 A;  4F2I A;  3BBY A;  4MH3 A;  3TRQ A;  1WJK A;  4K7O A;  2K9F A;  5ECL B;  4AJ7 A;  1XZO A;  2DC5 A;  2XPD A;  1PGT A;  2EIO A;  3G7Y A;  4IQA A;  4Q5Q A;  2L4Q A;  4POL A;  4AJ8 A;  3GYK A;  2V2G A;  3A2V A;  2MYG A;  1GUK A;  4JRR A;  3W8J A;  2LRT A;  4TXV A;  5DAK B;  1TK8 B;  4MPF A;  1GSD A;  3CXG A;  2O85 A;  6GSU A;  3HVV A;  4CHS A;  2CVK A;  1OC8 A;  2V6O A;  3F6D A;  3EMX A;  3BCK A;  7GSS A;  2H73 A;  5B8A A;  2YZH A;  1SK2 A;  4IW9 A;  4XHM A;  1GNE A;  4HZ2 A;  1ZGN A;  2GQM A;  1NHY A;  2K8S A;  2C0G A;  2WCI A;  2VL3 A;  1OAZ A;  3D0Z A;  3EC3 A;  3RHC A;  2V41 A;  5B6M A;  1TRU A;  5J5N A;  3C73 A;  1B8X A;  4KA0 A;  3IHQ A;  4OWY A;  3TKQ A;  3APS A;  5DJL A;  1FW1 A;  3ED3 A;  3ZML A;  1H4O A;  1PX6 A;  13GS A;  5JWR B;  2AAW A;  4HDE A;  1XOA A;  2FCH A;  4D73 B;  1GSE A;  3GV1 A;  4O92 A;  1PKW A;  5IOW A;  3U6V A;  1MD3 A;  1GUM A;  2P31 A;  5G5E A;  4KGI A;  1Y25 A;  1MDK A;  3QFB C;  5IMZ A;  1V57 A;  4TR0 A;  1Q4J A;  1SK0 A;  3KMO A;  5DQY A;  4IS0 A;  1K3L A;  4N0Z A;  2VUP A;  1SL0 B;  4YH2 A;  4BWQ A;  2E7P A;  3RAZ A;  3QFA C;  4ZIJ A;  1ERT A;  2H6Y A;  4FIW A;  1MDJ A;  3GFK A;  3SWL A;  2YWO A;  2B5E A;  4V2N A;  5D8I A;  1F9M A;  1SJI A;  3GHA A;  3TUE A;  3F9U A;  2VL2 A;  2ALB A;  5IOX A;  1GH2 A;  2LST A;  5GAP D;  4OMV A;  10GS A;  2L6C A;  4K1F A;  3GKX A;  2LUS A;  3K8N A;  1HNC A;  5GZZ B;  4CW9 A;  3IDV A;  1GSU A;  2FY6 A;  1AQV A;  2LRN A;  3GA4 A;  4XS4 A;  2B7K A;  3FR3 A;  3E9J B;  3DKS A;  5DAL B;  2C3T A;  2HZE A;  1V40 A;  4DSR A;  1Z7R A;  3NZN A;  4POB A;  5EL8 A;  3WGX A;  5H5Q A;  2XBI A;  1SJZ A;  1THX A;  5ID2 B;  2JSY A;  4AF2 A;  2VCV A;  3QOU A;  4MJC A;  3KH7 A;  1HNA A;  4I6X A;  3ZVJ A;  5G1L A;  1JLV A;  2DJK A;  5FWG A;  4F0C A;  3GIX A;  4KF9 A;  1V98 A;  5F05 A;  2V32 A;  1CQH A;  2LRC A;  4POM A;  1V2A A;  2R4V A;  4YAP A;  3DD3 A;  2B6M A;  2HSN B;  4ECC A;  5J41 A;  1WE0 A;  2AB6 A;  4PUA A;  5E4W A;  1TTZ A;  2AV4 A;  3IAS 2;  2N5F A;  2E2M A;  2PPT A;  4MJE A;  1DUG A;  5E59 A;  5DBQ A;  5G30 A;  2R6K A;  5ELG A;  1GUL A;  2C1Y A;  3HY2 A;  2NVL A;  1TI1 A;  4V2L A;  1SD9 A;  4XRA A;  2GTU A;  2FUG 2;  4K9Z A;  1T4Y A;  2YNX A;  19GS A;  2M72 A;  5ECN B;  3VWU A;  4GLT A;  3GKM A;  2CVB A;  3VI5 A;  2DLX A;  5A5K A;  2M80 A;  2EIR A;  2CZ3 A;  3H4K A;  2OE1 A;  4ACS A;  8GSS A;  2CA8 A;  3VUR A;  3HYP A;  3F4T A;  2OE0 A;  5ECQ B;  3FEU A;  1TW9 A;  4HQS A;  2A2R A;  5J4U A;  3F3Q A;  4EO3 A;  1GL8 A;  5COH A;  5ECO B;  3L0H A;  2NDO A;  2RII A;  4KH7 A;  4ML6 A;  5F0G A;  2J9H A;  1KTE A;  4X43 A;  5CAX A;  5IMA A;  2AHE A;  4LMW A;  2O89 A;  1A24 A;  4TRX A;  1AW9 A;  5F8B A;  4WF4 A;  4E8E A;  2HSY A;  1J9B A;  2DSA A;  2PER A;  3H79 A;  4YAV A;  4KUN A;  3TB2 A;  1PA3 A;  1X0R A;  2H30 A;  2VL9 A;  2C80 A;  4ZIL A;  3UVT A;  2E0Q A;  2CZ2 A;  5GAN D;  2VD0 A;  3ISO A;  4USS A;  3ZLP A;  4G2E A;  5C04 A;  1S3D A;  2HI7 A;  2LNS A;  1QFN A;  2Z9S A;  1MD4 A;  4DSS B;  1J0F A;  1THO A;  2HZF A;  1EWX A;  4MJA A;  2LTK A;  4ZBA A;  3RHB A;  1PL2 A;  3RDW A;  1ZYE A;  2GSS A;  3WT2 A;  5D93 A;  2RM5 A;  2HXK A;  2H1G A;  5AIX A;  3UIW A;  3UVH A;  1VF1 A;  2X64 A;  2AYT A;  4ZL7 A;  2MMO A;  1Z7P A;  4IP1 A;  3W6G A;  9GSS A;  3KP8 A;  3OR5 A;  2L57 A;  1GUH A;  4F82 A;  1GSF A;  2WDU A;  2YN1 A;  1S3C A;  2AJQ B;  3C8E A;  5D9V A;  1U88 A;  3NOF A;  3TKR A;  1NW2 A;  3F3R A;  2YWN A;  3VK9 A;  1DE1 A;  2MBS A;  3QPM A;  5JCU A;  2H66 A;  2YV9 A;  4ML1 A;  4IJ3 A;  1XBS A;  2VLV A;  5AN1 A;  2HSM B;  4ZBD A;  1YEX A;  1AUC A;  2L6D A;  3KD0 A;  2WB9 A;  4GXZ A;  1A8L A;  1TOF A;  3CSH A;  1TRS A;  1W89 A;  1EGR A;  3HKR A;  2TRC P;  4MF5 A;  3HJP A;  2OA7 A;  2HRK B;  1O6J A;  6GSX A;  3ZTL A;  2YOI A;  3WGD A;  1UA5 A;  2VL2 C;  3HDC A;  2LJK A;  3F8U A;  4J57 E;  2FWE A;  2YWM A;  5D73 A;  3TRP A;  3QMX A;  4RI7 A;  1ST9 A;  2JAD A;  4HUA A;  2PGT A;  2FNO A;  1U87 A;  2PBJ A;  2V1M A;  1KEB A;  4XS1 A;  4OFM A;  4DVC A;  3LXT A;  4XRD A;  3LYP A;  5DVB A;  3DEX A;  3R2Q A;  3RPP A;  3VWX A;  1YQ1 A;  3LEF A;  4MF7 A;  5GST A;  3WD6 A;  1X5E A;  4BWS A;  4GWR A;  3O3T A;  5G31 A;  1YZX A;  2GZZ A;  5B8B A;  4ID0 A;  2DML A;  3O76 A;  3UL3 A;  1X5D A;  2H8L A;  3TRX A;  3IBH A;  2H70 A;  5JCG A;  4HU7 A;  4P3Y B;  4L5O A;  2G2Q A;  2GQL A;  3KZQ A;  5H5R A;  2H0G A;  5DCH A;  3VPQ A;  3EU3 A;  2IN3 A;  1FO5 A;  4BVY B;  5CO3 A;  1BJX A;  1Z6M A;  2VOC A;  3ZIJ A;  4WET A;  5FHI A;  2JZS A;  5HR3 A;  5F07 A;  3KP9 A;  4K6X A;  3DGQ A;  4TR1 B;  2C8U A;  3GX0 A;  4TXO B;  4D73 A;  2YV7 A;  3HZ4 A;  1O73 A;  1R4W A;  1ON4 A;  2VCT A;  2MMZ A;  3CTF A;  4WR5 A;  2CX3 A;  4BL7 A;  4JZQ A;  3DVX A;  3FHK A;  3LWA A;  2IWT A;  5DQS A;  4YQV A;  5CRE A;  3GX8 A;  3S9F A;  4ZB8 A;  3F4S A;  2DIY A;  5LD0 A;  1GLP A;  1U3A A;  2QSI A;  3KCM A;  3PIN A;  3MDK A;  4XIH A;  4KW6 A;  5IO0 A;  5KEJ A;  1U6T A;  4QL7 A;  2CQ9 A;  1ZL9 A;  2CAI A;  14GS A;  4I8B A;  4MA9 A;  4MDC A;  1AAZ A;  3UOM A;  6GSY A;  3L4N A;  2H76 A;  2YP6 A;  1GSY A;  5LNK e;  2ZCT A;  4K8M A;  1HD2 A;  1B48 A;  2IMF A;  4KDY A;  3PGT A;  1GTA A;  2H0H A;  2RLI A;  11GS A;  2TRX A;  3TJJ A;  3D22 A;  4IBP A;  4HU9 A;  1OC3 A;  2H19 A;  4ZB6 A;  12GS A;  4EC0 A;  4BVX B;  1XVQ A;  1PX7 A;  2H01 A;  3D4M A;  3QAG A;  3ZFL A;  4LMV A;  4G10 A;  3KEB A;  4GF0 A;  3ERG A;  2LEG A;  4JU5 A;  2BJX A;  2HNL A;  2OAD A;  4KAE A;  5AGY A;  3TCO A;  6GSW A;  4TR3 A;  1R26 A;  2X99 A;  3GKN A;  4FO5 A;  3I9V 2;  4NHW A;  2R5G A;  1URM A;  1K0C A;  3D6I A;  18GS A;  3C71 A;  1LBK A;  5KN0 A;  3EWL A;  2YPM A;  1OYJ A;  2REM A;  1TDI A;  4OO5 A;  4KE3 A;  1EP7 A;  5ECM B;  4G0L A;  2K8V A;  3FRC A;  1AIU A;  3DIE A;  3F0I A;  3M8N A;  5LCZ A;  2DMM A;  4WKW A;  3DVW A;  2XHF A;  4RI6 A;  5HFG A;  1GTB A;  3DWV A;  2JZT A;  2C0D A;  4FYU A;  1M2D A;  2PWJ A;  3Q6O A;  3KMN A;  2GQK A;  3EE2 A;  4AJ6 A;  2VD1 A;  2IIY A;  1OC9 B;  2FWG A;  1SU9 A;  2LKU A;  4MZC A;  1USB A;  1JFU A;  3PPU A;  2R37 A;  4TN8 A;  2GT6 A;  4NMU A;  4G9H A;  4GRF A;  5ECR B;  3V1W A;  4EF0 A;  1XW9 A;  6GST A;  5CNW A;  4IKH A;  2RUF A;  3ZFB A;  1BED A;  5IMF A;  1UVZ A;  1K0N A;  1GRX A;  2P5Q A;  4OCF A;  3G7J A;  3ME7 A;  3SBC A;  5A4U A;  4GQF A;  2GS3 A;  4PXO A;  4MJB A;  1X9W B;  4EE0 A;  4KCE A;  2MBT A;  4N10 A;  3UJ1 A;  5INY A;  2O87 A;  4MPG A;  2CV4 A;  1OE8 A;  3ZIT A;  5G5F A;  2B1K A;  5IM9 A;  1OKD A;  4GQC A;  3LFL A;  3VWW A;  1VGL A;  3GH9 A;  3ZRE A;  4RQR A;  2PN8 A;  4KCA A;  2H71 A;  3DML A;  2GZP A;  4GTU A;  1YDK A;  4YQU A;  3JCM L;  2CT6 A;  4IN0 A;  4X1U A;  3TOU A;  2GLR A;  4EKZ A;  1S3A A;  2L4C A;  2IFQ A;  4V2M A;  4O5R A;  1JZD A;  3FZ4 A;  2KP1 A;  2IMD A;  2H72 A;  3Q19 A;  1X5C A;  4F03 A;  2DBC A;  1FHE A;  2GSQ A;  2O7K A;  1FG4 A;  4MAB A;  1MDI A;  1XXU A;  5HR1 A;  2H6Z A;  2NTO A;  4PQH A;  1M9B A;  1YKA A;  3TKS E;  1NM3 A;  1OKT A;  4XCS A;  1A23 A;  2IPA A;  4KSM A;  3ME8 A;  1EOH A;  5DJM A;  5KN2 A;  1XCC A;  2HRF A;  2VCZ A;  1AQW A;  2IME A;  5HFK A;  3BD2 A;  1YKC A;  4F0B A;  5J3R A;  1M99 A;  2H0I A;  1T00 A;  2HZE B;  3CBU A;  4NXI A;  3ZRD A;  3LQ7 A;  3HA9 A;  3C1R A;  2A2S A;  2LJR A;  1OVN A;  1Y6E A;  5KN1 A;  2YAN A;  4IVF A;  3QCP A;  2M46 A;  4KDX A;  2R2J A;  1O8X A;  4BPY A;  1SEN A;  1EEM A;  3FY7 A;  1G6Y A;  5ECS A;  3HD5 A;  2B3S A;  4QL9 A;  2KLX A;  3CTG A;  3EMP A;  4TW5 A;  5ELA A;  1O8W A;  1QMV A;  2DJ2 A;  1VF3 A;  3QD9 A;  4QQ7 A;  3GL3 A;  3M1G A;  3ZZX A;  1YF1 A;  1WP0 A;  2XC2 A;  5CRW A;  2I4A A;  2RUE A;  2FWH A;  3VFI A;  4I5Q A;  4J56 E;  5J9C A;  3TJB A;  4XTS A;  1ERU A;  4FYB A;  2WZ9 A;  2MZC A;  3TJK A;  1V9W A;  3ZIV A;  4LL1 B;  4HS1 A;  5D9T A;  1XIY A;  2B1L A;  5IMV A;  2I1U A;  5AIS A;  5ABR A;  3A2X A;  3J7Y b;  1WOU A;  2F8F A;  3D5J A;  3UAP A;  2OBK A;  2LQQ A;  1O85 A;  2H1A A;  2F8A A;  3FR9 A;  2WFC A;  2MMA A;  3A2W A;  1X9S B;  1SYR A;  2ON5 A;  3IK7 A;  3MNG A;  1Z9H A;  2AUV A;  3H93 A;  1QQ2 A;  2F9S A;  3QDN A;  3EUR A;  5HR0 A;  1T4Z A;  1A8Y A;  3M3M A;  5EVO A;  1G0T A;  3D21 A;  3US3 A;  1EEJ A;  1WWJ A;  1ZMA A;  1VF2 A;  3FZ9 A;  3CSI A;  4IHU A;  3L78 A;  4MF6 A;  5B7C A;  4BVY A;  4ZBB A;  4N30 A;  4OFT A;  4PUR A;  1XW6 A;  2VLU A;  4F9Z A;  1U3I A;  1JLW A;  2I81 A;  1Z6N A;  3HVS A;  3W8S A;  3N9J A;  2O8V B;  2JL4 A;  1KBN A;  4HOJ A;  1QK8 A;  5CRD A;  4ECI A;  5CRH A;  4Q5R A;  4I2T A;  3KTB A;  2X8G A;  2HE3 A;  2L5O A;  1MEK A;  2BTO T;  2EC4 A;  2LS5 A;  3IRA A;  2YZU A;  3RPN A;  5J9B A;  3IK9 A;  3ERW A;  1EZK A;  4XS6 A;  2JAC A;  4ULX A;  5F06 A;  3WGE A;  4IEL A;  1PSQ A;  4MLY A;  4DEJ A;  4HQZ A;  3D4T A;  3DYR A;  5DAK A;  2H75 A;  5B6N A;  1T8E B;  3IPZ A;  5DCG A;  2YWI A;  4Q5N A;  4RUV A;  2PMT A;  3FW2 A;  4PTS A;  1G7O A;  1CQG A;  5FT3 A;  4ECB A;  2WUL A;  3DXB A;  2L5L A;  1PRX A;  5AIV A;  2H1D A;  4ZL8 A;  1B4P A;  2FHE A;  3KIJ A;  1AXD A;  5A4W A;  4Q5F A;  1TP9 A;  4ZXG A;  2OE3 A;  2IMK A;  4IP6 A;  1QGV A;  3FZA A;  4N0V A;  3TOT A;  5GSS A;  1J08 A;  3L9V A;  2LV3 A;  3G9B A;  4J2F A;  4N11 A;  3TJF A;  1ZYQ B;  1GSQ A;  1ZOF A;  3GNJ A;  4DSQ A;  2GZY A;  3IXR A;  4NHZ A;  3GTU B;  4WBJ A;  3IOS A;  2K6V A;  2VLT A;  3MAK A;  3GH6 A;  4ISD A;  2YJH A;  3BOA A;  3IA1 A;  3F4R A;  4X0X A;  2FLS A;  1XWC A;  3CMI A;  3QAV A;  4ECJ A;  22GS A;  4KND A;  3TDG A;  1RQM A;  3N5O A;  3TGZ A;  1G7E A;  2GSR A;  4HZ4 A;  1TXX A;  3GN3 A;  4K0G A;  3IC8 A;  4LL4 B;  1R7H A;  4OCE A;  4GCI A;  3ZYW A;  3APO A;  3VWV A;  1A0R P;  1GLQ A;  4TVE A;  1XWA A;  2B7J A;  2KHP A;  1VRS D;  1OC9 A;  5DAL A;  2CVD A;  4MK3 A;  1R5P A;  1T3B A;  5BMU A;  4HJM A;  3VI7 A;  3LSZ A;  4EDZ A;  1K0B A;  4TKY A;  2OAC A;  3IAM 2;  1EV9 A;  2GDR A;  2HLS A;  3GKK A;  1IYH A;  2XBQ A;  1NHO A;  4NV2 A;  2VM1 A;  3HXS A;  20GS A;  4YQM A;  5ID2 A;  1Z3E A;  1XW5 A;  1SL1 B;  4GSN A;  1GNW A;  2HYX A;  3O6T A;  2LNT A;  1XPV A;  3TJG A;  2FD3 A;  5D96 A;  4PQ1 A;  4JR6 A;  1GP1 A;  1R5A A;  2F3M A;  4V1A p;  1EP8 A;  1T7P B;  2ZNM A;  4E8H A;  4OO4 A;  1EOG A;  2YCD A;  1GTU A;  2ON7 A;  3WYW A;  5IIZ A;  2WJU A;  4EVM A;  1A2J A;  1PD2 1;  1PMT A;  4V1A g;  2DJ0 A;  4LLR A;  3MSZ A;  4BL7 B;  1TKD B;  3J7Y k;  5IQY A;  2E2G A;  3UMA A;  1OE7 A;  4I2U A;  1FB0 A;  3ZL5 A;  1SYX A;  1ERW A;  1ILO A;  1XWK A;  1RK4 A;  1DBY A;  3E0U A;  4O32 A;  4POK A;  4L0W A;  1FAA A;  1A0F A;  3LJR A;  1M7T A;  1PKZ A;  3GST A;  3GSS A;  2X8C A;  2HSH A;  3MWH A;  16GS A;  3LYK A;  1O7U A;  1A2M A;  2VAF A;  2D2Z A;  1BYE A;  5ECH B;  2ES7 A;  1K0D A;  5H5S A;  3I69 A;  2H74 A;  3TKP A;  1SL2 B;  6GSS A;  3CYN A;  4O7H A;  1VF4 A;  1Q98 A;  3HHV A;  4OD7 A;  1AQX A;  3I43 A;  1JZW A;  3ZMK A;  1SK1 A;  3U5R E;  1ZCP A;  1UN2 A;  1YF0 A;  3FYG A;  2KP2 A;  1F37 A;  3TKS A;  4NV5 A;  2C3N A;  3IV4 A;  3P90 A;  4PGT A;  2PVO C;  2VCW A;  1K0O A;  3APQ A;  2CX4 A;  1PL1 A;  3BJ5 A;  1I5G A;  1TU7 A;  1HYU A;  1K0A A;  4K7N A;  4PNG A;  1F3B A;  1XWB A;  2LQO A;  4WEY A;  1XFL A;  1M2A A;  5CRG A;  4EDY A;  1H75 A;  4DSS A;  5ENU A;  3Q18 A;  1WMJ A;  1TK0 B;  5IMD A;  4NPB A;  3GMF A;  3P7X A;  3P8W A;  2WGR A;  4JED A;  3IE3 A;  4G0K A;  4NAX A;  4K0N A;  2KUC A;  2X8H A;  4PX1 A;  1NSW A;  5JWQ B;  4TR4 A;  1XVW A;  3M9J A;  4MH2 A;  3UBK A;  2PU9 C;  1T1V A;  5CYY A;  4EL1 A;  1TRW A;  1GTI A;  1YY7 A;  3UAR A;  2HT9 A;  1M0U A;  1K3O A;  1FVJ A;  2A4V A;  5ECK B;  2I3Y A;  1W4V A;  1WIK A;  3QAW A;  1DE2 A;  2FA4 A;  2GST A;  3FKF A;  1HQO A;  5A4V A;  3A3T A;  2I9H A;  1K3Y A;  1F2E A;  4XS4 B;  1N8J A;  1MTC A;  4GSS A;  4AGS A;  1V58 A;  1AC1 A;  2F51 A;  2HSM A;  4L0U A;  3AY8 A;  1BG5 A;  1K0M A;  2GGT A;  5HR2 A;  1DSB A;  3L9S A;  3KH9 A;  2FA8 A;  1I9D A;  1B4Q A;  2IL3 A;  5DDL A;  1B9X C;  5KN3 A;  5HFI A;  3KJY A;  2QC7 A;  3Q74 A;  4ZL9 A;  2HRK A;  2P0G A;  3KM6 A;  4PNF A;  1ML6 A;  1BQ7 A;  2RM6 A;  4PQI A;  3EIN A;  1TU8 A;  3PH9 A;  4EXJ A;  1PQN A;  3FZ5 A;  3KXO A;  4JE1 A;  3ZVJ D;  1GSS A;  3KTL A;  2PUK C;  3IR4 A;  1F6M C;  2DJ1 A;  2L59 A;  3BCI A;  2C3Q A;  4I97 A;  1WRY A;  4H86 A;  3RBT A;  4CDO A;  4TOP A;  2B5Y A;  5EPF A;  2ZUP A;  3EU4 A;  2KOK A;  3HJO A;  2BMX A;  4L8E A;  2VM2 A;  1PN9 A; 
#chains in the Genus database with same CATH topology
 4K5R A;  3VPT A;  2UZ8 A;  2HRA A;  1QUW A;  4ZB9 A;  3CRU A;  4GST A;  1TK5 B;  1F3A A;  5L71 A;  4BA7 A;  3DRN A;  5HQP A;  2EIQ A;  2JU5 A;  1KNG A;  2OJL A;  2NPB A;  6GSV A;  1M9A A;  2HRN A;  4KSO A;  3M9K A;  2IFQ B;  2JSZ A;  1JZO A;  4EUY A;  3I6A A;  4IQ1 A;  4WXT A;  5IPG A;  3UBL A;  2QKE A;  1ABA A;  5JWO B;  4L5L A;  1ERV A;  3GRX A;  2VO4 A;  2IJY A;  4FQU A;  1TRV A;  4WF5 A;  4JBB A;  5CP1 A;  4HI7 A;  3EVI A;  1IYI A;  3F6F A;  4MZW A;  2H6X A;  4O5Q A;  1QXH A;  2IMI A;  1JHB A;  4MP4 A;  3IC4 A;  2GVP A;  5IO2 A;  1Z5Y E;  3M0F A;  2H1B A;  3CRT A;  2B5X A;  3HZ8 A;  3E3E A;  2K18 A;  2DJ3 A;  4RQX A;  4Z7X A;  3HVX A;  5C00 A;  4TR1 A;  1SKW B;  4AKH A;  4TXO A;  3KGK A;  1EV4 A;  2C0E A;  4WR4 A;  4YKF A;  4K2D A;  1ACV A;  4NWY A;  3HJM A;  4KB3 A;  3GTU A;  2WRT A;  2VCX A;  1TJD A;  4K7I A;  3UEM A;  3QR6 A;  1I1I P;  1SJ6 A;  2G0F A;  2QGV A;  2OBI A;  5ECI B;  1BX9 A;  1UC7 A;  2R3X A;  4FH8 A;  2C0F A;  1JZR A;  2TIR A;  2NBS A;  3GL5 A;  4MMM A;  1X9M B;  5G2Z A;  3LGC A;  17GS A;  3C1S A;  1XWG A;  1SKR B;  5ECP B;  5D9X A;  3A5W A;  2VCQ A;  1HNB A;  1LU4 A;  3PR8 A;  3GUS A;  3G7I A;  3NIV A;  3R3E A;  4PUF C;  4FYC A;  1EGO A;  1FOV A;  2C4J A;  3P2A A;  5EY6 A;  2PVQ A;  1YJ6 A;  1XOB A;  3HCZ A;  2DIZ A;  2N5B A;  1B9Y C;  1WPI A;  2FGX A;  3ERF A;  3TKS C;  4WBR D;  1BAY A;  2V6K A;  1SD8 A;  3GUR A;  4G0I A;  1M3I A;  3VLN A;  2CAQ A;  4HEA 2;  3FK8 A;  4KDU A;  1SKS B;  3H1N A;  3LW9 A;  4BVX A;  4KX4 A;  1M2B A;  4ILF A;  3LOR A;  2VIM A;  2WW0 A;  4G19 A;  1YEP A;  1FB6 A;  3FR6 A;  2JZR A;  1C72 A;  4JR4 A;  5IPH A;  3CSJ A;  1E2Y A;  4GDF A;  2VKZ G;  4MCU A;  3EYT A;  3H8Q A;  1A2L A;  3L9U A;  2FWF A;  5IMC A;  2GT5 A;  2WS2 A;  4OFN A;  1ZZY A;  1O81 A;  4IGJ A;  1FVK A;  2N5A A;  1E6B A;  5JCW A;  3LXZ A;  2HQT A;  1YVL A;  1RW1 A;  5D9W A;  2P5R A;  2J23 A;  2HFD A;  4HJ2 A;  1TI3 A;  5G1K A;  3LG6 A;  2MMN A;  1G6W A;  2XPE A;  2DJJ A;  2LJA A;  2YJ7 A;  4MZB A;  2OKA A;  4LA1 A;  1N2A A;  2WVY A;  1LJR A;  3F63 A;  4IJI A;  3C7M A;  1GWC A;  3WT1 A;  4F2I A;  3BBY A;  4MH3 A;  3TRQ A;  3RGB C;  1WJK A;  4K7O A;  2K9F A;  5ECL B;  4AJ7 A;  1PFO A;  1XZO A;  2DC5 A;  2XPD A;  1PGT A;  2EIO A;  3G7Y A;  4IQA A;  4Q5Q A;  2L4Q A;  4YKG A;  4POL A;  4AJ8 A;  3GYK A;  2V2G A;  3A2V A;  2MYG A;  1GUK A;  4JRR A;  3W8J A;  2LRT A;  4TXV A;  5DAK B;  1TK8 B;  4MPF A;  1GSD A;  3CXG A;  2O85 A;  6GSU A;  3HVV A;  4CHS A;  2CVK A;  1OC8 A;  2V6O A;  5KOX A;  3F6D A;  3EMX A;  3BCK A;  7GSS A;  2H73 A;  5B8A A;  2YZH A;  1SK2 A;  4IW9 A;  4XHM A;  1GNE A;  4HZ2 A;  1ZGN A;  1N25 A;  2GQM A;  1NHY A;  2K8S A;  2C0G A;  2WCI A;  2VL3 A;  1OAZ A;  3D0Z A;  3EC3 A;  3RHC A;  2V41 A;  5B6M A;  1TRU A;  5J5N A;  3C73 A;  1B8X A;  4KA0 A;  3IHQ A;  4OWY A;  3TKQ A;  4K5S A;  3APS A;  5DJL A;  1FW1 A;  4AI6 A;  3ED3 A;  3ZML A;  1H4O A;  1PX6 A;  2OT3 A;  13GS A;  5JWR B;  2AAW A;  4HDE A;  1XOA A;  2FCH A;  4D73 B;  1GSE A;  3GV1 A;  4O92 A;  1PKW A;  5IOW A;  3U6V A;  1MD3 A;  1GUM A;  2P31 A;  2WVX B;  5G5E A;  4KGI A;  1Y25 A;  1MDK A;  5J47 A;  3QFB C;  5IMZ A;  1V57 A;  4Z2T A;  4TR0 A;  1Q4J A;  1SK0 A;  3KMO A;  5DQY A;  4IS0 A;  1K3L A;  4N0Z A;  2VUP A;  1SL0 B;  4YH2 A;  4Z2U A;  4BWQ A;  2E7P A;  3RAZ A;  3QFA C;  4ZIJ A;  1ERT A;  2H6Y A;  4FIW A;  1MDJ A;  3GFK A;  3SWL A;  2YWO A;  2B5E A;  4V2N A;  5D8I A;  1F9M A;  1SJI A;  3GHA A;  3TUE A;  3F9U A;  2VL2 A;  5A1N A;  2ALB A;  5IOX A;  1GH2 A;  2LST A;  5GAP D;  4OMV A;  10GS A;  2L6C A;  4K1F A;  3GKX A;  2LUS A;  3K8N A;  1HNC A;  5GZZ B;  4CW9 A;  3IDV A;  1GSU A;  2FY6 A;  1AQV A;  4PI2 C;  2LRN A;  3GA4 A;  4XS4 A;  2B7K A;  3FR3 A;  3CWG A;  3E9J B;  3DKS A;  5DAL B;  2C3T A;  2HZE A;  1V40 A;  5J4Y A;  4DSR A;  1Z7R A;  3NZN A;  4POB A;  5EL8 A;  3WGX A;  5H5Q A;  2XBI A;  1YEW C;  1SJZ A;  1THX A;  5ID2 B;  2JSY A;  4AF2 A;  2VCV A;  3QOU A;  4K2X A;  4MJC A;  3KH7 A;  1HNA A;  4I6X A;  3ZVJ A;  5G1L A;  1JLV A;  2DJK A;  5FWG A;  4F0C A;  3GIX A;  4KF9 A;  1V98 A;  5F05 A;  2V32 A;  1CQH A;  2LRC A;  4POM A;  1V2A A;  2R4V A;  4YAP A;  3DD3 A;  2B6M A;  2HSN B;  4ECC A;  5J41 A;  1WE0 A;  2AB6 A;  4PUA A;  5E4W A;  1TTZ A;  2AV4 A;  3IAS 2;  2N5F A;  2E2M A;  2PPT A;  4MJE A;  1DUG A;  5E59 A;  5DBQ A;  5G30 A;  1Y1U A;  2R6K A;  5ELG A;  1GUL A;  2C1Y A;  3HY2 A;  2NVL A;  1TI1 A;  3CHX C;  4V2L A;  1SD9 A;  4XRA A;  2GTU A;  2FUG 2;  4K9Z A;  1T4Y A;  2YNX A;  19GS A;  2O5V A;  2M72 A;  5ECN B;  3VWU A;  4GLT A;  3GKM A;  2CVB A;  3VI5 A;  2DLX A;  5A5K A;  2O36 A;  2M80 A;  2EIR A;  2CZ3 A;  3H4K A;  4FXY P;  2OE1 A;  4ACS A;  8GSS A;  2CA8 A;  3VUR A;  2WZS A;  3HYP A;  3F4T A;  2OE0 A;  5ECQ B;  3FEU A;  1TW9 A;  4HQS A;  2A2R A;  5J4U A;  3F3Q A;  4EO3 A;  1GL8 A;  5COH A;  5ECO B;  3L0H A;  2NDO A;  3HMJ G;  2RII A;  4KH7 A;  4ML6 A;  5F0G A;  2J9H A;  1KTE A;  4X43 A;  5CAX A;  5IMA A;  2AHE A;  4LMW A;  2O89 A;  2H1L A;  1A24 A;  4TRX A;  1AW9 A;  5F8B A;  4WF4 A;  4E8E A;  2HSY A;  1J9B A;  2DSA A;  2PER A;  3H79 A;  4YAV A;  4KUN A;  3TB2 A;  1PA3 A;  1X0R A;  2H30 A;  2VL9 A;  2C80 A;  4ZIL A;  3UVT A;  2E0Q A;  2CZ2 A;  5GAN D;  2VD0 A;  3ISO A;  4USS A;  3ZLP A;  4G2E A;  5C04 A;  1S3D A;  2HI7 A;  2LNS A;  1QFN A;  2A4H A;  2Z9S A;  1MD4 A;  4DSS B;  1J0F A;  1THO A;  2HZF A;  1EWX A;  4MJA A;  2LTK A;  4ZBA A;  3RHB A;  1PL2 A;  3RDW A;  1ZYE A;  2GSS A;  3WT2 A;  5D93 A;  2RM5 A;  2HXK A;  2H1G A;  5AIX A;  3UIW A;  3UVH A;  1VF1 A;  2X64 A;  2AYT A;  4O5U A;  4ZL7 A;  2MMO A;  1Z7P A;  4IP1 A;  4AKI A;  3W6G A;  9GSS A;  3KP8 A;  3OR5 A;  2L57 A;  1GUH A;  4F82 A;  1GSF A;  2WDU A;  2YN1 A;  1S3C A;  2AJQ B;  3C8E A;  5D9V A;  1U88 A;  3NOF A;  3TKR A;  1NW2 A;  3F3R A;  2YWN A;  2DKI A;  3VK9 A;  1DE1 A;  2X4A A;  2MBS A;  3CQF A;  3QPM A;  5JCU A;  2H66 A;  2YV9 A;  4ML1 A;  3MIX A;  4IJ3 A;  1XBS A;  2VLV A;  5AN1 A;  2HSM B;  4CY6 A;  4ZBD A;  1YEX A;  1AUC A;  2L6D A;  3KD0 A;  2WB9 A;  4GXZ A;  1A8L A;  1TOF A;  3CSH A;  1TRS A;  1W89 A;  1EGR A;  3HKR A;  2TRC P;  4MF5 A;  3HJP A;  2OA7 A;  2HRK B;  1O6J A;  6GSX A;  3ZTL A;  2YOI A;  3WGD A;  1UA5 A;  2VL2 C;  3HDC A;  2LJK A;  3F8U A;  4J57 E;  2FWE A;  3HVN A;  2YWM A;  5D73 A;  3TRP A;  3QMX A;  4RI7 A;  1ST9 A;  2JAD A;  4HUA A;  2PGT A;  2FNO A;  1U87 A;  2PBJ A;  3EPT A;  2V1M A;  1KEB A;  4XS1 A;  4OFM A;  4DVC A;  3LXT A;  4XRD A;  3LYP A;  5DVB A;  3DEX A;  3R2Q A;  3RPP A;  3VWX A;  1YQ1 A;  5A5H A;  3LEF A;  4MF7 A;  5GST A;  3WD6 A;  1X5E A;  4BWS A;  4GWR A;  3O3T A;  5G31 A;  1YZX A;  2GZZ A;  5B8B A;  4ID0 A;  2DML A;  3O76 A;  3UL3 A;  1X5D A;  2H8L A;  2R0P A;  3TRX A;  3IBH A;  2H70 A;  5JCG A;  4HU7 A;  4P3Y B;  4L5O A;  2G2Q A;  2GQL A;  3KZQ A;  5H5R A;  2H0G A;  5DCH A;  3VPQ A;  3EU3 A;  2IN3 A;  1FO5 A;  4BVY B;  5CO3 A;  1BJX A;  1Z6M A;  2VOC A;  3ZIJ A;  1M3J A;  4WET A;  5FHI A;  4EIQ A;  2JZS A;  5HR3 A;  5F07 A;  3KP9 A;  4K6X A;  3DGQ A;  4TR1 B;  2C8U A;  3GX0 A;  4TXO B;  4D73 A;  2YV7 A;  3HZ4 A;  1O73 A;  1R4W A;  1ON4 A;  2VCT A;  2MMZ A;  3CTF A;  4WR5 A;  2CX3 A;  4BL7 A;  4JZQ A;  3DVX A;  3FHK A;  3LWA A;  2IWT A;  5DQS A;  4YQV A;  5CRE A;  3GX8 A;  3S9F A;  4ZB8 A;  3F4S A;  2DIY A;  5LD0 A;  1S3R A;  1GLP A;  2EFE A;  1U3A A;  2QSI A;  3KCM A;  3PIN A;  3MDK A;  4XIH A;  4KW6 A;  5IO0 A;  5KEJ A;  1U6T A;  4QL7 A;  2CQ9 A;  1ZL9 A;  2X49 A;  2CAI A;  14GS A;  4I8B A;  4MA9 A;  3RFR C;  4MDC A;  1AAZ A;  3UOM A;  6GSY A;  3L4N A;  2H76 A;  2YP6 A;  1GSY A;  5LNK e;  2ZCT A;  4K8M A;  1HD2 A;  1B48 A;  2UV8 G;  1BF5 A;  2IMF A;  4KDY A;  3PGT A;  1GTA A;  2H0H A;  2RLI A;  11GS A;  2TRX A;  3TJJ A;  3D22 A;  4IBP A;  4HU9 A;  1OC3 A;  2H19 A;  4ZB6 A;  12GS A;  4EC0 A;  4BVX B;  1XVQ A;  1PX7 A;  2H01 A;  3D4M A;  3QAG A;  3ZFL A;  4LMV A;  4G10 A;  3KEB A;  4GF0 A;  3ERG A;  2LEG A;  4JU5 A;  2BJX A;  2HNL A;  2OAD A;  4KAE A;  5AGY A;  3TCO A;  6GSW A;  4TR3 A;  1R26 A;  2X99 A;  3GKN A;  4FO5 A;  3I9V 2;  4NHW A;  2R5G A;  1URM A;  1K0C A;  3D6I A;  18GS A;  3C71 A;  1LBK A;  2HSN A;  5KN0 A;  3EWL A;  2YPM A;  1OYJ A;  2REM A;  1TDI A;  4OO5 A;  4KE3 A;  1EP7 A;  4N3Z A;  5ECM B;  4G0L A;  2K8V A;  3FRC A;  1AIU A;  3DIE A;  3F0I A;  3M8N A;  5LCZ A;  2DMM A;  4WKW A;  3DVW A;  2XHF A;  1FOH A;  5BRT A;  4RI6 A;  5HFG A;  3A5I A;  1GTB A;  3DWV A;  2JZT A;  2C0D A;  4FYU A;  1M2D A;  2PWJ A;  3Q6O A;  3KMN A;  2GQK A;  3EE2 A;  4AJ6 A;  2VD1 A;  2IIY A;  1OC9 B;  2FWG A;  5BMU B;  1SU9 A;  2LKU A;  4MZC A;  1USB A;  1JFU A;  3PPU A;  2R37 A;  4TN8 A;  2GT6 A;  4NMU A;  4G9H A;  4GRF A;  2WW3 A;  5ECR B;  3V1W A;  4EF0 A;  1XW9 A;  6GST A;  5CNW A;  4IKH A;  2RUF A;  3ZFB A;  1BED A;  5IMF A;  1UVZ A;  1K0N A;  2R0G A;  1GRX A;  2P5Q A;  4OCF A;  5A34 B;  3G7J A;  3ME7 A;  3SBC A;  1SVM A;  5A4U A;  4GQF A;  2GS3 A;  4PXO A;  4MJB A;  1X9W B;  4EE0 A;  4KCE A;  2MBT A;  4N10 A;  3UJ1 A;  5INY A;  4ZB7 A;  2O87 A;  4MPG A;  2CV4 A;  1OE8 A;  3ZIT A;  5G5F A;  2B1K A;  5IM9 A;  1OKD A;  4GQC A;  3LFL A;  3VWW A;  1VGL A;  3GH9 A;  3ZRE A;  4RQR A;  2PN8 A;  4KCA A;  2H71 A;  3DML A;  2GZP A;  4GTU A;  1YDK A;  4YQU A;  3JCM L;  2CT6 A;  4IN0 A;  4X1U A;  3TOU A;  2GLR A;  4EKZ A;  1S3A A;  2L4C A;  3TU3 B;  2IFQ A;  4V2M A;  4O5R A;  1JZD A;  3FZ4 A;  2KP1 A;  2IMD A;  2H72 A;  3Q19 A;  1X5C A;  4F03 A;  2DBC A;  1FHE A;  2GSQ A;  2O7K A;  1FG4 A;  4MAB A;  1MDI A;  1XXU A;  5HR1 A;  2H6Z A;  2NTO A;  4PQH A;  1M9B A;  1YKA A;  3TKS E;  1NM3 A;  1OKT A;  4XCS A;  1A23 A;  4X4J A;  2IPA A;  4KSM A;  3ME8 A;  1EOH A;  5DJM A;  5KN2 A;  4AKX B;  4G01 A;  1XCC A;  2HRF A;  2VCZ A;  1AQW A;  2IME A;  2EFD A;  5HFK A;  3BD2 A;  1YKC A;  4F0B A;  5J3R A;  1M99 A;  2H0I A;  1T00 A;  2HZE B;  3CBU A;  4NXI A;  3ZRD A;  4W66 A;  3LQ7 A;  3HA9 A;  3C1R A;  2A2S A;  2LJR A;  1OVN A;  1Y6E A;  5KN1 A;  4QMK A;  2YAN A;  4IVF A;  3QCP A;  2M46 A;  4KDX A;  2R2J A;  1O8X A;  4BPY A;  1SEN A;  1EEM A;  3FY7 A;  1G6Y A;  5ECS A;  3IHG A;  3HD5 A;  2B3S A;  4QL9 A;  2KLX A;  3CTG A;  3EMP A;  4TW5 A;  5ELA A;  1O8W A;  1QMV A;  2DJ2 A;  1VF3 A;  3QD9 A;  4QQ7 A;  3GL3 A;  3M1G A;  3ZZX A;  1YF1 A;  1WP0 A;  2XC2 A;  5CRW A;  2I4A A;  2RUE A;  2FWH A;  3VFI A;  4I5Q A;  4J56 E;  5J9C A;  3TJB A;  2EFH A;  1SVO A;  4XTS A;  1ERU A;  4FYB A;  2WZ9 A;  2MZC A;  3TJK A;  1V9W A;  3ZIV A;  4LL1 B;  4HS1 A;  5D9T A;  1XIY A;  2B1L A;  5IMV A;  2I1U A;  5AIS A;  5ABR A;  3A2X A;  3J7Y b;  1WOU A;  2F8F A;  3D5J A;  3UAP A;  2A2P A;  2OBK A;  2LQQ A;  1O85 A;  2H1A A;  2F8A A;  3FR9 A;  2WFC A;  2MMA A;  3A2W A;  1X9S B;  1SYR A;  2ON5 A;  3IK7 A;  3MNG A;  1Z9H A;  2AUV A;  3H93 A;  1QQ2 A;  2F9S A;  3QDN A;  3EUR A;  5HR0 A;  1T4Z A;  1A8Y A;  3M3M A;  4EIP A;  5EVO A;  1G0T A;  3D21 A;  3US3 A;  1EEJ A;  1WWJ A;  1ZMA A;  1VF2 A;  3FZ9 A;  3CSI A;  4IHU A;  3L78 A;  4MF6 A;  5B7C A;  4BVY A;  4ZBB A;  4N30 A;  4OFT A;  1BG1 A;  4PUR A;  1XW6 A;  2VLU A;  4F9Z A;  1U3I A;  1JLW A;  2I81 A;  1Z6N A;  3HVS A;  3W8S A;  3N9J A;  2O8V B;  2JL4 A;  4CY8 A;  2WW1 A;  3MYD A;  1KBN A;  4HOJ A;  1QK8 A;  4HSC X;  5CRD A;  4ECI A;  5CRH A;  4Q5R A;  4I2T A;  3KTB A;  1PN0 A;  2X8G A;  1XG8 A;  2HE3 A;  2L5O A;  1MEK A;  2BTO T;  2EC4 A;  2LS5 A;  3IRA A;  2YZU A;  3RPN A;  5J9B A;  3IK9 A;  3ERW A;  1EZK A;  4XS6 A;  2JAC A;  4ULX A;  5F06 A;  3WGE A;  4IEL A;  1PSQ A;  4MLY A;  4DEJ A;  4HQZ A;  3D4T A;  3DYR A;  5DAK A;  2H75 A;  5B6N A;  1T8E B;  3IPZ A;  5DCG A;  2YWI A;  4Q5N A;  4RUV A;  2PMT A;  3FW2 A;  4PTS A;  1G7O A;  1CQG A;  5FT3 A;  4ECB A;  1ZYN A;  2WUL A;  3DXB A;  2L5L A;  2WVZ A;  1PRX A;  5AIV A;  2H1D A;  4ZL8 A;  1B4P A;  2FHE A;  3KIJ A;  1AXD A;  5A4W A;  4Q5F A;  5J4V A;  1TP9 A;  4ZXG A;  2OE3 A;  2IMK A;  4IP6 A;  1QGV A;  3FZA A;  4N0V A;  3TOT A;  4BIK A;  5GSS A;  1J08 A;  3L9V A;  2LV3 A;  3G9B A;  4J2F A;  4N11 A;  3TJF A;  1ZYQ B;  1GSQ A;  1ZOF A;  3GNJ A;  4DSQ A;  2GZY A;  2WVX A;  3IXR A;  4NHZ A;  3GTU B;  4WBJ A;  3IOS A;  2K6V A;  2VLT A;  4AKG A;  3MAK A;  3GH6 A;  4ISD A;  2YJH A;  3BOA A;  3IA1 A;  3F4R A;  4X0X A;  2FLS A;  1XWC A;  3CMI A;  1SVL A;  3QAV A;  4ECJ A;  22GS A;  4KND A;  3TDG A;  1RQM A;  3N5O A;  3TGZ A;  1G7E A;  2GSR A;  4HZ4 A;  1TXX A;  3GN3 A;  4K0G A;  3IC8 A;  4LL4 B;  1R7H A;  4OCE A;  4GCI A;  3ZYW A;  3APO A;  3VWV A;  1A0R P;  1GLQ A;  4PI0 C;  4TVE A;  1XWA A;  3FMW A;  2B7J A;  2KHP A;  1VRS D;  1OC9 A;  5DAL A;  2CVD A;  4MK3 A;  1R5P A;  1T3B A;  5BMU A;  5A5H B;  4HJM A;  3VI7 A;  3LSZ A;  4EDZ A;  1K0B A;  4TKY A;  2OAC A;  3IAM 2;  1EV9 A;  2GDR A;  2HLS A;  3GKK A;  1IYH A;  2XBQ A;  1NHO A;  4NV2 A;  2VM1 A;  3HXS A;  20GS A;  4YQM A;  5ID2 A;  1Z3E A;  1XW5 A;  1SL1 B;  4GSN A;  1GNW A;  2HYX A;  2R0C A;  3O6T A;  2LNT A;  1XPV A;  3TJG A;  2FD3 A;  5D96 A;  5A34 A;  4PQ1 A;  4JR6 A;  1GP1 A;  4Z2R A;  1R5A A;  2F3M A;  4V1A p;  1EP8 A;  1T7P B;  2ZNM A;  4E8H A;  4OO4 A;  1EOG A;  2YCD A;  1GTU A;  2ON7 A;  3WYW A;  5IIZ A;  2WJU A;  4EVM A;  1A2J A;  1PD2 1;  1PMT A;  4V1A g;  2DJ0 A;  4LLR A;  3MSZ A;  4A5P A;  4BL7 B;  1TKD B;  3J7Y k;  5IQY A;  2E2G A;  3UMA A;  1OE7 A;  4I2U A;  1FB0 A;  3ZL5 A;  1SYX A;  1ERW A;  1ILO A;  1XWK A;  1RK4 A;  1DBY A;  3E0U A;  4O32 A;  4POK A;  4L0W A;  1FAA A;  1A0F A;  2QA2 A;  3LJR A;  1M7T A;  4E68 A;  1PKZ A;  3GST A;  3GSS A;  2X8C A;  2HSH A;  3MWH A;  16GS A;  3LYK A;  1O7U A;  1A2M A;  2VAF A;  2D2Z A;  1BYE A;  5ECH B;  2ES7 A;  1K0D A;  5H5S A;  3I69 A;  2O3E A;  2H74 A;  3TKP A;  1SL2 B;  6GSS A;  3CYN A;  4O7H A;  1VF4 A;  1Q98 A;  3HHV A;  4OD7 A;  1AQX A;  3I43 A;  1JZW A;  3ZMK A;  1SK1 A;  3U5R E;  4PHZ C;  1ZCP A;  1UN2 A;  1YF0 A;  3FYG A;  2KP2 A;  1F37 A;  3TKS A;  4NV5 A;  2C3N A;  3IV4 A;  3P90 A;  1ZYP A;  4PGT A;  2DKH A;  2PVO C;  2VCW A;  1K0O A;  3APQ A;  3BJ5 A;  1PL1 A;  2CX4 A;  1I5G A;  1TU7 A;  1HYU A;  1K0A A;  4K7N A;  4PNG A;  1F3B A;  1XWB A;  2LQO A;  4WEY A;  1XFL A;  1M2A A;  5CRG A;  5J40 A;  4EDY A;  1H75 A;  4DSS A;  5ENU A;  3Q18 A;  1WMJ A;  1TK0 B;  5IMD A;  2WW2 A;  4NPB A;  3GMF A;  3P7X A;  3P8W A;  2WGR A;  2QA1 A;  4JED A;  3IE3 A;  1S4B P;  4G0K A;  4NAX A;  4K0N A;  2KUC A;  2X8H A;  4PX1 A;  1NSW A;  5JWQ B;  4TR4 A;  1XVW A;  3M9J A;  4MH2 A;  3UBK A;  2PU9 C;  1T1V A;  5CYY A;  5A1N B;  4EL1 A;  1TRW A;  1GTI A;  1YY7 A;  3UAR A;  2HT9 A;  1M0U A;  1K3O A;  1FVJ A;  2A4V A;  5ECK B;  2I3Y A;  1W4V A;  1WIK A;  3QAW A;  1DE2 A;  2FA4 A;  2GST A;  3FKF A;  1HQO A;  5A4V A;  3A3T A;  2I9H A;  1K3Y A;  1F2E A;  4XS4 B;  1N8J A;  1MTC A;  4GSS A;  4AGS A;  1V58 A;  1AC1 A;  2F51 A;  2HSM A;  4L0U A;  3AY8 A;  1BG5 A;  1K0M A;  2GGT A;  5HR2 A;  4ICY A;  1DSB A;  3L9S A;  3KH9 A;  2FA8 A;  1I9D A;  1B4Q A;  2IL3 A;  5DDL A;  1B9X C;  5KN3 A;  5HFI A;  3KJY A;  2QC7 A;  3Q74 A;  4ZL9 A;  2HRK A;  2P0G A;  1TXU A;  3KM6 A;  4PNF A;  1ML6 A;  1BQ7 A;  2RM6 A;  4PQI A;  3EIN A;  1TU8 A;  3PH9 A;  4EXJ A;  1PQN A;  3FZ5 A;  3KXO A;  4JE1 A;  3ZVJ D;  1GSS A;  3KTL A;  2PUK C;  3IR4 A;  1F6M C;  2DJ1 A;  2L59 A;  3BCI A;  2C3Q A;  4I97 A;  1WRY A;  4H86 A;  3RBT A;  4CDO A;  4TOP A;  2B5Y A;  4MNN A;  5EPF A;  2EFC A;  2ZUP A;  5KOW A;  3EU4 A;  2KOK A;  3HJO A;  2BMX A;  4L8E A;  2VM2 A;  1PN9 A; 
#chains in the Genus database with same CATH homology
 4K5R A;  3VPT A;  2UZ8 A;  2HRA A;  1QUW A;  4ZB9 A;  3CRU A;  4GST A;  1TK5 B;  1F3A A;  5L71 A;  4BA7 A;  3DRN A;  5HQP A;  2EIQ A;  2JU5 A;  1KNG A;  2OJL A;  2NPB A;  6GSV A;  1M9A A;  2HRN A;  4KSO A;  3M9K A;  2IFQ B;  2JSZ A;  1JZO A;  4EUY A;  3I6A A;  4IQ1 A;  4WXT A;  5IPG A;  3UBL A;  2QKE A;  1ABA A;  5JWO B;  4L5L A;  1ERV A;  3GRX A;  2VO4 A;  2IJY A;  4FQU A;  1TRV A;  4WF5 A;  4JBB A;  5CP1 A;  4HI7 A;  3EVI A;  1IYI A;  3F6F A;  4MZW A;  2H6X A;  4O5Q A;  1QXH A;  2IMI A;  1JHB A;  4MP4 A;  3IC4 A;  2GVP A;  5IO2 A;  1Z5Y E;  3M0F A;  2H1B A;  3CRT A;  2B5X A;  3HZ8 A;  3E3E A;  2K18 A;  2DJ3 A;  4RQX A;  4Z7X A;  3HVX A;  5C00 A;  4TR1 A;  1SKW B;  4AKH A;  4TXO A;  3KGK A;  1EV4 A;  2C0E A;  4WR4 A;  4YKF A;  4K2D A;  1ACV A;  4NWY A;  3HJM A;  4KB3 A;  3GTU A;  2WRT A;  2VCX A;  1TJD A;  4K7I A;  3UEM A;  3QR6 A;  1SJ6 A;  2G0F A;  2QGV A;  2OBI A;  5ECI B;  1BX9 A;  1UC7 A;  2R3X A;  4FH8 A;  2C0F A;  1JZR A;  2TIR A;  2NBS A;  3GL5 A;  4MMM A;  1X9M B;  5G2Z A;  3LGC A;  17GS A;  3C1S A;  1XWG A;  1SKR B;  5ECP B;  5D9X A;  3A5W A;  2VCQ A;  1HNB A;  1LU4 A;  3PR8 A;  3GUS A;  3G7I A;  3NIV A;  3R3E A;  4PUF C;  4FYC A;  1EGO A;  1FOV A;  2C4J A;  3P2A A;  5EY6 A;  2PVQ A;  1YJ6 A;  1XOB A;  3HCZ A;  2DIZ A;  2N5B A;  1B9Y C;  1WPI A;  2FGX A;  3ERF A;  3TKS C;  4WBR D;  1BAY A;  2V6K A;  1SD8 A;  3GUR A;  4G0I A;  3VLN A;  2CAQ A;  4HEA 2;  3FK8 A;  4KDU A;  1SKS B;  3H1N A;  3LW9 A;  4BVX A;  4KX4 A;  1M2B A;  4ILF A;  3LOR A;  2VIM A;  4G19 A;  1YEP A;  1FB6 A;  3FR6 A;  2JZR A;  1C72 A;  4JR4 A;  5IPH A;  3CSJ A;  1E2Y A;  4GDF A;  2VKZ G;  4MCU A;  3EYT A;  3H8Q A;  1A2L A;  3L9U A;  2FWF A;  5IMC A;  2GT5 A;  2WS2 A;  4OFN A;  1ZZY A;  1O81 A;  4IGJ A;  1FVK A;  2N5A A;  1E6B A;  5JCW A;  3LXZ A;  2HQT A;  1YVL A;  1RW1 A;  5D9W A;  2P5R A;  2J23 A;  2HFD A;  4HJ2 A;  1TI3 A;  5G1K A;  3LG6 A;  2MMN A;  1G6W A;  2XPE A;  2DJJ A;  2LJA A;  2YJ7 A;  4MZB A;  2OKA A;  4LA1 A;  1N2A A;  1LJR A;  3F63 A;  4IJI A;  3C7M A;  1GWC A;  3WT1 A;  4F2I A;  3BBY A;  4MH3 A;  3TRQ A;  1WJK A;  4K7O A;  2K9F A;  5ECL B;  4AJ7 A;  1XZO A;  2DC5 A;  2XPD A;  1PGT A;  2EIO A;  3G7Y A;  4IQA A;  4Q5Q A;  2L4Q A;  4YKG A;  4POL A;  4AJ8 A;  3GYK A;  2V2G A;  3A2V A;  2MYG A;  1GUK A;  4JRR A;  3W8J A;  2LRT A;  4TXV A;  5DAK B;  1TK8 B;  4MPF A;  1GSD A;  3CXG A;  2O85 A;  6GSU A;  3HVV A;  4CHS A;  2CVK A;  1OC8 A;  2V6O A;  5KOX A;  3F6D A;  3EMX A;  3BCK A;  7GSS A;  2H73 A;  5B8A A;  2YZH A;  1SK2 A;  4IW9 A;  4XHM A;  1GNE A;  4HZ2 A;  1ZGN A;  1N25 A;  2GQM A;  1NHY A;  2K8S A;  2C0G A;  2WCI A;  2VL3 A;  1OAZ A;  3D0Z A;  3EC3 A;  3RHC A;  2V41 A;  5B6M A;  1TRU A;  5J5N A;  3C73 A;  1B8X A;  4KA0 A;  3IHQ A;  4OWY A;  3TKQ A;  4K5S A;  3APS A;  5DJL A;  1FW1 A;  4AI6 A;  3ED3 A;  3ZML A;  1H4O A;  1PX6 A;  2OT3 A;  13GS A;  5JWR B;  2AAW A;  4HDE A;  1XOA A;  2FCH A;  4D73 B;  1GSE A;  3GV1 A;  4O92 A;  1PKW A;  5IOW A;  3U6V A;  1MD3 A;  1GUM A;  2P31 A;  5G5E A;  4KGI A;  1Y25 A;  1MDK A;  5J47 A;  3QFB C;  5IMZ A;  1V57 A;  4Z2T A;  4TR0 A;  1Q4J A;  1SK0 A;  3KMO A;  5DQY A;  4IS0 A;  1K3L A;  4N0Z A;  2VUP A;  1SL0 B;  4YH2 A;  4Z2U A;  4BWQ A;  2E7P A;  3RAZ A;  3QFA C;  4ZIJ A;  1ERT A;  2H6Y A;  4FIW A;  1MDJ A;  3GFK A;  3SWL A;  2YWO A;  2B5E A;  4V2N A;  5D8I A;  1F9M A;  1SJI A;  3GHA A;  3TUE A;  3F9U A;  2VL2 A;  5A1N A;  2ALB A;  5IOX A;  1GH2 A;  2LST A;  5GAP D;  4OMV A;  10GS A;  2L6C A;  4K1F A;  3GKX A;  2LUS A;  3K8N A;  1HNC A;  5GZZ B;  4CW9 A;  3IDV A;  1GSU A;  2FY6 A;  1AQV A;  2LRN A;  3GA4 A;  4XS4 A;  2B7K A;  3FR3 A;  3CWG A;  3E9J B;  3DKS A;  5DAL B;  2C3T A;  2HZE A;  1V40 A;  5J4Y A;  4DSR A;  1Z7R A;  3NZN A;  4POB A;  5EL8 A;  3WGX A;  5H5Q A;  2XBI A;  1SJZ A;  1THX A;  5ID2 B;  2JSY A;  4AF2 A;  2VCV A;  3QOU A;  4K2X A;  4MJC A;  3KH7 A;  1HNA A;  4I6X A;  3ZVJ A;  5G1L A;  1JLV A;  2DJK A;  5FWG A;  4F0C A;  3GIX A;  4KF9 A;  1V98 A;  5F05 A;  2V32 A;  1CQH A;  2LRC A;  4POM A;  1V2A A;  2R4V A;  4YAP A;  3DD3 A;  2B6M A;  2HSN B;  4ECC A;  5J41 A;  1WE0 A;  2AB6 A;  4PUA A;  5E4W A;  1TTZ A;  2AV4 A;  3IAS 2;  2N5F A;  2E2M A;  2PPT A;  4MJE A;  1DUG A;  5E59 A;  5DBQ A;  5G30 A;  1Y1U A;  2R6K A;  5ELG A;  1GUL A;  2C1Y A;  3HY2 A;  2NVL A;  1TI1 A;  4V2L A;  1SD9 A;  4XRA A;  2GTU A;  2FUG 2;  4K9Z A;  1T4Y A;  2YNX A;  19GS A;  2O5V A;  2M72 A;  5ECN B;  3VWU A;  4GLT A;  3GKM A;  2CVB A;  3VI5 A;  2DLX A;  5A5K A;  2M80 A;  2EIR A;  2CZ3 A;  3H4K A;  2OE1 A;  4ACS A;  8GSS A;  2CA8 A;  3VUR A;  3HYP A;  3F4T A;  2OE0 A;  5ECQ B;  3FEU A;  1TW9 A;  4HQS A;  2A2R A;  5J4U A;  3F3Q A;  4EO3 A;  1GL8 A;  5COH A;  5ECO B;  3L0H A;  2NDO A;  3HMJ G;  2RII A;  4KH7 A;  4ML6 A;  5F0G A;  2J9H A;  1KTE A;  4X43 A;  5CAX A;  5IMA A;  2AHE A;  4LMW A;  2O89 A;  2H1L A;  1A24 A;  4TRX A;  1AW9 A;  5F8B A;  4WF4 A;  4E8E A;  2HSY A;  1J9B A;  2DSA A;  2PER A;  3H79 A;  4YAV A;  4KUN A;  3TB2 A;  1PA3 A;  1X0R A;  2H30 A;  2VL9 A;  2C80 A;  4ZIL A;  3UVT A;  2E0Q A;  2CZ2 A;  5GAN D;  2VD0 A;  3ISO A;  4USS A;  3ZLP A;  4G2E A;  5C04 A;  1S3D A;  2HI7 A;  2LNS A;  1QFN A;  2A4H A;  2Z9S A;  1MD4 A;  4DSS B;  1J0F A;  1THO A;  2HZF A;  1EWX A;  4MJA A;  2LTK A;  4ZBA A;  3RHB A;  1PL2 A;  3RDW A;  1ZYE A;  2GSS A;  3WT2 A;  5D93 A;  2RM5 A;  2HXK A;  2H1G A;  5AIX A;  3UIW A;  3UVH A;  1VF1 A;  2X64 A;  2AYT A;  4O5U A;  4ZL7 A;  2MMO A;  1Z7P A;  4IP1 A;  4AKI A;  3W6G A;  9GSS A;  3KP8 A;  3OR5 A;  2L57 A;  1GUH A;  4F82 A;  1GSF A;  2WDU A;  2YN1 A;  1S3C A;  2AJQ B;  3C8E A;  5D9V A;  1U88 A;  3NOF A;  3TKR A;  1NW2 A;  3F3R A;  2YWN A;  2DKI A;  3VK9 A;  1DE1 A;  2X4A A;  2MBS A;  3QPM A;  5JCU A;  2H66 A;  2YV9 A;  4ML1 A;  3MIX A;  4IJ3 A;  1XBS A;  2VLV A;  5AN1 A;  2HSM B;  4CY6 A;  4ZBD A;  1YEX A;  1AUC A;  2L6D A;  3KD0 A;  2WB9 A;  4GXZ A;  1A8L A;  1TOF A;  3CSH A;  1TRS A;  1W89 A;  1EGR A;  3HKR A;  2TRC P;  4MF5 A;  3HJP A;  2OA7 A;  2HRK B;  1O6J A;  6GSX A;  3ZTL A;  2YOI A;  3WGD A;  1UA5 A;  2VL2 C;  3HDC A;  2LJK A;  3F8U A;  4J57 E;  2FWE A;  2YWM A;  5D73 A;  3TRP A;  3QMX A;  4RI7 A;  1ST9 A;  2JAD A;  4HUA A;  2PGT A;  2FNO A;  1U87 A;  2PBJ A;  3EPT A;  2V1M A;  1KEB A;  4XS1 A;  4OFM A;  4DVC A;  3LXT A;  4XRD A;  3LYP A;  5DVB A;  3DEX A;  3R2Q A;  3RPP A;  3VWX A;  1YQ1 A;  5A5H A;  3LEF A;  4MF7 A;  5GST A;  3WD6 A;  1X5E A;  4BWS A;  4GWR A;  3O3T A;  5G31 A;  1YZX A;  2GZZ A;  5B8B A;  4ID0 A;  2DML A;  3O76 A;  3UL3 A;  1X5D A;  2H8L A;  2R0P A;  3TRX A;  3IBH A;  2H70 A;  5JCG A;  4HU7 A;  4P3Y B;  4L5O A;  2G2Q A;  2GQL A;  3KZQ A;  5H5R A;  2H0G A;  5DCH A;  3VPQ A;  3EU3 A;  2IN3 A;  1FO5 A;  4BVY B;  5CO3 A;  1BJX A;  1Z6M A;  2VOC A;  3ZIJ A;  4WET A;  5FHI A;  4EIQ A;  2JZS A;  5HR3 A;  5F07 A;  3KP9 A;  4K6X A;  3DGQ A;  4TR1 B;  2C8U A;  3GX0 A;  4TXO B;  4D73 A;  2YV7 A;  3HZ4 A;  1O73 A;  1R4W A;  1ON4 A;  2VCT A;  2MMZ A;  3CTF A;  4WR5 A;  2CX3 A;  4BL7 A;  4JZQ A;  3DVX A;  3FHK A;  3LWA A;  2IWT A;  5DQS A;  4YQV A;  5CRE A;  3GX8 A;  3S9F A;  4ZB8 A;  3F4S A;  2DIY A;  5LD0 A;  1GLP A;  2EFE A;  1U3A A;  2QSI A;  3KCM A;  3PIN A;  3MDK A;  4XIH A;  4KW6 A;  5IO0 A;  5KEJ A;  1U6T A;  4QL7 A;  2CQ9 A;  1ZL9 A;  2X49 A;  2CAI A;  14GS A;  4I8B A;  4MA9 A;  4MDC A;  1AAZ A;  3UOM A;  6GSY A;  3L4N A;  2H76 A;  2YP6 A;  1GSY A;  5LNK e;  2ZCT A;  4K8M A;  1HD2 A;  1B48 A;  2UV8 G;  1BF5 A;  2IMF A;  4KDY A;  3PGT A;  1GTA A;  2H0H A;  2RLI A;  11GS A;  2TRX A;  3TJJ A;  3D22 A;  4IBP A;  4HU9 A;  1OC3 A;  2H19 A;  4ZB6 A;  12GS A;  4EC0 A;  4BVX B;  1XVQ A;  1PX7 A;  2H01 A;  3D4M A;  3QAG A;  3ZFL A;  4LMV A;  4G10 A;  3KEB A;  4GF0 A;  3ERG A;  2LEG A;  4JU5 A;  2BJX A;  2HNL A;  2OAD A;  4KAE A;  5AGY A;  3TCO A;  6GSW A;  4TR3 A;  1R26 A;  2X99 A;  3GKN A;  4FO5 A;  3I9V 2;  4NHW A;  2R5G A;  1URM A;  1K0C A;  3D6I A;  18GS A;  3C71 A;  1LBK A;  2HSN A;  5KN0 A;  3EWL A;  2YPM A;  1OYJ A;  2REM A;  1TDI A;  4OO5 A;  4KE3 A;  1EP7 A;  4N3Z A;  5ECM B;  4G0L A;  2K8V A;  3FRC A;  1AIU A;  3DIE A;  3F0I A;  3M8N A;  5LCZ A;  2DMM A;  4WKW A;  3DVW A;  2XHF A;  1FOH A;  5BRT A;  4RI6 A;  5HFG A;  3A5I A;  1GTB A;  3DWV A;  2JZT A;  2C0D A;  4FYU A;  1M2D A;  2PWJ A;  3Q6O A;  3KMN A;  2GQK A;  3EE2 A;  4AJ6 A;  2VD1 A;  2IIY A;  1OC9 B;  2FWG A;  5BMU B;  1SU9 A;  2LKU A;  4MZC A;  1USB A;  1JFU A;  3PPU A;  2R37 A;  4TN8 A;  2GT6 A;  4NMU A;  4G9H A;  4GRF A;  5ECR B;  3V1W A;  4EF0 A;  1XW9 A;  6GST A;  5CNW A;  4IKH A;  2RUF A;  3ZFB A;  1BED A;  5IMF A;  1UVZ A;  1K0N A;  2R0G A;  1GRX A;  2P5Q A;  4OCF A;  5A34 B;  3G7J A;  3ME7 A;  3SBC A;  1SVM A;  5A4U A;  4GQF A;  2GS3 A;  4PXO A;  4MJB A;  1X9W B;  4EE0 A;  4KCE A;  2MBT A;  4N10 A;  3UJ1 A;  5INY A;  4ZB7 A;  2O87 A;  4MPG A;  2CV4 A;  1OE8 A;  3ZIT A;  5G5F A;  2B1K A;  5IM9 A;  1OKD A;  4GQC A;  3LFL A;  3VWW A;  1VGL A;  3GH9 A;  3ZRE A;  4RQR A;  2PN8 A;  4KCA A;  2H71 A;  3DML A;  2GZP A;  4GTU A;  1YDK A;  4YQU A;  3JCM L;  2CT6 A;  4IN0 A;  4X1U A;  3TOU A;  2GLR A;  4EKZ A;  1S3A A;  2L4C A;  3TU3 B;  2IFQ A;  4V2M A;  4O5R A;  1JZD A;  3FZ4 A;  2KP1 A;  2IMD A;  2H72 A;  3Q19 A;  1X5C A;  4F03 A;  2DBC A;  1FHE A;  2GSQ A;  2O7K A;  1FG4 A;  4MAB A;  1MDI A;  1XXU A;  5HR1 A;  2H6Z A;  2NTO A;  4PQH A;  1M9B A;  1YKA A;  3TKS E;  1NM3 A;  1OKT A;  4XCS A;  1A23 A;  4X4J A;  2IPA A;  4KSM A;  3ME8 A;  1EOH A;  5DJM A;  5KN2 A;  4AKX B;  4G01 A;  1XCC A;  2HRF A;  2VCZ A;  1AQW A;  2IME A;  2EFD A;  5HFK A;  3BD2 A;  1YKC A;  4F0B A;  5J3R A;  1M99 A;  2H0I A;  1T00 A;  2HZE B;  3CBU A;  4NXI A;  3ZRD A;  4W66 A;  3LQ7 A;  3HA9 A;  3C1R A;  2A2S A;  2LJR A;  1OVN A;  1Y6E A;  5KN1 A;  4QMK A;  2YAN A;  4IVF A;  3QCP A;  2M46 A;  4KDX A;  2R2J A;  1O8X A;  4BPY A;  1SEN A;  1EEM A;  3FY7 A;  1G6Y A;  5ECS A;  3IHG A;  3HD5 A;  2B3S A;  4QL9 A;  2KLX A;  3CTG A;  3EMP A;  4TW5 A;  5ELA A;  1O8W A;  1QMV A;  2DJ2 A;  1VF3 A;  3QD9 A;  4QQ7 A;  3GL3 A;  3M1G A;  3ZZX A;  1YF1 A;  1WP0 A;  2XC2 A;  5CRW A;  2I4A A;  2RUE A;  2FWH A;  3VFI A;  4I5Q A;  4J56 E;  5J9C A;  3TJB A;  2EFH A;  1SVO A;  4XTS A;  1ERU A;  4FYB A;  2WZ9 A;  2MZC A;  3TJK A;  1V9W A;  3ZIV A;  4LL1 B;  4HS1 A;  5D9T A;  1XIY A;  2B1L A;  5IMV A;  2I1U A;  5AIS A;  5ABR A;  3A2X A;  3J7Y b;  1WOU A;  2F8F A;  3D5J A;  3UAP A;  2A2P A;  2OBK A;  2LQQ A;  1O85 A;  2H1A A;  2F8A A;  3FR9 A;  2WFC A;  2MMA A;  3A2W A;  1X9S B;  1SYR A;  2ON5 A;  3IK7 A;  3MNG A;  1Z9H A;  2AUV A;  3H93 A;  1QQ2 A;  2F9S A;  3QDN A;  3EUR A;  5HR0 A;  1T4Z A;  1A8Y A;  3M3M A;  4EIP A;  5EVO A;  1G0T A;  3D21 A;  3US3 A;  1EEJ A;  1WWJ A;  1ZMA A;  1VF2 A;  3FZ9 A;  3CSI A;  4IHU A;  3L78 A;  4MF6 A;  5B7C A;  4BVY A;  4ZBB A;  4N30 A;  4OFT A;  1BG1 A;  4PUR A;  1XW6 A;  2VLU A;  4F9Z A;  1U3I A;  1JLW A;  2I81 A;  1Z6N A;  3HVS A;  3W8S A;  3N9J A;  2O8V B;  2JL4 A;  4CY8 A;  3MYD A;  1KBN A;  4HOJ A;  1QK8 A;  5CRD A;  4ECI A;  5CRH A;  4Q5R A;  4I2T A;  3KTB A;  1PN0 A;  2X8G A;  2HE3 A;  2L5O A;  1MEK A;  2BTO T;  2EC4 A;  2LS5 A;  3IRA A;  2YZU A;  3RPN A;  5J9B A;  3IK9 A;  3ERW A;  1EZK A;  4XS6 A;  2JAC A;  4ULX A;  5F06 A;  3WGE A;  4IEL A;  1PSQ A;  4MLY A;  4DEJ A;  4HQZ A;  3D4T A;  3DYR A;  5DAK A;  2H75 A;  5B6N A;  1T8E B;  3IPZ A;  5DCG A;  2YWI A;  4Q5N A;  4RUV A;  2PMT A;  3FW2 A;  4PTS A;  1G7O A;  1CQG A;  5FT3 A;  4ECB A;  1ZYN A;  2WUL A;  3DXB A;  2L5L A;  1PRX A;  5AIV A;  2H1D A;  4ZL8 A;  1B4P A;  2FHE A;  3KIJ A;  1AXD A;  5A4W A;  4Q5F A;  5J4V A;  1TP9 A;  4ZXG A;  2OE3 A;  2IMK A;  4IP6 A;  1QGV A;  3FZA A;  4N0V A;  3TOT A;  5GSS A;  1J08 A;  3L9V A;  2LV3 A;  3G9B A;  4J2F A;  4N11 A;  3TJF A;  1ZYQ B;  1GSQ A;  1ZOF A;  3GNJ A;  4DSQ A;  2GZY A;  3IXR A;  4NHZ A;  3GTU B;  4WBJ A;  3IOS A;  2K6V A;  2VLT A;  4AKG A;  3MAK A;  3GH6 A;  4ISD A;  2YJH A;  3BOA A;  3IA1 A;  3F4R A;  4X0X A;  2FLS A;  1XWC A;  3CMI A;  1SVL A;  3QAV A;  4ECJ A;  22GS A;  4KND A;  3TDG A;  1RQM A;  3N5O A;  3TGZ A;  1G7E A;  2GSR A;  4HZ4 A;  1TXX A;  3GN3 A;  4K0G A;  3IC8 A;  4LL4 B;  1R7H A;  4OCE A;  4GCI A;  3ZYW A;  3APO A;  3VWV A;  1A0R P;  1GLQ A;  4TVE A;  1XWA A;  3FMW A;  2B7J A;  2KHP A;  1VRS D;  1OC9 A;  5DAL A;  2CVD A;  4MK3 A;  1R5P A;  1T3B A;  5BMU A;  5A5H B;  4HJM A;  3VI7 A;  3LSZ A;  4EDZ A;  1K0B A;  4TKY A;  2OAC A;  3IAM 2;  1EV9 A;  2GDR A;  2HLS A;  3GKK A;  1IYH A;  2XBQ A;  1NHO A;  4NV2 A;  2VM1 A;  3HXS A;  20GS A;  4YQM A;  5ID2 A;  1Z3E A;  1XW5 A;  1SL1 B;  4GSN A;  1GNW A;  2HYX A;  2R0C A;  3O6T A;  2LNT A;  1XPV A;  3TJG A;  2FD3 A;  5D96 A;  5A34 A;  4PQ1 A;  4JR6 A;  1GP1 A;  4Z2R A;  1R5A A;  2F3M A;  4V1A p;  1EP8 A;  1T7P B;  2ZNM A;  4E8H A;  4OO4 A;  1EOG A;  2YCD A;  1GTU A;  2ON7 A;  3WYW A;  5IIZ A;  2WJU A;  4EVM A;  1A2J A;  1PD2 1;  1PMT A;  4V1A g;  2DJ0 A;  4LLR A;  3MSZ A;  4A5P A;  4BL7 B;  1TKD B;  3J7Y k;  5IQY A;  2E2G A;  3UMA A;  1OE7 A;  4I2U A;  1FB0 A;  3ZL5 A;  1SYX A;  1ERW A;  1ILO A;  1XWK A;  1RK4 A;  1DBY A;  3E0U A;  4O32 A;  4POK A;  4L0W A;  1FAA A;  1A0F A;  2QA2 A;  3LJR A;  1M7T A;  4E68 A;  1PKZ A;  3GST A;  3GSS A;  2X8C A;  2HSH A;  3MWH A;  16GS A;  3LYK A;  1O7U A;  1A2M A;  2VAF A;  2D2Z A;  1BYE A;  5ECH B;  2ES7 A;  1K0D A;  5H5S A;  3I69 A;  2H74 A;  3TKP A;  1SL2 B;  6GSS A;  3CYN A;  4O7H A;  1VF4 A;  1Q98 A;  3HHV A;  4OD7 A;  1AQX A;  3I43 A;  1JZW A;  3ZMK A;  1SK1 A;  3U5R E;  1ZCP A;  1UN2 A;  1YF0 A;  3FYG A;  2KP2 A;  1F37 A;  3TKS A;  4NV5 A;  2C3N A;  3IV4 A;  3P90 A;  1ZYP A;  4PGT A;  2DKH A;  2PVO C;  2VCW A;  1K0O A;  3APQ A;  3BJ5 A;  1PL1 A;  2CX4 A;  1I5G A;  1TU7 A;  1HYU A;  1K0A A;  4K7N A;  4PNG A;  1F3B A;  1XWB A;  2LQO A;  4WEY A;  1XFL A;  1M2A A;  5CRG A;  5J40 A;  4EDY A;  1H75 A;  4DSS A;  5ENU A;  3Q18 A;  1WMJ A;  1TK0 B;  5IMD A;  4NPB A;  3GMF A;  3P7X A;  3P8W A;  2WGR A;  2QA1 A;  4JED A;  3IE3 A;  4G0K A;  4NAX A;  4K0N A;  2KUC A;  2X8H A;  4PX1 A;  1NSW A;  5JWQ B;  4TR4 A;  1XVW A;  3M9J A;  4MH2 A;  3UBK A;  2PU9 C;  1T1V A;  5CYY A;  5A1N B;  4EL1 A;  1TRW A;  1GTI A;  1YY7 A;  3UAR A;  2HT9 A;  1M0U A;  1K3O A;  1FVJ A;  2A4V A;  5ECK B;  2I3Y A;  1W4V A;  1WIK A;  3QAW A;  1DE2 A;  2FA4 A;  2GST A;  3FKF A;  1HQO A;  5A4V A;  3A3T A;  2I9H A;  1K3Y A;  1F2E A;  4XS4 B;  1N8J A;  1MTC A;  4GSS A;  4AGS A;  1V58 A;  1AC1 A;  2F51 A;  2HSM A;  4L0U A;  3AY8 A;  1BG5 A;  1K0M A;  2GGT A;  5HR2 A;  4ICY A;  1DSB A;  3L9S A;  3KH9 A;  2FA8 A;  1I9D A;  1B4Q A;  2IL3 A;  5DDL A;  1B9X C;  5KN3 A;  5HFI A;  3KJY A;  2QC7 A;  3Q74 A;  4ZL9 A;  2HRK A;  2P0G A;  1TXU A;  3KM6 A;  4PNF A;  1ML6 A;  1BQ7 A;  2RM6 A;  4PQI A;  3EIN A;  1TU8 A;  3PH9 A;  4EXJ A;  1PQN A;  3FZ5 A;  3KXO A;  4JE1 A;  3ZVJ D;  1GSS A;  3KTL A;  2PUK C;  3IR4 A;  1F6M C;  2DJ1 A;  2L59 A;  3BCI A;  2C3Q A;  4I97 A;  1WRY A;  4H86 A;  3RBT A;  4CDO A;  4TOP A;  2B5Y A;  4MNN A;  5EPF A;  2EFC A;  2ZUP A;  5KOW A;  3EU4 A;  2KOK A;  3HJO A;  2BMX A;  4L8E A;  2VM2 A;  1PN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...