3VIAA

Crystal structure of the ph domain of evectin-2 from human
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
112
structure length
112
Chain Sequence
GSMAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pleckstrin homology domain-containing family B member 2
publication title Structural basis of the strict phospholipid binding specificity of the pleckstrin homology domain of human evectin-2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 36
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00169 PH PH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3viaA00
4F7HA 4HB2B 1X05A 2P0HA 4DXAB 4K81A 4IOYX 2GCJA 1FB8A 2RUKB 1BWNA 4HAZB 3VIAA 4PQ0A 2CY5A 1P3RA 2LYDA 2MWNB 2VKIA 2YS1A 4BBKA 3PVUA 5JLJB 2PZ1A 5C5BA 2UZSA 5HE3A 1GC7A 1WG7A 2J0KA 1UNQA 4A6KA 2G35A 2Z0OA 1NI2A 1OY2A 5EFXA 1X86A 4TYZA 2NZ8B 3U7DA 1TQZA 4HB3B 4TKNA 2RVBB 1WJ1A 2COAA 3PP2A 4WSFA 1DROA 2XQNM 4HAUB 5JHHA 2Z0QA 1EF1A 2D11A 5FI0A 3ULCA 1SHCA 2NMBA 5D3WA 3DXEA 1X1FA 1J19A 1XODA 1WGUA 1ZSQA 1DDWA 1MK9B 1XX0A 3D8EA 3RCPA 1LW3A 3LJUX 3DXCA 1K5DB 1U2BA 2H7EA 4HAYB 2DFKA 2H7DA 4C0AA 1W1DA 2AEHA 2Y8GA 3A8PA 1U5DA 4IAPA 1RJ2A 2I1KA 1J0WA 4K2OA 1MIXA 3BINA 1NTVA 2DYNA 1AWEA 2LOZA 3KRXA 1OQNA 3PEGA 2CRFA 2MFQA 5C79A 4WJ7A 1XKEA 1UNPA 2P0FA 2DLWA 3D8DA 3FEHA 1FHXA 1PFJA 1ZC4B 4KVGB 5D3YA 3UZTA 1EAZA 2M14A 4A5KA 1W1GA 1XR0B 3P7ZA 4DX8A 3ZVRA 3F0WA 1K5GB 5DI9B 4D0NB 3U8ZA 2DTCA 4HDOA 2RNRB 3TVVA 1N3HA 1FGYA 2CODA 2RLOA 3FM8C 5DHFB 1NU2A 4MT7A 3F5RA 4HAXB 2RSGA 3MDBC 4HATB 1WVHA 1V89A 1V5UA 4KAXB 1PLSA 2LULA 2COFA 1MPHA 5HE2A 1QC6A 4GZUA 1I2HA 4EMOA 1DDVA 3KZ1A 3ODXA 3PZDA 2LG1A 3GYOA 1V61A 2YT0A 5D3XA 4HDQA 4GPTB 4KHAA 4F7GA 3WA0A 2L1CA 5C6RA 2I1JA 4DX90 2VRWB 3PG7A 2YSZA 4YL8A 5D3VA 4B6HA 4F7UP 2Z0PA 4GXBA 1FAOA 2OQBA 3AU4A 4XWXA 2W2WA 2K2UA 1AQCA 4GN1A 5KCVA 1U5GA 5HE1A 4MY6A 4GMXB 2E2XA 3KY9A 2CY4A 3TW1A 1ZM0A 3ODOA 1UPRA 2KCJA 4Z2MB 3TCAA 4EKUA 5GOWB 5DHAB 1KZ7A 2D9WA 1DBHA 1ISNA 1P5TA 1X1GA 2Q13A 1OMWA 3QBVB 3SNHA 3HK0A 1P6SA 2N23A 2J59M 1V5PA 5C16A 1MKEA 3D8FA 3T06A 4CHJA 2J0MA 2DN6A 2X18A 1UNRA 2RGNB 2QKLA 2K2JA 2W2XD 5J3TA 2D2QA 5J3YA 5D27A 2IYBA 4KHOA 4MK0A 2HTHB 3PVWA 3CXBB 2YS3A 1I7AA 4WVFB 1LB1A 5J3QA 3VOQA 4K2PA 2D9XA 5DIFB 1KI1B 2DYQA 5JP4A 1GG3A 3KSYA 3WYFB 4A6FB 5LOPB 1BTKA 4HB4B 3CIKA 1X11A 2OTXA 4CYEA 3SV1A 3KRWA 3SYXA 5DH9B 1XCGA 5CLLB 1NTYA 2R0DA 4EJNA 2CAYA 4ZRIA 3GYPA 2V76A 2MDXA 2YS5A 3FSSA 2LKOA 2GCLA 3PSCA 2EC1A 3NSUA 4DBBA 5L81A 2KUPA 3ODWA 3AU5A 3PVLA 2D9YA 2BCJA 5HE0A 1TJ6A 1V5MA 4NSWA 5JHGA 1IRSA 1KZGA 1M7RA 2P8VA 4GMVA 5FI1A 3ZDTA 3SUZA 2ADZA 3BJIA 2W2XC 4YONA 1BAKA 1FHOA 5KQ4A 1U5EA 5C5BB 1E5WA 1TXDA 3ULBA 4NY0A 1FOEA 3G9WA 3TO1A 3M1IB 5KQ1A 3P6AA 1BTNA 2Y8FA 3AJ4A 3V5WA 3MPXA 2EMSA 1W1HA 1Z87A 2GS0A 2ROZB 1MAIA 1ZC3B 3O96A 4ZRJA 4CHMA 4HAVB 4Y94A 2M38A 1U29A 1UPQA 2GJYA 1WGQA 4A6HA 2DX1A 2ELAA 4HHVA 1DDMA 1DYNA 1EVHA 3OANA 4ZRKA 2Y7BA 4K17A 1UEFA 1EGXA 2IFSA 3IVFA 1U5FA 2D10A 2P0DA 2ROVA 1H4RA 3HW2B 2DKQA 2D4QA 2DX5A 2I5FA 1PMSA 1WI1A 3X23A 2MKRA 2DHIA 3QWMA 1V88A 2COCA 4Z2NA 1B55A 1XD4A 1M7EA 2K00A 3N7CA 1FGZA 2QKMA 2I5CA 5LONB 4HB0B 2DA0A 2J0JA 3HQCA 1FHWA 3ML4A 4PNKA 1QQGA 4KHBB 3DXDA 2YF0A 5CLQB 1GC6A 4A6FA 2DHKA 2ELBA 1U27A 2YVCA 4L6EA 2ZPYA 2DKPA 4HAWB 2AL6A 3SO6A 2YRYA 2EJ8A 1SGHA 2UZRA 3A98B 1H10A 2EMTA 2R09A 1Y5OA 2D9VA 2N0YA 2VSZA 1ZVRA 4P7IA 2YT1A 2DHJA 1Q67A 2UVMA 4IFSA 2LOXA 2JP2A 3A8QA 1WJMA 2HE7A 3TFMA 2KGXB 1Y19B 4H8SA 1MIZB 2L2IA 2D9ZA 3QIJA 1MK7B 2FJLA 1RRPB
chains in the Genus database with same CATH superfamily
4F7HA 4HB2B 3U12A 1X05A 2P0HA 4DXAB 4K81A 4IOYX 2GCJA 1FB8A 2RUKB 1BWNA 4HAZB 3VIAA 4PQ0A 2CY5A 1P3RA 2LYDA 2MWNB 2VKIA 2YS1A 4BBKA 3PVUA 5JLJB 2PZ1A 5C5BA 2UZSA 5HE3A 2K49A 1GC7A 1WG7A 2J0KA 1UNQA 4A6KA 2G35A 2Z0OA 1NI2A 1OY2A 5EFXA 1X86A 4TYZA 2NZ8B 3U7DA 1TQZA 4HB3B 5IRSA 4TKNA 2RVBB 1WJ1A 2COAA 3PP2A 4WSFA 1DROA 2XQNM 4HAUB 2NBVA 4QJ5B 5JHHA 2Z0QA 1EF1A 2D11A 5FI0A 3ULCA 1SHCA 2NMBA 3NWFA 5D3WA 2Z13A 3DXEA 1X1FA 1J19A 1XODA 1WGUA 1ZSQA 1DDWA 1MK9B 1XX0A 3D8EA 3RCPA 1LW3A 3LJUX 3DXCA 1K5DB 1U2BA 2H7EA 4HAYB 2DFKA 2H7DA 4C0AA 1W1DA 3FVCA 2AEHA 2Y8GA 3A8PA 1U5DA 4IAPA 2Z4DA 1RJ2A 4KHBA 4QJ4B 2I1KA 1J0WA 4K2OA 1MIXA 3BINA 1NTVA 2DYNA 1AWEA 2LOZA 2KIGA 3KRXA 1OQNA 3PEGA 2CRFA 2MFQA 5C79A 4WJ7A 1XKEA 1UNPA 2P0FA 2DLWA 3D8DA 3FEHA 1FHXA 1PFJA 1ZC4B 4KVGB 5D3YA 3UZTA 1EAZA 2M14A 4A5KA 1W1GA 1XR0B 3P7ZA 4DX8A 2ZKMX 4CSQA 3ZVRA 3F0WA 1K5GB 5DI9B 4D0NB 3U8ZA 2DTCA 4HDOA 2RNRB 3TVVA 1N3HA 1FGYA 2CODA 2RLOA 3FM8C 5DHFB 1NU2A 4QJ3B 4MT7A 3F5RA 4HAXB 2KR0A 2RSGA 4DIXA 3MDBC 4HATB 2YT2A 1WVHA 1V89A 1V5UA 4KAXB 1PLSA 2LULA 5I2MA 2COFA 1ZYIA 1MPHA 5HE2A 1QC6A 5I2SA 4GZUA 1I2HA 4EMOA 1DDVA 3KZ1A 3ODXA 3PZDA 2LG1A 3GYOA 1V61A 2YT0A 5D3XA 5LG4B 4HDQA 4GPTB 4KHAA 4F7GA 3WA0A 2L1CA 4OSNA 5C6RA 2I1JA 4DX90 3B77A 2VRWB 3PG7A 2YSZA 4YL8A 5D3VA 4B6HA 4F7UP 2Z0PA 4GXBA 1FAOA 2OQBA 3AU4A 4XWXA 2W2WA 2K2UA 1AQCA 2Z14A 4GN1A 5KCVA 1U5GA 5HE1A 4MY6A 4GMXB 2FJUB 2E2XA 3KY9A 2CY4A 3TW1A 1ZM0A 3ODOA 1UPRA 2KCJA 4Z2MB 3TCAA 4EKUA 5GOWB 5DHAB 1KZ7A 2D9WA 1DBHA 1ISNA 1P5TA 1X1GA 2Q13A 3NWDA 1OMWA 3QBVB 3SNHA 3HK0A 3HIEA 1P6SA 2N23A 2J59M 1V5PA 5C16A 1MKEA 3D8FA 3T06A 4CHJA 2J0MA 2DN6A 2X18A 1UNRA 2RGNB 2QKLA 2K2JA 2W2XD 3A58A 5J3TA 2D2QA 5J3YA 5D27A 2IYBA 4HSIA 4KHOA 3DCXA 4MK0A 2HTHB 3PVWA 3CXBB 2YS3A 1I7AA 4WVFB 1LB1A 5J3QA 2KUQA 4QXAB 3VOQA 4K2PA 2D9XA 2KIEA 4L1RA 5DIFB 1KI1B 2DYQA 3NWAA 1GG3A 3KSYA 3WYFB 5JP4A 4A6FB 5LOPB 1BTKA 4HB4B 3CIKA 1X11A 2OTXA 4CYEA 3SV1A 3KRWA 3OHMB 3SYXA 5DH9B 1XCGA 5CLLB 1NTYA 2R0DA 4EJNA 2CAYA 4ZRIA 3GYPA 2V76A 2MDXA 2YS5A 3FSSA 2LKOA 2Z59A 2GCLA 3PSCA 2EC1A 3NSUA 4DBBA 5L81A 2KUPA 3ODWA 3AU5A 3PVLA 2D9YA 2BCJA 5HE0A 1TJ6A 1V5MA 4NSWA 5JHGA 1IRSA 1KZGA 1M7RA 2P8VA 4GMVA 5FI1A 3ZDTA 3SUZA 2ADZA 3BJIA 2W2XC 4YONA 1BAKA 1FHOA 5KQ4A 1U5EA 5C5BB 1E5WA 1TXDA 3ULBA 4NY0A 1FOEA 3G9WA 3TO1A 3M1IB 5KQ1A 3P6AA 4D6WA 1BTNA 2Y8FA 3AJ4A 3V5WA 3MPXA 2EMSA 1W1HA 1Z87A 2GS0A 2ROZB 1MAIA 1ZC3B 3O96A 4ZRJA 4CHMA 4HAVB 4Y94A 2M38A 1U29A 1UPQA 2GJYA 1WGQA 4A6HA 2DX1A 2ELAA 4HHVA 1DDMA 1DYNA 1EVHA 3OANA 4ZRKA 2Y7BA 4K17A 1UEFA 1EGXA 2GUMA 2IFSA 3IVFA 1U5FA 2D10A 2P0DA 2ROVA 1H4RA 3HW2B 4OT1A 2DKQA 2D4QA 2DX5A 2I5FA 1PMSA 1WI1A 3X23A 2MKRA 2DHIA 3QWMA 1V88A 2COCA 4Z2NA 1B55A 1XD4A 1M7EA 2K00A 3N7CA 1FGZA 2QKMA 2I5CA 5LONB 4HB0B 2DA0A 2J0JA 3HQCA 1FHWA 3ML4A 4PNKA 1QQGA 4KHBB 3DXDA 2YF0A 5CLQB 3NW8A 1GC6A 4A6FA 2DHKA 2ELBA 2K8EA 1U27A 2YVCA 4L6EA 2ZPYA 2DKPA 4HAWB 2AL6A 3SO6A 4GNKB 1MI1A 2YRYA 2EJ8A 1SGHA 2UZRA 3A98B 1H10A 3HSAA 2EMTA 2R09A 2R2YA 1T77A 1Y5OA 2D9VA 2N0YA 2VSZA 1ZVRA 4P7IA 2YT1A 2DHJA 1Q67A 2UVMA 4IFSA 2LOXA 2JP2A 3A8QA 1WJMA 2HE7A 4GOUA 5M4YB 2RRFA 3TFMA 2KGXB 1Y19B 4H8SA 1MIZB 2L2IA 2D9ZA 3QIJA 1MK7B 2FJLA 1RRPB
chains in the Genus database with same CATH topology
4F7HA 4HB2B 1X05A 2P0HA 4DXAB 4K81A 4IOYX 2GCJA 1FB8A 2RUKB 1BWNA 4HAZB 3VIAA 4PQ0A 2CY5A 1P3RA 2LYDA 2MWNB 2VKIA 2YS1A 4BBKA 3PVUA 5JLJB 2PZ1A 5C5BA 2UZSA 5HE3A 1GC7A 1WG7A 2J0KA 1UNQA 4A6KA 2G35A 2Z0OA 1NI2A 1OY2A 5EFXA 1X86A 4TYZA 2NZ8B 3U7DA 1TQZA 4HB3B 4TKNA 2RVBB 1WJ1A 2COAA 3PP2A 4WSFA 1DROA 2XQNM 4HAUB 5JHHA 2Z0QA 1EF1A 2D11A 5FI0A 3ULCA 1SHCA 2NMBA 5D3WA 3DXEA 1X1FA 1J19A 1XODA 1WGUA 1ZSQA 1DDWA 1MK9B 1XX0A 3D8EA 3RCPA 1LW3A 3LJUX 3DXCA 1K5DB 1U2BA 2H7EA 4HAYB 2DFKA 2H7DA 4C0AA 1W1DA 2AEHA 2Y8GA 3A8PA 1U5DA 4IAPA 1RJ2A 2I1KA 1J0WA 4K2OA 1MIXA 3BINA 1NTVA 2DYNA 1AWEA 2LOZA 3KRXA 1OQNA 3PEGA 2CRFA 2MFQA 5C79A 4WJ7A 1XKEA 1UNPA 2P0FA 2DLWA 3D8DA 3FEHA 1FHXA 1PFJA 1ZC4B 4KVGB 5D3YA 3UZTA 1EAZA 2M14A 4A5KA 1W1GA 1XR0B 3P7ZA 4DX8A 3ZVRA 3F0WA 1K5GB 5DI9B 4D0NB 3U8ZA 2DTCA 4HDOA 2RNRB 3TVVA 1N3HA 1FGYA 2CODA 2RLOA 3FM8C 5DHFB 1NU2A 4MT7A 3F5RA 4HAXB 2RSGA 3MDBC 4HATB 1WVHA 1V89A 1V5UA 4KAXB 1PLSA 2LULA 2COFA 1MPHA 5HE2A 1QC6A 4GZUA 1I2HA 4EMOA 1DDVA 3KZ1A 3ODXA 3PZDA 2LG1A 3GYOA 1V61A 2YT0A 5D3XA 4HDQA 4GPTB 4KHAA 4F7GA 3WA0A 2L1CA 5C6RA 2I1JA 4DX90 2VRWB 3PG7A 2YSZA 4YL8A 5D3VA 4B6HA 4F7UP 2Z0PA 4GXBA 1FAOA 2OQBA 3AU4A 4XWXA 2W2WA 2K2UA 1AQCA 4GN1A 5KCVA 1U5GA 5HE1A 4MY6A 4GMXB 2E2XA 3KY9A 2CY4A 3TW1A 1ZM0A 3ODOA 1UPRA 2KCJA 4Z2MB 3TCAA 4EKUA 5GOWB 5DHAB 1KZ7A 2D9WA 1DBHA 1ISNA 1P5TA 1X1GA 2Q13A 1OMWA 3QBVB 3SNHA 3HK0A 1P6SA 2N23A 2J59M 1V5PA 5C16A 1MKEA 3D8FA 3T06A 4CHJA 2J0MA 2DN6A 2X18A 1UNRA 2RGNB 2QKLA 2K2JA 2W2XD 5J3TA 2D2QA 5J3YA 5D27A 2IYBA 4KHOA 4MK0A 2HTHB 3PVWA 3CXBB 2YS3A 1I7AA 4WVFB 1LB1A 5J3QA 3VOQA 4K2PA 2D9XA 5DIFB 1KI1B 2DYQA 5JP4A 1GG3A 3KSYA 3WYFB 4A6FB 5LOPB 1BTKA 4HB4B 3CIKA 1X11A 2OTXA 4CYEA 3SV1A 3KRWA 3SYXA 5DH9B 1XCGA 5CLLB 1NTYA 2R0DA 4EJNA 2CAYA 4ZRIA 3GYPA 2V76A 2MDXA 2YS5A 3FSSA 2LKOA 2GCLA 3PSCA 2EC1A 3NSUA 4DBBA 5L81A 2KUPA 3ODWA 3AU5A 3PVLA 2D9YA 2BCJA 5HE0A 1TJ6A 1V5MA 4NSWA 5JHGA 1IRSA 1KZGA 1M7RA 2P8VA 4GMVA 5FI1A 3ZDTA 3SUZA 2ADZA 3BJIA 2W2XC 4YONA 1BAKA 1FHOA 5KQ4A 1U5EA 5C5BB 1E5WA 1TXDA 3ULBA 4NY0A 1FOEA 3G9WA 3TO1A 3M1IB 5KQ1A 3P6AA 1BTNA 2Y8FA 3AJ4A 3V5WA 3MPXA 2EMSA 1W1HA 1Z87A 2GS0A 2ROZB 1MAIA 1ZC3B 3O96A 4ZRJA 4CHMA 4HAVB 4Y94A 2M38A 1U29A 1UPQA 2GJYA 1WGQA 4A6HA 2DX1A 2ELAA 4HHVA 1DDMA 1DYNA 1EVHA 3OANA 4ZRKA 2Y7BA 4K17A 1UEFA 1EGXA 2IFSA 3IVFA 1U5FA 2D10A 2P0DA 2ROVA 1H4RA 3HW2B 2DKQA 2D4QA 2DX5A 2I5FA 1PMSA 1WI1A 3X23A 2MKRA 2DHIA 3QWMA 1V88A 2COCA 4Z2NA 1B55A 1XD4A 1M7EA 2K00A 3N7CA 1FGZA 2QKMA 2I5CA 5LONB 4HB0B 2DA0A 2J0JA 3HQCA 1FHWA 3ML4A 4PNKA 1QQGA 4KHBB 3DXDA 2YF0A 5CLQB 1GC6A 4A6FA 2DHKA 2ELBA 1U27A 2YVCA 4L6EA 2ZPYA 2DKPA 4HAWB 2AL6A 3SO6A 2YRYA 2EJ8A 1SGHA 2UZRA 3A98B 1H10A 2EMTA 2R09A 1Y5OA 2D9VA 2N0YA 2VSZA 1ZVRA 4P7IA 2YT1A 2DHJA 1Q67A 2UVMA 4IFSA 2LOXA 2JP2A 3A8QA 1WJMA 2HE7A 3TFMA 2KGXB 1Y19B 4H8SA 1MIZB 2L2IA 2D9ZA 3QIJA 1MK7B 2FJLA 1RRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7H A;  4HB2 B;  1X05 A;  2P0H A;  4DXA B;  4K81 A;  4IOY X;  2GCJ A;  1FB8 A;  2RUK B;  1BWN A;  4HAZ B;  3VIA A;  4PQ0 A;  2CY5 A;  1P3R A;  2LYD A;  2MWN B;  2VKI A;  2YS1 A;  4BBK A;  3PVU A;  5JLJ B;  2PZ1 A;  5C5B A;  2UZS A;  5HE3 A;  1GC7 A;  1WG7 A;  2J0K A;  1UNQ A;  4A6K A;  2G35 A;  2Z0O A;  1NI2 A;  1OY2 A;  5EFX A;  1X86 A;  4TYZ A;  2NZ8 B;  3U7D A;  1TQZ A;  4HB3 B;  4TKN A;  2RVB B;  1WJ1 A;  2COA A;  3PP2 A;  4WSF A;  1DRO A;  2XQN M;  4HAU B;  5JHH A;  2Z0Q A;  1EF1 A;  2D11 A;  5FI0 A;  3ULC A;  1SHC A;  2NMB A;  5D3W A;  3DXE A;  1X1F A;  1J19 A;  1XOD A;  1WGU A;  1ZSQ A;  1DDW A;  1MK9 B;  1XX0 A;  3D8E A;  3RCP A;  1LW3 A;  3LJU X;  3DXC A;  1K5D B;  1U2B A;  2H7E A;  4HAY B;  2DFK A;  2H7D A;  4C0A A;  1W1D A;  2AEH A;  2Y8G A;  3A8P A;  1U5D A;  4IAP A;  1RJ2 A;  2I1K A;  1J0W A;  4K2O A;  1MIX A;  3BIN A;  1NTV A;  2DYN A;  1AWE A;  2LOZ A;  3KRX A;  1OQN A;  3PEG A;  2CRF A;  2MFQ A;  5C79 A;  4WJ7 A;  1XKE A;  1UNP A;  2P0F A;  2DLW A;  3D8D A;  3FEH A;  1FHX A;  1PFJ A;  1ZC4 B;  4KVG B;  5D3Y A;  3UZT A;  1EAZ A;  2M14 A;  4A5K A;  1W1G A;  1XR0 B;  3P7Z A;  4DX8 A;  3ZVR A;  3F0W A;  1K5G B;  5DI9 B;  4D0N B;  3U8Z A;  2DTC A;  4HDO A;  2RNR B;  3TVV A;  1N3H A;  1FGY A;  2COD A;  2RLO A;  3FM8 C;  5DHF B;  1NU2 A;  4MT7 A;  3F5R A;  4HAX B;  2RSG A;  3MDB C;  4HAT B;  1WVH A;  1V89 A;  1V5U A;  4KAX B;  1PLS A;  2LUL A;  2COF A;  1MPH A;  5HE2 A;  1QC6 A;  4GZU A;  1I2H A;  4EMO A;  1DDV A;  3KZ1 A;  3ODX A;  3PZD A;  2LG1 A;  3GYO A;  1V61 A;  2YT0 A;  5D3X A;  4HDQ A;  4GPT B;  4KHA A;  4F7G A;  3WA0 A;  2L1C A;  5C6R A;  2I1J A;  4DX9 0;  2VRW B;  3PG7 A;  2YSZ A;  4YL8 A;  5D3V A;  4B6H A;  4F7U P;  2Z0P A;  4GXB A;  1FAO A;  2OQB A;  3AU4 A;  4XWX A;  2W2W A;  2K2U A;  1AQC A;  4GN1 A;  5KCV A;  1U5G A;  5HE1 A;  4MY6 A;  4GMX B;  2E2X A;  3KY9 A;  2CY4 A;  3TW1 A;  1ZM0 A;  3ODO A;  1UPR A;  2KCJ A;  4Z2M B;  3TCA A;  4EKU A;  5GOW B;  5DHA B;  1KZ7 A;  2D9W A;  1DBH A;  1ISN A;  1P5T A;  1X1G A;  2Q13 A;  1OMW A;  3QBV B;  3SNH A;  3HK0 A;  1P6S A;  2N23 A;  2J59 M;  1V5P A;  5C16 A;  1MKE A;  3D8F A;  3T06 A;  4CHJ A;  2J0M A;  2DN6 A;  2X18 A;  1UNR A;  2RGN B;  2QKL A;  2K2J A;  2W2X D;  5J3T A;  2D2Q A;  5J3Y A;  5D27 A;  2IYB A;  4KHO A;  4MK0 A;  2HTH B;  3PVW A;  3CXB B;  2YS3 A;  1I7A A;  4WVF B;  1LB1 A;  5J3Q A;  3VOQ A;  4K2P A;  2D9X A;  5DIF B;  1KI1 B;  2DYQ A;  5JP4 A;  1GG3 A;  3KSY A;  3WYF B;  4A6F B;  5LOP B;  1BTK A;  4HB4 B;  3CIK A;  1X11 A;  2OTX A;  4CYE A;  3SV1 A;  3KRW A;  3SYX A;  5DH9 B;  1XCG A;  5CLL B;  1NTY A;  2R0D A;  4EJN A;  2CAY A;  4ZRI A;  3GYP A;  2V76 A;  2MDX A;  2YS5 A;  3FSS A;  2LKO A;  2GCL A;  3PSC A;  2EC1 A;  3NSU A;  4DBB A;  5L81 A;  2KUP A;  3ODW A;  3AU5 A;  3PVL A;  2D9Y A;  2BCJ A;  5HE0 A;  1TJ6 A;  1V5M A;  4NSW A;  5JHG A;  1IRS A;  1KZG A;  1M7R A;  2P8V A;  4GMV A;  5FI1 A;  3ZDT A;  3SUZ A;  2ADZ A;  3BJI A;  2W2X C;  4YON A;  1BAK A;  1FHO A;  5KQ4 A;  1U5E A;  5C5B B;  1E5W A;  1TXD A;  3ULB A;  4NY0 A;  1FOE A;  3G9W A;  3TO1 A;  3M1I B;  5KQ1 A;  3P6A A;  1BTN A;  2Y8F A;  3AJ4 A;  3V5W A;  3MPX A;  2EMS A;  1W1H A;  1Z87 A;  2GS0 A;  2ROZ B;  1MAI A;  1ZC3 B;  3O96 A;  4ZRJ A;  4CHM A;  4HAV B;  4Y94 A;  2M38 A;  1U29 A;  1UPQ A;  2GJY A;  1WGQ A;  4A6H A;  2DX1 A;  2ELA A;  4HHV A;  1DDM A;  1DYN A;  1EVH A;  3OAN A;  4ZRK A;  2Y7B A;  4K17 A;  1UEF A;  1EGX A;  2IFS A;  3IVF A;  1U5F A;  2D10 A;  2P0D A;  2ROV A;  1H4R A;  3HW2 B;  2DKQ A;  2D4Q A;  2DX5 A;  2I5F A;  1PMS A;  1WI1 A;  3X23 A;  2MKR A;  2DHI A;  3QWM A;  1V88 A;  2COC A;  4Z2N A;  1B55 A;  1XD4 A;  1M7E A;  2K00 A;  3N7C A;  1FGZ A;  2QKM A;  2I5C A;  5LON B;  4HB0 B;  2DA0 A;  2J0J A;  3HQC A;  1FHW A;  3ML4 A;  4PNK A;  1QQG A;  4KHB B;  3DXD A;  2YF0 A;  5CLQ B;  1GC6 A;  4A6F A;  2DHK A;  2ELB A;  1U27 A;  2YVC A;  4L6E A;  2ZPY A;  2DKP A;  4HAW B;  2AL6 A;  3SO6 A;  2YRY A;  2EJ8 A;  1SGH A;  2UZR A;  3A98 B;  1H10 A;  2EMT A;  2R09 A;  1Y5O A;  2D9V A;  2N0Y A;  2VSZ A;  1ZVR A;  4P7I A;  2YT1 A;  2DHJ A;  1Q67 A;  2UVM A;  4IFS A;  2LOX A;  2JP2 A;  3A8Q A;  1WJM A;  2HE7 A;  3TFM A;  2KGX B;  1Y19 B;  4H8S A;  1MIZ B;  2L2I A;  2D9Z A;  3QIJ A;  1MK7 B;  2FJL A;  1RRP B; 
#chains in the Genus database with same CATH topology
 4F7H A;  4HB2 B;  3U12 A;  1X05 A;  2P0H A;  4DXA B;  4K81 A;  4IOY X;  2GCJ A;  1FB8 A;  2RUK B;  1BWN A;  4HAZ B;  3VIA A;  4PQ0 A;  2CY5 A;  1P3R A;  2LYD A;  2MWN B;  2VKI A;  2YS1 A;  4BBK A;  3PVU A;  5JLJ B;  2PZ1 A;  5C5B A;  2UZS A;  5HE3 A;  2K49 A;  1GC7 A;  1WG7 A;  2J0K A;  1UNQ A;  4A6K A;  2G35 A;  2Z0O A;  1NI2 A;  1OY2 A;  5EFX A;  1X86 A;  4TYZ A;  2NZ8 B;  3U7D A;  1TQZ A;  4HB3 B;  5IRS A;  4TKN A;  2RVB B;  1WJ1 A;  2COA A;  3PP2 A;  4WSF A;  1DRO A;  2XQN M;  4HAU B;  2NBV A;  4QJ5 B;  5JHH A;  2Z0Q A;  1EF1 A;  2D11 A;  5FI0 A;  3ULC A;  1SHC A;  2NMB A;  3NWF A;  5D3W A;  2Z13 A;  3DXE A;  1X1F A;  1J19 A;  1XOD A;  1WGU A;  1ZSQ A;  1DDW A;  1MK9 B;  1XX0 A;  3D8E A;  3RCP A;  1LW3 A;  3LJU X;  3DXC A;  1K5D B;  1U2B A;  2H7E A;  4HAY B;  2DFK A;  2H7D A;  4C0A A;  1W1D A;  3FVC A;  2AEH A;  2Y8G A;  3A8P A;  1U5D A;  4IAP A;  2Z4D A;  1RJ2 A;  4KHB A;  4QJ4 B;  2I1K A;  1J0W A;  4K2O A;  1MIX A;  3BIN A;  1NTV A;  2DYN A;  1AWE A;  2LOZ A;  2KIG A;  3KRX A;  1OQN A;  3PEG A;  2CRF A;  2MFQ A;  5C79 A;  4WJ7 A;  1XKE A;  1UNP A;  2P0F A;  2DLW A;  3D8D A;  3FEH A;  1FHX A;  1PFJ A;  1ZC4 B;  4KVG B;  5D3Y A;  3UZT A;  1EAZ A;  2M14 A;  4A5K A;  1W1G A;  1XR0 B;  3P7Z A;  4DX8 A;  2ZKM X;  4CSQ A;  3ZVR A;  3F0W A;  1K5G B;  5DI9 B;  4D0N B;  3U8Z A;  2DTC A;  4HDO A;  2RNR B;  3TVV A;  1N3H A;  1FGY A;  2COD A;  2RLO A;  3FM8 C;  5DHF B;  1NU2 A;  4QJ3 B;  4MT7 A;  3F5R A;  4HAX B;  2KR0 A;  2RSG A;  4DIX A;  3MDB C;  4HAT B;  2YT2 A;  1WVH A;  1V89 A;  1V5U A;  4KAX B;  1PLS A;  2LUL A;  5I2M A;  2COF A;  1ZYI A;  1MPH A;  5HE2 A;  1QC6 A;  5I2S A;  4GZU A;  1I2H A;  4EMO A;  1DDV A;  3KZ1 A;  3ODX A;  3PZD A;  2LG1 A;  3GYO A;  1V61 A;  2YT0 A;  5D3X A;  5LG4 B;  4HDQ A;  4GPT B;  4KHA A;  4F7G A;  3WA0 A;  2L1C A;  4OSN A;  5C6R A;  2I1J A;  4DX9 0;  3B77 A;  2VRW B;  3PG7 A;  2YSZ A;  4YL8 A;  5D3V A;  4B6H A;  4F7U P;  2Z0P A;  4GXB A;  1FAO A;  2OQB A;  3AU4 A;  4XWX A;  2W2W A;  2K2U A;  1AQC A;  2Z14 A;  4GN1 A;  5KCV A;  1U5G A;  5HE1 A;  4MY6 A;  4GMX B;  2FJU B;  2E2X A;  3KY9 A;  2CY4 A;  3TW1 A;  1ZM0 A;  3ODO A;  1UPR A;  2KCJ A;  4Z2M B;  3TCA A;  4EKU A;  5GOW B;  5DHA B;  1KZ7 A;  2D9W A;  1DBH A;  1ISN A;  1P5T A;  1X1G A;  2Q13 A;  3NWD A;  1OMW A;  3QBV B;  3SNH A;  3HK0 A;  3HIE A;  1P6S A;  2N23 A;  2J59 M;  1V5P A;  5C16 A;  1MKE A;  3D8F A;  3T06 A;  4CHJ A;  2J0M A;  2DN6 A;  2X18 A;  1UNR A;  2RGN B;  2QKL A;  2K2J A;  2W2X D;  3A58 A;  5J3T A;  2D2Q A;  5J3Y A;  5D27 A;  2IYB A;  4HSI A;  4KHO A;  3DCX A;  4MK0 A;  2HTH B;  3PVW A;  3CXB B;  2YS3 A;  1I7A A;  4WVF B;  1LB1 A;  5J3Q A;  2KUQ A;  4QXA B;  3VOQ A;  4K2P A;  2D9X A;  2KIE A;  4L1R A;  5DIF B;  1KI1 B;  2DYQ A;  3NWA A;  1GG3 A;  3KSY A;  3WYF B;  5JP4 A;  4A6F B;  5LOP B;  1BTK A;  4HB4 B;  3CIK A;  1X11 A;  2OTX A;  4CYE A;  3SV1 A;  3KRW A;  3OHM B;  3SYX A;  5DH9 B;  1XCG A;  5CLL B;  1NTY A;  2R0D A;  4EJN A;  2CAY A;  4ZRI A;  3GYP A;  2V76 A;  2MDX A;  2YS5 A;  3FSS A;  2LKO A;  2Z59 A;  2GCL A;  3PSC A;  2EC1 A;  3NSU A;  4DBB A;  5L81 A;  2KUP A;  3ODW A;  3AU5 A;  3PVL A;  2D9Y A;  2BCJ A;  5HE0 A;  1TJ6 A;  1V5M A;  4NSW A;  5JHG A;  1IRS A;  1KZG A;  1M7R A;  2P8V A;  4GMV A;  5FI1 A;  3ZDT A;  3SUZ A;  2ADZ A;  3BJI A;  2W2X C;  4YON A;  1BAK A;  1FHO A;  5KQ4 A;  1U5E A;  5C5B B;  1E5W A;  1TXD A;  3ULB A;  4NY0 A;  1FOE A;  3G9W A;  3TO1 A;  3M1I B;  5KQ1 A;  3P6A A;  4D6W A;  1BTN A;  2Y8F A;  3AJ4 A;  3V5W A;  3MPX A;  2EMS A;  1W1H A;  1Z87 A;  2GS0 A;  2ROZ B;  1MAI A;  1ZC3 B;  3O96 A;  4ZRJ A;  4CHM A;  4HAV B;  4Y94 A;  2M38 A;  1U29 A;  1UPQ A;  2GJY A;  1WGQ A;  4A6H A;  2DX1 A;  2ELA A;  4HHV A;  1DDM A;  1DYN A;  1EVH A;  3OAN A;  4ZRK A;  2Y7B A;  4K17 A;  1UEF A;  1EGX A;  2GUM A;  2IFS A;  3IVF A;  1U5F A;  2D10 A;  2P0D A;  2ROV A;  1H4R A;  3HW2 B;  4OT1 A;  2DKQ A;  2D4Q A;  2DX5 A;  2I5F A;  1PMS A;  1WI1 A;  3X23 A;  2MKR A;  2DHI A;  3QWM A;  1V88 A;  2COC A;  4Z2N A;  1B55 A;  1XD4 A;  1M7E A;  2K00 A;  3N7C A;  1FGZ A;  2QKM A;  2I5C A;  5LON B;  4HB0 B;  2DA0 A;  2J0J A;  3HQC A;  1FHW A;  3ML4 A;  4PNK A;  1QQG A;  4KHB B;  3DXD A;  2YF0 A;  5CLQ B;  3NW8 A;  1GC6 A;  4A6F A;  2DHK A;  2ELB A;  2K8E A;  1U27 A;  2YVC A;  4L6E A;  2ZPY A;  2DKP A;  4HAW B;  2AL6 A;  3SO6 A;  4GNK B;  1MI1 A;  2YRY A;  2EJ8 A;  1SGH A;  2UZR A;  3A98 B;  1H10 A;  3HSA A;  2EMT A;  2R09 A;  2R2Y A;  1T77 A;  1Y5O A;  2D9V A;  2N0Y A;  2VSZ A;  1ZVR A;  4P7I A;  2YT1 A;  2DHJ A;  1Q67 A;  2UVM A;  4IFS A;  2LOX A;  2JP2 A;  3A8Q A;  1WJM A;  2HE7 A;  4GOU A;  5M4Y B;  2RRF A;  3TFM A;  2KGX B;  1Y19 B;  4H8S A;  1MIZ B;  2L2I A;  2D9Z A;  3QIJ A;  1MK7 B;  2FJL A;  1RRP B; 
#chains in the Genus database with same CATH homology
 4F7H A;  4HB2 B;  1X05 A;  2P0H A;  4DXA B;  4K81 A;  4IOY X;  2GCJ A;  1FB8 A;  2RUK B;  1BWN A;  4HAZ B;  3VIA A;  4PQ0 A;  2CY5 A;  1P3R A;  2LYD A;  2MWN B;  2VKI A;  2YS1 A;  4BBK A;  3PVU A;  5JLJ B;  2PZ1 A;  5C5B A;  2UZS A;  5HE3 A;  1GC7 A;  1WG7 A;  2J0K A;  1UNQ A;  4A6K A;  2G35 A;  2Z0O A;  1NI2 A;  1OY2 A;  5EFX A;  1X86 A;  4TYZ A;  2NZ8 B;  3U7D A;  1TQZ A;  4HB3 B;  4TKN A;  2RVB B;  1WJ1 A;  2COA A;  3PP2 A;  4WSF A;  1DRO A;  2XQN M;  4HAU B;  5JHH A;  2Z0Q A;  1EF1 A;  2D11 A;  5FI0 A;  3ULC A;  1SHC A;  2NMB A;  5D3W A;  3DXE A;  1X1F A;  1J19 A;  1XOD A;  1WGU A;  1ZSQ A;  1DDW A;  1MK9 B;  1XX0 A;  3D8E A;  3RCP A;  1LW3 A;  3LJU X;  3DXC A;  1K5D B;  1U2B A;  2H7E A;  4HAY B;  2DFK A;  2H7D A;  4C0A A;  1W1D A;  2AEH A;  2Y8G A;  3A8P A;  1U5D A;  4IAP A;  1RJ2 A;  2I1K A;  1J0W A;  4K2O A;  1MIX A;  3BIN A;  1NTV A;  2DYN A;  1AWE A;  2LOZ A;  3KRX A;  1OQN A;  3PEG A;  2CRF A;  2MFQ A;  5C79 A;  4WJ7 A;  1XKE A;  1UNP A;  2P0F A;  2DLW A;  3D8D A;  3FEH A;  1FHX A;  1PFJ A;  1ZC4 B;  4KVG B;  5D3Y A;  3UZT A;  1EAZ A;  2M14 A;  4A5K A;  1W1G A;  1XR0 B;  3P7Z A;  4DX8 A;  3ZVR A;  3F0W A;  1K5G B;  5DI9 B;  4D0N B;  3U8Z A;  2DTC A;  4HDO A;  2RNR B;  3TVV A;  1N3H A;  1FGY A;  2COD A;  2RLO A;  3FM8 C;  5DHF B;  1NU2 A;  4MT7 A;  3F5R A;  4HAX B;  2RSG A;  3MDB C;  4HAT B;  1WVH A;  1V89 A;  1V5U A;  4KAX B;  1PLS A;  2LUL A;  2COF A;  1MPH A;  5HE2 A;  1QC6 A;  4GZU A;  1I2H A;  4EMO A;  1DDV A;  3KZ1 A;  3ODX A;  3PZD A;  2LG1 A;  3GYO A;  1V61 A;  2YT0 A;  5D3X A;  4HDQ A;  4GPT B;  4KHA A;  4F7G A;  3WA0 A;  2L1C A;  5C6R A;  2I1J A;  4DX9 0;  2VRW B;  3PG7 A;  2YSZ A;  4YL8 A;  5D3V A;  4B6H A;  4F7U P;  2Z0P A;  4GXB A;  1FAO A;  2OQB A;  3AU4 A;  4XWX A;  2W2W A;  2K2U A;  1AQC A;  4GN1 A;  5KCV A;  1U5G A;  5HE1 A;  4MY6 A;  4GMX B;  2E2X A;  3KY9 A;  2CY4 A;  3TW1 A;  1ZM0 A;  3ODO A;  1UPR A;  2KCJ A;  4Z2M B;  3TCA A;  4EKU A;  5GOW B;  5DHA B;  1KZ7 A;  2D9W A;  1DBH A;  1ISN A;  1P5T A;  1X1G A;  2Q13 A;  1OMW A;  3QBV B;  3SNH A;  3HK0 A;  1P6S A;  2N23 A;  2J59 M;  1V5P A;  5C16 A;  1MKE A;  3D8F A;  3T06 A;  4CHJ A;  2J0M A;  2DN6 A;  2X18 A;  1UNR A;  2RGN B;  2QKL A;  2K2J A;  2W2X D;  5J3T A;  2D2Q A;  5J3Y A;  5D27 A;  2IYB A;  4KHO A;  4MK0 A;  2HTH B;  3PVW A;  3CXB B;  2YS3 A;  1I7A A;  4WVF B;  1LB1 A;  5J3Q A;  3VOQ A;  4K2P A;  2D9X A;  5DIF B;  1KI1 B;  2DYQ A;  5JP4 A;  1GG3 A;  3KSY A;  3WYF B;  4A6F B;  5LOP B;  1BTK A;  4HB4 B;  3CIK A;  1X11 A;  2OTX A;  4CYE A;  3SV1 A;  3KRW A;  3SYX A;  5DH9 B;  1XCG A;  5CLL B;  1NTY A;  2R0D A;  4EJN A;  2CAY A;  4ZRI A;  3GYP A;  2V76 A;  2MDX A;  2YS5 A;  3FSS A;  2LKO A;  2GCL A;  3PSC A;  2EC1 A;  3NSU A;  4DBB A;  5L81 A;  2KUP A;  3ODW A;  3AU5 A;  3PVL A;  2D9Y A;  2BCJ A;  5HE0 A;  1TJ6 A;  1V5M A;  4NSW A;  5JHG A;  1IRS A;  1KZG A;  1M7R A;  2P8V A;  4GMV A;  5FI1 A;  3ZDT A;  3SUZ A;  2ADZ A;  3BJI A;  2W2X C;  4YON A;  1BAK A;  1FHO A;  5KQ4 A;  1U5E A;  5C5B B;  1E5W A;  1TXD A;  3ULB A;  4NY0 A;  1FOE A;  3G9W A;  3TO1 A;  3M1I B;  5KQ1 A;  3P6A A;  1BTN A;  2Y8F A;  3AJ4 A;  3V5W A;  3MPX A;  2EMS A;  1W1H A;  1Z87 A;  2GS0 A;  2ROZ B;  1MAI A;  1ZC3 B;  3O96 A;  4ZRJ A;  4CHM A;  4HAV B;  4Y94 A;  2M38 A;  1U29 A;  1UPQ A;  2GJY A;  1WGQ A;  4A6H A;  2DX1 A;  2ELA A;  4HHV A;  1DDM A;  1DYN A;  1EVH A;  3OAN A;  4ZRK A;  2Y7B A;  4K17 A;  1UEF A;  1EGX A;  2IFS A;  3IVF A;  1U5F A;  2D10 A;  2P0D A;  2ROV A;  1H4R A;  3HW2 B;  2DKQ A;  2D4Q A;  2DX5 A;  2I5F A;  1PMS A;  1WI1 A;  3X23 A;  2MKR A;  2DHI A;  3QWM A;  1V88 A;  2COC A;  4Z2N A;  1B55 A;  1XD4 A;  1M7E A;  2K00 A;  3N7C A;  1FGZ A;  2QKM A;  2I5C A;  5LON B;  4HB0 B;  2DA0 A;  2J0J A;  3HQC A;  1FHW A;  3ML4 A;  4PNK A;  1QQG A;  4KHB B;  3DXD A;  2YF0 A;  5CLQ B;  1GC6 A;  4A6F A;  2DHK A;  2ELB A;  1U27 A;  2YVC A;  4L6E A;  2ZPY A;  2DKP A;  4HAW B;  2AL6 A;  3SO6 A;  2YRY A;  2EJ8 A;  1SGH A;  2UZR A;  3A98 B;  1H10 A;  2EMT A;  2R09 A;  1Y5O A;  2D9V A;  2N0Y A;  2VSZ A;  1ZVR A;  4P7I A;  2YT1 A;  2DHJ A;  1Q67 A;  2UVM A;  4IFS A;  2LOX A;  2JP2 A;  3A8Q A;  1WJM A;  2HE7 A;  3TFM A;  2KGX B;  1Y19 B;  4H8S A;  1MIZ B;  2L2I A;  2D9Z A;  3QIJ A;  1MK7 B;  2FJL A;  1RRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...