3VIBA

Structural basis for multidrug recognition and antimicrobial resistance by mtrr, an efflux pump regulator from neisseria gonorrhoeae
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
202
structure length
193
Chain Sequence
ALKTKEHLMLAALETFYRKGIARTSLNEIAQAAGVTRDALYWHFKNKEDLFDALFQRICDDIENCIGSWTVFRHTLLHFFERLQSNDIHYKFHNILFLKCEHTEQNAAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSSGESFDLGKTAPRIIGIMMDNLENHPCLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MtrR
publication title Structural basis for multidrug recognitionand antimicrobial resistance by MTRR, an efflux pump regulator from Neisseria Gonorrhoeae
rcsb
source organism Neisseria gonorrhoeae
molecule tags Dna binding protein
total genus 81
structure length 193
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08361 TetR_C_2 MAATS-type transcriptional repressor, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vibA00
3QPSA 2WV1A 5D19A 1Z77A 1JUMA 2XPVA 4X1EA 3JSJA 1RPWA 2G3BA 2HYTA 3BR6A 2QKOA 3IH2A 1JUSA 3PM1A 4JYKA 2QIBA 3TP3A 2RAEA 2O7OA 4YZEA 2OF7A 2DG8A 4ICHA 5F0CA 3CJDA 2XGCA 5HBUA 3BCGA 2ZCMA 3VUQA 3AQTA 2I10A 3IH3A 2GENA 2RASA 1U9OA 2G7GA 2GUHA 2ID6A 1RKTA 5EZGA 3V6GA 3E7QA 2VKVA 2IU5A 3HTIA 5F0FA 3ZQHA 4CGRA 3WHCA 3V78A 2XPUA 3KZ9A 2Y31A 3RD3A 5F1JA 2IEKA 5H9TA 4MK6A 2DTZA 2RHAA 4V2GA 3VVYA 5K7HA 3CDLA 4DW6A 3EUPA 3QPLA 3GZIA 4G12A 5GPCA 5FKKA 5IP6A 2IAIA 5J1RA 3CWRA 3BQYA 4AUXA 1ZKGA 1QVTA 3VVZA 3ON4A 5J1UA 2PZ9A 2UXOA 4HKUA 4GCTA 3PASA 3LHQA 2GBYA 3Q0UA 3VW1A 5CW8A 2JJ7A 3NNRA 2XPWA 2Y2ZA 2VKEA 3G1LA 3HGYA 2D6YA 2NP3A 3KKCA 4GFLA 5EFYA 2OI8A 2X9DA 1ORKA 4L62A 3ANGA 2YVHA 3HE0A 3VW0A 2DG7A 4D5FA 3KKDA 5AQCA 2FBQA 3BR1A 4PXIA 1A6IA 3G56A 4KWAA 2ZOZA 3LSRA 4I76A 2XRLA 3QKXA 3BNIA 1U9NA 3P9TA 2G7LA 5F0HA 2XDNA 3VW2A 3LSJA 2F07A 1T56A 3S5RA 3BTCA 5FMPA 1BJZA 4B3AA 2HXOA 3FK7A 5FKNA 3B6CA 3DCFA 3PPBA 1VI0A 5DAJA 1QVUA 3G1OA 5C4YA 4ME9A 3HGGA 4AC0A 3WHBA 4JNNA 2QCOA 3HTAA 3KNWA 3BTLA 3BJBA 3BT9A 3SFIA 1ZK8A 5FKMA 3CRJA 5EZHA 2XGEA 1Z0XA 2OERA 5IOZA 3C07A 3Q3SA 4I6ZA 5CXGA 4XK4A 5IPAA 2EH3A 3DPJA 1RKWA 3BRUA 3NPIA 2HXIA 2O7TA 2FD5A 5GPAA 2ZB9A 4M3DA 3ZQFA 4GCLA 2FJ1A 2JK3A 2GFNA 3CCYA 1SGMA 3BR0A 3O60A 3HTJA 3O8HA 2ZCXA 3ON2A 4M3GA 4D7MA 1JTYA 1UI6A 2VPRA 3IUVA 3NXCA 2UXPA 4JKZA 3F0CA 2Q24A 5K7ZA 3MNLA 3VIBA 1T33A 2TCTA 2WUIA 2UXUA 4MO7A 4ABZA 1JUPA 2HYJA 2FX0A 3VVXA 2ZCNA 2OPTA 2UXIA 3IH4A 2TRTA 3BTIA 4M3BA 4M3FA 4AF5A 3ANPA 3BQZA 4W97A 3C2BA 2ID3A 3ZQIA 3LWJA 2Y30A 3FK6A 5FHPA 3FRQA 2PBXA 3NRGA 4NN1A 3GEUA 3ZQLA 3BHQA 2REKA 2NS7A 4D7NA 3VOKA 5F27A 1JT6A 1JTXA 3BR5A 3QBMA 2G7SA 1QPIA 3VP5A 2XGDA 5D1RA 2XB5A 3MVPA 4B1RA 4UDSA 2QTQA 5IOYA 3QQAA 2FQ4A 2NS8A 5FKLA 3AQSA 3HTHA 4AC6A 5K58A 5FKOA 4GCKA 3DEWA 2UXHA 2HKUA 5EYRA 2WGBA 1UI5A 2QOPA 4JL3A 3Q0VA 2X6OA 4V2FA 3HIMA 3BTJA 3Q0WA 3ZQGA 3EGQA 2YVEA 5CXIA 2QWTA 3B81A 4W1UA 3B6AA 5HAWA 3G1MA 4ACIA 4MXMA 5J3LA 4NELA 3SDGA 3T6NA 3BR2A 2W53A 2NP5A 3F1BA 5F08A 3NI7A 2ZOYA 5D18A 3G7RA 2V57A 5F04A 3LSPA 1JT0A 5FGLA 5K7FA 3O8GA 5HSZA 3VOXA 3LOCA 4GFKA 5J1YA 3LJLA 2HQ5A 4D5CA 3VPRA 3RH2A 3COLA 3BR3A 5GP9A 3FIWA 2G0EA 2IBDA 2NX4A 3TP0A 4M3EA
chains in the Genus database with same CATH superfamily
3QPSA 2WV1A 5D19A 1Z77A 3KYLA 1JUMA 2FJI1 2XPVA 4X1EA 3JSJA 1RPWA 2G3BA 2R7OA 2HYTA 3BR6A 2QKOA 3IH2A 1JUSA 3PM1A 4JYKA 4U9NA 2QIBA 3DU5A 4IRVA 3TP3A 2RAEA 2O7OA 4YZEA 2OF7A 2DG8A 4ICHA 4OD5A 5F0CA 3CJDA 2R7XA 2XGCA 3SWHA 5HBUA 3BCGA 2ZCMA 3VUQA 3AQTA 2I10A 3IH3A 2GENA 2RASA 1U9OA 2G7GA 2GUHA 2ID6A 1RKTA 5EZGA 3V6GA 3E7QA 2VKVA 2IU5A 3HTIA 3K8PC 5F0FA 3ZQHA 4CGRA 3WHCA 3V78A 2XPUA 3KZ9A 2Y31A 3RD3A 5F1JA 2IEKA 5H9TA 4MK6A 2DTZA 2RHAA 4V2GA 3VVYA 5K7HA 3CDLA 2R7TA 2B1EA 4DW6A 3EUPA 3QPLA 3GZIA 4G12A 5GPCA 5FKKA 5IP6A 2IAIA 5J1RA 3CWRA 3BQYA 4AUXA 1ZKGA 1QVTA 2R7WA 2B3WA 3VVZA 3ON4A 5J1UA 2PZ9A 2YVXA 2UXOA 4HKUA 4GCTA 3PASA 3LHQA 2GBYA 3Q0UA 5CQGA 3VW1A 5CW8A 2JJ7A 3NNRA 2XPWA 2Y2ZA 2VKEA 3G1LA 3HGYA 2D6YA 2NP3A 3KKCA 4GFLA 5EFYA 2OI8A 2X9DA 1ORKA 4L62A 3ANGA 2YVHA 3HE0A 3VW0A 2DG7A 4D5FA 3KKDA 5AQCA 2FBQA 3BR1A 4PXIA 1A6IA 3G56A 4KWAA 2ZOZA 3LSRA 4WIBA 2ZY9A 4I76A 2XRLA 3QKXA 3BNIA 1U9NA 3P9TA 2G7LA 5F0HA 2XDNA 3VW2A 3LSJA 2F07A 1T56A 3S5RA 3BTCA 5FMPA 1BJZA 4B3AA 4DVYP 2HXOA 3FK7A 2R7RA 5FKNA 3B6CA 3DCFA 3PPBA 1VI0A 5DAJA 1QVUA 3G1OA 5C4YA 4ME9A 3HGGA 4AC0A 3WHBA 3VTIA 4JNNA 3DU6A 2QCOA 3HTAA 3KNWA 3BTLA 3BJBA 3BT9A 3SFIA 1ZK8A 5FKMA 2R7SA 3CRJA 5EZHA 2XGEA 1Z0XA 2OERA 5IOZA 3C07A 3Q3SA 3NS4A 4I6ZA 5CXGA 4XK4A 5IPAA 2EH3A 3DPJA 1RKWA 3BRUA 2R7QA 3NPIA 2HXIA 2O7TA 2FD5A 5GPAA 2ZB9A 4M3DA 3ZQFA 4GCLA 2FJ1A 2JK3A 2GFNA 3CCYA 1SGMA 3BR0A 3O60A 3HTJA 3O8HA 2ZCXA 3ON2A 4M3GA 4D7MA 1JTYA 1UI6A 2VPRA 3IUVA 3NXCA 2UXPA 4JKZA 3F0CA 2Q24A 5K7ZA 3MNLA 3VIBA 2R7UA 1T33A 3FHNA 2TCTA 2WUIA 2UXUA 4MO7A 4ABZA 1JUPA 2HYJA 2FX0A 3VVXA 2ZCNA 2OPTA 2UXIA 3IH4A 2TRTA 3BTIA 4M3BA 4M3FA 4AF5A 3ANPA 3BQZA 4W97A 3C2BA 2ID3A 3ZQIA 3LWJA 2Y30A 3FK6A 5FHPA 3FRQA 2PBXA 3NRGA 4NN1A 3GEUA 3ZQLA 3BHQA 2REKA 2NS7A 4D7NA 3VOKA 5F27A 1JT6A 1JTXA 3BR5A 3QBMA 2G7SA 1QPIA 3VP5A 2XGDA 4OD4A 5D1RA 2XB5A 3MVPA 4B1RA 4UDSA 2QTQA 5IOYA 3QQAA 2FQ4A 2NS8A 5FKLA 3AQSA 3HTHA 4AC6A 5K58A 5FKOA 4GCKA 3DEWA 2UXHA 2HKUA 5EYRA 2WGBA 1UI5A 2QOPA 4JL3A 3Q0VA 2X6OA 4V2FA 3HIMA 3BTJA 3Q0WA 3ZQGA 3EGQA 2YVEA 5CXIA 2QWTA 3B81A 4W1UA 3B6AA 5HAWA 3G1MA 4ACIA 4U9LA 4MXMA 5J3LA 4NELA 3SDGA 3T6NA 3BR2A 2W53A 2NP5A 3F1BA 5F08A 3NI7A 2ZOYA 5D18A 3G7RA 2V57A 5F04A 3LSPA 1JT0A 4C2MA 2A2FX 5FGLA 2PFVA 5K7FA 2R7VA 3O8GA 5HSZA 3VOXA 3LOCA 4GFKA 5J1YA 3LJLA 2HQ5A 4D5CA 3VPRA 3RH2A 3COLA 3BR3A 5GP9A 3FIWA 2G0EA 2IBDA 2NX4A 3TP0A 4M3EA
chains in the Genus database with same CATH topology
3QPSA 2WV1A 5D19A 1Z77A 1JUMA 2XPVA 4X1EA 3JSJA 1RPWA 2G3BA 2HYTA 3BR6A 2QKOA 3IH2A 1JUSA 3PM1A 4JYKA 2QIBA 3TP3A 2RAEA 2O7OA 4YZEA 2OF7A 2DG8A 4ICHA 5F0CA 3CJDA 2XGCA 5HBUA 3BCGA 2ZCMA 3VUQA 3AQTA 2I10A 3IH3A 2GENA 2RASA 1U9OA 2G7GA 2GUHA 2ID6A 1RKTA 5EZGA 3V6GA 3E7QA 2VKVA 2IU5A 3HTIA 5F0FA 3ZQHA 4CGRA 3WHCA 3V78A 2XPUA 3KZ9A 2Y31A 3RD3A 5F1JA 2IEKA 5H9TA 4MK6A 2DTZA 2RHAA 4V2GA 3VVYA 5K7HA 3CDLA 4DW6A 3EUPA 3QPLA 3GZIA 4G12A 5GPCA 5FKKA 5IP6A 2IAIA 5J1RA 3CWRA 3BQYA 4AUXA 1ZKGA 1QVTA 3VVZA 3ON4A 5J1UA 2PZ9A 2UXOA 4HKUA 4GCTA 3PASA 3LHQA 2GBYA 3Q0UA 3VW1A 5CW8A 2JJ7A 3NNRA 2XPWA 2Y2ZA 2VKEA 3G1LA 3HGYA 2D6YA 2NP3A 3KKCA 4GFLA 5EFYA 2OI8A 2X9DA 1ORKA 4L62A 3ANGA 2YVHA 3HE0A 3VW0A 2DG7A 4D5FA 3KKDA 5AQCA 2FBQA 3BR1A 4PXIA 1A6IA 3G56A 4KWAA 2ZOZA 3LSRA 4I76A 2XRLA 3QKXA 3BNIA 1U9NA 3P9TA 2G7LA 5F0HA 2XDNA 3VW2A 3LSJA 2F07A 1T56A 3S5RA 3BTCA 5FMPA 1BJZA 4B3AA 2HXOA 3FK7A 5FKNA 3B6CA 3DCFA 3PPBA 1VI0A 5DAJA 1QVUA 3G1OA 5C4YA 4ME9A 3HGGA 4AC0A 3WHBA 4JNNA 2QCOA 3HTAA 3KNWA 3BTLA 3BJBA 3BT9A 3SFIA 1ZK8A 5FKMA 3CRJA 5EZHA 2XGEA 1Z0XA 2OERA 5IOZA 3C07A 3Q3SA 4I6ZA 5CXGA 4XK4A 5IPAA 2EH3A 3DPJA 1RKWA 3BRUA 3NPIA 2HXIA 2O7TA 2FD5A 5GPAA 2ZB9A 4M3DA 3ZQFA 4GCLA 2FJ1A 2JK3A 2GFNA 3CCYA 1SGMA 3BR0A 3O60A 3HTJA 3O8HA 2ZCXA 3ON2A 4M3GA 4D7MA 1JTYA 1UI6A 2VPRA 3IUVA 3NXCA 2UXPA 4JKZA 3F0CA 2Q24A 5K7ZA 3MNLA 3VIBA 1T33A 2TCTA 2WUIA 2UXUA 4MO7A 4ABZA 1JUPA 2HYJA 2FX0A 3VVXA 2ZCNA 2OPTA 2UXIA 3IH4A 2TRTA 3BTIA 4M3BA 4M3FA 4AF5A 3ANPA 3BQZA 4W97A 3C2BA 2ID3A 3ZQIA 3LWJA 2Y30A 3FK6A 5FHPA 3FRQA 2PBXA 3NRGA 4NN1A 3GEUA 3ZQLA 3BHQA 2REKA 2NS7A 4D7NA 3VOKA 5F27A 1JT6A 1JTXA 3BR5A 3QBMA 2G7SA 1QPIA 3VP5A 2XGDA 5D1RA 2XB5A 3MVPA 4B1RA 4UDSA 2QTQA 5IOYA 3QQAA 2FQ4A 2NS8A 5FKLA 3AQSA 3HTHA 4AC6A 5K58A 5FKOA 4GCKA 3DEWA 2UXHA 2HKUA 5EYRA 2WGBA 1UI5A 2QOPA 4JL3A 3Q0VA 2X6OA 4V2FA 3HIMA 3BTJA 3Q0WA 3ZQGA 3EGQA 2YVEA 5CXIA 2QWTA 3B81A 4W1UA 3B6AA 5HAWA 3G1MA 4ACIA 4MXMA 5J3LA 4NELA 3SDGA 3T6NA 3BR2A 2W53A 2NP5A 3F1BA 5F08A 3NI7A 2ZOYA 5D18A 3G7RA 2V57A 5F04A 3LSPA 1JT0A 5FGLA 5K7FA 3O8GA 5HSZA 3VOXA 3LOCA 4GFKA 5J1YA 3LJLA 2HQ5A 4D5CA 3VPRA 3RH2A 3COLA 3BR3A 5GP9A 3FIWA 2G0EA 2IBDA 2NX4A 3TP0A 4M3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPS A;  2WV1 A;  5D19 A;  1Z77 A;  1JUM A;  2XPV A;  4X1E A;  3JSJ A;  1RPW A;  2G3B A;  2HYT A;  3BR6 A;  2QKO A;  3IH2 A;  1JUS A;  3PM1 A;  4JYK A;  2QIB A;  3TP3 A;  2RAE A;  2O7O A;  4YZE A;  2OF7 A;  2DG8 A;  4ICH A;  5F0C A;  3CJD A;  2XGC A;  5HBU A;  3BCG A;  2ZCM A;  3VUQ A;  3AQT A;  2I10 A;  3IH3 A;  2GEN A;  2RAS A;  1U9O A;  2G7G A;  2GUH A;  2ID6 A;  1RKT A;  5EZG A;  3V6G A;  3E7Q A;  2VKV A;  2IU5 A;  3HTI A;  5F0F A;  3ZQH A;  4CGR A;  3WHC A;  3V78 A;  2XPU A;  3KZ9 A;  2Y31 A;  3RD3 A;  5F1J A;  2IEK A;  5H9T A;  4MK6 A;  2DTZ A;  2RHA A;  4V2G A;  3VVY A;  5K7H A;  3CDL A;  4DW6 A;  3EUP A;  3QPL A;  3GZI A;  4G12 A;  5GPC A;  5FKK A;  5IP6 A;  2IAI A;  5J1R A;  3CWR A;  3BQY A;  4AUX A;  1ZKG A;  1QVT A;  3VVZ A;  3ON4 A;  5J1U A;  2PZ9 A;  2UXO A;  4HKU A;  4GCT A;  3PAS A;  3LHQ A;  2GBY A;  3Q0U A;  3VW1 A;  5CW8 A;  2JJ7 A;  3NNR A;  2XPW A;  2Y2Z A;  2VKE A;  3G1L A;  3HGY A;  2D6Y A;  2NP3 A;  3KKC A;  4GFL A;  5EFY A;  2OI8 A;  2X9D A;  1ORK A;  4L62 A;  3ANG A;  2YVH A;  3HE0 A;  3VW0 A;  2DG7 A;  4D5F A;  3KKD A;  5AQC A;  2FBQ A;  3BR1 A;  4PXI A;  1A6I A;  3G56 A;  4KWA A;  2ZOZ A;  3LSR A;  4I76 A;  2XRL A;  3QKX A;  3BNI A;  1U9N A;  3P9T A;  2G7L A;  5F0H A;  2XDN A;  3VW2 A;  3LSJ A;  2F07 A;  1T56 A;  3S5R A;  3BTC A;  5FMP A;  1BJZ A;  4B3A A;  2HXO A;  3FK7 A;  5FKN A;  3B6C A;  3DCF A;  3PPB A;  1VI0 A;  5DAJ A;  1QVU A;  3G1O A;  5C4Y A;  4ME9 A;  3HGG A;  4AC0 A;  3WHB A;  4JNN A;  2QCO A;  3HTA A;  3KNW A;  3BTL A;  3BJB A;  3BT9 A;  3SFI A;  1ZK8 A;  5FKM A;  3CRJ A;  5EZH A;  2XGE A;  1Z0X A;  2OER A;  5IOZ A;  3C07 A;  3Q3S A;  4I6Z A;  5CXG A;  4XK4 A;  5IPA A;  2EH3 A;  3DPJ A;  1RKW A;  3BRU A;  3NPI A;  2HXI A;  2O7T A;  2FD5 A;  5GPA A;  2ZB9 A;  4M3D A;  3ZQF A;  4GCL A;  2FJ1 A;  2JK3 A;  2GFN A;  3CCY A;  1SGM A;  3BR0 A;  3O60 A;  3HTJ A;  3O8H A;  2ZCX A;  3ON2 A;  4M3G A;  4D7M A;  1JTY A;  1UI6 A;  2VPR A;  3IUV A;  3NXC A;  2UXP A;  4JKZ A;  3F0C A;  2Q24 A;  5K7Z A;  3MNL A;  3VIB A;  1T33 A;  2TCT A;  2WUI A;  2UXU A;  4MO7 A;  4ABZ A;  1JUP A;  2HYJ A;  2FX0 A;  3VVX A;  2ZCN A;  2OPT A;  2UXI A;  3IH4 A;  2TRT A;  3BTI A;  4M3B A;  4M3F A;  4AF5 A;  3ANP A;  3BQZ A;  4W97 A;  3C2B A;  2ID3 A;  3ZQI A;  3LWJ A;  2Y30 A;  3FK6 A;  5FHP A;  3FRQ A;  2PBX A;  3NRG A;  4NN1 A;  3GEU A;  3ZQL A;  3BHQ A;  2REK A;  2NS7 A;  4D7N A;  3VOK A;  5F27 A;  1JT6 A;  1JTX A;  3BR5 A;  3QBM A;  2G7S A;  1QPI A;  3VP5 A;  2XGD A;  5D1R A;  2XB5 A;  3MVP A;  4B1R A;  4UDS A;  2QTQ A;  5IOY A;  3QQA A;  2FQ4 A;  2NS8 A;  5FKL A;  3AQS A;  3HTH A;  4AC6 A;  5K58 A;  5FKO A;  4GCK A;  3DEW A;  2UXH A;  2HKU A;  5EYR A;  2WGB A;  1UI5 A;  2QOP A;  4JL3 A;  3Q0V A;  2X6O A;  4V2F A;  3HIM A;  3BTJ A;  3Q0W A;  3ZQG A;  3EGQ A;  2YVE A;  5CXI A;  2QWT A;  3B81 A;  4W1U A;  3B6A A;  5HAW A;  3G1M A;  4ACI A;  4MXM A;  5J3L A;  4NEL A;  3SDG A;  3T6N A;  3BR2 A;  2W53 A;  2NP5 A;  3F1B A;  5F08 A;  3NI7 A;  2ZOY A;  5D18 A;  3G7R A;  2V57 A;  5F04 A;  3LSP A;  1JT0 A;  5FGL A;  5K7F A;  3O8G A;  5HSZ A;  3VOX A;  3LOC A;  4GFK A;  5J1Y A;  3LJL A;  2HQ5 A;  4D5C A;  3VPR A;  3RH2 A;  3COL A;  3BR3 A;  5GP9 A;  3FIW A;  2G0E A;  2IBD A;  2NX4 A;  3TP0 A;  4M3E A; 
#chains in the Genus database with same CATH topology
 3QPS A;  2WV1 A;  5D19 A;  1Z77 A;  3KYL A;  1JUM A;  2FJI 1;  2XPV A;  4X1E A;  3JSJ A;  1RPW A;  2G3B A;  2R7O A;  2HYT A;  3BR6 A;  2QKO A;  3IH2 A;  1JUS A;  3PM1 A;  4JYK A;  4U9N A;  2QIB A;  3DU5 A;  4IRV A;  3TP3 A;  2RAE A;  2O7O A;  4YZE A;  2OF7 A;  2DG8 A;  4ICH A;  4OD5 A;  5F0C A;  3CJD A;  2R7X A;  2XGC A;  3SWH A;  5HBU A;  3BCG A;  2ZCM A;  3VUQ A;  3AQT A;  2I10 A;  3IH3 A;  2GEN A;  2RAS A;  1U9O A;  2G7G A;  2GUH A;  2ID6 A;  1RKT A;  5EZG A;  3V6G A;  3E7Q A;  2VKV A;  2IU5 A;  3HTI A;  3K8P C;  5F0F A;  3ZQH A;  4CGR A;  3WHC A;  3V78 A;  2XPU A;  3KZ9 A;  2Y31 A;  3RD3 A;  5F1J A;  2IEK A;  5H9T A;  4MK6 A;  2DTZ A;  2RHA A;  4V2G A;  3VVY A;  5K7H A;  3CDL A;  2R7T A;  2B1E A;  4DW6 A;  3EUP A;  3QPL A;  3GZI A;  4G12 A;  5GPC A;  5FKK A;  5IP6 A;  2IAI A;  5J1R A;  3CWR A;  3BQY A;  4AUX A;  1ZKG A;  1QVT A;  2R7W A;  2B3W A;  3VVZ A;  3ON4 A;  5J1U A;  2PZ9 A;  2YVX A;  2UXO A;  4HKU A;  4GCT A;  3PAS A;  3LHQ A;  2GBY A;  3Q0U A;  5CQG A;  3VW1 A;  5CW8 A;  2JJ7 A;  3NNR A;  2XPW A;  2Y2Z A;  2VKE A;  3G1L A;  3HGY A;  2D6Y A;  2NP3 A;  3KKC A;  4GFL A;  5EFY A;  2OI8 A;  2X9D A;  1ORK A;  4L62 A;  3ANG A;  2YVH A;  3HE0 A;  3VW0 A;  2DG7 A;  4D5F A;  3KKD A;  5AQC A;  2FBQ A;  3BR1 A;  4PXI A;  1A6I A;  3G56 A;  4KWA A;  2ZOZ A;  3LSR A;  4WIB A;  2ZY9 A;  4I76 A;  2XRL A;  3QKX A;  3BNI A;  1U9N A;  3P9T A;  2G7L A;  5F0H A;  2XDN A;  3VW2 A;  3LSJ A;  2F07 A;  1T56 A;  3S5R A;  3BTC A;  5FMP A;  1BJZ A;  4B3A A;  4DVY P;  2HXO A;  3FK7 A;  2R7R A;  5FKN A;  3B6C A;  3DCF A;  3PPB A;  1VI0 A;  5DAJ A;  1QVU A;  3G1O A;  5C4Y A;  4ME9 A;  3HGG A;  4AC0 A;  3WHB A;  3VTI A;  4JNN A;  3DU6 A;  2QCO A;  3HTA A;  3KNW A;  3BTL A;  3BJB A;  3BT9 A;  3SFI A;  1ZK8 A;  5FKM A;  2R7S A;  3CRJ A;  5EZH A;  2XGE A;  1Z0X A;  2OER A;  5IOZ A;  3C07 A;  3Q3S A;  3NS4 A;  4I6Z A;  5CXG A;  4XK4 A;  5IPA A;  2EH3 A;  3DPJ A;  1RKW A;  3BRU A;  2R7Q A;  3NPI A;  2HXI A;  2O7T A;  2FD5 A;  5GPA A;  2ZB9 A;  4M3D A;  3ZQF A;  4GCL A;  2FJ1 A;  2JK3 A;  2GFN A;  3CCY A;  1SGM A;  3BR0 A;  3O60 A;  3HTJ A;  3O8H A;  2ZCX A;  3ON2 A;  4M3G A;  4D7M A;  1JTY A;  1UI6 A;  2VPR A;  3IUV A;  3NXC A;  2UXP A;  4JKZ A;  3F0C A;  2Q24 A;  5K7Z A;  3MNL A;  3VIB A;  2R7U A;  1T33 A;  3FHN A;  2TCT A;  2WUI A;  2UXU A;  4MO7 A;  4ABZ A;  1JUP A;  2HYJ A;  2FX0 A;  3VVX A;  2ZCN A;  2OPT A;  2UXI A;  3IH4 A;  2TRT A;  3BTI A;  4M3B A;  4M3F A;  4AF5 A;  3ANP A;  3BQZ A;  4W97 A;  3C2B A;  2ID3 A;  3ZQI A;  3LWJ A;  2Y30 A;  3FK6 A;  5FHP A;  3FRQ A;  2PBX A;  3NRG A;  4NN1 A;  3GEU A;  3ZQL A;  3BHQ A;  2REK A;  2NS7 A;  4D7N A;  3VOK A;  5F27 A;  1JT6 A;  1JTX A;  3BR5 A;  3QBM A;  2G7S A;  1QPI A;  3VP5 A;  2XGD A;  4OD4 A;  5D1R A;  2XB5 A;  3MVP A;  4B1R A;  4UDS A;  2QTQ A;  5IOY A;  3QQA A;  2FQ4 A;  2NS8 A;  5FKL A;  3AQS A;  3HTH A;  4AC6 A;  5K58 A;  5FKO A;  4GCK A;  3DEW A;  2UXH A;  2HKU A;  5EYR A;  2WGB A;  1UI5 A;  2QOP A;  4JL3 A;  3Q0V A;  2X6O A;  4V2F A;  3HIM A;  3BTJ A;  3Q0W A;  3ZQG A;  3EGQ A;  2YVE A;  5CXI A;  2QWT A;  3B81 A;  4W1U A;  3B6A A;  5HAW A;  3G1M A;  4ACI A;  4U9L A;  4MXM A;  5J3L A;  4NEL A;  3SDG A;  3T6N A;  3BR2 A;  2W53 A;  2NP5 A;  3F1B A;  5F08 A;  3NI7 A;  2ZOY A;  5D18 A;  3G7R A;  2V57 A;  5F04 A;  3LSP A;  1JT0 A;  4C2M A;  2A2F X;  5FGL A;  2PFV A;  5K7F A;  2R7V A;  3O8G A;  5HSZ A;  3VOX A;  3LOC A;  4GFK A;  5J1Y A;  3LJL A;  2HQ5 A;  4D5C A;  3VPR A;  3RH2 A;  3COL A;  3BR3 A;  5GP9 A;  3FIW A;  2G0E A;  2IBD A;  2NX4 A;  3TP0 A;  4M3E A; 
#chains in the Genus database with same CATH homology
 3QPS A;  2WV1 A;  5D19 A;  1Z77 A;  1JUM A;  2XPV A;  4X1E A;  3JSJ A;  1RPW A;  2G3B A;  2HYT A;  3BR6 A;  2QKO A;  3IH2 A;  1JUS A;  3PM1 A;  4JYK A;  2QIB A;  3TP3 A;  2RAE A;  2O7O A;  4YZE A;  2OF7 A;  2DG8 A;  4ICH A;  5F0C A;  3CJD A;  2XGC A;  5HBU A;  3BCG A;  2ZCM A;  3VUQ A;  3AQT A;  2I10 A;  3IH3 A;  2GEN A;  2RAS A;  1U9O A;  2G7G A;  2GUH A;  2ID6 A;  1RKT A;  5EZG A;  3V6G A;  3E7Q A;  2VKV A;  2IU5 A;  3HTI A;  5F0F A;  3ZQH A;  4CGR A;  3WHC A;  3V78 A;  2XPU A;  3KZ9 A;  2Y31 A;  3RD3 A;  5F1J A;  2IEK A;  5H9T A;  4MK6 A;  2DTZ A;  2RHA A;  4V2G A;  3VVY A;  5K7H A;  3CDL A;  4DW6 A;  3EUP A;  3QPL A;  3GZI A;  4G12 A;  5GPC A;  5FKK A;  5IP6 A;  2IAI A;  5J1R A;  3CWR A;  3BQY A;  4AUX A;  1ZKG A;  1QVT A;  3VVZ A;  3ON4 A;  5J1U A;  2PZ9 A;  2UXO A;  4HKU A;  4GCT A;  3PAS A;  3LHQ A;  2GBY A;  3Q0U A;  3VW1 A;  5CW8 A;  2JJ7 A;  3NNR A;  2XPW A;  2Y2Z A;  2VKE A;  3G1L A;  3HGY A;  2D6Y A;  2NP3 A;  3KKC A;  4GFL A;  5EFY A;  2OI8 A;  2X9D A;  1ORK A;  4L62 A;  3ANG A;  2YVH A;  3HE0 A;  3VW0 A;  2DG7 A;  4D5F A;  3KKD A;  5AQC A;  2FBQ A;  3BR1 A;  4PXI A;  1A6I A;  3G56 A;  4KWA A;  2ZOZ A;  3LSR A;  4I76 A;  2XRL A;  3QKX A;  3BNI A;  1U9N A;  3P9T A;  2G7L A;  5F0H A;  2XDN A;  3VW2 A;  3LSJ A;  2F07 A;  1T56 A;  3S5R A;  3BTC A;  5FMP A;  1BJZ A;  4B3A A;  2HXO A;  3FK7 A;  5FKN A;  3B6C A;  3DCF A;  3PPB A;  1VI0 A;  5DAJ A;  1QVU A;  3G1O A;  5C4Y A;  4ME9 A;  3HGG A;  4AC0 A;  3WHB A;  4JNN A;  2QCO A;  3HTA A;  3KNW A;  3BTL A;  3BJB A;  3BT9 A;  3SFI A;  1ZK8 A;  5FKM A;  3CRJ A;  5EZH A;  2XGE A;  1Z0X A;  2OER A;  5IOZ A;  3C07 A;  3Q3S A;  4I6Z A;  5CXG A;  4XK4 A;  5IPA A;  2EH3 A;  3DPJ A;  1RKW A;  3BRU A;  3NPI A;  2HXI A;  2O7T A;  2FD5 A;  5GPA A;  2ZB9 A;  4M3D A;  3ZQF A;  4GCL A;  2FJ1 A;  2JK3 A;  2GFN A;  3CCY A;  1SGM A;  3BR0 A;  3O60 A;  3HTJ A;  3O8H A;  2ZCX A;  3ON2 A;  4M3G A;  4D7M A;  1JTY A;  1UI6 A;  2VPR A;  3IUV A;  3NXC A;  2UXP A;  4JKZ A;  3F0C A;  2Q24 A;  5K7Z A;  3MNL A;  3VIB A;  1T33 A;  2TCT A;  2WUI A;  2UXU A;  4MO7 A;  4ABZ A;  1JUP A;  2HYJ A;  2FX0 A;  3VVX A;  2ZCN A;  2OPT A;  2UXI A;  3IH4 A;  2TRT A;  3BTI A;  4M3B A;  4M3F A;  4AF5 A;  3ANP A;  3BQZ A;  4W97 A;  3C2B A;  2ID3 A;  3ZQI A;  3LWJ A;  2Y30 A;  3FK6 A;  5FHP A;  3FRQ A;  2PBX A;  3NRG A;  4NN1 A;  3GEU A;  3ZQL A;  3BHQ A;  2REK A;  2NS7 A;  4D7N A;  3VOK A;  5F27 A;  1JT6 A;  1JTX A;  3BR5 A;  3QBM A;  2G7S A;  1QPI A;  3VP5 A;  2XGD A;  5D1R A;  2XB5 A;  3MVP A;  4B1R A;  4UDS A;  2QTQ A;  5IOY A;  3QQA A;  2FQ4 A;  2NS8 A;  5FKL A;  3AQS A;  3HTH A;  4AC6 A;  5K58 A;  5FKO A;  4GCK A;  3DEW A;  2UXH A;  2HKU A;  5EYR A;  2WGB A;  1UI5 A;  2QOP A;  4JL3 A;  3Q0V A;  2X6O A;  4V2F A;  3HIM A;  3BTJ A;  3Q0W A;  3ZQG A;  3EGQ A;  2YVE A;  5CXI A;  2QWT A;  3B81 A;  4W1U A;  3B6A A;  5HAW A;  3G1M A;  4ACI A;  4MXM A;  5J3L A;  4NEL A;  3SDG A;  3T6N A;  3BR2 A;  2W53 A;  2NP5 A;  3F1B A;  5F08 A;  3NI7 A;  2ZOY A;  5D18 A;  3G7R A;  2V57 A;  5F04 A;  3LSP A;  1JT0 A;  5FGL A;  5K7F A;  3O8G A;  5HSZ A;  3VOX A;  3LOC A;  4GFK A;  5J1Y A;  3LJL A;  2HQ5 A;  4D5C A;  3VPR A;  3RH2 A;  3COL A;  3BR3 A;  5GP9 A;  3FIW A;  2G0E A;  2IBD A;  2NX4 A;  3TP0 A;  4M3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...