3VIBA

Structural basis for multidrug recognition and antimicrobial resistance by mtrr, an efflux pump regulator from neisseria gonorrhoeae
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
202
structure length
193
Chain Sequence
ALKTKEHLMLAALETFYRKGIARTSLNEIAQAAGVTRDALYWHFKNKEDLFDALFQRICDDIENCIGSWTVFRHTLLHFFERLQSNDIHYKFHNILFLKCEHTEQNAAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSSGESFDLGKTAPRIIGIMMDNLENHPCLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MtrR
publication title Structural basis for multidrug recognitionand antimicrobial resistance by MTRR, an efflux pump regulator from Neisseria Gonorrhoeae
rcsb
source organism Neisseria gonorrhoeae
molecule tags Dna binding protein
total genus 81
structure length 193
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08361 TetR_C_2 MAATS-type transcriptional repressor, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vibA00
5FHPA 3BR5A 5CXGA 3Q0VA 5IOZA 4DW6A 2XPWA 3IH4A 1ORKA 2X9DA 5J1UA 4D7NA 3BRUA 2O7TA 2FJ1A 3G1LA 2JJ7A 3V78A 2ZB9A 3VUQA 4NELA 3WHCA 2DG8A 3BTCA 3PM1A 3BHQA 5FKNA 2NS7A 2REKA 3V6GA 4ACIA 5AQCA 3G56A 4D5FA 2XGDA 3CRJA 5EZHA 3IUVA 3VOXA 3E7QA 2QKOA 4GCKA 2QTQA 3DEWA 4ME9A 1JTXA 4GCTA 1JT6A 4V2FA 3BR0A 1UI6A 3NI7A 3BR6A 3C07A 5HSZA 3BT9A 5GP9A 2OERA 5EYRA 3GEUA 1U9NA 5DAJA 3LJLA 4M3DA 3G1OA 3ZQIA 3LHQA 4D7MA 2F07A 2G7SA 4JYKA 3NXCA 2FBQA 5EFYA 5IOYA 4MK6A 2OI8A 3DPJA 4UDSA 4I76A 4L62A 4HKUA 3WHBA 1JUMA 4I6ZA 2JK3A 3GZIA 3F1BA 3LSRA 3VPRA 3B6CA 5FKOA 3P9TA 2X6OA 2XDNA 3DCFA 4AC0A 3ZQLA 3IH3A 1VI0A 3PASA 4KWAA 3VVZA 4JL3A 2XB5A 3VW0A 4PXIA 3BQZA 3LOCA 4D5CA 3HTAA 2WUIA 3HE0A 5F27A 3C2BA 3VOKA 3NNRA 3KNWA 3FK7A 3VP5A 5F04A 5HAWA 1QPIA 4M3BA 5IPAA 1JTYA 2UXUA 2IBDA 2QOPA 3IH2A 1SGMA 2IU5A 4AUXA 2EH3A 2G7GA 1T56A 3NPIA 2ZOZA 2XPVA 3RD3A 5F0CA 1T33A 3O8HA 5FGLA 2IAIA 2NP3A 3HGGA 4GFLA 1ZK8A 5FKLA 3BCGA 5FKKA 3HGYA 3TP3A 3CDLA 3MNLA 3QPSA 3FRQA 3BR1A 2FD5A 3BNIA 3F0CA 5F0HA 3O8GA 4M3EA 2DTZA 3TP0A 3CJDA 5GPCA 3BR2A 2ZCMA 3JSJA 5F1JA 2YVHA 1U9OA 4MXMA 3KKDA 3HIMA 1Z77A 3MVPA 2UXIA 3BQYA 2HXIA 3B6AA 5K7ZA 4ICHA 5J1YA 2UXOA 3SDGA 1BJZA 2OF7A 3G7RA 1UI5A 2QIBA 1JT0A 2Q24A 1A6IA 3ZQGA 2TRTA 3LSJA 3QKXA 2GFNA 1ZKGA 2VKVA 2RHAA 2GENA 4G12A 2HYJA 2QWTA 3EUPA 1JUPA 2IEKA 3VW1A 2YVEA 3Q3SA 4GFKA 3B81A 5J1RA 3ZQHA 4GCLA 2Y31A 4M3GA 3ZQFA 3VVYA 2PZ9A 5EZGA 3O60A 2ZOYA 2NX4A 3QPLA 3VVXA 2W53A 1QVUA 3ANGA 3ANPA 3BTIA 3RH2A 4JKZA 2ZCXA 3S5RA 1RKTA 5CW8A 2D6YA 2HQ5A 2G3BA 5H9TA 3VIBA 2TCTA 3CWRA 2HXOA 3SFIA 2RAEA 5K7FA 4W1UA 5FKMA 2WGBA 3PPBA 2RASA 2PBXA 3AQSA 3CCYA 3COLA 3FIWA 3HTJA 3VW2A 4B3AA 2ID6A 2V57A 4CGRA 5D18A 4AF5A 4XK4A 4ABZA 2VPRA 2VKEA 2XGCA 5F0FA 4NN1A 3Q0WA 2UXHA 5GPAA 3KKCA 5HBUA 2G0EA 3EGQA 2QCOA 2HKUA 4B1RA 5FMPA 3NRGA 2XGEA 2XPUA 5D1RA 4M3FA 3BR3A 4V2GA 2UXPA 2Y2ZA 2ID3A 5C4YA 1RPWA 5K58A 5IP6A 3G1MA 3LWJA 2Y30A 3T6NA 3QBMA 4X1EA 3QQAA 2FX0A 2ZCNA 1QVTA 2OPTA 2WV1A 4W97A 3FK6A 3AQTA 5D19A 2GUHA 2NP5A 1RKWA 4AC6A 4YZEA 4JNNA 2GBYA 3LSPA 1Z0XA 2HYTA 2NS8A 4MO7A 5K7HA 3HTHA 1JUSA 3Q0UA 2XRLA 3BTJA 3BJBA 2I10A 3HTIA 5CXIA 3BTLA 3ON4A 3KZ9A 2DG7A 5J3LA 2G7LA 2O7OA 3ON2A 5F08A 2FQ4A
chains in the Genus database with same CATH superfamily
5FHPA 3BR5A 5CXGA 3Q0VA 5IOZA 4DW6A 2XPWA 3IH4A 1ORKA 2X9DA 5J1UA 4D7NA 3BRUA 2O7TA 2FJ1A 3G1LA 2B1EA 2JJ7A 3V78A 2ZB9A 3VUQA 4NELA 3WHCA 2DG8A 3BTCA 3PM1A 3BHQA 5FKNA 2NS7A 2REKA 4OD4A 3V6GA 4ACIA 5AQCA 3G56A 4D5FA 2XGDA 3CRJA 5EZHA 3IUVA 3VOXA 3E7QA 2QKOA 4GCKA 2QTQA 3DEWA 4ME9A 1JTXA 4GCTA 1JT6A 4V2FA 3BR0A 1UI6A 3NI7A 3BR6A 3C07A 5HSZA 3BT9A 5GP9A 2OERA 5EYRA 3GEUA 1U9NA 5DAJA 3LJLA 4M3DA 3G1OA 3ZQIA 3LHQA 4D7MA 2F07A 2G7SA 4JYKA 3NXCA 2FBQA 5EFYA 5IOYA 4MK6A 2OI8A 3DPJA 4UDSA 4I76A 4L62A 4HKUA 3WHBA 1JUMA 4I6ZA 2JK3A 3GZIA 3F1BA 3LSRA 3VPRA 3B6CA 5FKOA 3P9TA 2X6OA 2XDNA 3DCFA 4AC0A 3ZQLA 2R7TA 3IH3A 1VI0A 3PASA 4KWAA 3VVZA 4JL3A 2XB5A 3VW0A 4PXIA 3BQZA 3LOCA 4D5CA 3HTAA 4C2MA 2WUIA 3HE0A 5F27A 3C2BA 3VOKA 3NNRA 3KNWA 3FK7A 3VP5A 5F04A 5HAWA 1QPIA 4M3BA 5IPAA 1JTYA 2UXUA 2IBDA 2QOPA 3IH2A 1SGMA 4WIBA 2IU5A 4AUXA 2EH3A 2G7GA 1T56A 2R7SA 3NPIA 2ZOZA 2XPVA 3RD3A 5F0CA 1T33A 3O8HA 5FGLA 2R7WA 2IAIA 2NP3A 3HGGA 4GFLA 1ZK8A 5FKLA 3BCGA 2ZY9A 5FKKA 3HGYA 3TP3A 3CDLA 3MNLA 2B3WA 2R7OA 3QPSA 3FHNA 4U9LA 3FRQA 3BR1A 2FD5A 3BNIA 3F0CA 5F0HA 3O8GA 4M3EA 2DTZA 3TP0A 3CJDA 5GPCA 3BR2A 2ZCMA 3JSJA 5F1JA 2YVHA 1U9OA 2YVXA 4MXMA 3KKDA 3HIMA 1Z77A 3MVPA 2UXIA 3BQYA 2HXIA 2R7UA 3B6AA 5K7ZA 4ICHA 5J1YA 2UXOA 3K8PC 3SDGA 1BJZA 2OF7A 3G7RA 1UI5A 2QIBA 3SWHA 1JT0A 2Q24A 1A6IA 4OD5A 3ZQGA 2TRTA 3LSJA 3VTIA 3QKXA 2GFNA 1ZKGA 2VKVA 2RHAA 2GENA 4G12A 2HYJA 2QWTA 3EUPA 1JUPA 2FJI1 5CQGA 2PFVA 2IEKA 3VW1A 2YVEA 3Q3SA 4GFKA 3B81A 3DU6A 5J1RA 3ZQHA 4GCLA 2R7XA 2Y31A 4M3GA 3ZQFA 3VVYA 2PZ9A 5EZGA 4U9NA 3O60A 2ZOYA 2R7VA 3NS4A 2NX4A 3QPLA 3VVXA 2W53A 1QVUA 3ANGA 3ANPA 3BTIA 3RH2A 2A2FX 3KYLA 4JKZA 2ZCXA 3S5RA 1RKTA 5CW8A 2D6YA 2HQ5A 2G3BA 5H9TA 3VIBA 2TCTA 3CWRA 2HXOA 3SFIA 2RAEA 5K7FA 4W1UA 5FKMA 2WGBA 3PPBA 2RASA 4IRVA 2PBXA 3AQSA 3CCYA 3COLA 3FIWA 3HTJA 3VW2A 4B3AA 2ID6A 2V57A 4CGRA 5D18A 4AF5A 4XK4A 4ABZA 2VPRA 2VKEA 2XGCA 5F0FA 4NN1A 3Q0WA 2UXHA 5GPAA 3KKCA 5HBUA 2G0EA 3DU5A 3EGQA 2QCOA 2HKUA 4B1RA 5FMPA 3NRGA 2XGEA 2XPUA 5D1RA 4M3FA 3BR3A 4V2GA 2UXPA 2Y2ZA 2ID3A 5C4YA 1RPWA 5K58A 5IP6A 3G1MA 3LWJA 2Y30A 3T6NA 3QBMA 4X1EA 3QQAA 2FX0A 2ZCNA 1QVTA 2OPTA 2WV1A 4W97A 3FK6A 2R7QA 3AQTA 5D19A 2GUHA 2NP5A 1RKWA 4AC6A 4YZEA 4JNNA 2GBYA 3LSPA 1Z0XA 4DVYP 2HYTA 2NS8A 4MO7A 5K7HA 3HTHA 1JUSA 3Q0UA 2XRLA 3BTJA 3BJBA 2I10A 3HTIA 5CXIA 3BTLA 2R7RA 3ON4A 3KZ9A 2DG7A 5J3LA 2G7LA 2O7OA 3ON2A 5F08A 2FQ4A
chains in the Genus database with same CATH topology
5FHPA 3BR5A 5CXGA 3Q0VA 5IOZA 4DW6A 2XPWA 3IH4A 1ORKA 2X9DA 5J1UA 4D7NA 3BRUA 2O7TA 2FJ1A 3G1LA 2JJ7A 3V78A 2ZB9A 3VUQA 4NELA 3WHCA 2DG8A 3BTCA 3PM1A 3BHQA 5FKNA 2NS7A 2REKA 3V6GA 4ACIA 5AQCA 3G56A 4D5FA 2XGDA 3CRJA 5EZHA 3IUVA 3VOXA 3E7QA 2QKOA 4GCKA 2QTQA 3DEWA 4ME9A 1JTXA 4GCTA 1JT6A 4V2FA 3BR0A 1UI6A 3NI7A 3BR6A 3C07A 5HSZA 3BT9A 5GP9A 2OERA 5EYRA 3GEUA 1U9NA 5DAJA 3LJLA 4M3DA 3G1OA 3ZQIA 3LHQA 4D7MA 2F07A 2G7SA 4JYKA 3NXCA 2FBQA 5EFYA 5IOYA 4MK6A 2OI8A 3DPJA 4UDSA 4I76A 4L62A 4HKUA 3WHBA 1JUMA 4I6ZA 2JK3A 3GZIA 3F1BA 3LSRA 3VPRA 3B6CA 5FKOA 3P9TA 2X6OA 2XDNA 3DCFA 4AC0A 3ZQLA 3IH3A 1VI0A 3PASA 4KWAA 3VVZA 4JL3A 2XB5A 3VW0A 4PXIA 3BQZA 3LOCA 4D5CA 3HTAA 2WUIA 3HE0A 5F27A 3C2BA 3VOKA 3NNRA 3KNWA 3FK7A 3VP5A 5F04A 5HAWA 1QPIA 4M3BA 5IPAA 1JTYA 2UXUA 2IBDA 2QOPA 3IH2A 1SGMA 2IU5A 4AUXA 2EH3A 2G7GA 1T56A 3NPIA 2ZOZA 2XPVA 3RD3A 5F0CA 1T33A 3O8HA 5FGLA 2IAIA 2NP3A 3HGGA 4GFLA 1ZK8A 5FKLA 3BCGA 5FKKA 3HGYA 3TP3A 3CDLA 3MNLA 3QPSA 3FRQA 3BR1A 2FD5A 3BNIA 3F0CA 5F0HA 3O8GA 4M3EA 2DTZA 3TP0A 3CJDA 5GPCA 3BR2A 2ZCMA 3JSJA 5F1JA 2YVHA 1U9OA 4MXMA 3KKDA 3HIMA 1Z77A 3MVPA 2UXIA 3BQYA 2HXIA 3B6AA 5K7ZA 4ICHA 5J1YA 2UXOA 3SDGA 1BJZA 2OF7A 3G7RA 1UI5A 2QIBA 1JT0A 2Q24A 1A6IA 3ZQGA 2TRTA 3LSJA 3QKXA 2GFNA 1ZKGA 2VKVA 2RHAA 2GENA 4G12A 2HYJA 2QWTA 3EUPA 1JUPA 2IEKA 3VW1A 2YVEA 3Q3SA 4GFKA 3B81A 5J1RA 3ZQHA 4GCLA 2Y31A 4M3GA 3ZQFA 3VVYA 2PZ9A 5EZGA 3O60A 2ZOYA 2NX4A 3QPLA 3VVXA 2W53A 1QVUA 3ANGA 3ANPA 3BTIA 3RH2A 4JKZA 2ZCXA 3S5RA 1RKTA 5CW8A 2D6YA 2HQ5A 2G3BA 5H9TA 3VIBA 2TCTA 3CWRA 2HXOA 3SFIA 2RAEA 5K7FA 4W1UA 5FKMA 2WGBA 3PPBA 2RASA 2PBXA 3AQSA 3CCYA 3COLA 3FIWA 3HTJA 3VW2A 4B3AA 2ID6A 2V57A 4CGRA 5D18A 4AF5A 4XK4A 4ABZA 2VPRA 2VKEA 2XGCA 5F0FA 4NN1A 3Q0WA 2UXHA 5GPAA 3KKCA 5HBUA 2G0EA 3EGQA 2QCOA 2HKUA 4B1RA 5FMPA 3NRGA 2XGEA 2XPUA 5D1RA 4M3FA 3BR3A 4V2GA 2UXPA 2Y2ZA 2ID3A 5C4YA 1RPWA 5K58A 5IP6A 3G1MA 3LWJA 2Y30A 3T6NA 3QBMA 4X1EA 3QQAA 2FX0A 2ZCNA 1QVTA 2OPTA 2WV1A 4W97A 3FK6A 3AQTA 5D19A 2GUHA 2NP5A 1RKWA 4AC6A 4YZEA 4JNNA 2GBYA 3LSPA 1Z0XA 2HYTA 2NS8A 4MO7A 5K7HA 3HTHA 1JUSA 3Q0UA 2XRLA 3BTJA 3BJBA 2I10A 3HTIA 5CXIA 3BTLA 3ON4A 3KZ9A 2DG7A 5J3LA 2G7LA 2O7OA 3ON2A 5F08A 2FQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FHP A;  3BR5 A;  5CXG A;  3Q0V A;  5IOZ A;  4DW6 A;  2XPW A;  3IH4 A;  1ORK A;  2X9D A;  5J1U A;  4D7N A;  3BRU A;  2O7T A;  2FJ1 A;  3G1L A;  2JJ7 A;  3V78 A;  2ZB9 A;  3VUQ A;  4NEL A;  3WHC A;  2DG8 A;  3BTC A;  3PM1 A;  3BHQ A;  5FKN A;  2NS7 A;  2REK A;  3V6G A;  4ACI A;  5AQC A;  3G56 A;  4D5F A;  2XGD A;  3CRJ A;  5EZH A;  3IUV A;  3VOX A;  3E7Q A;  2QKO A;  4GCK A;  2QTQ A;  3DEW A;  4ME9 A;  1JTX A;  4GCT A;  1JT6 A;  4V2F A;  3BR0 A;  1UI6 A;  3NI7 A;  3BR6 A;  3C07 A;  5HSZ A;  3BT9 A;  5GP9 A;  2OER A;  5EYR A;  3GEU A;  1U9N A;  5DAJ A;  3LJL A;  4M3D A;  3G1O A;  3ZQI A;  3LHQ A;  4D7M A;  2F07 A;  2G7S A;  4JYK A;  3NXC A;  2FBQ A;  5EFY A;  5IOY A;  4MK6 A;  2OI8 A;  3DPJ A;  4UDS A;  4I76 A;  4L62 A;  4HKU A;  3WHB A;  1JUM A;  4I6Z A;  2JK3 A;  3GZI A;  3F1B A;  3LSR A;  3VPR A;  3B6C A;  5FKO A;  3P9T A;  2X6O A;  2XDN A;  3DCF A;  4AC0 A;  3ZQL A;  3IH3 A;  1VI0 A;  3PAS A;  4KWA A;  3VVZ A;  4JL3 A;  2XB5 A;  3VW0 A;  4PXI A;  3BQZ A;  3LOC A;  4D5C A;  3HTA A;  2WUI A;  3HE0 A;  5F27 A;  3C2B A;  3VOK A;  3NNR A;  3KNW A;  3FK7 A;  3VP5 A;  5F04 A;  5HAW A;  1QPI A;  4M3B A;  5IPA A;  1JTY A;  2UXU A;  2IBD A;  2QOP A;  3IH2 A;  1SGM A;  2IU5 A;  4AUX A;  2EH3 A;  2G7G A;  1T56 A;  3NPI A;  2ZOZ A;  2XPV A;  3RD3 A;  5F0C A;  1T33 A;  3O8H A;  5FGL A;  2IAI A;  2NP3 A;  3HGG A;  4GFL A;  1ZK8 A;  5FKL A;  3BCG A;  5FKK A;  3HGY A;  3TP3 A;  3CDL A;  3MNL A;  3QPS A;  3FRQ A;  3BR1 A;  2FD5 A;  3BNI A;  3F0C A;  5F0H A;  3O8G A;  4M3E A;  2DTZ A;  3TP0 A;  3CJD A;  5GPC A;  3BR2 A;  2ZCM A;  3JSJ A;  5F1J A;  2YVH A;  1U9O A;  4MXM A;  3KKD A;  3HIM A;  1Z77 A;  3MVP A;  2UXI A;  3BQY A;  2HXI A;  3B6A A;  5K7Z A;  4ICH A;  5J1Y A;  2UXO A;  3SDG A;  1BJZ A;  2OF7 A;  3G7R A;  1UI5 A;  2QIB A;  1JT0 A;  2Q24 A;  1A6I A;  3ZQG A;  2TRT A;  3LSJ A;  3QKX A;  2GFN A;  1ZKG A;  2VKV A;  2RHA A;  2GEN A;  4G12 A;  2HYJ A;  2QWT A;  3EUP A;  1JUP A;  2IEK A;  3VW1 A;  2YVE A;  3Q3S A;  4GFK A;  3B81 A;  5J1R A;  3ZQH A;  4GCL A;  2Y31 A;  4M3G A;  3ZQF A;  3VVY A;  2PZ9 A;  5EZG A;  3O60 A;  2ZOY A;  2NX4 A;  3QPL A;  3VVX A;  2W53 A;  1QVU A;  3ANG A;  3ANP A;  3BTI A;  3RH2 A;  4JKZ A;  2ZCX A;  3S5R A;  1RKT A;  5CW8 A;  2D6Y A;  2HQ5 A;  2G3B A;  5H9T A;  3VIB A;  2TCT A;  3CWR A;  2HXO A;  3SFI A;  2RAE A;  5K7F A;  4W1U A;  5FKM A;  2WGB A;  3PPB A;  2RAS A;  2PBX A;  3AQS A;  3CCY A;  3COL A;  3FIW A;  3HTJ A;  3VW2 A;  4B3A A;  2ID6 A;  2V57 A;  4CGR A;  5D18 A;  4AF5 A;  4XK4 A;  4ABZ A;  2VPR A;  2VKE A;  2XGC A;  5F0F A;  4NN1 A;  3Q0W A;  2UXH A;  5GPA A;  3KKC A;  5HBU A;  2G0E A;  3EGQ A;  2QCO A;  2HKU A;  4B1R A;  5FMP A;  3NRG A;  2XGE A;  2XPU A;  5D1R A;  4M3F A;  3BR3 A;  4V2G A;  2UXP A;  2Y2Z A;  2ID3 A;  5C4Y A;  1RPW A;  5K58 A;  5IP6 A;  3G1M A;  3LWJ A;  2Y30 A;  3T6N A;  3QBM A;  4X1E A;  3QQA A;  2FX0 A;  2ZCN A;  1QVT A;  2OPT A;  2WV1 A;  4W97 A;  3FK6 A;  3AQT A;  5D19 A;  2GUH A;  2NP5 A;  1RKW A;  4AC6 A;  4YZE A;  4JNN A;  2GBY A;  3LSP A;  1Z0X A;  2HYT A;  2NS8 A;  4MO7 A;  5K7H A;  3HTH A;  1JUS A;  3Q0U A;  2XRL A;  3BTJ A;  3BJB A;  2I10 A;  3HTI A;  5CXI A;  3BTL A;  3ON4 A;  3KZ9 A;  2DG7 A;  5J3L A;  2G7L A;  2O7O A;  3ON2 A;  5F08 A;  2FQ4 A; 
#chains in the Genus database with same CATH topology
 5FHP A;  3BR5 A;  5CXG A;  3Q0V A;  5IOZ A;  4DW6 A;  2XPW A;  3IH4 A;  1ORK A;  2X9D A;  5J1U A;  4D7N A;  3BRU A;  2O7T A;  2FJ1 A;  3G1L A;  2B1E A;  2JJ7 A;  3V78 A;  2ZB9 A;  3VUQ A;  4NEL A;  3WHC A;  2DG8 A;  3BTC A;  3PM1 A;  3BHQ A;  5FKN A;  2NS7 A;  2REK A;  4OD4 A;  3V6G A;  4ACI A;  5AQC A;  3G56 A;  4D5F A;  2XGD A;  3CRJ A;  5EZH A;  3IUV A;  3VOX A;  3E7Q A;  2QKO A;  4GCK A;  2QTQ A;  3DEW A;  4ME9 A;  1JTX A;  4GCT A;  1JT6 A;  4V2F A;  3BR0 A;  1UI6 A;  3NI7 A;  3BR6 A;  3C07 A;  5HSZ A;  3BT9 A;  5GP9 A;  2OER A;  5EYR A;  3GEU A;  1U9N A;  5DAJ A;  3LJL A;  4M3D A;  3G1O A;  3ZQI A;  3LHQ A;  4D7M A;  2F07 A;  2G7S A;  4JYK A;  3NXC A;  2FBQ A;  5EFY A;  5IOY A;  4MK6 A;  2OI8 A;  3DPJ A;  4UDS A;  4I76 A;  4L62 A;  4HKU A;  3WHB A;  1JUM A;  4I6Z A;  2JK3 A;  3GZI A;  3F1B A;  3LSR A;  3VPR A;  3B6C A;  5FKO A;  3P9T A;  2X6O A;  2XDN A;  3DCF A;  4AC0 A;  3ZQL A;  2R7T A;  3IH3 A;  1VI0 A;  3PAS A;  4KWA A;  3VVZ A;  4JL3 A;  2XB5 A;  3VW0 A;  4PXI A;  3BQZ A;  3LOC A;  4D5C A;  3HTA A;  4C2M A;  2WUI A;  3HE0 A;  5F27 A;  3C2B A;  3VOK A;  3NNR A;  3KNW A;  3FK7 A;  3VP5 A;  5F04 A;  5HAW A;  1QPI A;  4M3B A;  5IPA A;  1JTY A;  2UXU A;  2IBD A;  2QOP A;  3IH2 A;  1SGM A;  4WIB A;  2IU5 A;  4AUX A;  2EH3 A;  2G7G A;  1T56 A;  2R7S A;  3NPI A;  2ZOZ A;  2XPV A;  3RD3 A;  5F0C A;  1T33 A;  3O8H A;  5FGL A;  2R7W A;  2IAI A;  2NP3 A;  3HGG A;  4GFL A;  1ZK8 A;  5FKL A;  3BCG A;  2ZY9 A;  5FKK A;  3HGY A;  3TP3 A;  3CDL A;  3MNL A;  2B3W A;  2R7O A;  3QPS A;  3FHN A;  4U9L A;  3FRQ A;  3BR1 A;  2FD5 A;  3BNI A;  3F0C A;  5F0H A;  3O8G A;  4M3E A;  2DTZ A;  3TP0 A;  3CJD A;  5GPC A;  3BR2 A;  2ZCM A;  3JSJ A;  5F1J A;  2YVH A;  1U9O A;  2YVX A;  4MXM A;  3KKD A;  3HIM A;  1Z77 A;  3MVP A;  2UXI A;  3BQY A;  2HXI A;  2R7U A;  3B6A A;  5K7Z A;  4ICH A;  5J1Y A;  2UXO A;  3K8P C;  3SDG A;  1BJZ A;  2OF7 A;  3G7R A;  1UI5 A;  2QIB A;  3SWH A;  1JT0 A;  2Q24 A;  1A6I A;  4OD5 A;  3ZQG A;  2TRT A;  3LSJ A;  3VTI A;  3QKX A;  2GFN A;  1ZKG A;  2VKV A;  2RHA A;  2GEN A;  4G12 A;  2HYJ A;  2QWT A;  3EUP A;  1JUP A;  2FJI 1;  5CQG A;  2PFV A;  2IEK A;  3VW1 A;  2YVE A;  3Q3S A;  4GFK A;  3B81 A;  3DU6 A;  5J1R A;  3ZQH A;  4GCL A;  2R7X A;  2Y31 A;  4M3G A;  3ZQF A;  3VVY A;  2PZ9 A;  5EZG A;  4U9N A;  3O60 A;  2ZOY A;  2R7V A;  3NS4 A;  2NX4 A;  3QPL A;  3VVX A;  2W53 A;  1QVU A;  3ANG A;  3ANP A;  3BTI A;  3RH2 A;  2A2F X;  3KYL A;  4JKZ A;  2ZCX A;  3S5R A;  1RKT A;  5CW8 A;  2D6Y A;  2HQ5 A;  2G3B A;  5H9T A;  3VIB A;  2TCT A;  3CWR A;  2HXO A;  3SFI A;  2RAE A;  5K7F A;  4W1U A;  5FKM A;  2WGB A;  3PPB A;  2RAS A;  4IRV A;  2PBX A;  3AQS A;  3CCY A;  3COL A;  3FIW A;  3HTJ A;  3VW2 A;  4B3A A;  2ID6 A;  2V57 A;  4CGR A;  5D18 A;  4AF5 A;  4XK4 A;  4ABZ A;  2VPR A;  2VKE A;  2XGC A;  5F0F A;  4NN1 A;  3Q0W A;  2UXH A;  5GPA A;  3KKC A;  5HBU A;  2G0E A;  3DU5 A;  3EGQ A;  2QCO A;  2HKU A;  4B1R A;  5FMP A;  3NRG A;  2XGE A;  2XPU A;  5D1R A;  4M3F A;  3BR3 A;  4V2G A;  2UXP A;  2Y2Z A;  2ID3 A;  5C4Y A;  1RPW A;  5K58 A;  5IP6 A;  3G1M A;  3LWJ A;  2Y30 A;  3T6N A;  3QBM A;  4X1E A;  3QQA A;  2FX0 A;  2ZCN A;  1QVT A;  2OPT A;  2WV1 A;  4W97 A;  3FK6 A;  2R7Q A;  3AQT A;  5D19 A;  2GUH A;  2NP5 A;  1RKW A;  4AC6 A;  4YZE A;  4JNN A;  2GBY A;  3LSP A;  1Z0X A;  4DVY P;  2HYT A;  2NS8 A;  4MO7 A;  5K7H A;  3HTH A;  1JUS A;  3Q0U A;  2XRL A;  3BTJ A;  3BJB A;  2I10 A;  3HTI A;  5CXI A;  3BTL A;  2R7R A;  3ON4 A;  3KZ9 A;  2DG7 A;  5J3L A;  2G7L A;  2O7O A;  3ON2 A;  5F08 A;  2FQ4 A; 
#chains in the Genus database with same CATH homology
 5FHP A;  3BR5 A;  5CXG A;  3Q0V A;  5IOZ A;  4DW6 A;  2XPW A;  3IH4 A;  1ORK A;  2X9D A;  5J1U A;  4D7N A;  3BRU A;  2O7T A;  2FJ1 A;  3G1L A;  2JJ7 A;  3V78 A;  2ZB9 A;  3VUQ A;  4NEL A;  3WHC A;  2DG8 A;  3BTC A;  3PM1 A;  3BHQ A;  5FKN A;  2NS7 A;  2REK A;  3V6G A;  4ACI A;  5AQC A;  3G56 A;  4D5F A;  2XGD A;  3CRJ A;  5EZH A;  3IUV A;  3VOX A;  3E7Q A;  2QKO A;  4GCK A;  2QTQ A;  3DEW A;  4ME9 A;  1JTX A;  4GCT A;  1JT6 A;  4V2F A;  3BR0 A;  1UI6 A;  3NI7 A;  3BR6 A;  3C07 A;  5HSZ A;  3BT9 A;  5GP9 A;  2OER A;  5EYR A;  3GEU A;  1U9N A;  5DAJ A;  3LJL A;  4M3D A;  3G1O A;  3ZQI A;  3LHQ A;  4D7M A;  2F07 A;  2G7S A;  4JYK A;  3NXC A;  2FBQ A;  5EFY A;  5IOY A;  4MK6 A;  2OI8 A;  3DPJ A;  4UDS A;  4I76 A;  4L62 A;  4HKU A;  3WHB A;  1JUM A;  4I6Z A;  2JK3 A;  3GZI A;  3F1B A;  3LSR A;  3VPR A;  3B6C A;  5FKO A;  3P9T A;  2X6O A;  2XDN A;  3DCF A;  4AC0 A;  3ZQL A;  3IH3 A;  1VI0 A;  3PAS A;  4KWA A;  3VVZ A;  4JL3 A;  2XB5 A;  3VW0 A;  4PXI A;  3BQZ A;  3LOC A;  4D5C A;  3HTA A;  2WUI A;  3HE0 A;  5F27 A;  3C2B A;  3VOK A;  3NNR A;  3KNW A;  3FK7 A;  3VP5 A;  5F04 A;  5HAW A;  1QPI A;  4M3B A;  5IPA A;  1JTY A;  2UXU A;  2IBD A;  2QOP A;  3IH2 A;  1SGM A;  2IU5 A;  4AUX A;  2EH3 A;  2G7G A;  1T56 A;  3NPI A;  2ZOZ A;  2XPV A;  3RD3 A;  5F0C A;  1T33 A;  3O8H A;  5FGL A;  2IAI A;  2NP3 A;  3HGG A;  4GFL A;  1ZK8 A;  5FKL A;  3BCG A;  5FKK A;  3HGY A;  3TP3 A;  3CDL A;  3MNL A;  3QPS A;  3FRQ A;  3BR1 A;  2FD5 A;  3BNI A;  3F0C A;  5F0H A;  3O8G A;  4M3E A;  2DTZ A;  3TP0 A;  3CJD A;  5GPC A;  3BR2 A;  2ZCM A;  3JSJ A;  5F1J A;  2YVH A;  1U9O A;  4MXM A;  3KKD A;  3HIM A;  1Z77 A;  3MVP A;  2UXI A;  3BQY A;  2HXI A;  3B6A A;  5K7Z A;  4ICH A;  5J1Y A;  2UXO A;  3SDG A;  1BJZ A;  2OF7 A;  3G7R A;  1UI5 A;  2QIB A;  1JT0 A;  2Q24 A;  1A6I A;  3ZQG A;  2TRT A;  3LSJ A;  3QKX A;  2GFN A;  1ZKG A;  2VKV A;  2RHA A;  2GEN A;  4G12 A;  2HYJ A;  2QWT A;  3EUP A;  1JUP A;  2IEK A;  3VW1 A;  2YVE A;  3Q3S A;  4GFK A;  3B81 A;  5J1R A;  3ZQH A;  4GCL A;  2Y31 A;  4M3G A;  3ZQF A;  3VVY A;  2PZ9 A;  5EZG A;  3O60 A;  2ZOY A;  2NX4 A;  3QPL A;  3VVX A;  2W53 A;  1QVU A;  3ANG A;  3ANP A;  3BTI A;  3RH2 A;  4JKZ A;  2ZCX A;  3S5R A;  1RKT A;  5CW8 A;  2D6Y A;  2HQ5 A;  2G3B A;  5H9T A;  3VIB A;  2TCT A;  3CWR A;  2HXO A;  3SFI A;  2RAE A;  5K7F A;  4W1U A;  5FKM A;  2WGB A;  3PPB A;  2RAS A;  2PBX A;  3AQS A;  3CCY A;  3COL A;  3FIW A;  3HTJ A;  3VW2 A;  4B3A A;  2ID6 A;  2V57 A;  4CGR A;  5D18 A;  4AF5 A;  4XK4 A;  4ABZ A;  2VPR A;  2VKE A;  2XGC A;  5F0F A;  4NN1 A;  3Q0W A;  2UXH A;  5GPA A;  3KKC A;  5HBU A;  2G0E A;  3EGQ A;  2QCO A;  2HKU A;  4B1R A;  5FMP A;  3NRG A;  2XGE A;  2XPU A;  5D1R A;  4M3F A;  3BR3 A;  4V2G A;  2UXP A;  2Y2Z A;  2ID3 A;  5C4Y A;  1RPW A;  5K58 A;  5IP6 A;  3G1M A;  3LWJ A;  2Y30 A;  3T6N A;  3QBM A;  4X1E A;  3QQA A;  2FX0 A;  2ZCN A;  1QVT A;  2OPT A;  2WV1 A;  4W97 A;  3FK6 A;  3AQT A;  5D19 A;  2GUH A;  2NP5 A;  1RKW A;  4AC6 A;  4YZE A;  4JNN A;  2GBY A;  3LSP A;  1Z0X A;  2HYT A;  2NS8 A;  4MO7 A;  5K7H A;  3HTH A;  1JUS A;  3Q0U A;  2XRL A;  3BTJ A;  3BJB A;  2I10 A;  3HTI A;  5CXI A;  3BTL A;  3ON4 A;  3KZ9 A;  2DG7 A;  5J3L A;  2G7L A;  2O7O A;  3ON2 A;  5F08 A;  2FQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...