3VIBA

Structural basis for multidrug recognition and antimicrobial resistance by mtrr, an efflux pump regulator from neisseria gonorrhoeae
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
202
structure length
193
Chain Sequence
b'ALKTKEHLMLAALETFYRKGIARTSLNEIAQAAGVTRDALYWHFKNKEDLFDALFQRICDDIENCIGSWTVFRHTLLHFFERLQSNDIHYKFHNILFLKCEHTEQNAAVIAIARKHQAIWREKITAVLTEAVENQDLADDLDKETAVIFIKSTLDGLIWRWFSSGESFDLGKTAPRIIGIMMDNLENHPCLRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MtrR
molecule tags Dna binding protein
source organism Neisseria gonorrhoeae
publication title Structural basis for multidrug recognitionand antimicrobial resistance by MTRR, an efflux pump regulator from Neisseria Gonorrhoeae
rcsb
total genus 81
structure length 193
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
A PF08361 TetR_C_2 MAATS-type transcriptional repressor, C-terminal region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vibA00
3ZQIA 2IBDA 4YZEA 5EFYA 5GP9A 3SDGA 5F1JA 2VKVA 3G1OA 2NP3A 4M3FA 3COLA 5DAJA 4D7MA 1A6IA 5D18A 2Y2ZA 2FQ4A 2QCOA 3BCGA 3IH4A 4AC0A 5K58A 5CXIA 3QPLA 3F1BA 3CWRA 3BTJA 3V78A 2ZOYA 3TP0A 1T56A 3WHCA 4GFLA 3CJDA 3LSRA 3CDLA 3F0CA 3V6GA 2DTZA 3VP5A 3LHQA 4M3EA 4JYKA 4CGRA 2G7SA 2WUIA 2OPTA 2D6YA 3BR0A 2HXIA 3VOKA 4AC6A 3VUQA 3LSPA 2XPUA 2ID3A 1JUMA 3Q3SA 3DCFA 2VPRA 2RHAA 1ORKA 3VPRA 1QPIA 5IPAA 4JNNA 2XRLA 3VW1A 3BR2A 3ZQLA 2NS7A 2Q24A 1JTYA 1RKWA 2O7TA 3NPIA 4V2GA 4ME9A 3Q0UA 3HGYA 3GEUA 3VW2A 3B6AA 3O60A 3BJBA 2GENA 5J1RA 5FHPA 4GCKA 5IOZA 2F07A 2ZB9A 5F27A 3VVZA 2UXHA 1JUSA 3FK7A 1UI5A 2QKOA 5F04A 3AQTA 2ZOZA 3B81A 3C07A 2GUHA 4G12A 3NI7A 4M3BA 2V57A 2XB5A 3MVPA 4JKZA 4D5CA 5AQCA 2X9DA 5FKOA 3LWJA 4NN1A 2EH3A 3P9TA 3KZ9A 4M3DA 4AF5A 3BQZA 3ANPA 5FMPA 1QVUA 5H9TA 3BR6A 3Q0WA 5FKKA 2QWTA 1JTXA 4AUXA 2YVHA 5J1UA 5EZGA 3JSJA 2NS8A 2UXPA 2OF7A 5FKMA 2X6OA 4I76A 4L62A 5F08A 3B6CA 5F0CA 3G7RA 5EYRA 5K7HA 2ZCNA 3NRGA 2HXOA 2GBYA 3PPBA 5D1RA 3ON2A 4X1EA 2UXUA 2XGCA 2WV1A 3G1MA 3VW0A 3GZIA 3O8GA 1U9OA 3T6NA 2JJ7A 5J1YA 5HSZA 4I6ZA 2XGEA 2PZ9A 4B1RA 2QIBA 3KNWA 5EZHA 3VIBA 4UDSA 4PXIA 3NXCA 3RD3A 4MK6A 5J3LA 3QBMA 2FJ1A 4DW6A 1Z77A 1SGMA 2OERA 1RKTA 3LSJA 3G56A 4W97A 2RASA 4MXMA 3HIMA 2NX4A 4GCTA 5GPAA 4ICHA 4MO7A 3HGGA 3EGQA 3WHBA 2ZCMA 3CRJA 5GPCA 3HE0A 3VOXA 3QPSA 2I10A 3NNRA 2YVEA 3MNLA 3BR5A 3ON4A 3S5RA 5F0HA 1BJZA 2G7GA 3VVXA 1ZK8A 5FKNA 3ZQGA 3IUVA 3KKCA 4D5FA 5K7FA 2TRTA 2FBQA 4KWAA 5D19A 5IP6A 4GFKA 2ZCXA 3E7QA 3BR3A 3BT9A 5IOYA 1JT6A 3BNIA 1U9NA 2PBXA 4GCLA 2XPVA 3BTIA 3FK6A 3EUPA 2RAEA 4D7NA 3PM1A 2DG7A 2HYTA 1T33A 2QTQA 3ZQHA 3BHQA 1UI6A 5CW8A 3BTCA 2HYJA 3HTJA 5FKLA 5F0FA 3BRUA 2FX0A 3LJLA 4XK4A 4B3AA 3SFIA 1VI0A 5CXGA 3HTIA 1JT0A 3QQAA 2OI8A 3ZQFA 2G3BA 3FIWA 5FGLA 1RPWA 1Z0XA 4HKUA 1JUPA 2W53A 3AQSA 2G7LA 2HQ5A 2G0EA 3C2BA 3DPJA 3CCYA 3LOCA 1QVTA 2UXIA 3QKXA 3BQYA 2QOPA 3O8HA 2NP5A 3BR1A 5K7ZA 4JL3A 4W1UA 2FD5A 3VVYA 3G1LA 2XDNA 3IH2A 4V2FA 2XPWA 2XGDA 5C4YA 2UXOA 1ZKGA 3FRQA 4ABZA 2IEKA 4ACIA 2IU5A 5HAWA 3DEWA 3BTLA 3TP3A 2Y31A 2REKA 2TCTA 3KKDA 2GFNA 2Y30A 3HTAA 2IAIA 2JK3A 2O7OA 4NELA 3RH2A 3HTHA 2VKEA 4M3GA 2ID6A 3Q0VA 2HKUA 3IH3A 2WGBA 5HBUA 3PASA 3ANGA 2DG8A
chains in the Genus database with same CATH superfamily
3ZQIA 2IBDA 4YZEA 5EFYA 3K8PC 5GP9A 4WIBA 3SDGA 5F1JA 2VKVA 3G1OA 2NP3A 4M3FA 2PFVA 3COLA 5DAJA 4D7MA 1A6IA 5D18A 2Y2ZA 2FQ4A 2QCOA 3BCGA 3IH4A 4AC0A 5K58A 5CXIA 3QPLA 2R7TA 3F1BA 3CWRA 3BTJA 3V78A 2ZOYA 3TP0A 1T56A 3WHCA 4GFLA 3CJDA 3LSRA 3CDLA 3F0CA 2R7OA 3V6GA 2DTZA 3VP5A 3LHQA 4M3EA 4JYKA 2R7VA 4CGRA 2G7SA 2WUIA 2OPTA 2ZY9A 2D6YA 3BR0A 2HXIA 3VOKA 4AC6A 3VUQA 3LSPA 2XPUA 2ID3A 1JUMA 3Q3SA 3DCFA 2VPRA 2RHAA 1ORKA 5CQGA 3VPRA 1QPIA 5IPAA 4JNNA 2XRLA 3VW1A 3BR2A 3ZQLA 2NS7A 3SWHA 2Q24A 1JTYA 1RKWA 2O7TA 3NPIA 4V2GA 4ME9A 3Q0UA 3HGYA 3GEUA 3VW2A 3B6AA 3O60A 3BJBA 2GENA 5J1RA 5FHPA 4GCKA 5IOZA 2F07A 2ZB9A 3DU6A 5F27A 3VVZA 2UXHA 3FHNA 4U9NA 1JUSA 3FK7A 1UI5A 2QKOA 5F04A 3AQTA 2ZOZA 3B81A 3C07A 2GUHA 4G12A 2R7QA 3NI7A 4M3BA 2V57A 2XB5A 3MVPA 4JKZA 4D5CA 5AQCA 2X9DA 5FKOA 3LWJA 4NN1A 2EH3A 3P9TA 3KZ9A 4AF5A 4M3DA 3BQZA 3KYLA 3ANPA 1QVUA 3BR6A 3Q0WA 5H9TA 5FMPA 5FKKA 2QWTA 2R7SA 1JTXA 4AUXA 2YVHA 5J1UA 5EZGA 3JSJA 2NS8A 2UXPA 2OF7A 5FKMA 2X6OA 4I76A 4L62A 5F08A 3B6CA 5F0CA 3G7RA 5EYRA 5K7HA 2ZCNA 3NRGA 2HXOA 2GBYA 3NS4A 3PPBA 5D1RA 3ON2A 4X1EA 2UXUA 2XGCA 2WV1A 3G1MA 3VW0A 3GZIA 3O8GA 1U9OA 3T6NA 2JJ7A 5J1YA 5HSZA 4I6ZA 4OD4A 2XGEA 2PZ9A 4B1RA 2B3WA 2QIBA 3KNWA 2YVXA 5EZHA 3VIBA 4UDSA 4PXIA 2A2FX 3NXCA 2FJI1 3RD3A 4MK6A 5J3LA 2R7WA 3QBMA 2FJ1A 4DW6A 1Z77A 1SGMA 2OERA 1RKTA 3LSJA 3G56A 4W97A 2RASA 4MXMA 3HIMA 2NX4A 4GCTA 5GPAA 4ICHA 4MO7A 3HGGA 3EGQA 3WHBA 4C2MA 2ZCMA 3CRJA 5GPCA 3DU5A 3HE0A 3VOXA 3QPSA 2I10A 3NNRA 2YVEA 3MNLA 3BR5A 3ON4A 3S5RA 1BJZA 5F0HA 2G7GA 3VVXA 1ZK8A 5FKNA 3ZQGA 3IUVA 3KKCA 4D5FA 5K7FA 2TRTA 4IRVA 2FBQA 4KWAA 5D19A 5IP6A 4GFKA 2ZCXA 3E7QA 3BR3A 3BT9A 5IOYA 1JT6A 3BNIA 1U9NA 3VTIA 2PBXA 4GCLA 2XPVA 3BTIA 3FK6A 3EUPA 2RAEA 4D7NA 3PM1A 2DG7A 2HYTA 4DVYP 1T33A 2QTQA 3ZQHA 3BHQA 1UI6A 5CW8A 3BTCA 2HYJA 3HTJA 5FKLA 5F0FA 3BRUA 2FX0A 3LJLA 4XK4A 4B3AA 3SFIA 1VI0A 5CXGA 3HTIA 1JT0A 3QQAA 2OI8A 3ZQFA 2G3BA 3FIWA 5FGLA 1RPWA 1Z0XA 4HKUA 1JUPA 2W53A 3AQSA 2G7LA 2HQ5A 2G0EA 3C2BA 3DPJA 4OD5A 3CCYA 3LOCA 1QVTA 2UXIA 3QKXA 3BQYA 2QOPA 3O8HA 2NP5A 3BR1A 5K7ZA 4JL3A 4W1UA 2FD5A 3VVYA 3G1LA 2XDNA 2B1EA 3IH2A 4V2FA 2XPWA 2XGDA 5C4YA 2UXOA 1ZKGA 3FRQA 4ABZA 2IEKA 4U9LA 4ACIA 2IU5A 5HAWA 3DEWA 2R7XA 3BTLA 3TP3A 2Y31A 2REKA 2TCTA 3KKDA 2GFNA 2Y30A 3HTAA 2R7UA 2IAIA 2JK3A 2O7OA 4NELA 3RH2A 3HTHA 2VKEA 4M3GA 2ID6A 3Q0VA 2HKUA 3IH3A 2WGBA 5HBUA 2R7RA 3PASA 3ANGA 2DG8A
chains in the Genus database with same CATH topology
3ZQIA 2IBDA 4YZEA 5EFYA 5GP9A 3SDGA 5F1JA 2VKVA 3G1OA 2NP3A 4M3FA 3COLA 5DAJA 4D7MA 1A6IA 5D18A 2Y2ZA 2FQ4A 2QCOA 3BCGA 3IH4A 4AC0A 5K58A 5CXIA 3QPLA 3F1BA 3CWRA 3BTJA 3V78A 2ZOYA 3TP0A 1T56A 3WHCA 4GFLA 3CJDA 3LSRA 3CDLA 3F0CA 3V6GA 2DTZA 3VP5A 3LHQA 4M3EA 4JYKA 4CGRA 2G7SA 2WUIA 2OPTA 2D6YA 3BR0A 2HXIA 3VOKA 4AC6A 3VUQA 3LSPA 2XPUA 2ID3A 1JUMA 3Q3SA 3DCFA 2VPRA 2RHAA 1ORKA 3VPRA 1QPIA 5IPAA 4JNNA 2XRLA 3VW1A 3BR2A 3ZQLA 2NS7A 2Q24A 1JTYA 1RKWA 2O7TA 3NPIA 4V2GA 4ME9A 3Q0UA 3HGYA 3GEUA 3VW2A 3B6AA 3O60A 3BJBA 2GENA 5J1RA 5FHPA 4GCKA 5IOZA 2F07A 2ZB9A 5F27A 3VVZA 2UXHA 1JUSA 3FK7A 1UI5A 2QKOA 5F04A 3AQTA 2ZOZA 3B81A 3C07A 2GUHA 4G12A 3NI7A 4M3BA 2V57A 2XB5A 3MVPA 4JKZA 4D5CA 5AQCA 2X9DA 5FKOA 3LWJA 4NN1A 2EH3A 3P9TA 3KZ9A 4M3DA 4AF5A 3BQZA 3ANPA 5FMPA 1QVUA 5H9TA 3BR6A 3Q0WA 5FKKA 2QWTA 1JTXA 4AUXA 2YVHA 5J1UA 5EZGA 3JSJA 2NS8A 2UXPA 2OF7A 5FKMA 2X6OA 4I76A 4L62A 5F08A 3B6CA 5F0CA 3G7RA 5EYRA 5K7HA 2ZCNA 3NRGA 2HXOA 2GBYA 3PPBA 5D1RA 3ON2A 4X1EA 2UXUA 2XGCA 2WV1A 3G1MA 3VW0A 3GZIA 3O8GA 1U9OA 3T6NA 2JJ7A 5J1YA 5HSZA 4I6ZA 2XGEA 2PZ9A 4B1RA 2QIBA 3KNWA 5EZHA 3VIBA 4UDSA 4PXIA 3NXCA 3RD3A 4MK6A 5J3LA 3QBMA 2FJ1A 4DW6A 1Z77A 1SGMA 2OERA 1RKTA 3LSJA 3G56A 4W97A 2RASA 4MXMA 3HIMA 2NX4A 4GCTA 5GPAA 4ICHA 4MO7A 3HGGA 3EGQA 3WHBA 2ZCMA 3CRJA 5GPCA 3HE0A 3VOXA 3QPSA 2I10A 3NNRA 2YVEA 3MNLA 3BR5A 3ON4A 3S5RA 5F0HA 1BJZA 2G7GA 3VVXA 1ZK8A 5FKNA 3ZQGA 3IUVA 3KKCA 4D5FA 5K7FA 2TRTA 2FBQA 4KWAA 5D19A 5IP6A 4GFKA 2ZCXA 3E7QA 3BR3A 3BT9A 5IOYA 1JT6A 3BNIA 1U9NA 2PBXA 4GCLA 2XPVA 3BTIA 3FK6A 3EUPA 2RAEA 4D7NA 3PM1A 2DG7A 2HYTA 1T33A 2QTQA 3ZQHA 3BHQA 1UI6A 5CW8A 3BTCA 2HYJA 3HTJA 5FKLA 5F0FA 3BRUA 2FX0A 3LJLA 4XK4A 4B3AA 3SFIA 1VI0A 5CXGA 3HTIA 1JT0A 3QQAA 2OI8A 3ZQFA 2G3BA 3FIWA 5FGLA 1RPWA 1Z0XA 4HKUA 1JUPA 2W53A 3AQSA 2G7LA 2HQ5A 2G0EA 3C2BA 3DPJA 3CCYA 3LOCA 1QVTA 2UXIA 3QKXA 3BQYA 2QOPA 3O8HA 2NP5A 3BR1A 5K7ZA 4JL3A 4W1UA 2FD5A 3VVYA 3G1LA 2XDNA 3IH2A 4V2FA 2XPWA 2XGDA 5C4YA 2UXOA 1ZKGA 3FRQA 4ABZA 2IEKA 4ACIA 2IU5A 5HAWA 3DEWA 3BTLA 3TP3A 2Y31A 2REKA 2TCTA 3KKDA 2GFNA 2Y30A 3HTAA 2IAIA 2JK3A 2O7OA 4NELA 3RH2A 3HTHA 2VKEA 4M3GA 2ID6A 3Q0VA 2HKUA 3IH3A 2WGBA 5HBUA 3PASA 3ANGA 2DG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQI A;  2IBD A;  4YZE A;  5EFY A;  5GP9 A;  3SDG A;  5F1J A;  2VKV A;  3G1O A;  2NP3 A;  4M3F A;  3COL A;  5DAJ A;  4D7M A;  1A6I A;  5D18 A;  2Y2Z A;  2FQ4 A;  2QCO A;  3BCG A;  3IH4 A;  4AC0 A;  5K58 A;  5CXI A;  3QPL A;  3F1B A;  3CWR A;  3BTJ A;  3V78 A;  2ZOY A;  3TP0 A;  1T56 A;  3WHC A;  4GFL A;  3CJD A;  3LSR A;  3CDL A;  3F0C A;  3V6G A;  2DTZ A;  3VP5 A;  3LHQ A;  4M3E A;  4JYK A;  4CGR A;  2G7S A;  2WUI A;  2OPT A;  2D6Y A;  3BR0 A;  2HXI A;  3VOK A;  4AC6 A;  3VUQ A;  3LSP A;  2XPU A;  2ID3 A;  1JUM A;  3Q3S A;  3DCF A;  2VPR A;  2RHA A;  1ORK A;  3VPR A;  1QPI A;  5IPA A;  4JNN A;  2XRL A;  3VW1 A;  3BR2 A;  3ZQL A;  2NS7 A;  2Q24 A;  1JTY A;  1RKW A;  2O7T A;  3NPI A;  4V2G A;  4ME9 A;  3Q0U A;  3HGY A;  3GEU A;  3VW2 A;  3B6A A;  3O60 A;  3BJB A;  2GEN A;  5J1R A;  5FHP A;  4GCK A;  5IOZ A;  2F07 A;  2ZB9 A;  5F27 A;  3VVZ A;  2UXH A;  1JUS A;  3FK7 A;  1UI5 A;  2QKO A;  5F04 A;  3AQT A;  2ZOZ A;  3B81 A;  3C07 A;  2GUH A;  4G12 A;  3NI7 A;  4M3B A;  2V57 A;  2XB5 A;  3MVP A;  4JKZ A;  4D5C A;  5AQC A;  2X9D A;  5FKO A;  3LWJ A;  4NN1 A;  2EH3 A;  3P9T A;  3KZ9 A;  4M3D A;  4AF5 A;  3BQZ A;  3ANP A;  5FMP A;  1QVU A;  5H9T A;  3BR6 A;  3Q0W A;  5FKK A;  2QWT A;  1JTX A;  4AUX A;  2YVH A;  5J1U A;  5EZG A;  3JSJ A;  2NS8 A;  2UXP A;  2OF7 A;  5FKM A;  2X6O A;  4I76 A;  4L62 A;  5F08 A;  3B6C A;  5F0C A;  3G7R A;  5EYR A;  5K7H A;  2ZCN A;  3NRG A;  2HXO A;  2GBY A;  3PPB A;  5D1R A;  3ON2 A;  4X1E A;  2UXU A;  2XGC A;  2WV1 A;  3G1M A;  3VW0 A;  3GZI A;  3O8G A;  1U9O A;  3T6N A;  2JJ7 A;  5J1Y A;  5HSZ A;  4I6Z A;  2XGE A;  2PZ9 A;  4B1R A;  2QIB A;  3KNW A;  5EZH A;  3VIB A;  4UDS A;  4PXI A;  3NXC A;  3RD3 A;  4MK6 A;  5J3L A;  3QBM A;  2FJ1 A;  4DW6 A;  1Z77 A;  1SGM A;  2OER A;  1RKT A;  3LSJ A;  3G56 A;  4W97 A;  2RAS A;  4MXM A;  3HIM A;  2NX4 A;  4GCT A;  5GPA A;  4ICH A;  4MO7 A;  3HGG A;  3EGQ A;  3WHB A;  2ZCM A;  3CRJ A;  5GPC A;  3HE0 A;  3VOX A;  3QPS A;  2I10 A;  3NNR A;  2YVE A;  3MNL A;  3BR5 A;  3ON4 A;  3S5R A;  5F0H A;  1BJZ A;  2G7G A;  3VVX A;  1ZK8 A;  5FKN A;  3ZQG A;  3IUV A;  3KKC A;  4D5F A;  5K7F A;  2TRT A;  2FBQ A;  4KWA A;  5D19 A;  5IP6 A;  4GFK A;  2ZCX A;  3E7Q A;  3BR3 A;  3BT9 A;  5IOY A;  1JT6 A;  3BNI A;  1U9N A;  2PBX A;  4GCL A;  2XPV A;  3BTI A;  3FK6 A;  3EUP A;  2RAE A;  4D7N A;  3PM1 A;  2DG7 A;  2HYT A;  1T33 A;  2QTQ A;  3ZQH A;  3BHQ A;  1UI6 A;  5CW8 A;  3BTC A;  2HYJ A;  3HTJ A;  5FKL A;  5F0F A;  3BRU A;  2FX0 A;  3LJL A;  4XK4 A;  4B3A A;  3SFI A;  1VI0 A;  5CXG A;  3HTI A;  1JT0 A;  3QQA A;  2OI8 A;  3ZQF A;  2G3B A;  3FIW A;  5FGL A;  1RPW A;  1Z0X A;  4HKU A;  1JUP A;  2W53 A;  3AQS A;  2G7L A;  2HQ5 A;  2G0E A;  3C2B A;  3DPJ A;  3CCY A;  3LOC A;  1QVT A;  2UXI A;  3QKX A;  3BQY A;  2QOP A;  3O8H A;  2NP5 A;  3BR1 A;  5K7Z A;  4JL3 A;  4W1U A;  2FD5 A;  3VVY A;  3G1L A;  2XDN A;  3IH2 A;  4V2F A;  2XPW A;  2XGD A;  5C4Y A;  2UXO A;  1ZKG A;  3FRQ A;  4ABZ A;  2IEK A;  4ACI A;  2IU5 A;  5HAW A;  3DEW A;  3BTL A;  3TP3 A;  2Y31 A;  2REK A;  2TCT A;  3KKD A;  2GFN A;  2Y30 A;  3HTA A;  2IAI A;  2JK3 A;  2O7O A;  4NEL A;  3RH2 A;  3HTH A;  2VKE A;  4M3G A;  2ID6 A;  3Q0V A;  2HKU A;  3IH3 A;  2WGB A;  5HBU A;  3PAS A;  3ANG A;  2DG8 A; 
#chains in the Genus database with same CATH topology
 3ZQI A;  2IBD A;  4YZE A;  5EFY A;  3K8P C;  5GP9 A;  4WIB A;  3SDG A;  5F1J A;  2VKV A;  3G1O A;  2NP3 A;  4M3F A;  2PFV A;  3COL A;  5DAJ A;  4D7M A;  1A6I A;  5D18 A;  2Y2Z A;  2FQ4 A;  2QCO A;  3BCG A;  3IH4 A;  4AC0 A;  5K58 A;  5CXI A;  3QPL A;  2R7T A;  3F1B A;  3CWR A;  3BTJ A;  3V78 A;  2ZOY A;  3TP0 A;  1T56 A;  3WHC A;  4GFL A;  3CJD A;  3LSR A;  3CDL A;  3F0C A;  2R7O A;  3V6G A;  2DTZ A;  3VP5 A;  3LHQ A;  4M3E A;  4JYK A;  2R7V A;  4CGR A;  2G7S A;  2WUI A;  2OPT A;  2ZY9 A;  2D6Y A;  3BR0 A;  2HXI A;  3VOK A;  4AC6 A;  3VUQ A;  3LSP A;  2XPU A;  2ID3 A;  1JUM A;  3Q3S A;  3DCF A;  2VPR A;  2RHA A;  1ORK A;  5CQG A;  3VPR A;  1QPI A;  5IPA A;  4JNN A;  2XRL A;  3VW1 A;  3BR2 A;  3ZQL A;  2NS7 A;  3SWH A;  2Q24 A;  1JTY A;  1RKW A;  2O7T A;  3NPI A;  4V2G A;  4ME9 A;  3Q0U A;  3HGY A;  3GEU A;  3VW2 A;  3B6A A;  3O60 A;  3BJB A;  2GEN A;  5J1R A;  5FHP A;  4GCK A;  5IOZ A;  2F07 A;  2ZB9 A;  3DU6 A;  5F27 A;  3VVZ A;  2UXH A;  3FHN A;  4U9N A;  1JUS A;  3FK7 A;  1UI5 A;  2QKO A;  5F04 A;  3AQT A;  2ZOZ A;  3B81 A;  3C07 A;  2GUH A;  4G12 A;  2R7Q A;  3NI7 A;  4M3B A;  2V57 A;  2XB5 A;  3MVP A;  4JKZ A;  4D5C A;  5AQC A;  2X9D A;  5FKO A;  3LWJ A;  4NN1 A;  2EH3 A;  3P9T A;  3KZ9 A;  4AF5 A;  4M3D A;  3BQZ A;  3KYL A;  3ANP A;  1QVU A;  3BR6 A;  3Q0W A;  5H9T A;  5FMP A;  5FKK A;  2QWT A;  2R7S A;  1JTX A;  4AUX A;  2YVH A;  5J1U A;  5EZG A;  3JSJ A;  2NS8 A;  2UXP A;  2OF7 A;  5FKM A;  2X6O A;  4I76 A;  4L62 A;  5F08 A;  3B6C A;  5F0C A;  3G7R A;  5EYR A;  5K7H A;  2ZCN A;  3NRG A;  2HXO A;  2GBY A;  3NS4 A;  3PPB A;  5D1R A;  3ON2 A;  4X1E A;  2UXU A;  2XGC A;  2WV1 A;  3G1M A;  3VW0 A;  3GZI A;  3O8G A;  1U9O A;  3T6N A;  2JJ7 A;  5J1Y A;  5HSZ A;  4I6Z A;  4OD4 A;  2XGE A;  2PZ9 A;  4B1R A;  2B3W A;  2QIB A;  3KNW A;  2YVX A;  5EZH A;  3VIB A;  4UDS A;  4PXI A;  2A2F X;  3NXC A;  2FJI 1;  3RD3 A;  4MK6 A;  5J3L A;  2R7W A;  3QBM A;  2FJ1 A;  4DW6 A;  1Z77 A;  1SGM A;  2OER A;  1RKT A;  3LSJ A;  3G56 A;  4W97 A;  2RAS A;  4MXM A;  3HIM A;  2NX4 A;  4GCT A;  5GPA A;  4ICH A;  4MO7 A;  3HGG A;  3EGQ A;  3WHB A;  4C2M A;  2ZCM A;  3CRJ A;  5GPC A;  3DU5 A;  3HE0 A;  3VOX A;  3QPS A;  2I10 A;  3NNR A;  2YVE A;  3MNL A;  3BR5 A;  3ON4 A;  3S5R A;  1BJZ A;  5F0H A;  2G7G A;  3VVX A;  1ZK8 A;  5FKN A;  3ZQG A;  3IUV A;  3KKC A;  4D5F A;  5K7F A;  2TRT A;  4IRV A;  2FBQ A;  4KWA A;  5D19 A;  5IP6 A;  4GFK A;  2ZCX A;  3E7Q A;  3BR3 A;  3BT9 A;  5IOY A;  1JT6 A;  3BNI A;  1U9N A;  3VTI A;  2PBX A;  4GCL A;  2XPV A;  3BTI A;  3FK6 A;  3EUP A;  2RAE A;  4D7N A;  3PM1 A;  2DG7 A;  2HYT A;  4DVY P;  1T33 A;  2QTQ A;  3ZQH A;  3BHQ A;  1UI6 A;  5CW8 A;  3BTC A;  2HYJ A;  3HTJ A;  5FKL A;  5F0F A;  3BRU A;  2FX0 A;  3LJL A;  4XK4 A;  4B3A A;  3SFI A;  1VI0 A;  5CXG A;  3HTI A;  1JT0 A;  3QQA A;  2OI8 A;  3ZQF A;  2G3B A;  3FIW A;  5FGL A;  1RPW A;  1Z0X A;  4HKU A;  1JUP A;  2W53 A;  3AQS A;  2G7L A;  2HQ5 A;  2G0E A;  3C2B A;  3DPJ A;  4OD5 A;  3CCY A;  3LOC A;  1QVT A;  2UXI A;  3QKX A;  3BQY A;  2QOP A;  3O8H A;  2NP5 A;  3BR1 A;  5K7Z A;  4JL3 A;  4W1U A;  2FD5 A;  3VVY A;  3G1L A;  2XDN A;  2B1E A;  3IH2 A;  4V2F A;  2XPW A;  2XGD A;  5C4Y A;  2UXO A;  1ZKG A;  3FRQ A;  4ABZ A;  2IEK A;  4U9L A;  4ACI A;  2IU5 A;  5HAW A;  3DEW A;  2R7X A;  3BTL A;  3TP3 A;  2Y31 A;  2REK A;  2TCT A;  3KKD A;  2GFN A;  2Y30 A;  3HTA A;  2R7U A;  2IAI A;  2JK3 A;  2O7O A;  4NEL A;  3RH2 A;  3HTH A;  2VKE A;  4M3G A;  2ID6 A;  3Q0V A;  2HKU A;  3IH3 A;  2WGB A;  5HBU A;  2R7R A;  3PAS A;  3ANG A;  2DG8 A; 
#chains in the Genus database with same CATH homology
 3ZQI A;  2IBD A;  4YZE A;  5EFY A;  5GP9 A;  3SDG A;  5F1J A;  2VKV A;  3G1O A;  2NP3 A;  4M3F A;  3COL A;  5DAJ A;  4D7M A;  1A6I A;  5D18 A;  2Y2Z A;  2FQ4 A;  2QCO A;  3BCG A;  3IH4 A;  4AC0 A;  5K58 A;  5CXI A;  3QPL A;  3F1B A;  3CWR A;  3BTJ A;  3V78 A;  2ZOY A;  3TP0 A;  1T56 A;  3WHC A;  4GFL A;  3CJD A;  3LSR A;  3CDL A;  3F0C A;  3V6G A;  2DTZ A;  3VP5 A;  3LHQ A;  4M3E A;  4JYK A;  4CGR A;  2G7S A;  2WUI A;  2OPT A;  2D6Y A;  3BR0 A;  2HXI A;  3VOK A;  4AC6 A;  3VUQ A;  3LSP A;  2XPU A;  2ID3 A;  1JUM A;  3Q3S A;  3DCF A;  2VPR A;  2RHA A;  1ORK A;  3VPR A;  1QPI A;  5IPA A;  4JNN A;  2XRL A;  3VW1 A;  3BR2 A;  3ZQL A;  2NS7 A;  2Q24 A;  1JTY A;  1RKW A;  2O7T A;  3NPI A;  4V2G A;  4ME9 A;  3Q0U A;  3HGY A;  3GEU A;  3VW2 A;  3B6A A;  3O60 A;  3BJB A;  2GEN A;  5J1R A;  5FHP A;  4GCK A;  5IOZ A;  2F07 A;  2ZB9 A;  5F27 A;  3VVZ A;  2UXH A;  1JUS A;  3FK7 A;  1UI5 A;  2QKO A;  5F04 A;  3AQT A;  2ZOZ A;  3B81 A;  3C07 A;  2GUH A;  4G12 A;  3NI7 A;  4M3B A;  2V57 A;  2XB5 A;  3MVP A;  4JKZ A;  4D5C A;  5AQC A;  2X9D A;  5FKO A;  3LWJ A;  4NN1 A;  2EH3 A;  3P9T A;  3KZ9 A;  4M3D A;  4AF5 A;  3BQZ A;  3ANP A;  5FMP A;  1QVU A;  5H9T A;  3BR6 A;  3Q0W A;  5FKK A;  2QWT A;  1JTX A;  4AUX A;  2YVH A;  5J1U A;  5EZG A;  3JSJ A;  2NS8 A;  2UXP A;  2OF7 A;  5FKM A;  2X6O A;  4I76 A;  4L62 A;  5F08 A;  3B6C A;  5F0C A;  3G7R A;  5EYR A;  5K7H A;  2ZCN A;  3NRG A;  2HXO A;  2GBY A;  3PPB A;  5D1R A;  3ON2 A;  4X1E A;  2UXU A;  2XGC A;  2WV1 A;  3G1M A;  3VW0 A;  3GZI A;  3O8G A;  1U9O A;  3T6N A;  2JJ7 A;  5J1Y A;  5HSZ A;  4I6Z A;  2XGE A;  2PZ9 A;  4B1R A;  2QIB A;  3KNW A;  5EZH A;  3VIB A;  4UDS A;  4PXI A;  3NXC A;  3RD3 A;  4MK6 A;  5J3L A;  3QBM A;  2FJ1 A;  4DW6 A;  1Z77 A;  1SGM A;  2OER A;  1RKT A;  3LSJ A;  3G56 A;  4W97 A;  2RAS A;  4MXM A;  3HIM A;  2NX4 A;  4GCT A;  5GPA A;  4ICH A;  4MO7 A;  3HGG A;  3EGQ A;  3WHB A;  2ZCM A;  3CRJ A;  5GPC A;  3HE0 A;  3VOX A;  3QPS A;  2I10 A;  3NNR A;  2YVE A;  3MNL A;  3BR5 A;  3ON4 A;  3S5R A;  5F0H A;  1BJZ A;  2G7G A;  3VVX A;  1ZK8 A;  5FKN A;  3ZQG A;  3IUV A;  3KKC A;  4D5F A;  5K7F A;  2TRT A;  2FBQ A;  4KWA A;  5D19 A;  5IP6 A;  4GFK A;  2ZCX A;  3E7Q A;  3BR3 A;  3BT9 A;  5IOY A;  1JT6 A;  3BNI A;  1U9N A;  2PBX A;  4GCL A;  2XPV A;  3BTI A;  3FK6 A;  3EUP A;  2RAE A;  4D7N A;  3PM1 A;  2DG7 A;  2HYT A;  1T33 A;  2QTQ A;  3ZQH A;  3BHQ A;  1UI6 A;  5CW8 A;  3BTC A;  2HYJ A;  3HTJ A;  5FKL A;  5F0F A;  3BRU A;  2FX0 A;  3LJL A;  4XK4 A;  4B3A A;  3SFI A;  1VI0 A;  5CXG A;  3HTI A;  1JT0 A;  3QQA A;  2OI8 A;  3ZQF A;  2G3B A;  3FIW A;  5FGL A;  1RPW A;  1Z0X A;  4HKU A;  1JUP A;  2W53 A;  3AQS A;  2G7L A;  2HQ5 A;  2G0E A;  3C2B A;  3DPJ A;  3CCY A;  3LOC A;  1QVT A;  2UXI A;  3QKX A;  3BQY A;  2QOP A;  3O8H A;  2NP5 A;  3BR1 A;  5K7Z A;  4JL3 A;  4W1U A;  2FD5 A;  3VVY A;  3G1L A;  2XDN A;  3IH2 A;  4V2F A;  2XPW A;  2XGD A;  5C4Y A;  2UXO A;  1ZKG A;  3FRQ A;  4ABZ A;  2IEK A;  4ACI A;  2IU5 A;  5HAW A;  3DEW A;  3BTL A;  3TP3 A;  2Y31 A;  2REK A;  2TCT A;  3KKD A;  2GFN A;  2Y30 A;  3HTA A;  2IAI A;  2JK3 A;  2O7O A;  4NEL A;  3RH2 A;  3HTH A;  2VKE A;  4M3G A;  2ID6 A;  3Q0V A;  2HKU A;  3IH3 A;  2WGB A;  5HBU A;  3PAS A;  3ANG A;  2DG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...