3VIDA

Crystal structure of human vegfr2 kinase domain with compound a.
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
356
structure length
299
Chain Sequence
LDEHCERLPYDASKWEFPRDRLKLGKPLGRGAFGQVIEADAFGIDKTATCRTVAVKMLKEGATHSEHRALMSELKILIHIGHHLNVVNLLGACTKPGGPLMVIVEFCKFGNLSTYLRSKRNEFVPYKEAPEDLYKDFLTLEHLICYSFQVAKGMEFLASRKCIHRDLAARNILLSEKNVVKICDYKDPDYVRKGDARLPLKWMAPETIFDRVYTIQSDVWSFGVLLWEIFSLGASPYPGVKIDEEFCRRLKEGTRMRAPDYTTPEMYQTMLDCWHGEPSQRPTFSELVEHLGNLLQANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Vascular endothelial growth factor receptor 2
publication title A Back-to-Front Fragment-Based Drug Design Search Strategy Targeting the DFG-Out Pocket of Protein Tyrosine Kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 88
structure length 299
sequence length 356
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2011-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3vidA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3vidA01
4UMQA 3GP0A 4AZTA 4C38A 2AYPA 4KNBA 3UDBA 1YOMA 3BU3A 1FMKA 1U5RA 2A0CX 2B9IA 4IVCA 5FBOA 5IA4A 1PMVA 3OFMA 2CN8A 4O0VA 5IUIA 3VBVA 3Q9WA 2NRYA 4QPMA 3WYXA 4EJNA 2C6DA 3EIDA 2C6OA 4FMQA 5IG1A 5DLSA 2C1BA 4WT6A 2PWLA 1ZY5A 4GFGA 3CCNA 5IQDA 2VRXA 4IX5A 2XNEA 1OIUA 1P2AA 1YDSE 3BWJA 3C9WA 4FV1A 4YO6A 3WOWA 5IPJA 3PA4A 4UMPA 2X0GA 2GHGA 3PSCA 2XNMA 3F5GA 3ZOSA 1OMWA 2G2FA 2JAMA 5DT4A 5IISA 3QD4A 3Q2MA 4RVMA 4IVAA 3T9TA 5JMSA 4FUYA 2PZPA 4DEGA 4FNZA 4U45A 1RQQA 4TWNA 4PMMA 4O7NA 4LI5A 3O7LB 3C7QA 3FMKA 3DJ6A 3F3WA 5EW9A 3RI1A 4USFA 5KMIA 5I3OA 4BCFA 4CTBA 4BHNA 3LFQA 4HCVA 4MQ2A 2OJJA 2PZIA 3DV3A 4LMUA 4MQ1A 5AAFA 4IWPA 4X0MA 3F2NA 3E7VA 4V05A 3LFAA 3QRIA 5FM2A 3BZ3A 4X2JA 1IASA 3R7IA 4E6AA 4HPTE 4O7LA 1H07A 1O6KA 2HW6A 4AFEA 3OWPA 3MW1A 4FUXA 3PIXA 4MBJA 4RBLA 3NCZA 4DGOA 3N4VA 3NIEA 3DS6A 4E6QA 3BKBA 1UU7A 4X2FA 3VS4A 4O21A 4U40A 2PMNX 5TO8A 4IWDA 1WBOA 3OD6X 3O51A 4TNDA 4ZZMA 3WIGA 4LUEA 3IGGA 3R1QA 4EHEA 4NL0A 2X2MA 1IA9A 3KRLA 4HYHA 4D9UA 3PXQA 3I5ZA 3H9FA 4XLVA 3CC6A 3MTFA 3SA0A 4BCKA 2X6EA 4D1SA 3A7GA 3OF0A 3IECA 4ZTNA 4FKLA 4RQVA 5DFPA 3SOAA 2WTWA 1I44A 1V0OA 2VTMA 5DIAA 4ZTRA 3C51A 3F61A 4LOPA 5CNOA 5C01A 2W1EA 4JAIA 2HXQA 3QZHA 2YIYA 2CHLA 4IFCA 1Q4LA 4PX6A 3TKUA 3QZIA 4U41A 4RIXB 4AN3A 1BL6A 2IZRA 1XWSA 2BRBA 2FSLX 3VBQA 1XHAA 3LLTA 3QRKA 3R1SA 4IM0A 5ANKA 4QMNA 5IQBA 3BI6A 4DGNA 3ZS5A 1XR1A 3S2PA 3CR0A 2JDSA 3IDBA 3QQKA 3R73A 4D1XA 4CGAA 3DXNA 4XG9A 4FIJA 3VS7A 1HCKA 2VTRA 3QALE 1FGIA 4W4VA 4CLIA 4EOSA 4RX5A 5CAQA 1OL6A 3P9JA 2HWPA 4QMYA 4YPSA 3FQSA 3ATSA 3FUPA 4AGCA 2X1NA 3DKGA 4XMOA 4AA0A 4AOJA 3NVKI 4X6QC 4CQEA 1UKHA 4O7RA 3FZRA 4FKVA 4ZJIA 1UNGA 1VYWA 5CU0A 4WOVA 2X2KA 5HHWA 4A4LA 1K9AA 4ANOA 3E8DA 3LZBA 5HE3A 3UOKA 3U6JA 4BY9E 5IU2A 4IZ7A 4IB3A 4ZSLA 3QKLA 1FVTA 4B6LA 5C1QB 1B38A 3IOPA 5CNNA 4F63A 1SMHA 4O7WA 2FH9A 3EOCA 5CZHA 5M57A 3DBQA 4NFMA 3COIA 4NUSA 5EHLA 3GCUA 2PMOX 5M4FA 3A7HA 4QT1A 4IAAA 4MXOA 5IDPA 3ZXZA 1WMKA 3MIAA 2XF0A 4FSUA 4FVRA 4JXFA 3L8PA 2REIA 1ZOEA 2NO3A 3C0IA 5CWZA 2WXVA 3V6RA 2YM4A 4C7TA 4DG0E 4LUDA 4KKHA 3UNKA 4MD8E 3D2IA 5CU4A 4PMTA 3N4TA 4DFZE 3NGAA 4UY9A 2VTQA 2XK4A 2QOCA 5EI6A 2ZMDA 3KK9A 4N0SA 5CEPA 1L8TA 3EFJA 4XCUA 3GBZA 3HL7A 3UQGA 3VS1A 1CKIA 2X81A 2CGXA 4I5HA 4GFMA 2VN9A 1Q5KA 4O27B 2JIUA 3JVSA 4UEUA 5JZNA 4ANSA 4AZFA 2HXLA 2PVNA 3NYNA 1G5SA 2JAVA 2OG8A 1H0WA 4L6QA 4XBRA 3UVRA 3MY5A 3QTSA 5AP7A 3RK5A 4YGAA 5CT7A 2BIKB 3MJ1A 4U42A 5H8GA 3ENHA 4DEBA 5BVNA 5HCXA 4AOIA 3MYGA 4AP7A 3ZUTA 5CSPA 5ANEA 2GTNA 5AM6A 1EH4A 1ZYSA 4KRDA 4A9SA 2QR7A 4HCTA 5AV2A 5IUGA 2QVSE 4QRCA 3FJQE 3TZMA 3KEXA 4H1JA 5HG9A 4FL1A 2WTJA 2YCQA 4C8BA 3AQVA 1W98A 4FK3A 3NW7A 4QYYA 5FXSA 5EM8A 1XH6A 5G1XA 1Q99A 3RNYA 4FT7A 4FKWA 1GZ8A 3IW6A 4HVIA 4R7IA 3SW4A 4EH9A 2YERA 3IGOA 2R3LA 4ZMFA 3ANRA 1MRUA 3OCSA 5HBHA 3DLZA 1WBNA 3GUBA 4F64A 2XIXA 4FZ6A 1JWHA 3SOCA 3G5DA 3D4QA 4MWHA 2W1FA 3F82A 3NW6A 5HD7A 3R02A 4NEUA 5E8XA 3CS9A 5L2WA 2HCKA 4FTNA 2PYWA 1OECA 1GZOA 1ZXEA 3CP9A 1NA7A 4OTPA 3V5QA 5JFVA 2VAGA 2UZNA 4OTWA 5EHOA 4DH1A 2XNOA 4AF3A 4RFMA 5H2UA 3ZEWA 4I21A 1BYGA 3Q9ZA 5EYKA 4RRVA 1NVRA 4GT4A 4JDIA 3ORIA 1Y57A 3AMYA 5KMMA 4GG7A 5KBRA 2IZSA 1PKGA 3DZOA 4QTAA 5HE2A 4AAAA 4O0TA 4N57A 4BTMA 2Y4IB 2Z7SA 1H0VA 3DDPA 4GT3A 5AP6A 4LGDA 1GIIA 3SDJA 4YSMA 3E88A 1BX6A 2G15A 3R0TA 3ULIA 4DEIA 2XK6A 2GPHA 1MQ4A 2RL5A 3MH0A 4PDYA 3NMUF 3A99A 4U3ZA 3GCQA 2XKEA 3QQUA 2WTVA 4YZNA 4AA5A 2QR8A 4S31A 2GQRA 3KXGA 3W16A 2C69A 4R5SA 3ID6C 4YJVA 1S9IA 5H8BA 1E1XA 3ANQA 4CYJA 2JIIA 3EH9A 3KXNA 3VRZA 3UC4A 5L8KA 2EVAA 4FTRA 3D83A 3OW3A 1OIQA 1BUHA 3HV5A 4EQUA 4CLJA 3CTQA 3R7YA 3H0YA 3VIDA 5AFVA 4BHZA 5IQGA 3CGOA 4TYEA 4ZSJA 3BLHA 2ETRA 2G1TA 2P33A 3F3VA 4USDA 4K2RA 4MEDA 4J99A 4CRLA 5HD4A 4BBFA 3ZCLA 3S00A 4XRLA 4FTLA 5ANOA 4BCQA 5IA0A 4F7NA 1RJBA 5M56A 4WUNA 2J4ZA 1GIHA 3REPA 3OTVA 2PUUA 2X7GA 2CKPA 4NFNA 4R5YA 1DS5A 2J0JA 3UJGA 3G9LX 3RM7A 4BDEA 2UZLA 2CJMA 3JVRA 3MH1A 2IVUA 2ZM1A 4DLJA 3G0FA 2PVRA 4MNEA 5BMSA 5DG5A 3P08A 4C62A 5KX8A 3F9NA 5HO8A 2JIVA 3FY2A 4FSWA 2W1GA 4H39A 5KMOA 5E4HA 4YNEA 2UZTA 3LJ2A 5M08A 4YBKA 4ZP5A 2VWIA 5DR6A 3NWWA 4ZS0A 4E4XA 2DYLA 5M51A 4ZTMA 4JVGA 4BGHA 4EC8A 3HV6A 4ACCA 2P4IA 3D7ZA 2OF2A 3RNIA 4WG4A 3V04A 3DCVA 5HESA 3UZTA 4J95A 2XKCA 4ZK5A 2BZJA 2VTOA 3EN6A 5AP4A 4LL5A 5CSXA 3LQ8A 4AWIA 4XOYA 3MVMA 3R7EA 2ITVA 4M13A 4RJ5A 2QHMA 2WQOA 4ZTQA 1HCLA 3ZMMA 2UV2A 4UB7A 1MUOA 4FG9A 1KOBA 2BRNA 3FBVA 3OCTA 4Z55A 1V1KA 5GJFA 4CV8A 3A8WA 5K5NA 3F5PA 4ALUA 3KMMA 3NDMA 4FTUA 4U7ZA 4FL3A 5DEYA 4ZTHA 3UNZA 3K5UA 5JRQA 4BCHA 5CALA 2X4ZA 4G1WA 5FM3A 4EQCA 1YDTE 2HZNA 2C5NA 3BU5A 5F20A 3RAIA 2PHKA 1PMUA 3FMMA 4FV2A 1J91A 4P5QA 4C34A 2WOUA 4F9AA 3COMA 3C4WA 2J0KA 3QUDA 4G17A 3W55A 3ZBXA 1GY3A 4CFWA 5M44A 1PHKA 3RPYA 4Q2AA 4XRJA 2RF9A 4EOQA 2C3IB 3KRJA 3HMNA 2CPKE 2BILB 2YLEA 4A7CA 3HX4A 4I5CA 2BRHA 3P1AA 3V5PA 4EHZA 4RJ7A 3CD8A 5L2TA 4BVUA 5LQFA 4EH4A 5KMLA 2B0QA 1YWVA 2R3GA 4FVQA 4J52A 4ANLA 1FVVA 4F1MA 4I5MA 4W9WA 1Q61A 5KMJA 2QOQA 2QO2A 4S34A 2XA4A 4D2SA 3Q6UA 1GAGA 4OT5A 5LMKA 4CCUA 2WU7A 2JBOA 2X9EA 4QMZA 2JKMA 4YLLA 4ZSAA 5LVLA 5J5SA 4Y83A 2R3JA 3IONA 4AQCA 3WF6A 1Q3WA 2BPMA 4FV9A 3WZDA 4QPAA 4O7TA 2EXCX 1KE5A 3OOMA 4JOAA 4HCUA 1NW1A 3NS9A 3RZFA 5IH5A 4XS2A 1BI8A 1VJYA 3H30A 3IDPA 4GEOA 3TZ7A 3W8LA 3DFCB 4WUAA 3BYVA 4FSMA 3BELA 4FK6A 2PMLX 5LVPA 2ITOA 4BZOA 4LL0A 4DINA 5AV4A 5JFXA 3SC1A 4O0XA 4F7LA 1URCA 3KN6A 4CFUA 5CTPA 2V55A 3LXLA 2LGCA 1OPKA 4JX7A 1Q97A 3QRUA 1MRVA 3V01A 2BDWA 3EN7A 4BFMA 4C57A 5IEVA 3EQBA 4HGEA 2CGWA 2XZSA 3O71A 4J98A 5FP5A 3NLBA 3VQUA 3HMMA 4Y73A 1OKYA 4ZLOA 5FLFA 2YM5A 4C0TA 2ZV2A 3U9CA 3WARA 3FMNA 2BROA 4C4IA 3EN4A 4ZZOA 4G2FA 1PXMA 4DEHA 4QP7A 4PMPA 1K2PA 1ZY4A 5IA5A 4FGBA 2Y8OA 4O2PA 3R22A 4QP8A 5ETAA 2XCHA 3EFLA 2YZLA 2YIQA 1SVEA 3AC1A 3QQHA 4I1ZA 4OTIA 2V62A 3R00A 4N70A 5DR2A 5FEDA 5D11A 1OUYA 1UV5A 4IH8A 4NYEA 4YJOA 4DTKA 4IEBA 1FPUA 4S2ZA 4NCTA 3SXFA 3FDNA 4R77A 3CPCA 3TI1A 3UNJA 3A8XA 3GNIB 3UOLA 2QOHA 3CY3A 3TACA 4D2TA 5BPYA 3MJ2A 3ORNA 3BQCA 2XK8A 4ENXA 4MX9A 5H3QA 1JKTA 4KIQA 1CSNA 4RWKA 3KFAA 2PUIA 3PXFA 4QOXA 2YM7A 4JG8A 5AIRA 3HP2A 4AW1A 2PVFA 3R8VA 4GU9A 1XH5A 2V5QA 3NAYA 5HLPA 3LIJA 3QHRA 1WVYA 3MTLA 2VNWA 3BU6A 3CKWA 3AT2A 4F4PA 5CAPA 3UPZA 3JY0A 4DGLC 3FSKA 3FZ1A 3FXZA 5DMZA 3CKXA 4BWPA 3F66A 2VTAA 4BTKA 4BDAA 1YQJA 3R21A 5K5XA 2WGJA 4YC8A 1YHWA 4EOLA 2DQ7X 3TUDA 2VNYA 4HGLA 4EOIA 2WPAA 3MESA 4IAFA 2HY0A 4LOOA 5IEYA 5A54A 2XNBA 4FYOA 3Q9XA 4E93A 3G51A 4YTCA 4KSQA 2JDRA 3IG7A 4D2VA 4IM2A 4I5PA 5KNJA 1OKWA 3ZFYA 4QYEA 4JQEA 1R3CA 5DEWA 3QQJA 2WO6A 3DB6A 3P86A 4BDHA 4EK3A 3MH2A 5L2IA 1JKKA 4UN0C 1H1RA 3GU4A 2HIWA 3NUPA 4DFXE 2QONA 3RPRA 2OSCA 4CT1A 5AR2A 3IW4A 4XX9A 5LMAA 2R9SA 4ACHA 1ZMUA 4AN9A 4QMQA 4RGJA 5KKRB 1ATPE 2EU9A 2W17A 3F2AA 3UODA 3QWJA 4ZAUA 3UZPA 5BVDA 1YI6A 2WMUA 3EQCA 2JLDA 4QNYA 2G01A 4OW8A 4UWBA 2UZUE 4DFLA 4WHZA 3DQXA 3BX5A 2QKWB 1LUFA 4JX3A 2BALA 2ZDUA 4QTDA 5AR8A 4H3PA 3GCSA 1FVRA 4GK2A 3E64A 2CNVA 4XV2A 4O82A 3F5UA 3KXXA 3WIKA 2FGIA 2PE1A 4JRVA 2C6IA 4IC7A 3ZO3A 4B0GA 3GCPA 5I5ZA 3I6WA 5JQ8A 4UWYA 2PULA 5FGKA 3KK8A 4XH6A 5GJDA 4UBAA 5FTGA 3UQFA 4Q9SA 1YI4A 4UWCA 4AW5A 3BHHA 3VUHA 2ITWA 3UP7A 5CANA 3EFKA 1KUTA 2W1HA 4JLCA 3UG1A 3ZO1A 2CKQA 1OVEA 2X4FA 5HIEA 2ITNA 3FLZA 3R8UA 4FGRA 4Z16A 4FI1A 2UZVA 3DGKA 5BUEA 3RKBA 5CY3A 3TNPC 1YXSA 2H6DA 4C35A 2R3NA 3F3ZA 2C6EA 3CGFA 3QA8A 3FC1X 2C6TA 3QHWA 4K0YA 2ZV9A 3NPCA 2F7ZE 2UZDA 3VC4A 4O2ZA 4A9TA 4F08A 1PY5A 4O7VA 3C4XA 2R4BA 4BWXA 4JR3A 4O1OA 3KVXA 5CVGA 3BWFA 4K9YA 4FKSA 4BN1A 2R3IA 1OL2A 1GJOA 4DFUA 3I6UA 4ZMEA 3RK7A 1XBCA 4GVAA 4FOCA 4OGRA 4CQGA 5J8IA 2WTCA 2YITA 4FX3A 2YJRA 4F6SA 2ETMA 4EQMA 2ZYBA 4JDJA 5EHYA 2C0IA 2R3RA 4GT5A 4CCBA 2BDJA 2QLQA 3ZH8A 4JL9A 4YZMA 3KL8A 1DAWA 1J7IA 3P4KA 4I92A 4ZTLA 4ZLZA 4AZVA 4RFYA 5LWMA 3RCJA 3DU8A 3EQRA 1W83A 2W05A 2WQEA 2UW3A 2WTDA 4MD7E 5CXHA 3VO3A 4FG7A 4TYIA 5HLNA 4USEA 3SRVA 4PTGA 4GCJA 4P90A 3O50A 1PRYA 2PVJA 4AS0A 4L7FA 4RC2A 4OTHA 4KIPA 2WKMA 4ANQA 4QTCA 4G3DA 1E1VA 4YJQA 3FY0A 2HENA 2XM9A 4J8NA 4C4GA 3OWKA 2QG7A 3MN3A 3AGMA 4FIEA 2XKFA 4NIFA 4QMPA 1M17A 4JIAA 2XIZA 3IW7A 4AG8A 4RC3A 1Z9XA 3QKKA 4J71A 3GQIA 3SAYA 2WTKC 3PTGA 4IE9A 4OLIA 4GKHA 3PSDA 2ONLC 5HI2A 3OS3A 2QO7A 2XIKA 4K1BA 4O38A 4TL0A 1T45A 4NK9A 4N4SA 4PTCA 4GSBA 3RTPA 5IQHA 4PPAA 2NP8A 2YDKA 3FHRA 1BLXA 3EN5A 4CFNA 3KF7A 3EQPA 3VN9A 4L01A 4XG2A 3PYYA 4BL1A 3KU2A 2B9JA 1KV2A 3TDVA 1XKKA 2EB3A 3CLYA 3HEGA 5KZIA 5HTIA 1OL5A 3MSSA 1VZOA 1YHSA 1YVJA 5ETIA 4E73A 3O7LD 4L9IA 3UZRA 3HRFA 1CM8A 5EM6A 3TUBA 5HE0A 4YURA 1OUKA 3LQ5A 3KGAA 3PWYA 3VVHA 3VNTA 1X8BA 2BAJA 2PZ5A 5KHXA 4C3PA 1NT2A 2QOKA 4L67A 4HYSA 5DOSA 5A9UA 4YP8A 3RALA 1H26A 2UW9A 4XG3A 2A2AA 4RJ3A 5EH0A 4EOJA 4X3JA 4NM3A 1DI8A 3M2WA 3FSFA 1Q24A 1A06A 3BGPA 4QYHA 3E3PA 4AT4A 2YEXA 5L4QA 4JG6A 3WF7A 5AWMA 4Y95A 1AQ1A 2XRUA 4KA3A 5LJJA 3ORXA 4XV3A 2BZKB 2CSNA 3I1AA 1XH9A 2JFMA 1CKPA 3UMXA 3NYVA 3E87A 3POZA 3RVGA 3ATTA 3E62A 3UYTA 4YC3A 4KUJA 4M97A 4RWIA 2FO0A 2YLFA 4DFNA 4RA5A 2C5XA 2WZJA 5FEEA 4FV8A 4DH7A 3HP5A 5EFQA 1JQHA 2IZUA 4V0GA 2OICA 2OH0E 2YHVA 5EYMA 1PXIA 5TT7A 3TT0A 1Y91A 3OEZA 4FTAA 4JNWA 4KKEA 3R2YA 4GYGA 3ZYAA 4X7QA 4HVHA 3P78A 2PE2A 3OOGA 1H1SA 5BUJA 4C58A 2J50A 2JBPA 5CEMA 3LQ3A 3TNHA 3QCYA 3FL5A 4FEVA 2UW0A 5BVKA 2YM6A 3ZM4A 3ZC5A 1UNHA 4O0UA 4TW9A 2XP2A 4FTTA 4IM3A 4B4LA 4L53A 4R3RA 5IQFA 5HNBA 4IJ9A 4LRKA 5EI8A 3L9PA 2P2IA 4WG3A 1REKA 1PF8A 5LCKA 1LEWA 4ARKA 3QUPA 4ONAA 3SRVB 2YJSA 4XG7A 3U8WA 2OU7A 2XJ0A 3EYHA 3MY0A 4L3JA 3THBA 4Y46A 4G6LA 5IMXA 3U55A 4BKZA 4ASXA 5J7BA 4GRBA 5FG8A 5T68A 3F3TA 4IZAA 3R8LA 3UP2A 4IDTA 2X8DA 5EKNA 5C03A 5ICPA 4NIFB 4IX4A 4JIKA 4RZVA 2ITPA 4MNFA 2O64A 5ETCA 4X2NA 5KHWA 3NUNA 5FXRA 3UO5A 3IOKA 4EKLA 5IF1A 3NNVA 3NX8A 4YTIA 4ITHA 4XP3A 2RGPA 3Q2JA 4AGDA 4HVSA 2VTPA 4RX7A 3R6XA 2XIYA 4QMUA 5I0BA 1ERKA 4LGHA 2W99B 2QOOA 3VF9A 4EZ5A 2CMWA 4JAJA 3UC3A 5J5TA 3DT1A 3QWKA 2F7XE 4E4LA 5K4JA 5M4CA 3A2CA 4MVFA 3D0EA 3ORTA 2Z7RA 2ZAZA 5HEZA 3TN8A 4Q9ZA 4M15A 2CGUA 5B2MA 3GU8A 4E4NA 3L1SA 5AUYA 3FI3A 3DKOA 3WI6A 2HZ4A 1I09A 3ZRLA 4DH5A 2YIWA 4U8ZA 3UYSA 3W33A 4F7SA 3PP0A 2R3OA 3GFWA 1FINA 2ZDTA 3D7TA 3GOKA 1JOWB 3U54A 5CU6A 4TRLA 3EZRA 3BCEA 3R28A 4B7TA 2CCIA 4J8MA 3K2LA 3BGQA 3K54A 1A9UA 3AD4A 3C0HA 5CQWA 1Y6BA 5EOBA 4DC2A 3S0OA 3SLSA 3TCPA 3HRCA 3L8VA 5E1EA 4CTCA 3DBDA 3F3UA 4GS6A 4RFZA 3SG9A 3RP9A 3W2QA 3ENMA 4APPA 3PDTA 1GOLA 2X8IA 5CEIA 1LEZA 1CMKE 4PPCA 3TJDA 3R9HA 3R7OA 1SYKA 2GTMA 5GNKA 2R7IA 3DLSA 5CAVA 2Y0AA 3GU5A 4Y5HA 4RLLA 1URWA 3S1HA 2FYSA 5GINE 2J51A 4YSJA 3QTQA 1H01A 4S33A 3D94A 3V5LA 3VUIA 4GIHA 3QQLA 1TQMA 4V0GB 3EQGA 1YKRA 2VTNA 1OBGA 4QO9A 4CFFA 4XLIA 4E5WA 2UW5A 2QURA 4PNIA 3KCKA 4LOQA 5AR7A 1M2PA 5JFWA 5BUIA 2IJMA 3FXWA 2O8YA 3OY1A 4J97A 4FZ7A 3F7WA 3FI2A 4YJSA 3VS3A 3BYMA 3PJ3A 1UWJA 2AC5A 1J1BA 5HU3A 4Q5HA 3KKVA 3TIZA 2B53A 5LXMA 5HZNA 2E9OA 4H3BA 4ZY6A 2WOTA 3LCOA 4X3FC 2I40A 3TKIA 4D4RA 5DI1A 5HICA 3P7CA 3VF8A 1YWRA 4BYIA 4WO5A 4FVPA 1CTPE 4F0GA 1P5EA 4BCNA 5E9EA 2VGOA 3NUSA 2YCSA 5ACBC 2F9GA 3ZDUA 3PVBA 3NNXA 3M42A 4D58A 3LE6A 2JFLA 4ZJVA 4D4YA 4E6DA 2UW4A 4B8MA 3LFBA 4J96A 3VAPA 1OI9A 4P5ZA 5E90A 2NPQA 4JBPA 3CE3A 3TXOA 3HAMA 3DJ5A 2QOFA 4KBCA 2BIYA 4BR3A 1WVXA 4OTRA 3GOPA 4PV0A 2KTYA 3IKAA 4TWOA 4X2KA 4BDKA 4GFOA 1OBDA 4IWQA 5KMNA 4LRMA 3FHIA 5JT2A 3V5JA 4GL9A 4M67A 3ZTXA 4U6RA 4QMSA 5JRSA 5C27A 1U54A 5E8SA 4S30A 4ZJJA 4Z9LA 2YCFA 4EOPA 5JGAA 3WZUA 4E26A 1SVGA 4FNYA 5D7AA 4NKAA 3KF4A 2W0JA 2GNLA 2W96B 4Y5QA 4IBMA 1H1PA 1PJKA 4YLJA 3D7TB 4BDDA 4MH7A 4JBVA 3AC2A 5G6VA 3UO4A 4DGGA 4E6CA 3QRJA 3L9NA 4FOBA 4FEXA 4JDKA 4YR8A 4NM7A 3Q4TA 3QYZA 3DBFA 2OO8X 3V8WA 5JGBA 5EOLA 3K3IA 3OTUA 2E9VA 4FT0A 4LV5A 3JYAA 4IMYA 5CEQA 1U59A 3WF8A 2C5OA 4ALVA 3DK6A 1O6YA 5TKDA 1YXXA 2XBJA 3O23A 4ZTSA 4P4CA 3OWLA 4GUBA 3SQQA 4YU2A 3LXKA 3ALOA 3Q3BA 1F0QA 3D9VA 3R9RA 4EYMA 3QD2B 4QTEA 2RKUA 4W4YA 3R30A 2F2CB 4DT9A 4G5JA 3LJ1A 4FT5A 3ZSHA 3HUCA 4YZCA 1TKIA 3QU0A 4M84A 2X6DA 4CXAA 2JITA 2C30A 3UIXA 4FG8A 4ENYA 4NW5A 4RC4A 4OT6A 3PY0A 5HX6A 3O0GA 1YDRE 5CF4A 3VUKA 3VULA 4ASDA 4OBPA 2DS1A 3UGCA 3SG8A 3GB2A 3B2TA 2I0YA 3PIZA 3RK9A 1ND4A 2YZAA 3P0MA 4DG2E 3VW6A 3VW8A 4XJ0A 3LVPA 4NU1A 2V0DA 4LM5A 4TXCA 3NAXA 4FKOA 4YHFA 5A4TA 3K5VA 4Z3VA 3CXWA 3PE2A 4OR5A 5CF6A 2IVVA 1W82A 2WIPA 2R3FA 4KBAA 4QYFA 4TN6A 3RWQA 3E93A 3OXZA 1YHVA 3LXPA 2V7AA 3PY1A 5FTOA 4DGMA 4UXLA 2O0UA 3HECA 5AP5A 2IVSA 2A19B 3I7BA 4QD6A 3QLGA 3R9OA 2YACA 3Q96A 5E8YA 4A9RA 2WMQA 4I24A 1PXJA 3BE9A 4PWNA 2VWUA 2ITQA 2C5VA 5AMNA 2P3GX 3Q5IA 4MCVA 2IZTA 2R0UA 4R3PA 4CD0A 3CY2A 5EDQA 2JD5A 4EOKA 2F7EE 3TV4A 4O96A 5HVKA 3PJ8A 3PPZA 1U4DA 1VYZA 4FNXA 4NZWB 2VTIA 3CJFA 4HGSA 4FZFB 5DA3A 4IWOA 2F2UA 4JDHA 2CKOA 5LVMA 2UW6A 2RG6A 5T3QA 3S4QA 1U54B 3Q4CA 4N6ZA 4Y72A 2A27A 3TTIA 4AW2A 4RJ8A 3F5XA 4FV0A 3LMIA 4EHGA 4GK3A 1NY3A 2JKQA 3CQUA 4C3FA 1WBWA 3TV7A 2VX3A 4C2WA 2B52A 3G90X 4X6RA 5JN2A 1ZYDA 3ZBFA 2IW6A 3PJ2A 1HOWA 5EM7A 4ACMA 4C02A 4O84A 4AA4A 3LJ0A 5C8NA 2YAKA 4G16A 1Q8TA 2EB2A 4PL3A 3PP1A 4BI2A 4A4OA 2Z60A 4YPDA 3NNWA 3VS0A 1QPDA 4U0IA 5DRBA 4KSPA 3QTRA 2C5YA 5E91A 4FKGA 4GW8A 2PTKA 4WRSA 5D41A 3B8RA 5EDPA 2UZEA 3UO6A 4GK4A 4BI1A 4CRSA 1WVWA 3OT8A 3CEKA 5BYYA 2ZJWA 2J7TA 3OT3A 4I6QA 1OKZA 3L9LA 3VS5A 4I94A 1T46A 4ERWA 4I0SA 1SVHA 2OF4A 4ERKA 5LMBA 4EOMA 4BDJA 3PVWA 4E5AX 2BFXA 4UZDA 4HYIA 3MWUA 5HORA 2W7XA 5BVWA 4DTAA 1UWHA 5KO1A 2A1AB 1KOAA 2Z7QA 4D28A 3FKOA 5F1ZA 5HIBA 4UX9A 3G6HA 2RFNA 1W84A 5KE0A 3SD0A 5C8KA 5BYLA 2QO9A 5IQCA 3VUDA 3ALNA 2EWAA 1WZYA 3W2PA 2JKOA 3FZPA 4FIHA 5AV0A 3TDWA 5IA3A 5CXZA 4IADA 3A62A 3HV7A 5CYIA 4D0XA 4WG5A 4HNFA 2E9UA 2XNPA 1BMKA 2XJ1A 3QQGA 4RJ4A 2JDVA 2QOIA 4ZSGA 4XOZA 4WBOA 4AT3A 4EWQA 5JEBA 5HCYA 3VJNA 5FRIA 2OJIA 3UOJA 4JT3A 3C4FA 4LV8A 4M7IA 3FQHA 3VRYA 3ROYA 4BZNA 5A3XA 3TM0A 2VD5A 1SM2A 4CKRA 1UNLA 4JQ8A 3U4UA 3UQCA 3R7GA 3S95A 3R83A 3EQHA 3HUBA 3MFUA 4O0SA 4PL4A 1L3RE 4ZS4A 2GQGA 2VTTA 4BI0A 4EJ7A 5LVOA 3QQFA 4RWLA 1KE7A 2AC3A 3BYUA 4HZRA 2VWVA 3FAAA 5FQDC 4JR7A 4RG0A 4XP2A 3U9NA 4N6YA 3PXRA 2W5AA 5DNRA 3GENA 3C50A 4IAIA 4OTQA 1P4FA 5AR3A 2WU6A 3UIBA 2P2HA 3G9NA 3GQLA 3QLFA 2BZIB 3PXKA 2X7OA 4UYNA 3D14A 1O6LA 1J3HA 4MBIA 4JQ7A 3E5AA 4YBJA 5LARA 1XBAA 2FVDA 4IB1A 2YIXA 2VX0A 4NKSA 5J95A 5J87A 2BRMA 4C4HA 4G6NA 1B39A 2IN6A 4WNMA 3I81A 2W9ZB 4LG4A 4YO4A 3A7JA 2E2BA 4PDOA 4W8EA 5AAGA 3QFVA 2VU3A 3FMHA 3MPTA 4C2VA 2YWVA 4NTTA 5K0XA 4XHKB 2WIHA 4EI4A 2VUWA 3BHTA 3BLRA 3G6GA 3QD0A 2WMSA 5M09A 5BNJA 5HCZA 4R7HA 1J7LA 3OUNB 3I0QA 4FIGA 2WMTA 4GH2A 2R3HA 4D2PA 1NVSA 1PMNA 4I6BA 4BCJA 5A14A 3HNGA 3AT4A 2CGVA 3COHA 4HNIA 4DLIA 4F0IA 1LPUA 5K9IA 2GQSA 2GFCA 5AV3A 3SKCA 5F95A 4HYUA 3LW0A 3C13A 4UALA 2VTHA 4FZDB 3HAVA 4GU6A 3LMGA 4FKUA 4IVDA 4HGTA 4DTBA 3L9MA 2YAAA 5FXQA 5L8LA 4OTGA 3PPJA 4G6OA 1Y8YA 2WAJA 4AXAA 5AA9A 3FLYA 3GC7A 3AGLA 1MP8A 3NW5A 3NZ0A 5CU2A 3B2WA 2C6KA 5AUZA 2J90A 2UUEA 2GS7A 4WSQA 1IG1A 1YRPA 4W4WA 3MFSA 2QU5A 3DA6A 1TQIA 3EB0A 4BCMA 4BC6A 3RMFA 2QOLA 3RWPA 3DKCA 1PXPA 3WE8A 2ACXA 3FPMA 3OCBA 3MBLA 2CN5A 4EONA 4KINA 2C0TA 4ID7A 4O6LA 3ZHPC 5FDXA 1SNUA 4V01A 3PWDA 3I0OA 2XNGA 4BBMA 3ET7A 5J7HA 5BVFA 4FA2A 2W1ZA 3IO7A 3W1FA 5AADA 3PUPA 2C6LA 1W7HA 4MXAA 1Q3DA 4RSSA 3HMIA 5HG5A 1PXOA 2XBAA 4KAOA 5C4LA 1YW2A 3HA6A 3NYOA 2UW7A 4FV6A 4I4FA 1AGWA 4DFYA 3DTWA 3H10A 3OVVA 3KREA 2QU6A 2IO6A 1KWPA 5I9XA 2VWXA 4M68A 1H8FA 1JPAA 3DB8A 4F1OA 4YJUA 3DJ7A 3SV0A 3DFAA 4ACDA 3ETAA 4FT9A 1TVOA 2IWIA 2OXYA 1YOJA 2C0OA 3DBEA 3PVGA 2OZOA 4LFIA 3BEGA 3PLAE 4G3EA 3H9OA 4NM5A 3F69A 5AM7A 3VHKA 3NUUA 3MPMA 3ACKA 3MB7A 4AZSA 4O7ZA 3QC9A 4CYIA 3BV3A 2B1PA 3GVUA 4WRGA 5IH6A 1F3MC 3E92A 1G8AA 3BYSA 3GC9A 4QP1A 4FKTA 2IW8A 4C59A 2PL0A 5IQAA 4ZIMA 2ZB0A 4C61A 3H0ZA 3OWJA 2J5FA 2WEVA 1OIRA 2C4GA 5A6OA 4H58A 4YZDA 5CSVA 4EH3A 3HZTA 3NUXA 1OKVA 4EL9A 4HJOA 2ETKA 1S9JA 1WBPA 2P55A 5BVEA 4FNWA 3TNIA 4FKQA 2OWBA 3V8TA 3W10A 4YZBA 4F6WA 2HAKA 3LXNA 4WNPA 1AD5A 5DWRA 2IW9A 3FI8A 2E9NA 4EKKA 3DY7A 2ZM3A 5FUTA 4UZHA 3UVQA 5JFSA 2DUVA 2VO0A 5A6NA 4F1TA 2GS6A 2PE0A 4BICA 5C8MA 3F7ZA 4KRCA 2PVKA 3IW5A 4AACA 2E9PA 3RBWA 3HLLA 1WAKA 2OJFE 4APCA 2PSQA 3R01A 4FIFA 4ZZNA 3PY3A 4UXQA 4OAVB 3VS6A 1LP4A 5T6KA 3MS9A 4MXYA 2Z2WA 4U44A 4L68A 5CI6A 4QMOA 4H1MA 5GZ9A 3EL7A 1JKSA 5I4NA 2F57A 3BBTB 4ZOGA 4I23A 2F49A 3DAEA 3RAHA 3E7OA 3LM5A 2R5TA 4GMYA 4L42A 2PVMA 3A4PA 3FXXA 4I93A 4FBXA 4RLKA 3FV8A 1OB3A 2J6MA 4RQKA 3JR1A 2Q83A 1ZZLA 3ERKA 5DN3A 5J1WA 5HKMA 4PY1A 3MA6A 4GKIA 5GIPE 4BCPA 4HW7A 3D5XA 2XK9A 5ANIA 2ITUA 3Q32A 3UPXA 3LMHA 3Q53A 4ASEA 3PXYA 5DT3A 5E8VA 4C4JA 3DNEA 3H9RA 4FEUA 4YHJA 2Z8CA 4BF2A 2Q0BA 4EUTA 1Q8WA 4U43A 4OUCA 1B6CB 4MYGA 4IHPA 2JDTA 2OIBA 2FSMX 4RWJA 1UVRA 2BTRA 4U9AA 2YM3A 2VO3A 3U51A 4EZ7A 5HG8A 3DKFA 4TYJA 3C5IA 4FTMA 1ZWSA 3VUTA 1JAMA 1M7NA 3GCVA 3OXTA 4XP0A 3Q52A 2WMVA 3FI4A 3KCFA 3PG1A 4MD9E 4QMWA 3EZVA 2WMBA 1H24A 3PVUA 3MFRA 3Q9YA 3CIKA 1SZMA 3ORMA 3QTUA 4PQNA 3W2SA 4M69A 1PXNA 1YXTA 5DHJA 3FL4A 4KIOA 4U3YA 4F7JA 2OJGA 4ZLYA 3R2BA 3AD5A 4ANMA 4B8LA 5KUPA 2BUJA 4KD1A 4RVTA 5AP3A 4GJ3A 5FEQA 5H8EA 1YXUA 3R7VA 5CX9A 5HNGA 4EWHA 2J5EA 4RJ6A 3O96A 3P79A 3NIZA 4DF3A 3ROCA 3CJGA 3LHJA 3VBTA 4CMTA 2YISA 5ANGA 2V22A 5HBJA 3DXQA 5BQ0A 3PRFA 4CKIA 3FLQA 3KA0A 3P23A 3CQWA 4G9CA 2ZMCA 3QBNA 5GZ8A 2OIDA 4NSTA 4FKRA 2W1DA 4U5JA 2VZ6A 4IACA 3GEQA 4KIKA 1UU8A 1OIYA 2V7OA 4DBXA 4A07A 5FP6A 2WQNA 4Y85A 5EI2A 3EKNA 5CEOA 3FEGA 2XRWA 4I6HA 2XUUA 5K3YA 3PZEA 3PLSA 4BCOA 3AC5A 4EZ3A 4CSVA 4M12A 4CV9A 2ZB1A 4AGUA 4DA5A 4CMUA 2P0CA 3HRBA 4I0RA 2W5BA 3LCDA 1FQ1B 1H1WA 4XV9A 5CAOA 2X8EA 3DAKA 3T3VA 2IG7A 5AR4A 1CDKA 2B9HA 2J0IA 4R8QA 4RT7A 5JZJA 1QMZA 4YC6A 3PRIA 2GHMA 2BVAA 2Y7JA 3HV4A 3KULA 3MI9A 4G3CA 5CEKA 1R39A 3KXMA 5J79A 5CQUA 1R1WA 1QPJA 4NTSA 3KB7A 3GC0A 4JG7A 3O17A 3QA0A 3GC8A 4L3PA 4U97A 4CZTA 5LWNA 4V04A 5EQPA 3C0GA 2XEYA 2RFDA 1XH4A 4CKJA 3WZEA 3MPAA 4K18A 4TWPA 3QGWA 4MXXA 3D2KA 4FKPA 4FSTA 2PPQA 4D5KA 5C26A 4IDVA 2LAVA 2GHLA 3OMVA 5CSHA 3ULZA 3GU7A 3M11A 2C6MA 2PU8A 5E92A 3LM0A 3WF9A 5AUTA 4QP3A 3TEIA 3UMWA 5HO7A 4TYGA 1U46A 3G33A 3RHXA 3R63A 1ZYJA 4IC8A 5L2QA 4MBLA 4MXCA 4R1VA 4AW0A 4DCAA 2RSVA 3QXOA 2GCDA 2Y4IC 4FV4A 4GG5A 3ZRKA 5E8WA 2QOBA 2XKDA 4BKYA 5HG7A 5IZFA 3W2CA 4LYNA 5C4KA 1YXVA 5E1SA 3OC1A 5DRDA 3U4WA 1JKLA 3LOKA 5CENA 3EHAA 4TYHB 3QKMA 4WD5A 3ODYX 5HNIX 4K33A 2WFYA 3ZO2A 4MF1A 2O3PA 3C4EA 4RX8A 4DEAA 5IQIA 3EFWA 1FBNA 2Z7LA 4O91A 2WMXA 4ALWA 5CAUA 3NVMB 5HX8A 3EJ1A 1FOTA 4CZUA 2BFYA 3EKKA 4M69B 4NJDA 3VWAA 1YI3A 3NNUA 4EEVA 5IQEA 5EYDA 4ORKA 5DBXA 3MVJA 4EUUA 2ONLA 2XJ2A 3JXWA 3S3IA 3QCSA 3RJCA 3C1XA 1RDQE 3UG2A 3OEFX 4ZY4A 4QQJA 2OLCA 3CD3A 3QZFA 5M06A 1PKDA 5E7RA 5B0XA 1KV1A 5K0KA 4C36A 3PJ1A 4CG8A 4IJPA 4IZYA 1Q8YA 4GYIA 1R0EA 5HOAA 1PXKA 3LFSA 4W9XA 4CVAA 4J53A 4U79A 5HU9A 4KIKB 4R78A 3QX4A 5L3AA 2XB7A 3QTWA 3CQEA 3OHTA 3TZ9A 5AUVA 4M14A 4EK5A 4KB8A 3N51A 3G2FA 5CI7A 3PJCA 3QTIA 4BTJA 3HV3A 4HVDA 3PA3A 4I0TA 3DNDA 2UW8A 3NR9A 1XH7A 4IZ5A 1Y6AA 4PP9A 1ZYLA 3D15A 5DH3A 4IB0A 3KRXA 4EBWA 1ZAOA 3EWHA 4YJNA 4WSYA 5I3RA 3TTJA 4ANNA 3W32A 2ZOQA 4Z7HA 2WQBA 4O83A 3V51A 2YM8A 1ZARA 4M8TA 3NYXA 1IEPA 2Y6OA 2OIQA 3V3VA 1TQPA 4CZYB 2W1CA 2RFSA 4FF8A 5D10A 4MWIA 1UU3A 3PZHA 4KBKA 4XEYA 4MF0A 3KULB 4XNEA 2ZVAA 3AT3A 2DWBA 2J0MB 1XQZA 4BZDA 3FKLA 2UVXA 4KKGA 3RHKA 4FTOA 1BI7A 3SHEA 4EOOA 1IR3A 3AC8A 1DM2A 2W4OA 4BCIA 4U80A 4C37A 1A48A 2VWBA 4FC0A 4BB4A 2I7QA 3ZC6A 3VS2A 4GVJA 4MK0A 3BLQA 3P7AA 3M1SA 3QGYA 3ZU7A 5L6PA 3JPVA 1REJA 4IX3A 4TPTA 1IA8A 2R3PA 3MV5A 4IXPA 3V6SA 4IB5A 2QKRA 4R7BA 3F88A 4ZSEA 3FWQA 3GT8A 3PFQA 4PL5A 3FPQA 3O8UA 3O8TA 1OL1A 2R7BA 3C5UA 4DEEA 2HELA 3FMJA 2Y4PA 1W0XC 3A7FA 5HLWA 2ITXA 4QMXA 4MTAA 3T9IA 3QTZA 5IUHA 5L6OA 1Q8UA 4RIWA 3TJCA 2YIRA 2VWYA 4QYGA 1BKXA 4DYMA 3G15A 3MH3A 4EH2A 2Y6MA 3W2OA 2OW3A 5HQ0A 3KMWA 3I79A 1J7UA 4W4XA 2BMCA 4WIHA 3JY9A 2RIOA 3PE1A 3QXPA 4E3CA 5CASA 4MKCA 2YCRA 4JI9A 4FE2A 2I0VA 4O6EA 2G2IA 2JC6A 4F65A 4NWMA 4DAWA 3VJOA 4OBQA 4ITIA 1H25A 1V0BA 1WBSA 3BE2A 4DN5A 5BX0A 2WTKB 5FD2A 3R8PA 4MXZA 2OI4X 5CZIA 2CLXA 4I6FA 4C4FA 3U6IA 5A46A 1WBVA 3FZSA 5AUXA 1KE8A 2IPXA 3FMLA 2H34A 3NUYA 4EYJA 4I4EA 5A4QA 5HTCA 5ITAA 4NT4A 3LCKA 5K4IA 1M2RA 5FBNC 4CG9A 3ZSGA 2BRGA 4F9YA 5AP0A 5D7VA 5E8UA 1VR2A 2HYYA 5TF9A 4OTDA 4QP9A 4QQCA 5HBEA 2OFUA 1FMOE 3ITZA 4QQ5A 3CTJA 4R6VA 4H3QA 2J9MA 1OGUA 2JEDA 4S32A 1WCCA 4YUQA 2YDJA 4L00A 3U87A 3C4CA 4PDPA 3Q4UA 2B55A 5IA1A 3ZLXA 4PUZA 1GZNA 4A9YA 3TUCA 4F6UA 3NEWA 4HOKA 1G8SA 2CCHA 1XH8A 3HKOA 3ZZWA 4IFGA 3Q60A 4EK6A 3PXZA 5HVYA 1APME 4EORA 4CFVA 2CKEA 3GI3A 5KMKA 5M4IA 4IW0A 4NH1A 5BVOA 3RPOA 1Y8GA 2EXMA 2XIRA 3QCQA 4TZRA 1G3NA 2OXDA 3BV2A 3MA3A 4WKQA 5CU3A 2FB8A 5JSMA 3E8EA 2J0LA 4FYNA 3WBLA 3SXRA 2VWZA 4FKIA 4C3RA 3DDQA 3UTOA 5EW8A 3GFEA 3OCGA 3QAME 4RZWA 3VBWA 1NXKA 3SVVA 2C3JA 2FSOX 2XNNA 4K8AA 5DT0A 3ZUVA 1E9HA 2QNJA 4DITA 2O5KA 5B2LA 3I60A 2WTIA 4E4MA 4RVLA 4BGGA 2BHEA 3ZFMA 4FICA 2B7AA 4DH8A 4BKJA 5F94A 2ITYA 1LR4A 1P4OA 3ZSIA 4AZWA 2BKKA 4OAUC 4PF4A 2OGVA 2VX1A 1YWNA 3AD6A 4QMMA 3N4UA 1OL7A 3R9DA 2VTLA 4O0WA 1DAYA 3EMGA 3OUKA 2H9VA 3ZO4A 4E5BA 5M53A 3ORPA 3AOXA 4YHTA 3TNWA 4X3FA 4JBQA 4LRJA 2NRUA 4FEQA 4RIWB 2FA2A 3LFEA 3IS5A 3R8ZA 5M07A 2CNUA 5ACKA 2R3MA 4RPVA 4AUAA 4XBUA 2GNJA 2BZHB 3LFCA 4P7EA 5IKWA 4D4SA 5FDPA 4EH6A 1WBTA 4EH5A 4TNBA 5F4NA 2FUMA 4H36A 5AV1A 3RPVA 3DAJA 1UA2A 3KMUA 4M3QA 5HO6A 4D0WA 4ZEGA 1JLUE 4IAKA 1RE8A 3ZLWA 2EXEA 4MHAA 4AGWA 4CMOA 4IX6A 3FC2A 3BHYA 5HTBA 1ZLTA 2OH4A 5I9WA 5D1JA 3DOGA 4FSNA 4IAYA 4AE6A 5LMKC 4HZSA 4O0YA 4OTFA 5A4EA 5TOZA 4D5HA 4YZ9A 4DE4A 2I1MA 3EL8A 4FSZA 3NSZA 4GV1A 3GXLA 3ZLYA 3BHUA 4R1YA 2PUNA 4EH7A 1O9UA 4PPBA 2GS2A 3OBGA 5D12A 2R3KA 3ORKA 5LVNA 2XK7A 3KRWA 3FLWA 3ELJA 1RW8A 4FIIA 1K3AA 4H05A 5EKOA 2JDOA 4QQTA 2IVTA 4NW6A 3ZRMA 4DEDA 4C4EA 2HK5A 2R2PA 2ERZE 2ZV7A 5CVFA 1WFCA 1IAHA 5KKRC 2H8HA 3DTCA 3TWJA 3OBJA 5AX9A 4L3LA 1PYXA 1IAJA 3BEAA 3ZLSA 4BDFA 2FSTX 2G2HA 2VWWA 5EYCA 3Q04A 4BIBA 4F99A 2UZWE 2YDIA 1XO2B 1GZKA 5GIOE 1H1QA 2QODA 1P14A 4I3ZA 3JS2A 4AX8A 4ANBA 4JBOA 1U5QA 1QCFA 1JSTA 3MVHA 4I22A 5GHVA 4WNKA 3RGFA 3A7IA 4PP7A 4FSYA 1OPLA 4KABA 1OITA 3RINA 4W8DA 2YFXA 2HY81 3QTXA 5TR6A 3O8PA 3ORLA 1NVQA 1OM1A 4J1RA 3TZ8A 3I4BA 1JVPP 2WNTA 3Q4ZA 3VUGA 4KWPA 4F9WA 2NNWB 1GIJA 3LCTA 4BIEA 3ZZEA 4B99A 5L6WL 4K77A 4CT2A 5HVJA 4FTQA 5CSWA 4BGQA 5CF5A 1MQBA 1OPJA 4IAZA 5HE1A 2GNIA 1ZRZA 4ZY5A 3C4ZA 2PZRA 2BR1A 3DQWA 3FYJX 2XM8A 2WQMA 5DGZA 1FGKA 2AUHA 4L45A 3T8OA 3COKA 5DR9A 1R0PA 2X9FA 4NCTC 5AUWA 3OG7A 3R8MA 3EQFA 4FV3A 3UBDA 2GU8A 1J1CA 3E3BX 4X3FB 3W8QA 4D2WA 3FYKX 2WMRA 3O2MA 4FKJA 4G9RA 3AC4A 5H9BA 2JGZA 5JQ5A 4FL2A 4KS7A 3LLAA 4RIYA 3LFNA 2YN8A 2RFEA 1JSVA 2CDZA 1H28A 5AIKA 3RCDA 2OKRA 3WZKA 4L43A 4AN2A 3KC3A 4DT8A 1PMEA 2BAQA 3FLNC 3ZEPA 2W1IA 4D4VA 1V0PA 2C3LA 4CNHA 4I20A 4C33A 3E63A 2I6LA 4JS8A 5FTQA 3HYHA 4FTKA 2O65A 3PSBA 1ZMVA 5TE0A 1JSUA 2XK3A 2QI8A 4YTFA 1UKIA 4QP4A 3CBLA 3ZDIA 2ESMA 4D1ZA 3OP5A 4G5PA 4IANA 1F5QA 2GNFA 1Q62A 3AMBA 4LGGA 2ZM4A 4L7SA 4EH8A 5IEXA 5J1VA 5JK3A 5B7VA 5LCJA 1Z57A 4XG6A 3B8QA 5L8JA 3BQRA 4YJRA 4G31A 2GNHA 4QP2A 5EK7A 5AP1A 3WILA 1PXLA 2OXXA 2QCSA 1YOLA 2PVYA 3A61A 4M66A 1JBPE 3EQDA 3FLSA 2QLUA 1H00A 2W4KA 4J7BA 1PYEA 3KQ7A 3QYWA 3MY1A 3Q5ZA 2EUFB 5AJQA 2UZOA 3DPKA 2PUPA 3QF9A 4DG3E 5C9CA 3CPBA 2BDFA 4CFXA 3KXZA 3VUMA 2HOGA 2WELA 4D2RA 5AA8A 4A06A 2XS0A 2OK1A 4FTCA 4YJPA 4RMZA 3QRTA 4UYAA 4A9UA 2A4LA 4IVBA 4MNEB 4RIOA 4RVKA 4RX9A 4K6ZA 5AEPA 4FR4A 1ZOHA 3LFDA 3FMDA 2R64A 3KVWA 2XH5A 3TNQB 4ACGA 5CF8A 5J9LA 3HDMA 5IDNA 2YA9A 2Q0NA 3L8SA 4GUEA 3UOHA 3U6HA 3QC4A 1OZ1A 3I5NA 4XYFA 2GFSA 2C68A 4X21A 1XBBA 4ZXTA 3R7UA 3ZM9A 3EN9A 1KE6A 4K11A 4I41A 2O2UA 4O7YA 4IQ6A 4ITJA 4WA9A 2VO7A 5L2SA 3PIYA 3H3CA 3BBWA 3G0EA 4TTHB 4AFJA 4FEWA 2WEIA 3R9NA 4AZEA 2BCJA 4BIDA 3OROA 3TIYA 1IRKA 5EQEA 3V5TA 3R04A 3T3UA 2QG5A 2VGPA 4EK8A 2BHHA 3GU6A 4FV7A 4FTIA 1KSWA 5AX3A 1M14A 2R0IA 3FZTA 1M52A 4CEGA 5A4CA 3MIYA 2CNQA 3PA5A 4EK4A 2GDOA 4FSQA 5CT0A 2BKZA 2WD1A 4RIYB 3EQIA 2GMXA 3HGKA 3IDCA 3ODZX 4M0ZA 4P2KA 4YJTA 5AUUA 3FQEA 5GZAA 4RA4A 2WB8A 3A4OX 4HPUE 5ANDA 4F09A 4KS8A 4DCEA 2UVZA 3IPHA 5EDRA 2PVLA 3BRBA 3CTHA 2XMYA 1VEBA 3POOA 5EM5A 5BMMA 5JKGA 2HZ0A 3VHEA 4WBBB 3ORZA 3EYGA 3TV6A 4EC9A 3LKMA 4BWKA 1R78A 3VBXA 5AP2A 3CSVA 1JNKA 3ZXTA 2PVHA 2XCKA 4AT5A 2C3KA 5EG3A 2OZAA 4JRNA 4TT7A 2J2IB 1Q41A 4O81A 2B9FA 5M55A 3MFTA 5LOHA 4BRXA 4HVGA 2WHBA 3LPBA 4BYJA 3KY2A 1KE9A 2CLQA 3R1NA 4YLKA 4F9BA 5AAEA 5EQYA 1W8CA 3FMEA 3TL8A 5DYJA 3LAUA 2ERKA 4LMNA 4D55A 3SX9A 2OBJA 3A60A 4G3GA 4PNKA 3D5VA 4AE9A 2XYNA 4FT3A 3II5A 3KN5A 2X39A 5IH4A 5D9HA 2OJ9A 3SW7A 4B9DA 4DFBA 4O7SA 4Q5EA 2W4JA 1PW2A 5I9UA 4BBEA 3IW8A 4U81A 1GNGA 3D5UA 4E20A 4GJ2A 2UZBA 3LCSA 3AG9A 4EHVA 4WNOA 4XUFA 3RPSA 3QX2A 5JH6A 4OBOA 1SNXA 1DI9A 3WF5A 3BHVA 3K3JA 2R3QA 3HVCA 2W5HA 3HMPA 4QTBA 4M0YA 3L8XA 3UIMA 3WZJA 3JUHA 4NJ3A 4UV0A 4QMTA 3W18A 3Q6WA 4AOTA 3MVLA 4L46A 3HMOA 3VQHA 3FKNA 4II5A 3RZBA 4F70A 4AU8A 4E8AA 5ANJA 2VO6A 4CFMA 3QD3A 1QPEA 4PDSA 5DE2A 4BDGA 2QC6A 3DXPA 4L52A 2PY3A 3KXHA 3SXSA 2YABA 4YNOA 3E8CA 4QP6A 2BAKA 1ZZ2A 1M7QA 2UVYA 3MB6A 3QZGA 1CKJA 5CLPA 4F9CA 4PRJA 3KRRA 4UMUA 3MGYA 3P7BA 3IK3A 4Z7GA 3N9XA 2W06A 4E1ZA 2VTSA 4NM0A 3WE4A 3WYYA 5I9VA 2VV9A 5HIDA 2BTSA 3DBCA 3V5WA 4FODA 3BGZA 5A4LA 4BDBA 2I0EA 3MDYA 4D9TA 3LFFA 4L44A 5GJGA 5I9ZA 3OY3A 4TWCA 3DZQA 3AC3A 2JKKA 5B2KA 3NUAA 3E8NA 3UE4A 3ACJA 4O22A 4Y8DA 4BTFA 3R1YA 3AMAA 4XG4A 5EW3A 3ZFXA 4BCGA 5JGDA 4FV5A 1UU9A 1H4LA 3TG1A 3D5WA 3H4JA 4G34A 3OZ6A 3PPKA 2F4JA 3BYOA 2B4SB 4G3FA 3V8SA 4YMJA 4DBNA 3RM6A 2OFVA 2X7FA 4QMVA 2QQ7A 4PTEA 1H08A 2HW7A 2G9XA 1BL7A 1XJDA 3OW4A 4LQMA 4TYHA 3RAWA 4E7WA 2WMWA 5I9YA 2PMIA 3HA8A 2W9FB 4TKSA 3DK7A 1ZMWA 2C1AA 2PZYA 1QPCA 3NRMA 3NCGA 1M2QA 4F0FA 4FSRA 3FE3A 3ZONA 2B54A 3W2RA 1Q8ZA 2OZAB 3BPRA 4FTJA 3RAKA 5KBQA 1H27A 2QD9A 2O63A 2ITTA 2HZIA 3DK3A 4JJRA 4XG8A 5IA2A 2Z02A 5ETFA 1STCE 2HWOA 5FWKK 5BYZA 5J9YA 4QPSA 5AR5A 1ZYCA 3F2RA 5CS6A 2H96A 3ZUUA 2PK9A 4O86A 5M4UA 4ASZA 3UIUA 5E8TA 1ZOGA 3TKHA 3BIZA 3FZOA 3VBYA 4O1PA 3QUEA 2ZV8A 2QHNA 4R3CA 3QL8A 5KZ0A 3I7CA 2X2LA 4XV1A 5CVHA 4QMLA 3P5KA 4L8MA 5E8ZA 4MAOA 5IMEA 1QL6A 2KULA 1Z5MA 2SRCA 5DVRA 4A4XA 2RG5A 4BDCA 4DHFA 4PMSA 3QCXA 3SGCA 5F9EA 5DPVA 4UMRA 4QNAA 3AXWA 3F6XA 2I0HA 4FZAB 5J9ZA 4IIRA 5KCVA 4YTHA 2C47A 2GSFA 3HDNA 3OXIA 3R71A 4O0RA 3UVPA 2Y9QA 4TY1A 2WMAA 3PG3A 2YWPA 5HGIA 4BDIA 2XEZA 1MRYA 3GGFA 4GIIA 4RIXA 4DH3A 2XYUA 2VTJA 4EBVA 3IQ7A 4X2GA 2XVDA 4UMTA 2ITZA 2GNGA
chains in the Genus database with same CATH superfamily
4UMQA 3GP0A 4AZTA 4C38A 2AYPA 4KNBA 3UDBA 1YOMA 3BU3A 1FMKA 1U5RA 2A0CX 2B9IA 4IVCA 5FBOA 5IA4A 1PMVA 3OFMA 2CN8A 4O0VA 5IUIA 3VBVA 3Q9WA 2NRYA 4QPMA 3WYXA 4EJNA 2C6DA 3EIDA 2C6OA 4FMQA 5IG1A 5DLSA 2C1BA 4WT6A 2PWLA 1ZY5A 4GFGA 3CCNA 5IQDA 2VRXA 4IX5A 2XNEA 1OIUA 1P2AA 1YDSE 3BWJA 3C9WA 4FV1A 4YO6A 3WOWA 5IPJA 3PA4A 4UMPA 2X0GA 2GHGA 3PSCA 2XNMA 3F5GA 3ZOSA 1OMWA 2G2FA 2JAMA 5DT4A 5IISA 3QD4A 3Q2MA 4RVMA 4IVAA 3T9TA 4LV7A 5JMSA 4FUYA 2PZPA 4DEGA 4FNZA 4U45A 1RQQA 4TWNA 4PMMA 4O7NA 4LI5A 3O7LB 3C7QA 3FMKA 3DJ6A 3F3WA 5EW9A 3RI1A 4USFA 5KMIA 5I3OA 4BCFA 4CTBA 4BHNA 3LFQA 4HCVA 4MQ2A 1XMLA 2OJJA 2PZIA 3DV3A 4LMUA 4MQ1A 5AAFA 4IWPA 4X0MA 1XMMA 3F2NA 3E7VA 4V05A 3LFAA 3QRIA 5FM2A 3BZ3A 4X2JA 1IASA 3R7IA 4E6AA 4HPTE 4O7LA 1H07A 1O6KA 2HW6A 4AFEA 3OWPA 3MW1A 4FUXA 3PIXA 4MBJA 4F78A 4RBLA 3NCZA 4DGOA 3N4VA 3NIEA 3DS6A 4E6QA 3BKBA 1UU7A 4X2FA 3VS4A 4O21A 4U40A 2PMNX 5TO8A 4IWDA 1WBOA 3OD6X 3O51A 4TNDA 4ZZMA 3WIGA 4LUEA 3IGGA 3R1QA 4EHEA 4NL0A 2X2MA 1IA9A 3KRLA 4HYHA 4D9UA 3PXQA 3I5ZA 3H9FA 4XLVA 3CC6A 3MTFA 3SA0A 4BCKA 2X6EA 4D1SA 3A7GA 3OF0A 3IECA 4ZTNA 4FKLA 4RQVA 5DFPA 3SOAA 2WTWA 1I44A 1V0OA 2VTMA 5DIAA 4ZTRA 3C51A 3F61A 4LOPA 5CNOA 5C01A 2W1EA 4JAIA 2HXQA 3QZHA 2YIYA 3KIOC 2CHLA 4IFCA 1Q4LA 4PX6A 3TKUA 3QZIA 4U41A 4RIXB 4AN3A 1BL6A 2IZRA 1XWSA 1OGYA 2BRBA 2FSLX 3VBQA 1XHAA 3LLTA 3QRKA 3R1SA 4IM0A 5ANKA 4QMNA 5IQBA 3BI6A 4DGNA 3ZS5A 1XR1A 3S2PA 3CR0A 2JDSA 3IDBA 3QQKA 3R73A 4D1XA 4CGAA 3DXNA 4XG9A 4FIJA 3VS7A 1HCKA 2VTRA 3QALE 1FGIA 4W4VA 4CLIA 4EOSA 4RX5A 5CAQA 1OL6A 3P9JA 2HWPA 4QMYA 4YPSA 3FQSA 3ATSA 3FUPA 4AGCA 3AKLA 2X1NA 3DKGA 4XMOA 4AA0A 4AOJA 3NVKI 4X6QC 4CQEA 1UKHA 4O7RA 4FRFA 3FZRA 4FKVA 4ZJIA 1UNGA 1VYWA 5CU0A 4WOVA 2X2KA 2XAOA 5HHWA 4A4LA 1K9AA 4ANOA 3E8DA 3LZBA 5HE3A 3UOKA 3U6JA 4BY9E 5IU2A 4IZ7A 4IB3A 4ZSLA 3QKLA 1FVTA 4B6LA 4JMQA 5C1QB 1B38A 3IOPA 5CNNA 4F63A 1SMHA 4O7WA 2FH9A 3EOCA 5CZHA 5M57A 3DBQA 4NFMA 3COIA 4NUSA 5EHLA 3GCUA 2PMOX 5M4FA 3A7HA 4QT1A 4IAAA 4MXOA 5IDPA 3ZXZA 1WMKA 3MIAA 2XF0A 4FSUA 4FVRA 4JXFA 3L8PA 2REIA 1ZOEA 2NO3A 3C0IA 5CWZA 2WXVA 3V6RA 2YM4A 4C7TA 4DG0E 4LUDA 4KKHA 3UNKA 4MD8E 3D2IA 5CU4A 4PMTA 3N4TA 4O4CA 4DFZE 3NGAA 4UY9A 4LDTA 2VTQA 2XK4A 2QOCA 5EI6A 2ZMDA 3KK9A 4N0SA 5CEPA 1L8TA 3EFJA 4XCUA 3GBZA 3HL7A 3UQGA 3VS1A 1CKIA 2X81A 2CGXA 4I5HA 4GFMA 2VN9A 1Q5KA 4O27B 2JIUA 3JVSA 4UEUA 5JZNA 4ANSA 4AZFA 4DDIA 2HXLA 2PVNA 3NYNA 1G5SA 2JAVA 2OG8A 1H0WA 4L6QA 4XBRA 3UVRA 3MY5A 3QTSA 5AP7A 3RK5A 4YGAA 5CT7A 2BIKB 3MJ1A 4U42A 5H8GA 3ENHA 4DEBA 5BVNA 5HCXA 4AOIA 3MYGA 4AP7A 3ZUTA 5CSPA 5ANEA 2GTNA 5AM6A 1EH4A 1ZYSA 4KRDA 4A9SA 2QR7A 4HCTA 5AV2A 5IUGA 2QVSE 4QRCA 3FJQE 3TZMA 3KEXA 4H1JA 5HG9A 4FL1A 2WTJA 2YCQA 4C8BA 3AQVA 1W98A 4FK3A 3NW7A 4QYYA 5FXSA 5EM8A 1XH6A 5G1XA 1Q99A 3RNYA 4FT7A 4FKWA 3W0RA 1GZ8A 3IW6A 4HVIA 4R7IA 3SW4A 4EH9A 2YERA 3IGOA 2R3LA 4ZMFA 3ANRA 1MRUA 3OCSA 5HBHA 3DLZA 1WBNA 3GUBA 4F64A 2XIXA 4FZ6A 1JWHA 3SOCA 3G5DA 3D4QA 4MWHA 2W1FA 3F82A 3NW6A 5HD7A 3R02A 4NEUA 5E8XA 3CS9A 5L2WA 2HCKA 4FTNA 2PYWA 1OECA 1GZOA 1ZXEA 3CP9A 1NA7A 4OTPA 3V5QA 5JFVA 2VAGA 2UZNA 4OTWA 5EHOA 4DH1A 2XNOA 4AF3A 4RFMA 5H2UA 3ZEWA 1W2DA 4I21A 1BYGA 3Q9ZA 5EYKA 4RRVA 1NVRA 4GT4A 4JDIA 3ORIA 1Y57A 3AMYA 5KMMA 4GG7A 5KBRA 2IZSA 1PKGA 3DZOA 4QTAA 5HE2A 4AAAA 4O0TA 4N57A 4BTMA 2Y4IB 2Z7SA 1H0VA 3DDPA 4GT3A 5AP6A 4LGDA 1GIIA 3SDJA 4YSMA 3E88A 4DHZA 1BX6A 2G15A 3R0TA 3ULIA 4DEIA 2XK6A 2GPHA 1MQ4A 2RL5A 3MH0A 4PDYA 3NMUF 3A99A 4U3ZA 3GCQA 2XKEA 3QQUA 2WTVA 4YZNA 4AA5A 2QR8A 4S31A 2GQRA 3KXGA 3W16A 2C69A 4R5SA 3ID6C 4YJVA 1S9IA 5H8BA 1E1XA 3ANQA 4CYJA 2JIIA 3EH9A 3KXNA 3VRZA 3UC4A 5L8KA 2EVAA 4FTRA 3D83A 3OW3A 1OIQA 1BUHA 3HV5A 4EQUA 4CLJA 3CTQA 3R7YA 3H0YA 3VIDA 5AFVA 4BHZA 5IQGA 3CGOA 4TYEA 4ZSJA 3BLHA 2ETRA 2G1TA 2P33A 3F3VA 4USDA 4K2RA 4MEDA 4J99A 4CRLA 5HD4A 4BBFA 3ZCLA 3S00A 4XRLA 4FTLA 5ANOA 4BCQA 5IA0A 4F7NA 1RJBA 5M56A 4WUNA 2J4ZA 1GIHA 3REPA 3OTVA 2PUUA 2X7GA 2CKPA 4NFNA 4R5YA 1DS5A 2J0JA 3UJGA 3G9LX 3RM7A 4BDEA 2UZLA 2CJMA 3JVRA 3MH1A 2IVUA 2ZM1A 4DLJA 3G0FA 2PVRA 4MNEA 5BMSA 5DG5A 3P08A 4C62A 5KX8A 3F9NA 5HO8A 2JIVA 3FY2A 4FSWA 2W1GA 4H39A 5KMOA 5E4HA 4YNEA 2UZTA 3LJ2A 5M08A 4YBKA 4ZP5A 2VWIA 5DR6A 3NWWA 4ZS0A 4E4XA 2DYLA 5M51A 4ZTMA 4JVGA 4BGHA 4EC8A 3HV6A 4ACCA 2P4IA 3D7ZA 2OF2A 3RNIA 4WG4A 3V04A 3DCVA 5HESA 3UZTA 4J95A 2XKCA 4ZK5A 2BZJA 2VTOA 3EN6A 5AP4A 4LL5A 5CSXA 3LQ8A 4AWIA 4XOYA 3MVMA 3R7EA 2ITVA 4M13A 4RJ5A 2QHMA 2WQOA 4ZTQA 1HCLA 4O4DA 3ZMMA 2UV2A 4UB7A 1MUOA 4FG9A 1KOBA 2BRNA 3FBVA 3OCTA 4Z55A 1V1KA 5GJFA 4CV8A 3A8WA 5K5NA 3F5PA 4ALUA 3KMMA 3NDMA 4FTUA 4U7ZA 4FL3A 5DEYA 4ZTHA 3UNZA 3K5UA 5JRQA 4BCHA 5CALA 2X4ZA 4G1WA 5FM3A 4EQCA 5BV3A 1YDTE 2HZNA 2C5NA 3BU5A 5F20A 3RAIA 2PHKA 1PMUA 3FMMA 4FV2A 1J91A 4P5QA 4C34A 2WOUA 4F9AA 3COMA 3C4WA 2J0KA 3QUDA 4G17A 3W55A 3ZBXA 1GY3A 4CFWA 5M44A 1PHKA 2X0PA 3RPYA 4Q2AA 4XRJA 2RF9A 4EOQA 2C3IB 3KRJA 3HMNA 2CPKE 2BILB 2YLEA 4A7CA 3HX4A 4I5CA 2BRHA 3P1AA 3V5PA 4EHZA 4RJ7A 3CD8A 5L2TA 4BVUA 5LQFA 4EH4A 3NFGB 5KMLA 2B0QA 1YWVA 2R3GA 2X0QA 4FVQA 4J52A 1FVVA 4O4FA 4ANLA 4F1MA 4AXEA 2IEWA 4I5MA 4W9WA 1Q61A 5KMJA 2QOQA 2QO2A 4S34A 2XA4A 4D2SA 3Q6UA 1GAGA 4OT5A 5LMKA 4CCUA 2WU7A 2JBOA 2X9EA 4QMZA 2JKMA 4YLLA 4ZSAA 5LVLA 3UDZA 5J5SA 4Y83A 2R3JA 3IONA 4AQCA 3WF6A 1Q3WA 2BPMA 4FV9A 3WZDA 4QPAA 4O7TA 2EXCX 1KE5A 3OOMA 4JOAA 4HCUA 1NW1A 3NS9A 3RZFA 5IH5A 4XS2A 1BI8A 1VJYA 3H30A 3IDPA 4GEOA 3TZ7A 3W8LA 3DFCB 4WUAA 3BYVA 4FSMA 3BELA 4FK6A 2PMLX 5LVPA 2ITOA 4BZOA 3W0NA 4LL0A 4DINA 5AV4A 5JFXA 3SC1A 4O0XA 4F7LA 1URCA 3KN6A 4CFUA 5CTPA 2V55A 3LXLA 2LGCA 1OPKA 4JX7A 1Q97A 3QRUA 1MRVA 3V01A 2BDWA 3EN7A 4BFMA 4C57A 5IEVA 3EQBA 4HGEA 2CGWA 2XZSA 3O71A 4J98A 5FP5A 3NLBA 3VQUA 3HMMA 4Y73A 1OKYA 4ZLOA 5FLFA 2YM5A 4C0TA 2ZV2A 3U9CA 3WARA 3FMNA 2BROA 4C4IA 3EN4A 4ZZOA 4G2FA 1PXMA 4DEHA 4QP7A 4PMPA 1K2PA 1ZY4A 5IA5A 4FGBA 2Y8OA 4O2PA 3R22A 4QP8A 5ETAA 2XCHA 3EFLA 2YZLA 2YIQA 1SVEA 3AC1A 3QQHA 4I1ZA 4OTIA 2V62A 3R00A 4N70A 5DR2A 5FEDA 5D11A 1OUYA 1UV5A 4IH8A 4NYEA 4YJOA 4DTKA 4IEBA 1FPUA 4S2ZA 4NCTA 3SXFA 3FDNA 4R77A 3CPCA 3TI1A 3UNJA 3A8XA 3GNIB 3UOLA 2QOHA 3CY3A 3TACA 2AQXA 4D2TA 5BPYA 3MJ2A 3ORNA 3BQCA 2XK8A 4ENXA 4MX9A 5H3QA 1JKTA 4KIQA 1CSNA 4RWKA 3KFAA 2PUIA 3PXFA 4QOXA 2YM7A 4JG8A 5AIRA 3HP2A 4AW1A 2PVFA 3R8VA 4GU9A 1XH5A 2V5QA 3NAYA 5HLPA 3LIJA 3QHRA 1WVYA 3MTLA 2VNWA 3BU6A 3CKWA 3AT2A 4F4PA 5CAPA 3UPZA 3JY0A 4DGLC 3FSKA 3FZ1A 3FXZA 5DMZA 3CKXA 4BWPA 3F66A 2VTAA 4BTKA 4BDAA 1YQJA 3R21A 5K5XA 2WGJA 4YC8A 1YHWA 4EOLA 2DQ7X 3TUDA 1TZDA 2VNYA 4HGLA 4EOIA 2WPAA 3MESA 4IAFA 2HY0A 4LOOA 5IEYA 5A54A 2XNBA 4FYOA 3UDSA 3Q9XA 4E93A 3G51A 4YTCA 4KSQA 2JDRA 3IG7A 4D2VA 4IM2A 4I5PA 5KNJA 1OKWA 3ZFYA 4QYEA 4JQEA 1R3CA 5DEWA 3QQJA 2WO6A 3DB6A 3P86A 4BDHA 4EK3A 3MH2A 5L2IA 1JKKA 4UN0C 1H1RA 3GU4A 2HIWA 3NUPA 4DFXE 2QONA 3RPRA 2OSCA 4CT1A 5AR2A 3IW4A 4XX9A 5LMAA 2R9SA 4ACHA 1ZMUA 4AN9A 4QMQA 4RGJA 5KKRB 1ATPE 2EU9A 2W17A 3F2AA 3UODA 3QWJA 4ZAUA 3UZPA 5BVDA 1YI6A 2WMUA 3EQCA 2JLDA 4QNYA 2G01A 4OW8A 4UWBA 2UZUE 4DFLA 4WHZA 3DQXA 3BX5A 2QKWB 1LUFA 4JX3A 2BALA 2ZDUA 4QTDA 5AR8A 4H3PA 3GCSA 1FVRA 4GK2A 3E64A 2CNVA 4XV2A 1ST4A 4O82A 3F5UA 3KXXA 3WIKA 2FGIA 2PE1A 4JRVA 2C6IA 4IC7A 3ZO3A 4B0GA 3GCPA 5I5ZA 3I6WA 5JQ8A 4UWYA 2PULA 5FGKA 3KK8A 4XH6A 5GJDA 4UBAA 5FTGA 3UQFA 4Q9SA 1YI4A 4UWCA 3VONA 4AW5A 3BHHA 3VUHA 2ITWA 3UP7A 5CANA 3EFKA 1KUTA 2W1HA 4JLCA 3UG1A 3ZO1A 2CKQA 1OVEA 2X4FA 5HIEA 2ITNA 3FLZA 3R8UA 4FGRA 4Z16A 4FI1A 2UZVA 3DGKA 5BUEA 3RKBA 5CY3A 3TNPC 1YXSA 2H6DA 4C35A 2R3NA 3F3ZA 2C6EA 3CGFA 3QA8A 3FC1X 2C6TA 3QHWA 4K0YA 2ZV9A 3NPCA 2F7ZE 2UZDA 3VC4A 4O2ZA 4A9TA 4F08A 1PY5A 4O7VA 3C4XA 2R4BA 4BWXA 4JR3A 4O1OA 3KVXA 5CVGA 3BWFA 4K9YA 4FKSA 4BN1A 2R3IA 1OL2A 1GJOA 4DFUA 3I6UA 4ZMEA 3RK7A 1XBCA 4GVAA 4FOCA 4OGRA 4CQGA 5J8IA 2WTCA 2YITA 4FX3A 2YJRA 4F6SA 2ETMA 4EQMA 2ZYBA 4JDJA 5EHYA 2C0IA 2R3RA 4GT5A 4CCBA 4I6LA 2BDJA 2QLQA 3ZH8A 4JL9A 4YZMA 3KL8A 1DAWA 1J7IA 3P4KA 4I92A 4ZTLA 4ZLZA 4AZVA 4RFYA 5LWMA 3RCJA 3DU8A 3EQRA 1W83A 2W05A 2WQEA 2UW3A 2WTDA 4MD7E 5CXHA 3VO3A 4FG7A 4TYIA 5HLNA 4USEA 3SRVA 4PTGA 4GCJA 4P90A 3O50A 1PRYA 2PVJA 4AS0A 4L7FA 4RC2A 4OTHA 4KIPA 2WKMA 4ANQA 4QTCA 4G3DA 1E1VA 4YJQA 3FY0A 2HENA 2XM9A 4J8NA 4C4GA 3OWKA 2QG7A 2A98A 3MN3A 3AGMA 4FIEA 2XKFA 4NIFA 4QMPA 1M17A 4JIAA 2XIZA 3IW7A 4AG8A 4RC3A 1Z9XA 3QKKA 4J71A 3GQIA 3SAYA 2WTKC 3PTGA 4IE9A 4OLIA 4GKHA 3PSDA 2ONLC 5HI2A 3OS3A 2QO7A 2XIKA 4K1BA 4O38A 4TL0A 1T45A 4NK9A 4N4SA 4PTCA 4GSBA 3RTPA 5IQHA 4PPAA 2NP8A 2YDKA 3FHRA 1BLXA 3EN5A 4CFNA 3KF7A 3EQPA 3VN9A 4L01A 4XG2A 3PYYA 4BL1A 3KU2A 2B9JA 1KV2A 3TDVA 1XKKA 2EB3A 3CLYA 3HEGA 5KZIA 5HTIA 1OL5A 3MSSA 1VZOA 1YHSA 1YVJA 5ETIA 1TFFA 4E73A 3O7LD 4L9IA 3UZRA 3HRFA 1CM8A 5EM6A 3TUBA 5HE0A 4YURA 1OUKA 3LQ5A 3KGAA 3PWYA 3VVHA 3VNTA 1X8BA 2BAJA 2PZ5A 5KHXA 4C3PA 1NT2A 4QEBA 2QOKA 4L67A 4HYSA 5DOSA 5A9UA 4YP8A 3RALA 1H26A 2UW9A 4XG3A 2A2AA 4RJ3A 5EH0A 4EOJA 4X3JA 4NM3A 1DI8A 3M2WA 3FSFA 1Q24A 1A06A 3BGPA 4QYHA 3E3PA 4AT4A 2YEXA 5L4QA 4JG6A 3WF7A 5AWMA 4Y95A 1AQ1A 2XRUA 4KA3A 5LJJA 3ORXA 4XV3A 2BZKB 2CSNA 3I1AA 1XH9A 2JFMA 1CKPA 3UMXA 3NYVA 3E87A 3POZA 3RVGA 3ATTA 3E62A 3UYTA 4YC3A 4KUJA 4M97A 4RWIA 2FO0A 2YLFA 4DFNA 4RA5A 2C5XA 2WZJA 5FEEA 4FV8A 4DH7A 3HP5A 5EFQA 1JQHA 2IZUA 4V0GA 2OICA 2OH0E 2YHVA 5EYMA 1PXIA 5TT7A 3TT0A 1Y91A 3OEZA 4FTAA 4JNWA 4KKEA 3R2YA 4GYGA 3ZYAA 4X7QA 4HVHA 3P78A 2PE2A 3OOGA 1H1SA 5BUJA 4C58A 2J50A 2JBPA 5CEMA 3LQ3A 3TNHA 3QCYA 3FL5A 4FEVA 4O4EA 2UW0A 5BVKA 2YM6A 3ZM4A 3ZC5A 1UNHA 4O0UA 4TW9A 2XP2A 4FTTA 4IM3A 4B4LA 4L53A 4R3RA 5IQFA 5HNBA 4IJ9A 4AXDA 4LRKA 5EI8A 3L9PA 2P2IA 4WG3A 1REKA 1PF8A 5LCKA 1LEWA 4ARKA 3QUPA 4ONAA 3SRVB 2YJSA 4XG7A 3U8WA 2OU7A 2XJ0A 3EYHA 3MY0A 4L3JA 3THBA 4Y46A 4G6LA 5IMXA 3U55A 4BKZA 4ASXA 5J7BA 4GRBA 5FG8A 5T68A 3F3TA 4IZAA 3R8LA 3UP2A 4IDTA 2X8DA 5EKNA 5C03A 5ICPA 4NIFB 4IX4A 4JIKA 4RZVA 2ITPA 4MNFA 2O64A 5ETCA 4X2NA 5KHWA 3NUNA 5FXRA 3UO5A 3IOKA 4EKLA 5IF1A 3NNVA 3NX8A 4YTIA 4ITHA 4XP3A 2RGPA 3Q2JA 4AGDA 4HVSA 2VTPA 4RX7A 3R6XA 2XIYA 4QMUA 5I0BA 1ERKA 4LGHA 2W99B 2QOOA 3VF9A 4EZ5A 2CMWA 4JAJA 3UC3A 5J5TA 3DT1A 3QWKA 2F7XE 4E4LA 5K4JA 5M4CA 3A2CA 4MVFA 3D0EA 3ORTA 2Z7RA 2ZAZA 5HEZA 3TN8A 4Q9ZA 4M15A 2CGUA 5B2MA 3GU8A 4E4NA 3L1SA 5AUYA 3FI3A 3DKOA 3WI6A 2HZ4A 1I09A 3ZRLA 4DH5A 2YIWA 4U8ZA 3UYSA 3W33A 4F7SA 3PP0A 2R3OA 3GFWA 1FINA 2ZDTA 3D7TA 3GOKA 1JOWB 3U54A 5CU6A 4TRLA 3EZRA 3BCEA 3R28A 4B7TA 2CCIA 4J8MA 3K2LA 3BGQA 3K54A 1A9UA 3AD4A 3C0HA 5CQWA 1Y6BA 5EOBA 4DC2A 3S0OA 3SLSA 3TCPA 3HRCA 3L8VA 5E1EA 4CTCA 4BJJA 3DBDA 3F3UA 4GS6A 4RFZA 3SG9A 3RP9A 3W2QA 3ENMA 4APPA 3PDTA 1GOLA 2X8IA 5CEIA 1LEZA 1CMKE 4PPCA 3TJDA 3R9HA 3R7OA 1SYKA 2GTMA 5GNKA 2R7IA 3DLSA 5CAVA 2Y0AA 3GU5A 4Y5HA 4RLLA 4DHJA 1URWA 3S1HA 2FYSA 5GINE 2J51A 4YSJA 3QTQA 1H01A 4S33A 3D94A 3V5LA 3VUIA 4GIHA 3QQLA 1TQMA 4V0GB 3EQGA 1YKRA 2VTNA 1OBGA 4QO9A 4CFFA 4XLIA 4E5WA 2UW5A 2QURA 4PNIA 3KCKA 4LOQA 5AR7A 1M2PA 5JFWA 5BUIA 2IJMA 3FXWA 2O8YA 3OY1A 2XANA 4J97A 4FZ7A 3F7WA 3FI2A 4YJSA 3VS3A 3BYMA 3PJ3A 1UWJA 2AC5A 1J1BA 5HU3A 4Q5HA 3KKVA 3TIZA 2B53A 5LXMA 5HZNA 4AXFA 2E9OA 4H3BA 4ZY6A 2WOTA 3LCOA 4X3FC 2I40A 3TKIA 4D4RA 5DI1A 5HICA 3P7CA 3VF8A 1YWRA 4BYIA 4WO5A 4FVPA 1CTPE 4F0GA 1P5EA 4BCNA 5E9EA 2VGOA 3NUSA 2YCSA 5ACBC 2F9GA 3ZDUA 3PVBA 3NNXA 3M42A 4D58A 3LE6A 2JFLA 4ZJVA 4D4YA 4E6DA 2UW4A 4B8MA 3LFBA 4J96A 3VAPA 4DHIB 1OI9A 4P5ZA 5E90A 2NPQA 4JBPA 3CE3A 3TXOA 3HAMA 3DJ5A 2QOFA 4KBCA 2BIYA 4BR3A 1WVXA 4OTRA 3GOPA 4PV0A 2KTYA 3IKAA 4TWOA 4X2KA 4BDKA 4GFOA 1OBDA 4IWQA 5KMNA 4LRMA 3FHIA 5JT2A 3V5JA 4GL9A 4M67A 3ZTXA 4U6RA 4QMSA 5JRSA 5C27A 1U54A 5E8SA 4S30A 4ZJJA 4Z9LA 2YCFA 4EOPA 5JGAA 3WZUA 4E26A 1SVGA 4FNYA 5D7AA 4NKAA 3KF4A 2W0JA 2GNLA 2W96B 4Y5QA 4IBMA 1H1PA 1PJKA 3P5JC 4YLJA 3D7TB 4BDDA 4MH7A 4JBVA 3AC2A 5G6VA 3UO4A 4DGGA 4E6CA 3QRJA 3L9NA 4FOBA 4FEXA 4JDKA 4YR8A 4NM7A 3Q4TA 3QYZA 3BL7A 3DBFA 2OO8X 3V8WA 5JGBA 5EOLA 3K3IA 3OTUA 2E9VA 4FT0A 4LV5A 3JYAA 4IMYA 5CEQA 1U59A 3WF8A 3W0MA 4BJJB 2C5OA 4ALVA 3DK6A 1O6YA 5TKDA 1YXXA 2XBJA 3O23A 4ZTSA 4P4CA 3OWLA 4GUBA 3SQQA 4YU2A 3LXKA 3ALOA 3Q3BA 1F0QA 3D9VA 3R9RA 4EYMA 3QD2B 4QTEA 2RKUA 4W4YA 3R30A 2F2CB 4DT9A 4G5JA 3LJ1A 4FT5A 3ZSHA 3HUCA 4YZCA 1TKIA 3QU0A 4M84A 2X6DA 4CXAA 2JITA 2C30A 3UIXA 4FG8A 4ENYA 4NW5A 4RC4A 3O5AA 4OT6A 3PY0A 5HX6A 3O0GA 1YDRE 3W0QA 5CF4A 3VUKA 3VULA 4ASDA 4OBPA 2DS1A 3UGCA 3SG8A 3GB2A 3B2TA 2I0YA 3PIZA 3RK9A 1ND4A 2YZAA 3P0MA 4DG2E 3VW6A 3VW8A 4XJ0A 3LVPA 4NU1A 2V0DA 4LM5A 4TXCA 3NAXA 4FKOA 4YHFA 5A4TA 3K5VA 4Z3VA 3CXWA 3PE2A 4OR5A 5CF6A 2IVVA 1W82A 2WIPA 2R3FA 4KBAA 4QYFA 4TN6A 3RWQA 3E93A 3OXZA 2NYAA 1YHVA 3LXPA 2V7AA 3PY1A 5FTOA 4DGMA 4UXLA 2O0UA 3HECA 5AP5A 2IVSA 2A19B 3I7BA 4QD6A 3QLGA 3R9OA 2YACA 3Q96A 5E8YA 4A9RA 2WMQA 4I24A 1PXJA 3BE9A 4PWNA 2VWUA 2ITQA 2C5VA 5AMNA 2P3GX 3Q5IA 4MCVA 2IZTA 2R0UA 4R3PA 4CD0A 3CY2A 5EDQA 2JD5A 2XARA 4EOKA 2F7EE 3TV4A 4O96A 5HVKA 3PJ8A 3PPZA 1U4DA 1VYZA 4FNXA 4NZWB 2VTIA 3CJFA 4HGSA 4FZFB 5DA3A 4IWOA 2F2UA 4JDHA 2CKOA 5LVMA 2UW6A 2RG6A 5T3QA 3S4QA 1U54B 3Q4CA 4N6ZA 4Y72A 2A27A 2X0OA 3TTIA 4AW2A 4RJ8A 3F5XA 4FV0A 3LMIA 4EHGA 4GK3A 1NY3A 2JKQA 3CQUA 4C3FA 1WBWA 3TV7A 2VX3A 4C2WA 2B52A 3G90X 4X6RA 5JN2A 1ZYDA 3ZBFA 2IW6A 3PJ2A 1HOWA 5EM7A 4ACMA 4C02A 4O84A 4AA4A 3LJ0A 5C8NA 2YAKA 4G16A 1Q8TA 2EB2A 4PL3A 3PP1A 4BI2A 4A4OA 2Z60A 4YPDA 3NNWA 3VS0A 1QPDA 4U0IA 5DRBA 4KSPA 3QTRA 2C5YA 5E91A 4FKGA 4GW8A 2PTKA 4WRSA 5D41A 3B8RA 5EDPA 2UZEA 3UO6A 4GK4A 4BI1A 4CRSA 1WVWA 3OT8A 3CEKA 5BYYA 2ZJWA 2J7TA 3OT3A 4I6QA 1OKZA 3L9LA 3VS5A 4I94A 1T46A 4ERWA 4QDEA 4I0SA 1SVHA 2OF4A 4ERKA 5LMBA 4EOMA 4BDJA 3PVWA 4E5AX 2BFXA 4UZDA 4HYIA 3MWUA 5HORA 2W7XA 5BVWA 4DTAA 1UWHA 5KO1A 2A1AB 1KOAA 2Z7QA 4D28A 3FKOA 5F1ZA 5HIBA 4UX9A 3G6HA 2RFNA 1W84A 5KE0A 3SD0A 5C8KA 5BYLA