3VIVA

1510-n membrane-bound stomatin-specific protease k138a mutant in complex with a substrate peptide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
219
structure length
219
Chain Sequence
b'LAKNIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRPILGYSQNGSIIEAPPAITNYFIAYIKSLAQESGRNATIAEEFITKDLSLTPEEALKYGVIEVVARDINELLKKSNGMKTKIPVNGRYVTLNFTNVEVRYLAPSFKDKLISYITDL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 441aa long hypothetical nfeD protein
publication title Crystal structure of a membrane stomatin-specific protease in complex with a substrate Peptide
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase/protein binding
total genus 82
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3vivA00
4WCZA 1K32A 3FDUA 3QXZA 3U9RB 1FC9A 4KWBA 5MGBA 5INGA 5E0SA 2ZL3A 3QREA 4WYOB 4EMLA 3QK8A 4L6WA 1HNOA 3TLFA 3TVUA 4MOUA 3ZWBA 4ZU2A 3TZ3A 1XNVA 4KNPA 3L3SA 2ZQQA 4LK5A 1Q51A 3R0OA 2C8TA 2Q34A 1WZ8A 2EJ5A 1PIXA 4Q1IA 3H0UA 4FNDA 3KTKA 4U19A 3H02A 4F47A 1HNUA 4IZDA 2VSSA 3ZWCA 3LAOA 3NJDA 5DZKH 3Q0GA 1EF8A 3ZW8A 4JSBA 1SZOA 3Q7HA 2ZL4A 5DZKA 3GF7A 4JCRA 4QIJA 3BF0A 4I42A 3R9SA 2ZQRA 2J5IA 1J7XA 3H0SA 3IBBA 4IZBA 3G64A 4U0GH 1FC7A 3PZKA 5DU8A 1FCFA 3MFMA 2J5SA 2ZL0A 4ZDBA 5DL1A 4NNQA 4HC8A 2IEXA 4U0GA 2GTRA 3K8XA 2FW2A 3NJBA 3STAA 3KTJA 1RJNA 3GKBA 3RSIA 3TT7A 1Q52A 3KTHA 4OMRA 3R6HA 5INIA 1FC6A 3P85A 1OD2A 3MOYA 3DJAA 1XNWA 5INFA 5G1QA 3TV5A 1TYFA 3QKAA 2PPYA 4KD6A 3ST9A 3MYBA 5JBWA 4FZWA 1SG4A 3T8AA 3HINA 5IKLB 1NZYB 1TG6A 1EY3A 3P2LA 2Q35A 1X0UA 2VSUF 3ZWAA 4QIIA 5CTCA 2HW5A 3QXIA 5DU6A 3QMJA 1JXZA 4OLQA 3SLLA 3WG5A 3N6RB 3PE8A 3TVWA 3ZW9A 5FIFA 3BPPA 3R9QA 4GM2A 4B3JA 4FZWC 2A7KA 4JVTA 5DU4A 1WDMA 4I4ZA 4QFEA 2NP9A 4K3WA 3OMEA 3T88A 4ZDCA 2F9YB 4JOTA 2X24A 4ELSA 2VREA 2FZSA 3K50A 3VIVA 4JYJA 4GHNA 1UYTA 2FBMA 1PJHA 2VSUE 1K39A 4G2RA 1O8UA 4B3HA 2A81A 4RYFH 3TRRA 5DUCA 3T3WA 2J5GA 1N6DA 2X58A 1UYVA 3FF6A 1EF9A 3I47A 4MI2A 4L8KA 4FB8A 4RYFA 3KTGA 4ZDDA 4JCSA 5E0NX 5KDRA 3KQFA 4Z0MA 3H81A 3Q0JA 3JU1A 1NZYA 4U0HA 1N6EA 1YG6A 2J5II 2A7SA 3IAVA 1Y7OA 5DTPA 3OT6A 4EMPA 4IZCA 3LKEA 3GMAA 3RSTA 4OG1A 5DUFA 4JCQA 3RRVA 2D3TA 3U9SB 2VX2A 1ON3A 1DUBA 3PGQA 5KDRB 2VSUA 5JBXA 4HNKA 2F6QA 3SWXA 3M6MA 4JYLA 2W3PA 3OC7A 4U1AA 5G1RA 4MXIA 4FN8A 5DKPA 2WTBA 3Q1TA 2F9YA 4ELWA 2CBYA 1WDKA 4NEKA 4JCTA 2F9IA 1UYRA 3H0QA 3H0JA 1XX4A 3TDCA 4DI1A 3V5EA 3M6NA 3GF3A 5G1SA 3U9TB 3HP0A 3PEAA 2VSUC 3ISAA 3KTIA 1WDLA 1XNYA 1RJMA 3HLN1 2PBPA 4K29A 3IB9A 3HE2A 4KPKA 3BEZA 2J5GD 4RCNA 3HRXA 2F9IB 4Q0GA 1DCIA 1VRGA 3V5IA 4FNBA 5KJPA 1YG8A 5CTBA 3T89A 4ZDEA 2CE3A 4EMMA 2DEOA 3GLMA 1HZDA 1UIYA 3MT6A 3TT6A 3R9TA 5FUSA 3DORA 5DTWA 4ZDFA 4I52A 5C90A 3T8BA 4JFCA 1N6FA 1OD4A 2VSSF 4K2NA 4B3IA 2Q2XA 5C9GA 2QQ3A 2DUBA 4FJWD 2UZFA 2BZRA 4JWVA 4JJTA 2ZL2A 4WZ8B 1UYSA 3P5MA 1MJ3A 4FN7A 4ELXA 4YLHA 1ON9A 1XO6A 1W2XA 4ASIA 2J5IB 4U18A 2F6IA 2PG8A 3QWDA 3QYRA 2VSSE 5E0SH
chains in the Genus database with same CATH superfamily
4WCZA 1K32A 3FDUA 3QXZA 3U9RB 1FC9A 4KWBA 5MGBA 5INGA 5E0SA 2ZL3A 3QREA 4WYOB 4EMLA 3QK8A 4L6WA 1HNOA 3TLFA 3TVUA 4MOUA 3ZWBA 4ZU2A 3TZ3A 1XNVA 4KNPA 3L3SA 2ZQQA 4LK5A 1Q51A 3R0OA 2C8TA 2Q34A 1WZ8A 2EJ5A 1PIXA 4Q1IA 3H0UA 4FNDA 4NARA 3KTKA 4U19A 3H02A 4F47A 1HNUA 4IZDA 2VSSA 3ZWCA 3LAOA 3NJDA 5DZKH 3Q0GA 1EF8A 3ZW8A 4JSBA 1SZOA 3Q7HA 2ZL4A 5DZKA 3GF7A 4J2UA 4JCRA 4QIJA 3BF0A 4I42A 3R9SA 2ZQRA 2J5IA 1J7XA 3H0SA 3IBBA 4IZBA 3G64A 4U0GH 1FC7A 3PZKA 5DU8A 1FCFA 3MFMA 2J5SA 3BPTA 2ZL0A 4ZDBA 5DL1A 4NNQA 4HC8A 2IEXA 4U0GA 2GTRA 3K8XA 2FW2A 3NJBA 3STAA 3KTJA 1RJNA 3GKBA 3RSIA 3TT7A 1Q52A 3KTHA 4OMRA 3R6HA 5INIA 1FC6A 3P85A 1OD2A 3MOYA 3DJAA 1XNWA 5INFA 5G1QA 3TV5A 1TYFA 3QKAA 2PPYA 4KD6A 3ST9A 3MYBA 5JBWA 4FZWA 1SG4A 3T8AA 3HINA 5IKLB 1NZYB 1TG6A 1EY3A 3P2LA 2Q35A 1X0UA 2VSUF 4HDTA 3ZWAA 4QIIA 5CTCA 2HW5A 3QXIA 5DU6A 3QMJA 1JXZA 4OLQA 3SLLA 3WG5A 3N6RB 3PE8A 3TVWA 3ZW9A 5FIFA 3BPPA 3R9QA 4GM2A 4B3JA 4FZWC 2A7KA 4JVTA 5DU4A 1WDMA 4I4ZA 4QFEA 2NP9A 4K3WA 3OMEA 3T88A 4ZDCA 2F9YB 4JOTA 2X24A 4ELSA 2VREA 2FZSA 3K50A 3VIVA 4JYJA 4GHNA 1UYTA 2FBMA 1PJHA 2VSUE 1K39A 4G2RA 1O8UA 4B3HA 2A81A 4RYFH 3TRRA 5DUCA 3T3WA 2J5GA 1N6DA 2X58A 1UYVA 5HUQA 3FF6A 1EF9A 3I47A 4MI2A 4L8KA 4FB8A 4RYFA 3KTGA 4ZDDA 4JCSA 5E0NX 5KDRA 3KQFA 4Z0MA 3H81A 3Q0JA 3JU1A 1NZYA 4U0HA 1N6EA 1YG6A 2J5II 2A7SA 3IAVA 1Y7OA 5DTPA 3OT6A 4EMPA 4IZCA 3LKEA 3GMAA 3RSTA 4OG1A 5DUFA 4JCQA 3RRVA 2D3TA 3U9SB 2VX2A 1ON3A 1DUBA 3PGQA 5KDRB 2VSUA 5JBXA 4HNKA 2F6QA 3SWXA 3M6MA 4JYLA 2W3PA 3OC7A 4U1AA 5G1RA 4MXIA 4FN8A 5DKPA 2WTBA 3Q1TA 2F9YA 4ELWA 2CBYA 1WDKA 4NEKA 4JCTA 2F9IA 1UYRA 3H0QA 3H0JA 1XX4A 3TDCA 4DI1A 3V5EA 3M6NA 3GF3A 5G1SA 3U9TB 3HP0A 3PEAA 2VSUC 3ISAA 3KTIA 1WDLA 1XNYA 1RJMA 3HLN1 2PBPA 4K29A 3IB9A 3HE2A 4KPKA 3BEZA 2J5GD 4RCNA 3HRXA 2F9IB 4Q0GA 1DCIA 1VRGA 3V5IA 4FNBA 5KJPA 1YG8A 5CTBA 2YJGA 3T89A 4ZDEA 2CE3A 4EMMA 2DEOA 3GLMA 1HZDA 1UIYA 3MT6A 3TT6A 3R9TA 5FUSA 3DORA 5DTWA 4ZDFA 4I52A 5C90A 3T8BA 4JFCA 1N6FA 1OD4A 2VSSF 4K2NA 4B3IA 2Q2XA 5C9GA 2QQ3A 2DUBA 4FJWD 2UZFA 2BZRA 4JWVA 4JJTA 2ZL2A 4WZ8B 1UYSA 3P5MA 1MJ3A 4FN7A 4ELXA 4YLHA 1ON9A 1XO6A 1W2XA 4ASIA 2J5IB 4U18A 2F6IA 2PG8A 3QWDA 3QYRA 2VSSE 5E0SH
chains in the Genus database with same CATH topology
4WCZA 1K32A 3FDUA 3QXZA 3U9RB 1FC9A 4KWBA 5MGBA 5INGA 5E0SA 2ZL3A 3QREA 4WYOB 4EMLA 3QK8A 4L6WA 1HNOA 3TLFA 3TVUA 4MOUA 3ZWBA 4ZU2A 3TZ3A 1XNVA 4KNPA 3L3SA 2ZQQA 4LK5A 1Q51A 3R0OA 2C8TA 2Q34A 1WZ8A 2EJ5A 1PIXA 4Q1IA 3H0UA 4FNDA 4NARA 3KTKA 4U19A 3H02A 4F47A 1HNUA 4IZDA 2VSSA 3ZWCA 3LAOA 3NJDA 5DZKH 3Q0GA 1EF8A 3ZW8A 4JSBA 1SZOA 3Q7HA 2ZL4A 5DZKA 3GF7A 4J2UA 4JCRA 4QIJA 3BF0A 4I42A 3R9SA 2ZQRA 2J5IA 1J7XA 3H0SA 3IBBA 4IZBA 3G64A 4U0GH 1FC7A 3PZKA 5DU8A 1FCFA 3MFMA 2J5SA 3BPTA 2ZL0A 4ZDBA 5DL1A 4NNQA 4HC8A 2IEXA 4U0GA 2GTRA 3K8XA 2FW2A 3NJBA 3STAA 3KTJA 1RJNA 3GKBA 3RSIA 3TT7A 1Q52A 3KTHA 4OMRA 3R6HA 5INIA 1FC6A 3P85A 1OD2A 3MOYA 3DJAA 1XNWA 5INFA 5G1QA 3TV5A 1TYFA 3QKAA 2PPYA 4KD6A 3ST9A 3MYBA 5JBWA 4FZWA 1SG4A 3T8AA 3HINA 5IKLB 1NZYB 1TG6A 1EY3A 3P2LA 2Q35A 1X0UA 2VSUF 4HDTA 3ZWAA 4QIIA 5CTCA 2HW5A 3QXIA 5DU6A 3QMJA 1JXZA 4OLQA 3SLLA 3WG5A 3N6RB 3PE8A 3TVWA 3ZW9A 5FIFA 3BPPA 3R9QA 4GM2A 4B3JA 4FZWC 2A7KA 4JVTA 5DU4A 1WDMA 4I4ZA 4QFEA 2NP9A 4K3WA 3OMEA 3T88A 4ZDCA 2F9YB 4JOTA 2X24A 4ELSA 2VREA 2FZSA 3K50A 3VIVA 4JYJA 4GHNA 1UYTA 2FBMA 1PJHA 2VSUE 1K39A 4G2RA 1O8UA 4B3HA 2A81A 4RYFH 3TRRA 5DUCA 3T3WA 2J5GA 1N6DA 2X58A 1UYVA 5HUQA 3FF6A 1EF9A 3I47A 4MI2A 4L8KA 4FB8A 4RYFA 3KTGA 4ZDDA 4JCSA 5E0NX 5KDRA 3KQFA 4Z0MA 3H81A 3Q0JA 3JU1A 1NZYA 4U0HA 1N6EA 1YG6A 2J5II 2A7SA 3IAVA 1Y7OA 5DTPA 3OT6A 4EMPA 4IZCA 3LKEA 3GMAA 3RSTA 4OG1A 5DUFA 4JCQA 3RRVA 2D3TA 3U9SB 2VX2A 1ON3A 1DUBA 3PGQA 5KDRB 2VSUA 5JBXA 4HNKA 2F6QA 3SWXA 3M6MA 4JYLA 2W3PA 3OC7A 4U1AA 5G1RA 4MXIA 4FN8A 5DKPA 2WTBA 3Q1TA 2F9YA 4ELWA 2CBYA 1WDKA 4NEKA 4JCTA 2F9IA 1UYRA 3H0QA 3H0JA 1XX4A 3TDCA 4DI1A 3V5EA 3M6NA 3GF3A 5G1SA 3U9TB 3HP0A 3PEAA 2VSUC 3ISAA 3KTIA 1WDLA 1XNYA 1RJMA 3HLN1 2PBPA 4K29A 3IB9A 3HE2A 4KPKA 3BEZA 2J5GD 4RCNA 3HRXA 2F9IB 4Q0GA 1DCIA 1VRGA 3V5IA 4FNBA 5KJPA 1YG8A 5CTBA 2YJGA 3T89A 4ZDEA 2CE3A 4EMMA 2DEOA 3GLMA 1HZDA 1UIYA 3MT6A 3TT6A 3R9TA 5FUSA 3DORA 5DTWA 4ZDFA 4I52A 5C90A 3T8BA 4JFCA 1N6FA 1OD4A 2VSSF 4K2NA 4B3IA 2Q2XA 5C9GA 2QQ3A 2DUBA 4FJWD 2UZFA 2BZRA 4JWVA 4JJTA 2ZL2A 4WZ8B 1UYSA 3P5MA 1MJ3A 4FN7A 4ELXA 4YLHA 1ON9A 1XO6A 1W2XA 4ASIA 2J5IB 4U18A 2F6IA 2PG8A 3QWDA 3QYRA 2VSSE 5E0SH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WCZ A;  1K32 A;  3FDU A;  3QXZ A;  3U9R B;  1FC9 A;  4KWB A;  5MGB A;  5ING A;  5E0S A;  2ZL3 A;  3QRE A;  4WYO B;  4EML A;  3QK8 A;  4L6W A;  1HNO A;  3TLF A;  3TVU A;  4MOU A;  3ZWB A;  4ZU2 A;  3TZ3 A;  1XNV A;  4KNP A;  3L3S A;  2ZQQ A;  4LK5 A;  1Q51 A;  3R0O A;  2C8T A;  2Q34 A;  1WZ8 A;  2EJ5 A;  1PIX A;  4Q1I A;  3H0U A;  4FND A;  3KTK A;  4U19 A;  3H02 A;  4F47 A;  1HNU A;  4IZD A;  2VSS A;  3ZWC A;  3LAO A;  3NJD A;  5DZK H;  3Q0G A;  1EF8 A;  3ZW8 A;  4JSB A;  1SZO A;  3Q7H A;  2ZL4 A;  5DZK A;  3GF7 A;  4JCR A;  4QIJ A;  3BF0 A;  4I42 A;  3R9S A;  2ZQR A;  2J5I A;  1J7X A;  3H0S A;  3IBB A;  4IZB A;  3G64 A;  4U0G H;  1FC7 A;  3PZK A;  5DU8 A;  1FCF A;  3MFM A;  2J5S A;  2ZL0 A;  4ZDB A;  5DL1 A;  4NNQ A;  4HC8 A;  2IEX A;  4U0G A;  2GTR A;  3K8X A;  2FW2 A;  3NJB A;  3STA A;  3KTJ A;  1RJN A;  3GKB A;  3RSI A;  3TT7 A;  1Q52 A;  3KTH A;  4OMR A;  3R6H A;  5INI A;  1FC6 A;  3P85 A;  1OD2 A;  3MOY A;  3DJA A;  1XNW A;  5INF A;  5G1Q A;  3TV5 A;  1TYF A;  3QKA A;  2PPY A;  4KD6 A;  3ST9 A;  3MYB A;  5JBW A;  4FZW A;  1SG4 A;  3T8A A;  3HIN A;  5IKL B;  1NZY B;  1TG6 A;  1EY3 A;  3P2L A;  2Q35 A;  1X0U A;  2VSU F;  3ZWA A;  4QII A;  5CTC A;  2HW5 A;  3QXI A;  5DU6 A;  3QMJ A;  1JXZ A;  4OLQ A;  3SLL A;  3WG5 A;  3N6R B;  3PE8 A;  3TVW A;  3ZW9 A;  5FIF A;  3BPP A;  3R9Q A;  4GM2 A;  4B3J A;  4FZW C;  2A7K A;  4JVT A;  5DU4 A;  1WDM A;  4I4Z A;  4QFE A;  2NP9 A;  4K3W A;  3OME A;  3T88 A;  4ZDC A;  2F9Y B;  4JOT A;  2X24 A;  4ELS A;  2VRE A;  2FZS A;  3K50 A;  3VIV A;  4JYJ A;  4GHN A;  1UYT A;  2FBM A;  1PJH A;  2VSU E;  1K39 A;  4G2R A;  1O8U A;  4B3H A;  2A81 A;  4RYF H;  3TRR A;  5DUC A;  3T3W A;  2J5G A;  1N6D A;  2X58 A;  1UYV A;  3FF6 A;  1EF9 A;  3I47 A;  4MI2 A;  4L8K A;  4FB8 A;  4RYF A;  3KTG A;  4ZDD A;  4JCS A;  5E0N X;  5KDR A;  3KQF A;  4Z0M A;  3H81 A;  3Q0J A;  3JU1 A;  1NZY A;  4U0H A;  1N6E A;  1YG6 A;  2J5I I;  2A7S A;  3IAV A;  1Y7O A;  5DTP A;  3OT6 A;  4EMP A;  4IZC A;  3LKE A;  3GMA A;  3RST A;  4OG1 A;  5DUF A;  4JCQ A;  3RRV A;  2D3T A;  3U9S B;  2VX2 A;  1ON3 A;  1DUB A;  3PGQ A;  5KDR B;  2VSU A;  5JBX A;  4HNK A;  2F6Q A;  3SWX A;  3M6M A;  4JYL A;  2W3P A;  3OC7 A;  4U1A A;  5G1R A;  4MXI A;  4FN8 A;  5DKP A;  2WTB A;  3Q1T A;  2F9Y A;  4ELW A;  2CBY A;  1WDK A;  4NEK A;  4JCT A;  2F9I A;  1UYR A;  3H0Q A;  3H0J A;  1XX4 A;  3TDC A;  4DI1 A;  3V5E A;  3M6N A;  3GF3 A;  5G1S A;  3U9T B;  3HP0 A;  3PEA A;  2VSU C;  3ISA A;  3KTI A;  1WDL A;  1XNY A;  1RJM A;  3HLN 1;  2PBP A;  4K29 A;  3IB9 A;  3HE2 A;  4KPK A;  3BEZ A;  2J5G D;  4RCN A;  3HRX A;  2F9I B;  4Q0G A;  1DCI A;  1VRG A;  3V5I A;  4FNB A;  5KJP A;  1YG8 A;  5CTB A;  3T89 A;  4ZDE A;  2CE3 A;  4EMM A;  2DEO A;  3GLM A;  1HZD A;  1UIY A;  3MT6 A;  3TT6 A;  3R9T A;  5FUS A;  3DOR A;  5DTW A;  4ZDF A;  4I52 A;  5C90 A;  3T8B A;  4JFC A;  1N6F A;  1OD4 A;  2VSS F;  4K2N A;  4B3I A;  2Q2X A;  5C9G A;  2QQ3 A;  2DUB A;  4FJW D;  2UZF A;  2BZR A;  4JWV A;  4JJT A;  2ZL2 A;  4WZ8 B;  1UYS A;  3P5M A;  1MJ3 A;  4FN7 A;  4ELX A;  4YLH A;  1ON9 A;  1XO6 A;  1W2X A;  4ASI A;  2J5I B;  4U18 A;  2F6I A;  2PG8 A;  3QWD A;  3QYR A;  2VSS E;  5E0S H; 
#chains in the Genus database with same CATH topology
 4WCZ A;  1K32 A;  3FDU A;  3QXZ A;  3U9R B;  1FC9 A;  4KWB A;  5MGB A;  5ING A;  5E0S A;  2ZL3 A;  3QRE A;  4WYO B;  4EML A;  3QK8 A;  4L6W A;  1HNO A;  3TLF A;  3TVU A;  4MOU A;  3ZWB A;  4ZU2 A;  3TZ3 A;  1XNV A;  4KNP A;  3L3S A;  2ZQQ A;  4LK5 A;  1Q51 A;  3R0O A;  2C8T A;  2Q34 A;  1WZ8 A;  2EJ5 A;  1PIX A;  4Q1I A;  3H0U A;  4FND A;  4NAR A;  3KTK A;  4U19 A;  3H02 A;  4F47 A;  1HNU A;  4IZD A;  2VSS A;  3ZWC A;  3LAO A;  3NJD A;  5DZK H;  3Q0G A;  1EF8 A;  3ZW8 A;  4JSB A;  1SZO A;  3Q7H A;  2ZL4 A;  5DZK A;  3GF7 A;  4J2U A;  4JCR A;  4QIJ A;  3BF0 A;  4I42 A;  3R9S A;  2ZQR A;  2J5I A;  1J7X A;  3H0S A;  3IBB A;  4IZB A;  3G64 A;  4U0G H;  1FC7 A;  3PZK A;  5DU8 A;  1FCF A;  3MFM A;  2J5S A;  3BPT A;  2ZL0 A;  4ZDB A;  5DL1 A;  4NNQ A;  4HC8 A;  2IEX A;  4U0G A;  2GTR A;  3K8X A;  2FW2 A;  3NJB A;  3STA A;  3KTJ A;  1RJN A;  3GKB A;  3RSI A;  3TT7 A;  1Q52 A;  3KTH A;  4OMR A;  3R6H A;  5INI A;  1FC6 A;  3P85 A;  1OD2 A;  3MOY A;  3DJA A;  1XNW A;  5INF A;  5G1Q A;  3TV5 A;  1TYF A;  3QKA A;  2PPY A;  4KD6 A;  3ST9 A;  3MYB A;  5JBW A;  4FZW A;  1SG4 A;  3T8A A;  3HIN A;  5IKL B;  1NZY B;  1TG6 A;  1EY3 A;  3P2L A;  2Q35 A;  1X0U A;  2VSU F;  4HDT A;  3ZWA A;  4QII A;  5CTC A;  2HW5 A;  3QXI A;  5DU6 A;  3QMJ A;  1JXZ A;  4OLQ A;  3SLL A;  3WG5 A;  3N6R B;  3PE8 A;  3TVW A;  3ZW9 A;  5FIF A;  3BPP A;  3R9Q A;  4GM2 A;  4B3J A;  4FZW C;  2A7K A;  4JVT A;  5DU4 A;  1WDM A;  4I4Z A;  4QFE A;  2NP9 A;  4K3W A;  3OME A;  3T88 A;  4ZDC A;  2F9Y B;  4JOT A;  2X24 A;  4ELS A;  2VRE A;  2FZS A;  3K50 A;  3VIV A;  4JYJ A;  4GHN A;  1UYT A;  2FBM A;  1PJH A;  2VSU E;  1K39 A;  4G2R A;  1O8U A;  4B3H A;  2A81 A;  4RYF H;  3TRR A;  5DUC A;  3T3W A;  2J5G A;  1N6D A;  2X58 A;  1UYV A;  5HUQ A;  3FF6 A;  1EF9 A;  3I47 A;  4MI2 A;  4L8K A;  4FB8 A;  4RYF A;  3KTG A;  4ZDD A;  4JCS A;  5E0N X;  5KDR A;  3KQF A;  4Z0M A;  3H81 A;  3Q0J A;  3JU1 A;  1NZY A;  4U0H A;  1N6E A;  1YG6 A;  2J5I I;  2A7S A;  3IAV A;  1Y7O A;  5DTP A;  3OT6 A;  4EMP A;  4IZC A;  3LKE A;  3GMA A;  3RST A;  4OG1 A;  5DUF A;  4JCQ A;  3RRV A;  2D3T A;  3U9S B;  2VX2 A;  1ON3 A;  1DUB A;  3PGQ A;  5KDR B;  2VSU A;  5JBX A;  4HNK A;  2F6Q A;  3SWX A;  3M6M A;  4JYL A;  2W3P A;  3OC7 A;  4U1A A;  5G1R A;  4MXI A;  4FN8 A;  5DKP A;  2WTB A;  3Q1T A;  2F9Y A;  4ELW A;  2CBY A;  1WDK A;  4NEK A;  4JCT A;  2F9I A;  1UYR A;  3H0Q A;  3H0J A;  1XX4 A;  3TDC A;  4DI1 A;  3V5E A;  3M6N A;  3GF3 A;  5G1S A;  3U9T B;  3HP0 A;  3PEA A;  2VSU C;  3ISA A;  3KTI A;  1WDL A;  1XNY A;  1RJM A;  3HLN 1;  2PBP A;  4K29 A;  3IB9 A;  3HE2 A;  4KPK A;  3BEZ A;  2J5G D;  4RCN A;  3HRX A;  2F9I B;  4Q0G A;  1DCI A;  1VRG A;  3V5I A;  4FNB A;  5KJP A;  1YG8 A;  5CTB A;  2YJG A;  3T89 A;  4ZDE A;  2CE3 A;  4EMM A;  2DEO A;  3GLM A;  1HZD A;  1UIY A;  3MT6 A;  3TT6 A;  3R9T A;  5FUS A;  3DOR A;  5DTW A;  4ZDF A;  4I52 A;  5C90 A;  3T8B A;  4JFC A;  1N6F A;  1OD4 A;  2VSS F;  4K2N A;  4B3I A;  2Q2X A;  5C9G A;  2QQ3 A;  2DUB A;  4FJW D;  2UZF A;  2BZR A;  4JWV A;  4JJT A;  2ZL2 A;  4WZ8 B;  1UYS A;  3P5M A;  1MJ3 A;  4FN7 A;  4ELX A;  4YLH A;  1ON9 A;  1XO6 A;  1W2X A;  4ASI A;  2J5I B;  4U18 A;  2F6I A;  2PG8 A;  3QWD A;  3QYR A;  2VSS E;  5E0S H; 
#chains in the Genus database with same CATH homology
 4WCZ A;  1K32 A;  3FDU A;  3QXZ A;  3U9R B;  1FC9 A;  4KWB A;  5MGB A;  5ING A;  5E0S A;  2ZL3 A;  3QRE A;  4WYO B;  4EML A;  3QK8 A;  4L6W A;  1HNO A;  3TLF A;  3TVU A;  4MOU A;  3ZWB A;  4ZU2 A;  3TZ3 A;  1XNV A;  4KNP A;  3L3S A;  2ZQQ A;  4LK5 A;  1Q51 A;  3R0O A;  2C8T A;  2Q34 A;  1WZ8 A;  2EJ5 A;  1PIX A;  4Q1I A;  3H0U A;  4FND A;  4NAR A;  3KTK A;  4U19 A;  3H02 A;  4F47 A;  1HNU A;  4IZD A;  2VSS A;  3ZWC A;  3LAO A;  3NJD A;  5DZK H;  3Q0G A;  1EF8 A;  3ZW8 A;  4JSB A;  1SZO A;  3Q7H A;  2ZL4 A;  5DZK A;  3GF7 A;  4J2U A;  4JCR A;  4QIJ A;  3BF0 A;  4I42 A;  3R9S A;  2ZQR A;  2J5I A;  1J7X A;  3H0S A;  3IBB A;  4IZB A;  3G64 A;  4U0G H;  1FC7 A;  3PZK A;  5DU8 A;  1FCF A;  3MFM A;  2J5S A;  3BPT A;  2ZL0 A;  4ZDB A;  5DL1 A;  4NNQ A;  4HC8 A;  2IEX A;  4U0G A;  2GTR A;  3K8X A;  2FW2 A;  3NJB A;  3STA A;  3KTJ A;  1RJN A;  3GKB A;  3RSI A;  3TT7 A;  1Q52 A;  3KTH A;  4OMR A;  3R6H A;  5INI A;  1FC6 A;  3P85 A;  1OD2 A;  3MOY A;  3DJA A;  1XNW A;  5INF A;  5G1Q A;  3TV5 A;  1TYF A;  3QKA A;  2PPY A;  4KD6 A;  3ST9 A;  3MYB A;  5JBW A;  4FZW A;  1SG4 A;  3T8A A;  3HIN A;  5IKL B;  1NZY B;  1TG6 A;  1EY3 A;  3P2L A;  2Q35 A;  1X0U A;  2VSU F;  4HDT A;  3ZWA A;  4QII A;  5CTC A;  2HW5 A;  3QXI A;  5DU6 A;  3QMJ A;  1JXZ A;  4OLQ A;  3SLL A;  3WG5 A;  3N6R B;  3PE8 A;  3TVW A;  3ZW9 A;  5FIF A;  3BPP A;  3R9Q A;  4GM2 A;  4B3J A;  4FZW C;  2A7K A;  4JVT A;  5DU4 A;  1WDM A;  4I4Z A;  4QFE A;  2NP9 A;  4K3W A;  3OME A;  3T88 A;  4ZDC A;  2F9Y B;  4JOT A;  2X24 A;  4ELS A;  2VRE A;  2FZS A;  3K50 A;  3VIV A;  4JYJ A;  4GHN A;  1UYT A;  2FBM A;  1PJH A;  2VSU E;  1K39 A;  4G2R A;  1O8U A;  4B3H A;  2A81 A;  4RYF H;  3TRR A;  5DUC A;  3T3W A;  2J5G A;  1N6D A;  2X58 A;  1UYV A;  5HUQ A;  3FF6 A;  1EF9 A;  3I47 A;  4MI2 A;  4L8K A;  4FB8 A;  4RYF A;  3KTG A;  4ZDD A;  4JCS A;  5E0N X;  5KDR A;  3KQF A;  4Z0M A;  3H81 A;  3Q0J A;  3JU1 A;  1NZY A;  4U0H A;  1N6E A;  1YG6 A;  2J5I I;  2A7S A;  3IAV A;  1Y7O A;  5DTP A;  3OT6 A;  4EMP A;  4IZC A;  3LKE A;  3GMA A;  3RST A;  4OG1 A;  5DUF A;  4JCQ A;  3RRV A;  2D3T A;  3U9S B;  2VX2 A;  1ON3 A;  1DUB A;  3PGQ A;  5KDR B;  2VSU A;  5JBX A;  4HNK A;  2F6Q A;  3SWX A;  3M6M A;  4JYL A;  2W3P A;  3OC7 A;  4U1A A;  5G1R A;  4MXI A;  4FN8 A;  5DKP A;  2WTB A;  3Q1T A;  2F9Y A;  4ELW A;  2CBY A;  1WDK A;  4NEK A;  4JCT A;  2F9I A;  1UYR A;  3H0Q A;  3H0J A;  1XX4 A;  3TDC A;  4DI1 A;  3V5E A;  3M6N A;  3GF3 A;  5G1S A;  3U9T B;  3HP0 A;  3PEA A;  2VSU C;  3ISA A;  3KTI A;  1WDL A;  1XNY A;  1RJM A;  3HLN 1;  2PBP A;  4K29 A;  3IB9 A;  3HE2 A;  4KPK A;  3BEZ A;  2J5G D;  4RCN A;  3HRX A;  2F9I B;  4Q0G A;  1DCI A;  1VRG A;  3V5I A;  4FNB A;  5KJP A;  1YG8 A;  5CTB A;  2YJG A;  3T89 A;  4ZDE A;  2CE3 A;  4EMM A;  2DEO A;  3GLM A;  1HZD A;  1UIY A;  3MT6 A;  3TT6 A;  3R9T A;  5FUS A;  3DOR A;  5DTW A;  4ZDF A;  4I52 A;  5C90 A;  3T8B A;  4JFC A;  1N6F A;  1OD4 A;  2VSS F;  4K2N A;  4B3I A;  2Q2X A;  5C9G A;  2QQ3 A;  2DUB A;  4FJW D;  2UZF A;  2BZR A;  4JWV A;  4JJT A;  2ZL2 A;  4WZ8 B;  1UYS A;  3P5M A;  1MJ3 A;  4FN7 A;  4ELX A;  4YLH A;  1ON9 A;  1XO6 A;  1W2X A;  4ASI A;  2J5I B;  4U18 A;  2F6I A;  2PG8 A;  3QWD A;  3QYR A;  2VSS E;  5E0S H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...