3VIVA

1510-n membrane-bound stomatin-specific protease k138a mutant in complex with a substrate peptide
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
219
structure length
219
Chain Sequence
LAKNIVYVAQIKGQITSYTYDQFDRYITIAEQDNAEAIIIELDTPGGRADAMMNIVQRIQQSKIPVIIYVYPPGASAASAGTYIALGSHLIAMAPGTSIGACRPILGYSQNGSIIEAPPAITNYFIAYIKSLAQESGRNATIAEEFITKDLSLTPEEALKYGVIEVVARDINELLKKSNGMKTKIPVNGRYVTLNFTNVEVRYLAPSFKDKLISYITDL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a membrane stomatin-specific protease in complex with a substrate Peptide
pubmed doi rcsb
source organism Pyrococcus horikoshii
molecule tags Hydrolase/protein binding
molecule keywords 441aa long hypothetical nfeD protein
total genus 82
structure length 219
sequence length 219
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 3vivA00
4LK5A 4JCSA 3H0SA 1NZYA 3H0QA 4KWBA 3H0UA 4WYOB 4JWVA 3WG5A 3TT6A 1EF9A 3MFMA 4MXIA 3M6MA 3PZKA 3KTHA 4ZDFA 2X58A 2ZL0A 3JU1A 1Q52A 4JVTA 3KTJA 4JCQA 4F47A 4KPKA 4JFCA 4GM2A 4Q0GA 4ELSA 3ST9A 2VX2A 4DI1A 4OG1A 1WZ8A 3PGQA 3H02A 1HNOA 3R0OA 5KJPA 2GTRA 5DZKH 4FJWD 3T3WA 5E0SA 3TVWA 2ZL2A 1ON3A 3IBBA 1ON9A 3HINA 1NZYB 2Q35A 1XNWA 4U19A 3ZW9A 4L8KA 4QFEA 3KTKA 5E0NX 1UIYA 1K32A 5DU6A 2VSUF 5KDRA 2C8TA 3ZWBA 4FNDA 4FZWC 3SWXA 5FIFA 1SG4A 3HE2A 3GLMA 3V5IA 5INGA 3RSTA 1XNYA 4OMRA 1UYTA 3QREA 5INFA 3BPPA 4IZDA 5DZKA 2VSSA 3SLLA 1WDLA 4WZ8B 1UYSA 1UYRA 2PPYA 1HZDA 4NEKA 3MT6A 5JBWA 5G1SA 4K3WA 3I47A 3OT6A 4B3HA 4NNQA 2FBMA 1MJ3A 2J5IA 5DU8A 3HRXA 3QWDA 2QQ3A 3TZ3A 3R9SA 1W2XA 3OMEA 4MI2A 1HNUA 4RCNA 4K2NA 3ISAA 3TV5A 4KNPA 1RJMA 3Q0GA 2VSUC 4IZCA 3TLFA 1VRGA 3P2LA 5CTBA 3PE8A 4HC8A 3PEAA 3T8BA 3HLN1 5DKPA 1N6FA 5FUSA 2F9IB 4HNKA 3U9RB 4Z0MA 3MOYA 3KTGA 1XNVA 4WCZA 2VSSE 2FW2A 2ZL3A 2ZQQA 3DJAA 4I52A 4JCTA 5INIA 4FZWA 3G64A 1FCFA 2J5GD 4EMPA 4YLHA 1O8UA 3ZW8A 4JCRA 2PBPA 3KTIA 2F9YA 2ZL4A 3MYBA 3GF3A 4U18A 2J5IB 1N6DA 5C90A 3R9QA 2CE3A 1J7XA 4ZDEA 2VSUE 2PG8A 4ZDDA 3RSIA 5DUCA 4EMMA 4MOUA 1RJNA 5E0SH 2Q34A 4U1AA 1UYVA 3H81A 1XO6A 3QK8A 5DU4A 4I4ZA 3KQFA 1TG6A 3N6RB 1PIXA 1EY3A 5DL1A 1Q51A 2W3PA 5C9GA 3GMAA 2F6IA 4ZDBA 2J5GA 3NJBA 3T88A 3U9SB 3T89A 4JYJA 3HP0A 4IZBA 3QXIA 3BF0A 4G2RA 2DEOA 3Q1TA 2F9IA 1WDMA 2VSUA 2X24A 2A7KA 3K8XA 4ZU2A 4KD6A 2CBYA 3IB9A 3V5EA 4QIIA 1DCIA 1YG6A 4FN7A 4B3IA 2IEXA 2VREA 2F9YB 2D3TA 3GF7A 4JYLA 1FC7A 1XX4A 3BEZA 4U0HA 1K39A 2F6QA 4ZDCA 2A81A 2EJ5A 4I42A 4L6WA 5DTPA 1OD4A 3LAOA 3T8AA 4Q1IA 4JJTA 3QKAA 3OC7A 5IKLB 5CTCA 3TRRA 4U0GA 4ELXA 5G1RA 2FZSA 3H0JA 4OLQA 4ELWA 4U0GH 3P85A 3M6NA 3TDCA 2J5II 3ZWCA 5MGBA 3Q0JA 4GHNA 4B3JA 1JXZA 4FNBA 1OD2A 2UZFA 3FF6A 5DTWA 2WTBA 3R9TA 1X0UA 4JOTA 3FDUA 4JSBA 3P5MA 3R6HA 3K50A 2DUBA 1TYFA 2BZRA 3GKBA 5DUFA 3QXZA 1FC9A 3TVUA 2VSSF 2A7SA 1PJHA 1EF8A 2HW5A 3QYRA 4ASIA 2Q2XA 1N6EA 3QMJA 2J5SA 4K29A 1FC6A 3NJDA 1Y7OA 3TT7A 3STAA 3DORA 1WDKA 1DUBA 4EMLA 3ZWAA 3U9TB 4FB8A 3IAVA 1YG8A 3VIVA 5G1QA 3L3SA 1SZOA 3LKEA 5KDRB 4RYFA 2NP9A 4QIJA 5JBXA 3Q7HA 2ZQRA 4FN8A 3RRVA 4RYFH
chains in the Genus database with same CATH superfamily
4LK5A 4JCSA 3H0SA 1NZYA 3H0QA 4KWBA 3H0UA 4WYOB 4JWVA 3WG5A 3TT6A 1EF9A 3MFMA 4MXIA 3M6MA 3PZKA 3KTHA 4ZDFA 2X58A 2ZL0A 3JU1A 1Q52A 4JVTA 3KTJA 4JCQA 4F47A 4KPKA 4JFCA 4GM2A 4Q0GA 4ELSA 3ST9A 2VX2A 4DI1A 4OG1A 1WZ8A 3PGQA 3H02A 1HNOA 3R0OA 5KJPA 2GTRA 5DZKH 4FJWD 3T3WA 5E0SA 3TVWA 2ZL2A 1ON3A 3IBBA 1ON9A 3HINA 5HUQA 1NZYB 2Q35A 1XNWA 4U19A 3ZW9A 4L8KA 4QFEA 3KTKA 5E0NX 1UIYA 1K32A 5DU6A 2VSUF 5KDRA 2C8TA 3ZWBA 4FNDA 4FZWC 3SWXA 5FIFA 1SG4A 3HE2A 3GLMA 3V5IA 5INGA 3RSTA 1XNYA 4OMRA 1UYTA 3QREA 5INFA 3BPPA 4IZDA 5DZKA 2VSSA 3SLLA 1WDLA 4WZ8B 1UYSA 1UYRA 2PPYA 1HZDA 4NEKA 4HDTA 3MT6A 5JBWA 5G1SA 4K3WA 3I47A 3OT6A 4B3HA 4NNQA 2FBMA 1MJ3A 2J5IA 5DU8A 3HRXA 3QWDA 2QQ3A 3TZ3A 3R9SA 3BPTA 1W2XA 3OMEA 4MI2A 1HNUA 4RCNA 4K2NA 3ISAA 3TV5A 4KNPA 1RJMA 3Q0GA 2VSUC 4IZCA 3TLFA 1VRGA 3P2LA 5CTBA 3PE8A 4HC8A 3PEAA 3T8BA 3HLN1 5DKPA 1N6FA 5FUSA 2F9IB 4HNKA 3U9RB 4Z0MA 3MOYA 3KTGA 1XNVA 4WCZA 2VSSE 2FW2A 2ZL3A 2ZQQA 3DJAA 4I52A 4JCTA 5INIA 4NARA 4FZWA 3G64A 1FCFA 2J5GD 4EMPA 4YLHA 1O8UA 3ZW8A 4JCRA 2PBPA 3KTIA 2F9YA 2ZL4A 3MYBA 3GF3A 4U18A 2J5IB 1N6DA 5C90A 3R9QA 2CE3A 1J7XA 4ZDEA 2VSUE 2PG8A 4ZDDA 3RSIA 2YJGA 5DUCA 4EMMA 4MOUA 1RJNA 5E0SH 2Q34A 4U1AA 1UYVA 3H81A 1XO6A 3QK8A 5DU4A 4I4ZA 3KQFA 1TG6A 3N6RB 1PIXA 1EY3A 5DL1A 1Q51A 2W3PA 5C9GA 3GMAA 2F6IA 4ZDBA 2J5GA 3NJBA 3T88A 3U9SB 3T89A 4JYJA 3HP0A 4IZBA 3QXIA 3BF0A 4G2RA 2DEOA 3Q1TA 2F9IA 1WDMA 2VSUA 2X24A 2A7KA 3K8XA 4ZU2A 4KD6A 2CBYA 3IB9A 3V5EA 4QIIA 1DCIA 1YG6A 4FN7A 4B3IA 2IEXA 2VREA 2F9YB 2D3TA 3GF7A 4JYLA 1FC7A 1XX4A 3BEZA 4U0HA 1K39A 2F6QA 4ZDCA 2A81A 2EJ5A 4I42A 4L6WA 5DTPA 1OD4A 3LAOA 3T8AA 4Q1IA 4JJTA 3QKAA 3OC7A 5IKLB 5CTCA 3TRRA 4U0GA 4ELXA 5G1RA 2FZSA 3H0JA 4OLQA 4J2UA 4ELWA 4U0GH 3P85A 3M6NA 3TDCA 2J5II 3ZWCA 5MGBA 3Q0JA 4GHNA 4B3JA 1JXZA 4FNBA 1OD2A 2UZFA 3FF6A 5DTWA 2WTBA 3R9TA 1X0UA 4JOTA 3FDUA 4JSBA 3P5MA 3R6HA 3K50A 2DUBA 1TYFA 2BZRA 3GKBA 5DUFA 3QXZA 1FC9A 3TVUA 2VSSF 2A7SA 1PJHA 1EF8A 2HW5A 3QYRA 4ASIA 2Q2XA 1N6EA 3QMJA 2J5SA 4K29A 1FC6A 3NJDA 1Y7OA 3TT7A 3STAA 3DORA 1WDKA 1DUBA 4EMLA 3ZWAA 3U9TB 4FB8A 3IAVA 1YG8A 3VIVA 5G1QA 3L3SA 1SZOA 3LKEA 5KDRB 4RYFA 2NP9A 4QIJA 5JBXA 3Q7HA 2ZQRA 4FN8A 3RRVA 4RYFH
chains in the Genus database with same CATH topology
4LK5A 4JCSA 3H0SA 1NZYA 3H0QA 4KWBA 3H0UA 4WYOB 4JWVA 3WG5A 3TT6A 1EF9A 3MFMA 4MXIA 3M6MA 3PZKA 3KTHA 4ZDFA 2X58A 2ZL0A 3JU1A 1Q52A 4JVTA 3KTJA 4JCQA 4F47A 4KPKA 4JFCA 4GM2A 4Q0GA 4ELSA 3ST9A 2VX2A 4DI1A 4OG1A 1WZ8A 3PGQA 3H02A 1HNOA 3R0OA 5KJPA 2GTRA 5DZKH 4FJWD 3T3WA 5E0SA 3TVWA 2ZL2A 1ON3A 3IBBA 1ON9A 3HINA 5HUQA 1NZYB 2Q35A 1XNWA 4U19A 3ZW9A 4L8KA 4QFEA 3KTKA 5E0NX 1UIYA 1K32A 5DU6A 2VSUF 5KDRA 2C8TA 3ZWBA 4FNDA 4FZWC 3SWXA 5FIFA 1SG4A 3HE2A 3GLMA 3V5IA 5INGA 3RSTA 1XNYA 4OMRA 1UYTA 3QREA 5INFA 3BPPA 4IZDA 5DZKA 2VSSA 3SLLA 1WDLA 4WZ8B 1UYSA 1UYRA 2PPYA 1HZDA 4NEKA 4HDTA 3MT6A 5JBWA 5G1SA 4K3WA 3I47A 3OT6A 4B3HA 4NNQA 2FBMA 1MJ3A 2J5IA 5DU8A 3HRXA 3QWDA 2QQ3A 3TZ3A 3R9SA 3BPTA 1W2XA 3OMEA 4MI2A 1HNUA 4RCNA 4K2NA 3ISAA 3TV5A 4KNPA 1RJMA 3Q0GA 2VSUC 4IZCA 3TLFA 1VRGA 3P2LA 5CTBA 3PE8A 4HC8A 3PEAA 3T8BA 3HLN1 5DKPA 1N6FA 5FUSA 2F9IB 4HNKA 3U9RB 4Z0MA 3MOYA 3KTGA 1XNVA 4WCZA 2VSSE 2FW2A 2ZL3A 2ZQQA 3DJAA 4I52A 4JCTA 5INIA 4NARA 4FZWA 3G64A 1FCFA 2J5GD 4EMPA 4YLHA 1O8UA 3ZW8A 4JCRA 2PBPA 3KTIA 2F9YA 2ZL4A 3MYBA 3GF3A 4U18A 2J5IB 1N6DA 5C90A 3R9QA 2CE3A 1J7XA 4ZDEA 2VSUE 2PG8A 4ZDDA 3RSIA 2YJGA 5DUCA 4EMMA 4MOUA 1RJNA 5E0SH 2Q34A 4U1AA 1UYVA 3H81A 1XO6A 3QK8A 5DU4A 4I4ZA 3KQFA 1TG6A 3N6RB 1PIXA 1EY3A 5DL1A 1Q51A 2W3PA 5C9GA 3GMAA 2F6IA 4ZDBA 2J5GA 3NJBA 3T88A 3U9SB 3T89A 4JYJA 3HP0A 4IZBA 3QXIA 3BF0A 4G2RA 2DEOA 3Q1TA 2F9IA 1WDMA 2VSUA 2X24A 2A7KA 3K8XA 4ZU2A 4KD6A 2CBYA 3IB9A 3V5EA 4QIIA 1DCIA 1YG6A 4FN7A 4B3IA 2IEXA 2VREA 2F9YB 2D3TA 3GF7A 4JYLA 1FC7A 1XX4A 3BEZA 4U0HA 1K39A 2F6QA 4ZDCA 2A81A 2EJ5A 4I42A 4L6WA 5DTPA 1OD4A 3LAOA 3T8AA 4Q1IA 4JJTA 3QKAA 3OC7A 5IKLB 5CTCA 3TRRA 4U0GA 4ELXA 5G1RA 2FZSA 3H0JA 4OLQA 4J2UA 4ELWA 4U0GH 3P85A 3M6NA 3TDCA 2J5II 3ZWCA 5MGBA 3Q0JA 4GHNA 4B3JA 1JXZA 4FNBA 1OD2A 2UZFA 3FF6A 5DTWA 2WTBA 3R9TA 1X0UA 4JOTA 3FDUA 4JSBA 3P5MA 3R6HA 3K50A 2DUBA 1TYFA 2BZRA 3GKBA 5DUFA 3QXZA 1FC9A 3TVUA 2VSSF 2A7SA 1PJHA 1EF8A 2HW5A 3QYRA 4ASIA 2Q2XA 1N6EA 3QMJA 2J5SA 4K29A 1FC6A 3NJDA 1Y7OA 3TT7A 3STAA 3DORA 1WDKA 1DUBA 4EMLA 3ZWAA 3U9TB 4FB8A 3IAVA 1YG8A 3VIVA 5G1QA 3L3SA 1SZOA 3LKEA 5KDRB 4RYFA 2NP9A 4QIJA 5JBXA 3Q7HA 2ZQRA 4FN8A 3RRVA 4RYFH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LK5 A;  4JCS A;  3H0S A;  1NZY A;  3H0Q A;  4KWB A;  3H0U A;  4WYO B;  4JWV A;  3WG5 A;  3TT6 A;  1EF9 A;  3MFM A;  4MXI A;  3M6M A;  3PZK A;  3KTH A;  4ZDF A;  2X58 A;  2ZL0 A;  3JU1 A;  1Q52 A;  4JVT A;  3KTJ A;  4JCQ A;  4F47 A;  4KPK A;  4JFC A;  4GM2 A;  4Q0G A;  4ELS A;  3ST9 A;  2VX2 A;  4DI1 A;  4OG1 A;  1WZ8 A;  3PGQ A;  3H02 A;  1HNO A;  3R0O A;  5KJP A;  2GTR A;  5DZK H;  4FJW D;  3T3W A;  5E0S A;  3TVW A;  2ZL2 A;  1ON3 A;  3IBB A;  1ON9 A;  3HIN A;  1NZY B;  2Q35 A;  1XNW A;  4U19 A;  3ZW9 A;  4L8K A;  4QFE A;  3KTK A;  5E0N X;  1UIY A;  1K32 A;  5DU6 A;  2VSU F;  5KDR A;  2C8T A;  3ZWB A;  4FND A;  4FZW C;  3SWX A;  5FIF A;  1SG4 A;  3HE2 A;  3GLM A;  3V5I A;  5ING A;  3RST A;  1XNY A;  4OMR A;  1UYT A;  3QRE A;  5INF A;  3BPP A;  4IZD A;  5DZK A;  2VSS A;  3SLL A;  1WDL A;  4WZ8 B;  1UYS A;  1UYR A;  2PPY A;  1HZD A;  4NEK A;  3MT6 A;  5JBW A;  5G1S A;  4K3W A;  3I47 A;  3OT6 A;  4B3H A;  4NNQ A;  2FBM A;  1MJ3 A;  2J5I A;  5DU8 A;  3HRX A;  3QWD A;  2QQ3 A;  3TZ3 A;  3R9S A;  1W2X A;  3OME A;  4MI2 A;  1HNU A;  4RCN A;  4K2N A;  3ISA A;  3TV5 A;  4KNP A;  1RJM A;  3Q0G A;  2VSU C;  4IZC A;  3TLF A;  1VRG A;  3P2L A;  5CTB A;  3PE8 A;  4HC8 A;  3PEA A;  3T8B A;  3HLN 1;  5DKP A;  1N6F A;  5FUS A;  2F9I B;  4HNK A;  3U9R B;  4Z0M A;  3MOY A;  3KTG A;  1XNV A;  4WCZ A;  2VSS E;  2FW2 A;  2ZL3 A;  2ZQQ A;  3DJA A;  4I52 A;  4JCT A;  5INI A;  4FZW A;  3G64 A;  1FCF A;  2J5G D;  4EMP A;  4YLH A;  1O8U A;  3ZW8 A;  4JCR A;  2PBP A;  3KTI A;  2F9Y A;  2ZL4 A;  3MYB A;  3GF3 A;  4U18 A;  2J5I B;  1N6D A;  5C90 A;  3R9Q A;  2CE3 A;  1J7X A;  4ZDE A;  2VSU E;  2PG8 A;  4ZDD A;  3RSI A;  5DUC A;  4EMM A;  4MOU A;  1RJN A;  5E0S H;  2Q34 A;  4U1A A;  1UYV A;  3H81 A;  1XO6 A;  3QK8 A;  5DU4 A;  4I4Z A;  3KQF A;  1TG6 A;  3N6R B;  1PIX A;  1EY3 A;  5DL1 A;  1Q51 A;  2W3P A;  5C9G A;  3GMA A;  2F6I A;  4ZDB A;  2J5G A;  3NJB A;  3T88 A;  3U9S B;  3T89 A;  4JYJ A;  3HP0 A;  4IZB A;  3QXI A;  3BF0 A;  4G2R A;  2DEO A;  3Q1T A;  2F9I A;  1WDM A;  2VSU A;  2X24 A;  2A7K A;  3K8X A;  4ZU2 A;  4KD6 A;  2CBY A;  3IB9 A;  3V5E A;  4QII A;  1DCI A;  1YG6 A;  4FN7 A;  4B3I A;  2IEX A;  2VRE A;  2F9Y B;  2D3T A;  3GF7 A;  4JYL A;  1FC7 A;  1XX4 A;  3BEZ A;  4U0H A;  1K39 A;  2F6Q A;  4ZDC A;  2A81 A;  2EJ5 A;  4I42 A;  4L6W A;  5DTP A;  1OD4 A;  3LAO A;  3T8A A;  4Q1I A;  4JJT A;  3QKA A;  3OC7 A;  5IKL B;  5CTC A;  3TRR A;  4U0G A;  4ELX A;  5G1R A;  2FZS A;  3H0J A;  4OLQ A;  4ELW A;  4U0G H;  3P85 A;  3M6N A;  3TDC A;  2J5I I;  3ZWC A;  5MGB A;  3Q0J A;  4GHN A;  4B3J A;  1JXZ A;  4FNB A;  1OD2 A;  2UZF A;  3FF6 A;  5DTW A;  2WTB A;  3R9T A;  1X0U A;  4JOT A;  3FDU A;  4JSB A;  3P5M A;  3R6H A;  3K50 A;  2DUB A;  1TYF A;  2BZR A;  3GKB A;  5DUF A;  3QXZ A;  1FC9 A;  3TVU A;  2VSS F;  2A7S A;  1PJH A;  1EF8 A;  2HW5 A;  3QYR A;  4ASI A;  2Q2X A;  1N6E A;  3QMJ A;  2J5S A;  4K29 A;  1FC6 A;  3NJD A;  1Y7O A;  3TT7 A;  3STA A;  3DOR A;  1WDK A;  1DUB A;  4EML A;  3ZWA A;  3U9T B;  4FB8 A;  3IAV A;  1YG8 A;  3VIV A;  5G1Q A;  3L3S A;  1SZO A;  3LKE A;  5KDR B;  4RYF A;  2NP9 A;  4QIJ A;  5JBX A;  3Q7H A;  2ZQR A;  4FN8 A;  3RRV A;  4RYF H; 
#chains in the Genus database with same CATH topology
 4LK5 A;  4JCS A;  3H0S A;  1NZY A;  3H0Q A;  4KWB A;  3H0U A;  4WYO B;  4JWV A;  3WG5 A;  3TT6 A;  1EF9 A;  3MFM A;  4MXI A;  3M6M A;  3PZK A;  3KTH A;  4ZDF A;  2X58 A;  2ZL0 A;  3JU1 A;  1Q52 A;  4JVT A;  3KTJ A;  4JCQ A;  4F47 A;  4KPK A;  4JFC A;  4GM2 A;  4Q0G A;  4ELS A;  3ST9 A;  2VX2 A;  4DI1 A;  4OG1 A;  1WZ8 A;  3PGQ A;  3H02 A;  1HNO A;  3R0O A;  5KJP A;  2GTR A;  5DZK H;  4FJW D;  3T3W A;  5E0S A;  3TVW A;  2ZL2 A;  1ON3 A;  3IBB A;  1ON9 A;  3HIN A;  5HUQ A;  1NZY B;  2Q35 A;  1XNW A;  4U19 A;  3ZW9 A;  4L8K A;  4QFE A;  3KTK A;  5E0N X;  1UIY A;  1K32 A;  5DU6 A;  2VSU F;  5KDR A;  2C8T A;  3ZWB A;  4FND A;  4FZW C;  3SWX A;  5FIF A;  1SG4 A;  3HE2 A;  3GLM A;  3V5I A;  5ING A;  3RST A;  1XNY A;  4OMR A;  1UYT A;  3QRE A;  5INF A;  3BPP A;  4IZD A;  5DZK A;  2VSS A;  3SLL A;  1WDL A;  4WZ8 B;  1UYS A;  1UYR A;  2PPY A;  1HZD A;  4NEK A;  4HDT A;  3MT6 A;  5JBW A;  5G1S A;  4K3W A;  3I47 A;  3OT6 A;  4B3H A;  4NNQ A;  2FBM A;  1MJ3 A;  2J5I A;  5DU8 A;  3HRX A;  3QWD A;  2QQ3 A;  3TZ3 A;  3R9S A;  3BPT A;  1W2X A;  3OME A;  4MI2 A;  1HNU A;  4RCN A;  4K2N A;  3ISA A;  3TV5 A;  4KNP A;  1RJM A;  3Q0G A;  2VSU C;  4IZC A;  3TLF A;  1VRG A;  3P2L A;  5CTB A;  3PE8 A;  4HC8 A;  3PEA A;  3T8B A;  3HLN 1;  5DKP A;  1N6F A;  5FUS A;  2F9I B;  4HNK A;  3U9R B;  4Z0M A;  3MOY A;  3KTG A;  1XNV A;  4WCZ A;  2VSS E;  2FW2 A;  2ZL3 A;  2ZQQ A;  3DJA A;  4I52 A;  4JCT A;  5INI A;  4NAR A;  4FZW A;  3G64 A;  1FCF A;  2J5G D;  4EMP A;  4YLH A;  1O8U A;  3ZW8 A;  4JCR A;  2PBP A;  3KTI A;  2F9Y A;  2ZL4 A;  3MYB A;  3GF3 A;  4U18 A;  2J5I B;  1N6D A;  5C90 A;  3R9Q A;  2CE3 A;  1J7X A;  4ZDE A;  2VSU E;  2PG8 A;  4ZDD A;  3RSI A;  2YJG A;  5DUC A;  4EMM A;  4MOU A;  1RJN A;  5E0S H;  2Q34 A;  4U1A A;  1UYV A;  3H81 A;  1XO6 A;  3QK8 A;  5DU4 A;  4I4Z A;  3KQF A;  1TG6 A;  3N6R B;  1PIX A;  1EY3 A;  5DL1 A;  1Q51 A;  2W3P A;  5C9G A;  3GMA A;  2F6I A;  4ZDB A;  2J5G A;  3NJB A;  3T88 A;  3U9S B;  3T89 A;  4JYJ A;  3HP0 A;  4IZB A;  3QXI A;  3BF0 A;  4G2R A;  2DEO A;  3Q1T A;  2F9I A;  1WDM A;  2VSU A;  2X24 A;  2A7K A;  3K8X A;  4ZU2 A;  4KD6 A;  2CBY A;  3IB9 A;  3V5E A;  4QII A;  1DCI A;  1YG6 A;  4FN7 A;  4B3I A;  2IEX A;  2VRE A;  2F9Y B;  2D3T A;  3GF7 A;  4JYL A;  1FC7 A;  1XX4 A;  3BEZ A;  4U0H A;  1K39 A;  2F6Q A;  4ZDC A;  2A81 A;  2EJ5 A;  4I42 A;  4L6W A;  5DTP A;  1OD4 A;  3LAO A;  3T8A A;  4Q1I A;  4JJT A;  3QKA A;  3OC7 A;  5IKL B;  5CTC A;  3TRR A;  4U0G A;  4ELX A;  5G1R A;  2FZS A;  3H0J A;  4OLQ A;  4J2U A;  4ELW A;  4U0G H;  3P85 A;  3M6N A;  3TDC A;  2J5I I;  3ZWC A;  5MGB A;  3Q0J A;  4GHN A;  4B3J A;  1JXZ A;  4FNB A;  1OD2 A;  2UZF A;  3FF6 A;  5DTW A;  2WTB A;  3R9T A;  1X0U A;  4JOT A;  3FDU A;  4JSB A;  3P5M A;  3R6H A;  3K50 A;  2DUB A;  1TYF A;  2BZR A;  3GKB A;  5DUF A;  3QXZ A;  1FC9 A;  3TVU A;  2VSS F;  2A7S A;  1PJH A;  1EF8 A;  2HW5 A;  3QYR A;  4ASI A;  2Q2X A;  1N6E A;  3QMJ A;  2J5S A;  4K29 A;  1FC6 A;  3NJD A;  1Y7O A;  3TT7 A;  3STA A;  3DOR A;  1WDK A;  1DUB A;  4EML A;  3ZWA A;  3U9T B;  4FB8 A;  3IAV A;  1YG8 A;  3VIV A;  5G1Q A;  3L3S A;  1SZO A;  3LKE A;  5KDR B;  4RYF A;  2NP9 A;  4QIJ A;  5JBX A;  3Q7H A;  2ZQR A;  4FN8 A;  3RRV A;  4RYF H; 
#chains in the Genus database with same CATH homology
 4LK5 A;  4JCS A;  3H0S A;  1NZY A;  3H0Q A;  4KWB A;  3H0U A;  4WYO B;  4JWV A;  3WG5 A;  3TT6 A;  1EF9 A;  3MFM A;  4MXI A;  3M6M A;  3PZK A;  3KTH A;  4ZDF A;  2X58 A;  2ZL0 A;  3JU1 A;  1Q52 A;  4JVT A;  3KTJ A;  4JCQ A;  4F47 A;  4KPK A;  4JFC A;  4GM2 A;  4Q0G A;  4ELS A;  3ST9 A;  2VX2 A;  4DI1 A;  4OG1 A;  1WZ8 A;  3PGQ A;  3H02 A;  1HNO A;  3R0O A;  5KJP A;  2GTR A;  5DZK H;  4FJW D;  3T3W A;  5E0S A;  3TVW A;  2ZL2 A;  1ON3 A;  3IBB A;  1ON9 A;  3HIN A;  5HUQ A;  1NZY B;  2Q35 A;  1XNW A;  4U19 A;  3ZW9 A;  4L8K A;  4QFE A;  3KTK A;  5E0N X;  1UIY A;  1K32 A;  5DU6 A;  2VSU F;  5KDR A;  2C8T A;  3ZWB A;  4FND A;  4FZW C;  3SWX A;  5FIF A;  1SG4 A;  3HE2 A;  3GLM A;  3V5I A;  5ING A;  3RST A;  1XNY A;  4OMR A;  1UYT A;  3QRE A;  5INF A;  3BPP A;  4IZD A;  5DZK A;  2VSS A;  3SLL A;  1WDL A;  4WZ8 B;  1UYS A;  1UYR A;  2PPY A;  1HZD A;  4NEK A;  4HDT A;  3MT6 A;  5JBW A;  5G1S A;  4K3W A;  3I47 A;  3OT6 A;  4B3H A;  4NNQ A;  2FBM A;  1MJ3 A;  2J5I A;  5DU8 A;  3HRX A;  3QWD A;  2QQ3 A;  3TZ3 A;  3R9S A;  3BPT A;  1W2X A;  3OME A;  4MI2 A;  1HNU A;  4RCN A;  4K2N A;  3ISA A;  3TV5 A;  4KNP A;  1RJM A;  3Q0G A;  2VSU C;  4IZC A;  3TLF A;  1VRG A;  3P2L A;  5CTB A;  3PE8 A;  4HC8 A;  3PEA A;  3T8B A;  3HLN 1;  5DKP A;  1N6F A;  5FUS A;  2F9I B;  4HNK A;  3U9R B;  4Z0M A;  3MOY A;  3KTG A;  1XNV A;  4WCZ A;  2VSS E;  2FW2 A;  2ZL3 A;  2ZQQ A;  3DJA A;  4I52 A;  4JCT A;  5INI A;  4NAR A;  4FZW A;  3G64 A;  1FCF A;  2J5G D;  4EMP A;  4YLH A;  1O8U A;  3ZW8 A;  4JCR A;  2PBP A;  3KTI A;  2F9Y A;  2ZL4 A;  3MYB A;  3GF3 A;  4U18 A;  2J5I B;  1N6D A;  5C90 A;  3R9Q A;  2CE3 A;  1J7X A;  4ZDE A;  2VSU E;  2PG8 A;  4ZDD A;  3RSI A;  2YJG A;  5DUC A;  4EMM A;  4MOU A;  1RJN A;  5E0S H;  2Q34 A;  4U1A A;  1UYV A;  3H81 A;  1XO6 A;  3QK8 A;  5DU4 A;  4I4Z A;  3KQF A;  1TG6 A;  3N6R B;  1PIX A;  1EY3 A;  5DL1 A;  1Q51 A;  2W3P A;  5C9G A;  3GMA A;  2F6I A;  4ZDB A;  2J5G A;  3NJB A;  3T88 A;  3U9S B;  3T89 A;  4JYJ A;  3HP0 A;  4IZB A;  3QXI A;  3BF0 A;  4G2R A;  2DEO A;  3Q1T A;  2F9I A;  1WDM A;  2VSU A;  2X24 A;  2A7K A;  3K8X A;  4ZU2 A;  4KD6 A;  2CBY A;  3IB9 A;  3V5E A;  4QII A;  1DCI A;  1YG6 A;  4FN7 A;  4B3I A;  2IEX A;  2VRE A;  2F9Y B;  2D3T A;  3GF7 A;  4JYL A;  1FC7 A;  1XX4 A;  3BEZ A;  4U0H A;  1K39 A;  2F6Q A;  4ZDC A;  2A81 A;  2EJ5 A;  4I42 A;  4L6W A;  5DTP A;  1OD4 A;  3LAO A;  3T8A A;  4Q1I A;  4JJT A;  3QKA A;  3OC7 A;  5IKL B;  5CTC A;  3TRR A;  4U0G A;  4ELX A;  5G1R A;  2FZS A;  3H0J A;  4OLQ A;  4J2U A;  4ELW A;  4U0G H;  3P85 A;  3M6N A;  3TDC A;  2J5I I;  3ZWC A;  5MGB A;  3Q0J A;  4GHN A;  4B3J A;  1JXZ A;  4FNB A;  1OD2 A;  2UZF A;  3FF6 A;  5DTW A;  2WTB A;  3R9T A;  1X0U A;  4JOT A;  3FDU A;  4JSB A;  3P5M A;  3R6H A;  3K50 A;  2DUB A;  1TYF A;  2BZR A;  3GKB A;  5DUF A;  3QXZ A;  1FC9 A;  3TVU A;  2VSS F;  2A7S A;  1PJH A;  1EF8 A;  2HW5 A;  3QYR A;  4ASI A;  2Q2X A;  1N6E A;  3QMJ A;  2J5S A;  4K29 A;  1FC6 A;  3NJD A;  1Y7O A;  3TT7 A;  3STA A;  3DOR A;  1WDK A;  1DUB A;  4EML A;  3ZWA A;  3U9T B;  4FB8 A;  3IAV A;  1YG8 A;  3VIV A;  5G1Q A;  3L3S A;  1SZO A;  3LKE A;  5KDR B;  4RYF A;  2NP9 A;  4QIJ A;  5JBX A;  3Q7H A;  2ZQR A;  4FN8 A;  3RRV A;  4RYF H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...