3VJRA

Crystal structure of peptidyl-trna hydrolase from escherichia coli in complex with the cca-acceptor-t[psi]c domain of trna
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
193
structure length
193
Chain Sequence
TIKLIVGLANPGAEYAATRHNAGAWFVDLLAERLRAPLREEAKFFGYTSRVTLGGEDVRLLVPTTFMNLSGKAVAAMASFFRINPDEILVAHDELDLPPGVAKFKLGGGHGGHNGLKDIISKLGNNPNFHRLRIGIGHPGDKNKVVGFVLGKPPVSEQKLIDEAIDEAARCTEMWFTDGLTKATNRLHAFKAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-tRNA hydrolase
publication title Structural basis for the substrate recognition and catalysis of peptidyl-tRNA hydrolase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase/rna
total genus 58
structure length 193
sequence length 193
chains with identical sequence C
ec nomenclature ec 3.1.1.29: Aminoacyl-tRNA hydrolase.
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01195 Pept_tRNA_hydro Peptidyl-tRNA hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1470 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidyl-tRNA hydrolase 3vjrA00
4HOYA 4IKOA 4FOTA 5IMBA 4DJJA 3OFVA 2PTHA 4DHWA 4QT4A 4FOPA 4P7BA 3VJRA 4LWQA 3NEAA 4JWKA 4Z86A 5B6JA 4FNOA 3P2JA 5IKEA 3TD2A 4FYJA 2JRCA 5IVPA 3KK0A 4ZXPA 4ERXA 3TCNA 4JC4A 2MJLA 4JX9A 3V2IA 4OLJA 3TD6A 4JY7A 2Z2JA 4QAJA 3TCKA 2Z2IA 5EKTA 1RYBA 4QD3A 3KJZA 1RYMA 1RYNA 4QBKA 2NAFA 4YLYA 2Z2KA 2LGJA
chains in the Genus database with same CATH superfamily
2X76A 1BROA 5ENVA 5DZSA 4BV8A 4A2WA 2CJWA 3L1VA 3MS4A 4B4OA 3RU9A 1DKOA 3I23A 4FNGA 3ZI4A 1HRDA 3MJ4A 1V95A 2WM3A 1XF9A 1L5MA 2A5JA 1ZL2A 3H2BA 3LT2A 3NC4A 3EVEA 1ADYA 3QBVA 4F5YA 1AUVA 2ZR9A 4YI3A 2H7VA 1LLQA 1QG2A 3FJYA 1NPDA 3KQVA 4LC9A 2K2WA 3OZXA 4HNTA 2YASA 2FPUA 2VDNB 4CFSA 7YASA 1U0TA 4NV3A 4CV1A 3WNDA 5BWNA 1T9DA 3E27A 4U2KA 3V1KA 1Y8AA 5AH0A 2F3RA 3JYQA 3Q7RA 1TO2E 3BH0A 3DQPA 4BVBA 1SUFA 2B36A 3TLJA 4EYGA 3GH1A 2VP2A 1EH5A 3I8OA 3ZS9A 1U7PA 3QA9A 3OUZA 3W5SA 5KIAA 4QSHA 2P79A 3DLIA 4UEOA 4ZVKA 3BK2A 4D9JA 4DQ0A 1P4HA 2JF0A 1PQYA 5JI3E 4D43A 1V43A 1PR5A 2DMRA 2WD8A 4UHKA 4MR7B 4DY4A 3U40A 2ZFUA 5KNLA 4LZNA 1EWVA 1K3FA 2Q5JA 2XYGA 4HKTA 3ANMA 3DHYA 1K5GA 1PR0A 1XP8A 4KO8A 3E2PA 4ONEA 4XX0A 5EZYA 3HMQA 4PO8A 1G20A 1GCUA 1RYMA 2VK2A 4TS9A 2WMYA 5EIWA 4IYJA 3SXUA 3DTVB 4DTIA 1MAVA 4UTZA 5KYUB 1T6NA 2JFGA 3NT4A 1DOZA 2FW9A 2YQ4A 2JVKA 4HGNA 1O58A 4Q1CA 1LS6A 3LF2A 1V71A 3WKCA 4C6TB 3LSTA 2B0JA 5ICCA 4BUCA 3KVNA 3RTAA 1FOEB 1VLZA 5KO2A 4ZZ1A 2I0FA 4ZXPA 5CFQA 3X2SA 3L82B 1ECLA 1I33A 3WNQA 1JKMA 1VIAA 5DCYA 1M1UA 5CA0A 4XWOA 1SXHA 4OK3A 1WW3A 4D8UA 3HB7A 3HKEB 1VE9A 1BMQA 2BMAA 4G36A 1F2UB 4DRZA 2B3DA 5CFLA 1N25A 1JAIA 3BPSA 3QVJA 1EA5A 3ESZA 3WIEA 3WBKA 3G9ZA 5I3CA 2Q7XA 1KK0A 5BY2A 1T6XA 3K32A 1BDIA 3ZGZA 3P0IA 3CZMA 4DCVA 2EFEB 3L02A 3MB5A 3PEYA 3RSQA 4EQZA 4NV1A 2FXVA 4Z49A 4EJSA 4HS4A 2DYKA 1IQRA 1I6WA 1TYDE 3SN6A 4UUMA 1G9XA 3RBZA 3DFFA 5TGDA 4M99A 2A78A 3E35A 1Y7HA 5DK4A 4DUPA 1JWLA 3AU8A 4B44A 1UMCB 2CFOA 2XB2A 1X7HA 5AW2A 4AJNA 2J46A 1NW8A 2HMTA 4TMZA 3F9CA 1DTSA 3W2TA 4DIDA 1K6EA 1EHIA 1TQ4A 2I76A 4ZO7A 5KX5B 4IVNA 4LHVA 1MQ8B 4GQBA 2SECE 2A9OA 3ROTA 1A88A 4QRIA 1FFCA 4LZLA 5CK4A 2GEBA 4P98A 4QG7A 4UDYX 5EMNA 2WD7B 4JROA 4AY5A 1TZBA 4BLPA 4PC3A 1P1KA 1QVRA 4ZT5A 1PJBA 4DSOA 4QUBA 1N2CE 3RUEA 4U7TB 2UZAA 1PNRA 5K8VA 2J0EA 3CE9A 4TXMA 3D4LA 2B4YA 4W6QA 3E4DA 4G63A 4XB1A 4QU9A 3O3NB 4DV3B 3SIPA 1RI1A 5EGNA 4Z51A 1QC5B 3H75A 4GXRA 3WK8A 3IBSA 1PWXA 1M2OA 1UKZA 1GR1A 2CLMB 4K88A 4R9UC 3X1DA 2ZBGA 1WUTA 2QZ9A 3AX6A 1S7GA 2I8CA 3RHSA 3ZIUA 1Q3KA 5EMMA 3DOOA 4V39A 3ROXA 2FNAA 5L51A 4Z0NA 5AESA 1ZMBA 5E6UB 3F78A 1CUIA 4MS1B 4D6PA 3GMDA 4P0PB 3RS8A 3TBHA 1BJTA 1NFFA 4KCGA 3P7MA 4TSFA 4RD6A 4C4PA 1HBJA 3LK7A 2MMGA 3R44A 5AJYA 5BW4A 3MT8A 3TBFA 3NEAA 5JMWA 4J7UA 4A8HA 3C6ZA 3PUWA 4IUBS 2VC2B 4MIEA 5J58A 2EP8A 1JG6A 1DRVA 1FLVA 3LA8A 3M70A 4HLQB 5CU7A 3M5PA 1FTQA 3ACDA 4NJMB 3B60A 3QW2A 4KAFA 4MLCA 3VR4D 4BO5A 1C3EA 2C92A 4QUIA 5EKXA 5JXGA 3HEMA 4ZEXA 1MPTA 4B82A 1W5AA 5IT9A 5EIHA 1RXVA 1NQ5A 4J0EA 1IJBA 1FYVA 2MSKA 4W1PA 1Y5LA 2ADFA 2G08A 1P9LA 2O0MA 1HNZB 3PFFA 1FS4A 1JQKA 1QIHA 2XT6A 1RYYA 4Z9XA 3GA5A 3H2SA 3IIMA 1Q1ZA 1XKQA 4FD3A 1UBEA 4O8CA 2YS7A 4NTZA 1EFPA 4TMTA 3IILA 1I7DA 2Q0HA 2V4ZA 4KPUB 3TCXB 1MP0A 1V3TA 4S12A 1RM3A 2Q6TA 2DFPA 4K2AA 1CK4A 1JQ5A 3T7RA 5F98A 2HRCA 3MGAA 3O8CA 2OEPA 1W96A 5FR2A 3V48A 3TW6A 4YQFA 2YRFA 2IIQA 3U6KA 3EULA 5F78A 4L6AA 2FR1A 3RCBA 2QWXA 2Q2QA 1LBHA 5CYPA 3BHNA 5DULA 3F5QA 2P0EA 3K0KA 1UC8A 3I6IA 4BTLA 1A72A 3KM0A 4INOA 3RV4A 2PRKA 5ANRB 1CHNA 4A2CA 3NOQA 4MAAA 4H7FA 4L15A 5DLDA 4ALNA 4LGMA 4KOEC 3IAM1 2ZS8A 3WLMA 1JWBB 3QELB 5CURA 1YZHA 2P9CA 4L4ZA 2DFKB 4UMDA 2PLFA 1YDGA 4BIIA 4FC6A 4CKEB 1X1BA 5IZ4A 3CVWA 1FTWA 2XVXA 4JASB 2IZ0A 2OK7A 1G5FA 1E6MA 3AEQB 1B41A 2BDUA 3TIGA 1CR1A 3CGWA 2GBGA 2C5AA 1VG9B 2EBFX 3GL9A 3U7QB 2C7GA 3QKSB 1TK3A 2I8LA 4FGWA 1J2JA 5DP2A 1D2EA 4EFNA 5AVVA 3AB8A 1Q92A 1R6AA 1Z45A 3I4FA 5DXAA 1L7BA 2Z95A 1PV4A 3O4HA 3RM3A 3VPFA 2BM9A 1GRQA 4FI3F 3DJYA 5DXFA 4OATA 2XMCA 4IJKA 3T38A 1E7QA 1IOWA 2GAOA 3N2EA 4WK4B 5AKZA 3PE3A 2GBIA 3D64A 3TECE 1E18A 3LHFA 5IEBA 1TPZA 1GTJ1 5DF1A 1KDVA 3CF4G 4UQLA 3QPDA 4K28A 2GBCA 1O57A 1V9CA 1YBAA 5TF0A 4B3XA 1QG4A 1SOWA 3OU6A 1R0RE 3UWSA 1J5EB 1GU7A 3SVLA 5BN3B 3BERA 4LJAA 4DWWA 1SG9A 3ZV6A 3VUFA 5GJVC 2OBYA 2GBFA 3DXZA 3OE7D 4C5CA 2XUAA 3OT1A 1RHQA 2E1RA 4KFRA 4D0SA 1TT5A 3I52A 1SGWA 2ZRDA 4XD2A 3KQYA 4P93A 1GAQA 5ALVA 1AXRA 4FD2A 3OLYA 1GPDG 1AC5A 3V4RA 2VDMB 2RI6A 3BIWA 4IW3B 3UAOA 1GCIA 2WWIA 2NLOA 3VV2A 1Z56C 2JGDB 4BFXA 2PKWA 2X7XA 4M0FA 4IDOA 1Y1PA 4IFTA 1JI0A 4Y8VA 3DONA 5CBPA 3B7PA 3KZNA 5HXAA 1EWTA 3FOZA 1KXJA 3D7RA 4JBWA 4KIFA 1U8EA 1ZGHA 1O87A 1T8PA 1QZZA 1UK6A 3MW8A 4EMTA 5D87A 1QYCA 4IDQA 1CUYA 4AUMA 3LOUA 4DN6A 4MQMA 1EQUA 4OHUA 3IRVA 4FN5A 2IP1A 2W4IA 4KODA 4UTXA 1T4MA 3B38A 4I8IA 3IKLA 4FYVA 3RG8A 5AW6A 3PGKA 1TB4A 1PQWA 4M1OA 1ADFA 4WZZA 5I9IA 1IEVA 3F3YA 4YCLA 2HV8A 1H66A 3NB0A 4GHWA 2JIMA 1XJ5A 1SPXA 4HQRA 1YNOA 4LDJA 4LHZA 4PSDA 2W2OA 3WYDA 1F12A 4M9SA 1BXGA 2XQVA 4Q4DA 4PLVA 4LC1A 4P2BA 1CZNA 5FOTA 4F56A 4BXOB 2RG7A 2AWOA 2XCIA 1D09A 4CLDA 1LQ2A 3ZW9A 4G89A 3CLRC 1CD5A 4QDTA 3IAS6 1DAMA 3LECA 3U4MA 1JALA 3BC1A 2BI8A 3L3BA 4D3YA 3EPPA 1HOXA 221PA 2QD4A 4LWPA 4XWYA 5FJIA 1V5FA 821PA 3NUGA 2HC9A 3DO6A 2WVGA 4FBGA 3QG1A 4FT2A 3B6KA 4R1PA 1KC1A 4QDOA 3P0JA 1CUDA 4FT4A 3S44A 2QGNA 4W8GA 4QEKA 5F9FA 3SZMA 1NE2A 1VFNA 4IIEA 4YRJA 3HC7A 3A6JA 3ENKA 3QLUA 1QMPA 4X61A 4JOQA 3TEMA 3CMMA 1U6JA 3NI2A 5C46F 5BW6B 3C5EA 2XF2A 1NW3A 5CH3A 2ZBVA 1GT6A 5BNZA 4HUTA 4US2R 2P7IA 4F5ZA 3N39C 4Q3NA 1LNQA 1L5VA 3BB1A 3SJ7A 3U5TA 2ONJA 2E4XA 4FKMA 1CY7A 2R6JA 2YVAA 1ZD8A 3T3IA 2OY0A 5DLQC 5AK4A 1ZM9A 4LVNA 3L7JA 1DAHA 1EGHA 3SPXA 4BFLA 1Y4AE 4H6VA 1G5IA 4L51A 4WX2B 4Y0NA 1OGJA 4Z5XA 3V8QA 4IH1A 1XNQB 1VE3A 3PKJA 4GLJA 3BN3A 5FBZA 2QTVA 3OIGA 4GPD1 4HATA 3WV4A 3RKUA 4KE6A 4OB8A 3HJBA 1DUVG 3GGJA 1ZPDA 4RVDA 1RT9A 4X3CA 1BHQ1 4E22A 2R8BA 3DOEA 5TARA 1Y4DE 1XVAA 4F1WA 4TS1A 2IK8A 2UXDB 5HF9A 1KQOA 1P4AA 5E9QA 4NFSA 5DN6A 1BTOA 2B2CA 1QV9A 3C7AA 3EGCA 4I55F 4AQDA 1GDTA 3BOSA 3S2EA 3TW8A 1SUPA 4Z9FA 3T9FA 3FRIA 4LNUA 4EUKA 5E2BA 3HEAA 4XGKA 2OYCA 1QHNA 3L7YA 4OMCA 1UWCA 3K5WA 3O94A 1RC0A 2D5BA 4KPYA 4X7MA 3RC2A 3TOCA 1RZRA 3TIXB 2XTNA 2QY6A 3AGQA 3TPCA 1H9AA 4MWSA 5JARA 1KQGA 3T7SA 5EZQA 1UL1X 1QUFA 4GX5A 4EHIA 3AEUB 3I8XA 3GVHA 4LF5B 4TLEA 5ILOA 1SCDA 3TAXA 1SCAA 4YDHB 1OHHD 3ZE1B 4XYEA 4U8GA 1T1IA 3D31A 3SJAA 5LR6A 2XJ9A 4EJSC 4E4TA 3L92A 4F86A 3VPGA 3R7NA 3RBVA 4L5CA 5J23A 4MDEA 1OGIA 1TU0A 3FKJA 4JJEA 3NONA 2P9GA 3DXYA 3EEFA 3EXFB 3NR2A 4FCVA 4I4TB 3TMYA 1RRMA 1KSJA 2ZVDA 3EC7A 3EDRA 3L84A 5EPOA 3A2KA 4DLPA 4L7VA 5U1PA 1BS2A 3HK2A 2BMFA 4JYBA 4XTRA 3K1ZA 2C5SA 3GQVA 4LW8A 2PX8A 4D9MA 5LZ5A 3B1ZA 3KFVA 3RSLA 3A28A 3SEQA 3ZEIA 2C2ZA 1L5SA 4NULA 1ZK0A 1EX1A 2W5UA 3DLCA 3GRVA 1PKEA 1IM2A 3IUJA 3VTKA 1QGUB 1QHYA 4QU8A 2WU1A 5B55A 1EUYA 1GEEA 5BQOA 1BD4A 4M9CA 5AVRA 2A4MA 2QAJA 1IFXA 2GMWA 1HE8B 4P4SA 5HOEA 4WXHA 5FL7A 3K73O 1R1DA 3TM4A 1KNXA 4MGZR 1JE0A 1PGJA 1BDBA 3AYXB 4WGGA 4BNDB 4GQAA 3R7FA 4M89A 4P31A 2GYYA 1PV1A 2WPNA 3Q8WA 4B2YA 5CBKA 2GK4A 5C51B 3D54D 4EHJA 1NONA 2BCEA 1V96A 2D59A 1KMCA 1FNNA 4PAGA 4U7WA 3D7LA 1A76A 4QYMA 5C8YA 3H5NA 1N1DA 1US8B 2GZRA 5LP6B 5MGBA 2PKRA 3QF4B 4DYVA 1QHSA 4EG8A 3IUNA 1LDYA 3NBQA 4DXHA 1V1MA 5FUVA 4F9TA 3DKKA 4F3TA 3UV7A 4PTLA 2FSFA 1DMRA 4IIUA 1I9GA 4YPFA 3WLAA 4HS9A 1X2BA 3PBKA 5CVEA 3N2KB 1DELA 1KMNA 1YBVA 3H83A 2UVPB 5E1OA 5IAKA 3RSSA 2Y68A 3W4KA 4EKYA 5EJAA 4ZVOA 3Q6IA 3U5ZB 5I7AA 1IWPB 4P38A 2PL5A 3VKFA 4OP1A 4KDCA 5TQ2B 3CRRA 3GFTA 3R3YA 4G4JA 1RYHA 5NULA 4AJKA 1VP3A 2Z3WA 4HFMA 2Q4DA 1W7AA 1FLAA 5LWHA 2QD3A 5EFZA 4OA5A 3HB9A 3STWA 1NLUA 3H4MA 4QSMA 4CL8A 1TTTA 1HDYA 1Y81A 3VR4H 3PPIA 5ALPA 1VPTA 1A1SA 2QRUA 4BE4A 2Y1LA 4JK3A 4I99A 4QJ4A 2NXWA 1AGXA 1E2HA 4O6VA 5DPMA 1MJ5A 4D98A 4Z9BA 5DX8A 5FL7D 3X1KA 4FB5A 4P5EA 2BM8A 2PR7A 4IJQA 3VO8A 1RBYA 5KSZA 2OC4A 1NJ1A 2CDAA 1XAJA 2N42A 1P4SA 2NNLD 1NP3A 2OL4A 2XGGA 1GD1O 3GRCA 4JBNA 1L7DA 1RWXA 2DPXA 4LOKA 2AGVA 2I4OA 1UFRA 4G85A 1I94B 1QOQB 4BP8A 4GM4A 1Z6XA 4B32A 1B1CA 3RSOA 5LFAA 1JHZA 4YJKA 1Y7IA 5JCZA 1N2BA 3ZIAD 4W82A 1Z2NX 2BKUA 2H2AA 2AZTA 3HBNA 4UEKA 3WDSA 3ZV4A 1VHTA 2Q3DA 3DBOB 3SHTA 2AFHB 3VYVA 5K0FA 4RJ2A 2HCTA 4KU4A 16PKA 2OK8A 1MAWA 1LBTA 2X86A 3HBLA 4ARSA 4EY5A 3HUTA 3EE6A 4WD3A 4WFJA 1Y1QA 1GVHA 4XCXA 5AOAA 3TKYA 2A4KA 4D3FA 1K7FB 1G291 1SCNE 1WE2A 1Z06A 2A5FA 3QU9A 4RVGA 1Q1QA 3NAMA 4MR9B 1CVLA 2PD4A 2R11A 2V5VA 5E7QA 5IYZF 4UBNA 1MB3A 4EGQA 1XDZA 4LSMA 3FDFA 3MAGA 3B70A 3L0OA 3UMBA 1DTWB 2BFEB 1BXZA 3HV2A 3IAUA 4FTWA 4N5IX 4QUAA 3G85A 5BWCA 1XZFA 3O2QB 4KH1A 4TKUB 5FB3A 3ROMA 3PJGA 4DA6A 1Z4LA 3G8BA 4IDAA 2PMDA 2ZS9A 2ZKIA 3DF7A 3MUNA 1T9ZA 4GOLD 4IHJA 4MWBA 2BFWA 3LBYA 4DWVA 2QTNA 3C98A 3SDSA 4ZCTA 1BAPA 4U5XA 4J3NA 3KV3O 1CLUA 3AR3A 5CVTA 4DQKA 1OYOA 1SC6A 2CGEA 2QMZA 2Z4TA 2IY8A 1HFJA 2J9RA 5BNFA 5KQPA 1OOEA 1Y8CA 1DQRA 1BHJA 1P2GA 1VCMA 3IB6A 3KPYA 3QLVA 1U2ZA 4HZUA 1IQPA 2OFOA 2QG9A 1ADCA 1DX4A 3JATB 4ME6A 4OJQA 4BMXA 1Y6GA 3E3LA 3KJHA 5BYAA 4RKQA 1MHTA 1NXOA 4F4IA 3R1IA 1B8OA 5C5IA 4MDHA 3ZGOA 3CSUA 2YJ5A 4PWYA 5L95A 1NUTA 2O2JA 3K0HA 1EESA 2YCLA 1ZMOA 4OXKA 2V55B 2JFFA 2BGJA 1O4WA 2BUCA 2RI0A 4D99A 1KWKA 4P0TA 4WNYA 3VM6A 4YJDA 5CEEA 1ELOA 2RHCA 1GAWA 3F96A 1I7PA 3EGDB 4EUHA 3I3OA 1OBFO 4FFRA 3HHEA 4G1UC 3RK1A 3WMWA 4NCAA 3DL7A 4GMKA 3D8RA 2J1LA 5C1DA 1KI3A 4NNPA 1R0XA 3LI2A 3O7WA 4GKAA 4P7KA 3NBMA 3W5HA 1KZ1A 1Z7GA 2I54A 4DC0A 1KR5A 3HCNA 1C2TA 3EIXA 3I0ZA 1LVGA 4ESOA 2OCXA 3FDIA 4YCNA 5F2EA 3HDVA 1EXWA 2C9BA 4BY9E 5FV7A 5JI2E 3BWMA 2FK7A 4FYJA 1NU8A 3AQ4A 5AVZA 4PQRA 1W73A 1VCNA 2FR8A 1WQ1R 3OZUA 4EELA 2XW6A 5CB4A 2DQ4A 2ST1A 3DYVA 3SR3A 2QQ5A 2NV0A 4CMJA 1TIPA 4PN7A 2M98A 5EMLA 5LZ2A 1W52X 2HU5A 1V16A 4ZZ3A 4UAJA 1UJCA 1SHKA 3B48A 4C3ZA 4D0LB 3STYA 3QJYA 1IDOA 1HLDA 3QY9A 5JCJA 4BMSA 4BNKA 1PG5A 3NUQA 2Q5FA 3IELA 1DCTA 2B61A 1FMFA 4KBFA 1DIRA 2B1RA 2PU5A 2DKOA 4HAIA 4XVUA 1KF0A 1RKQA 5M2QA 5F73A 1W36D 4S1VA 5REQA 3I9V6 9ATCA 4HUQB 2WPDA 4IRMA 2ISSD 5TEWA 2JEYA 3EEOA 1Z88A 2FSGA 1VLLA 3B1YA 3DVAB 3MA0A 4YHHB 3BGDA 1W88A 2MSEB 4F1KA 1GNSA 1Q0LA 3JQDA 4X1YA 3SKVA 3DHWC 5H7XA 3QLUC 2ZTLA 5B57C 4RS4A 4XGRA 4IHQA 5E6RA 5CCBA 2VRCA 2G9UA 3R74A 3GFPA 2GCOB 5TQJA 3COVA 4E1VA 2PJDA 1E6LA 2R47A 2QYTA 2W2TA 4NCXA 4ECEA 5JSFA 5AKYA 4AZVA 2QMOA 3NDPA 1Z7BA 1SUWA 2BE9A 4QUGA 2G9QA 2IWRA 2CDCA 1ISSA 1WZCA 4ALIA 3CEPB 3FSGD 1JIIA 4FZVA 2AJTA 2HKIA 3GHYA 3AR7A 1ZJ5A 3K0FA 3WBJA 1FFXA 4C4RA 3V33A 1JL3A 1LV7A 1XU9A 4DLWA 2WY2D 2C88A 3T5AA 1TW3A 1IBMB 3ZH9B 3NHRA 3QK7A 2TS1A 4YMTA 2BT4A 3MGGA 1TM1E 2VHUA 4BCCA 4IJWA 3ZY5A 4EEKA 4WLUA 3SBXA 2VPQA 3DV0A 3E6AA 2HO4A 2XIQA 3GFOA 4FXOA 1CP2A 1E2NA 3E48A 2JH3A 3EFOB 4K40A 3OCXA 3TOXA 4BP3A 2WR8A 4JOCA 1U3VA 5BRNA 2FPMA 3OQPA 4B76A 2YMPA 3ER8A 4REQB 3J81A 1HT3A 3NHKA 1WLYA 2AZMA 3HY3A 3QSGA 4WHMA 5JIBA 3ELYA 1UOEA 4BPBA 1ZUNA 2BV3A 1CHDA 1QAQA 2JFXA 3HXOA 4TTPA 4NESA 1XZCA 1F2VA 1E3EA 3OE1A 1E1QA 3I5AA 4MPTA 1OCEA 2HBRA 3BMCA 1JTVA 2FEAA 1KDZA 3MJSA 2ZRMA 1DU4A 3OHMA 5D3MA 1Q1NA 1ZIYA 2VEDA 3MTAA 4KTTE 2O3SA 5DHSA 4C7BA 1IOZA 3K53A 2HOQA 4IIHA 4W7HA 1PTJA 3T3GA 4PQGA 1CIVA 3SM9A 1BXRB 1HL7A 4KQ1A 4HQNA 3RVOA 4AAYA 1U63A 1CZUA 1OXSC 1AKUA 3VR2A 1Y7PA 4EOGA 4KO3S 3V97A 2Q4EA 1T0HB 2CXUA 5DHPA 1NDUA 5HM6A 2J30A 3Q7TA 2W2QA 2VSYA 3EAGA 4P4GA 2I3DA 1O2DA 1G8FA 3TEFA 4L74A 1QFXA 1WDMA 2G6TA 2XSZA 3BWCA 4MS3B 4RAQA 4C0BA 4CGYA 3P94A 4UVEA 3UT6A 3FFXA 1CB7A 1UBKS 5IVPA 1OI3A 4WACA 4ZKEA 4GPTA 1G6HA 4KVZA 4M1KA 1HQKA 2GPAA 4HZGA 1O89A 1ZD5A 4A0QA 4UFPA 1M66A 3HUUA 4IIFA 4NU0A 2WV9A 2AUNA 2V9CA 2YWJA 4CM7A 4CF5A 4DLRA 1Q0RA 1F8FA 2XUPA 3V7NA 4YLGA 2Y6UA 4B3HA 5CEFA 1A5TA 5DNCA 1G2PA 1MEOA 4QU5A 4HRVA 1E3WA 1VDMA 1K6XA 1X1AA 2DBZA 1OB5A 3ZJVA 3N3BC 1DEKA 2QP9X 1G18A 2XH8A 4X8MA 1Z8DA 3ZUGA 1OKKA 4HUJA 2ID8A 2H0RA 2H4ZA 1LPPA 3BMOB 3DAGA 3CUWA 3PG5A 4TQGA 5FLKA 5G02A 2ZYIA 4KQHA 5LBTA 5LSAA 3EX7C 1KRWA 2CEAA 4ZN6A 3VDXA 5I4CA 2Q1TA 4FINA 1F9AA 1IDN1 3OPYB 4D3DA 1Q0TA 4HO1X 1F4VA 3BBLA 1HYHA 3H5AA 1PU2A 2QX4A 5B2FA 4ITVA 2I99A 2Q1XA 4QGBA 1EAYA 1ZGZA 1G3IA 4IM7A 4KQEA 1KRHA 3QF7A 4FEAA 1XKTA 1OXUA 3NYQA 4OQFA 4TYPA 4FUQA 4N7BA 4LECA 3U3MA 3VR6D 1WP4A 3M3HA 4D4IA 2IH4A 3D5EA 3C3CA 1TC1A 1C0IA 3K6RA 1DJMA 3OPVA 4AZWA 2J48A 2QMUA 4OX9Y 1U3GA 1E92A 4KDRA 2HRRA 1SOAA 1ZIOA 1C1XB 1M2NA 2E0IA 2BSXA 5EUQB 4A8JA 1CJVC 3EIQA 1GITA 2GF2A 4PLHA 4NJEA 1ONNA 4B3GA 2AKAB 3WL5A 3B6ZA 2ONYA 4CM6A 1YS2X 1JDBC 5EJ5A 3KQHA 5EP2A 4LBZA 1FPQA 3KLMX 1I2BA 2VPYA 5AUQA 1VLQA 3C70A 1OF1A 3DBHA 3HFGA 2L0XA 4YRMA 2C82A 1E6WA 1QIJA 2TYSB 3Q3IA 3PA6A 1M2EA 1CJUC 2J3LA 4PYOA 4LVCA 3TZEA 3W5IA 4B74A 3RRMA 2B37A 2WWGA 1JEQA 1FJ2A 1N3YA 5F7OA 3DEKA 3U48A 5FWYA 2QRNA 1G2OA 1D9ZA 5I51A 1IBKB 3F5MA 3RJMA 3THYB 1I0IA 2G76A 1C4OA 1HTWA 3OESA 1QLWA 2XVYA 5IDVA 4D9IA 4IEIA 4ZU3A 1M3SA 2P2GA 2PSHA 1J0DA 1ST2A 1W4LA 1DJQA 4GE3A 1VSTA 5KMGA 1VG8A 4RANA 1OC2A 4TKZA 1DJNA 1F6BA 4CM9A 1EP2B 4WZAB 3ZY2A 4B9EA 3T9DA 3GGPA 4URFA 2GN1A 4FNMA 3IDOA 5SY6A 2RI1A 3V00A 3NHYA 1J7KA 4RPCA 4RHYA 1G21E 2YXDA 2B20A 4OHWA 1NKTA 1XMPA 4QOFA 1SVNA 3T9AA 3JZMA 4BMVA 1QZTA 1GDHA 4JC8A 2DBVO 3JD1A 3C8ZA 2FDRA 2JIQA 3TUJC 2ZJBA 3AW9A 3LE8A 3QEOA 4TYMA 4Y6GB 3OJXA 3PNKA 3Q5GA 2ZDHA 5FP0A 2GYUA 2J33A 1NBOA 4EGFA 1JX6A 1NXXA 2BSAA 4WCFA 5BURA 2ERCA 5CD9A 1AGPA 2CLKB 2P9JA 4GL4A 5DSXA 3RVKA 3DT8A 3G8AA 2J3HA 2FFRA 2YJZA 4F06A 4GPAA 1OJLA 1GGJA 1U4SA 2EL9A 1Z2AA 4IIJB 4JL8A 4DMRA 1P1RA 3EXG2 4XQ9A 5DU2A 1DBIA 4CQMB 1XEFA 4OM8A 4C4TA 3IT0A 1TU3A 4TTVA 3TZHA 1P0IA 2Q5LA 2X0NA 3CR7A 3N7AA 4H3KB 5DOVA 4RA6A 1K06A 3HWX1 1CQIB 1UZLA 3R0VA 3AFOA 5ELMA 5KOYA 1EUDB 4OKIA 3OHSX 1SOVA 5IN5A 2I65A 2YMQA 4PNPA 2SHKA 5HIMA 1B0ZA 4Q3KA 3CJQA 3KOUA 2ZULA 2PXAA 2WT4A 4RVSA 1P6QA 1COWA 2YVQA 1PX0A 2IGTA 3B3GA 3R20A 5J40A 1J00A 4ER6A 1RJ9A 4KGZA 5ICEA 3HYLA 1RWVA 2AQHA 5FO0A 5J4VA 3QLVC 1UPCA 5KJCA 5E6SA 5MGNA 1KDPA 3DB2A 4YONB 3HJGA 3GWZA 1QO9A 3HRHA 4KE7A 5CEJA 1JEJA 1QRSA 2H9IA 3RFCA 1NF8A 3CYFA 3AL3A 3EEIA 4L27A 2ZTSA 3W7VA 4RELA 5JTTA 1FVOA 2DLNA 3S2SA 3NC0C 3CUYA 3BWDD 3WMGA 4E2XA 5I9BA 5CW2A 1RADA 1RQNA 1XXHB 1NM5A 3A36A 4FJ1A 6LDHA 1RC8A 3N2IA 2NU8A 2I9KA 4K6MA 4R2HA 5KQLA 3CX3A 1L9KA 4TSKA 1P7WA 2XECA 1X1CA 1DRKA 1MBZA 3PR2B 4Q37A 2R1TB 2WFLB 3RNLA 4CLHA 1JEYA 5D3QA 2AC7A 2IYTA 2O05A 3BJEA 3S1AA 4AG6A 5CD1A 2PRSA 5THXA 4C87A 2BGWA 2D3WA 1W29A 2O8DB 3R4CA 3AF1A 5EP3A 2PDAA 4ZRNA 5BXQC 4FMCB 3DLAA 3H9JA 3VZCA 1FFSA 4N76A 3E3NA 1HT0A 3FUXA 5CX1B 3A14A 4Q3LA 3FZGA 2V03A 3F98A 1X8LA 4CU5A 4RTOA 2FR8C 2QOEA 2VATA 1GGFA 4ADSG 1NQVA 1E2BA 2I3AA 1H23A 1EK0A 1REQA 1UMKA 2H4WA 1BDJA 4FGZA 2JFPA 3KPJA 2ZCUA 3QLTA 4LIPD 4FX5A 4DPMA 1QF7A 1BJKA 1CRQA 2EJUA 2CJWB 1ODTC 4BUJA 1TZMA 1CYDA 1MIOA 2DETA 1U8AA 2IUYA 1ZUD1 3FAZA 1FMCA 2ASEA 3SR0A 3ZK9A 2GA8A 1CQPA 4PO3X 5KDOA 1J07A 2GRAA 4JUDX 1ODIA 4BKPA 4AVYA 5DI3B 2H7XA 1YDWA 4ZV9A 4J75A 5IN4A 1FDTA 1NTOA 3MJVA 4MQEA 1UXOA 1A5ZA 1XT6A 2PUFA 3E9ZA 2ZWVA 3DOCA 2ZP1A 3KSZO 4PYRA 3ZWDA 2N1BA 1XQ9A 3L4SO 1Y3BE 3H8SA 4Q1BA 4EB8A 5FR1A 3UXEA 3J80A 2OBNA 1TM2A 3B52X 3KOZA 2WJAA 2GM4A 2A0KA 2J8ZA 2LUOA 3MSCA 5A1TA 1MNQA 3L4BA 3O8QB 4UATA 3UHJA 3S8EA 1JHDA 5JAOA 3MRTA 2AEEA 1TDJA 1MF7A 1VBKA 4MJXA 4P3XA 4ACAA 4YT4A 3L6CA 5LB4A 2TRSB 3DWFA 4BZPA 1FNSA 2QMHA 4QBFA 1J09A 3A3PA 3KQQA 2C54A 4NK4A 2I7VA 2TECE 2X7JA 1E4VA 2JGMA 2PVSA 4XX0B 2R25B 5EZYB 4E3WA 5H9VA 2FMHA 5LKRA 1X14A 2IQ5A 1G20B 2PUEA 1OXTA 3QGMA 1AK2A 3ETJA 4RD1A 3QKUA 4DUYB 2IX9A 3ZR4B 1A27A 1BWSA 4X00A 4F2GA 4HGPA 2P6PA 4PG8A 5CA1B 4NZMA 2IYQA 1RQGA 4FEGA 5IVHA 3O4GA 1B74A 2HLPA 3JQGA 2Z56A 4IIVA 1XDWA 1MB4A 4N54A 3HVRA 1JLSA 1OIVA 4QUKA 4DNXA 5HZKA 2HIAA 2HA3A 3COJA 3UAGA 1JZSA 4K6HA 4R6WA 3U7FB 2XBMA 3GG9A 2P9BA 5LCXA 3PUYA 3WWCA 3O21A 1YRQA 1D9XA 4QXMA 3T9EA 5CA0B 1VJ0A 3DWIA 4BRZA 5J5CA 3ABZA 3HUDA 4GEKA 3ESDA 3IJRA 4L3WA 3LHIA 3IVAA 5DBEX 4C3UA 1DHRA 1PTJC 2VDKB 3N05A 3OE4A 4LYAA 4XWAA 4EUSA 3T7JA 5ITWA 2X4DA 4TN1A 3SD7A 3DZGA 1PS0A 1T5DX 3DE2X 1RPAA 2HJSA 4RQTA 4EJSB 1XPRA 3P52A 1Z6ZA 5LYYA 1YVEI 4LXHA 1LI4A 4E31A 1QKJA 2NTYC 2ZI6A 3ESCA 3V4ZA 4GPBA 4KTVE 4PYKA 5TMPA 4C5AA 1UOPA 3LLUA 3UV3A 1YONA 7REQA 3K71B 3U09A 2HWUA 5T7BA 1TK9A 3CUKA 3UOAB 2YIJA 4DB4A 3TD9A 3WE7A 4A92A 3RVNA 1E66A 3TD2A 2EF1A 2HFKA 3TQCA 3FLEA 3K0AA 3KJNA 4V2IA 1WS6A 1Y4SA 1A4UA 4D26A 2EGUA 4M98A 4Q15A 3P0EA 4ZAWA 3IUMA 2HGSA 1XG5A 1EDDA 2B83A 4R84A 4ZO4A 2DPGA 3RVQA 5BVGA 4N49A 2AKYA 4CI9A 1BZYA 4HPJB 3Q6MA 1MW8X 3ZHRA 1LW6E 3AESA 1SUCA 2WIAA 1RW4A 2BLLA 1R9MA 3V8EA 5C81A 4P53A 3WKEA 4Z7NB 1M2OB 3HN6A 4XWTA 2YJ6A 4OAPA 5DO9A 2QE6A 5DM2A 4F11A 4DR3B 5I7HA 1TYZA 1Z0FA 2L82A 4HAUA 4PCVA 1JEDA 4WKGA 4C06A 4TYWA 2OWDA 2LZ0A 3I9OA 3IKVA 2MSNA 2NO9A 4EHDA 5KVCA 1CWUA 1IY1A 2I66A 3PCRB 1R8XA 5KQMA 1EZ1A 3RTEA 3ILYA 1IEXA 4CV0A 4YO8A 1M2JA 2LNDA 2LDXA 4D9HA 2ZRBA 4HD8A 2ZG6A 2CKMA 4ZO6A 2H17A 1I01A 2IUEA 1Y7LA 2EDAA 3M6MD 3W2IA 3WO1A 4GZ6A 3FLAA 4LYJA 3OLXA 4M8LA 4HDRB 2F8SA 2WE8A 3OOHA 4MVJF 3AG5A 4TVOA 5KUTA 1GNTA 2VRNA 2H07A 1KIFA 2AZXA 3KXDA 4JB2A 3FBWA 1KNQA 5JLAA 3NV7A 5L3QB 5JO9A 3PFBA 3QPVA 3TTVA 3W1VA 4A8JC 2D0DA 5LZ9A 4M1TA 4Y2YA 1J4AA 1W0JA 3LU1A 3OQ6A 3PUJA 3I62A 2XGSA 5C8XA 3AW8A 4PCLA 1QONA 1KYTA 5AHWA 5KCZA 2QTBA 3TN7A 3D81A 3R77A 4EI7A 3HBMA 4HFJA 4AXBA 5FTLA 4DR1B 3R09A 1L5LA 3ZE9A 4D4LA 1NXSA 2VHVA 1TM3E 1ZO8A 1Q7BA 2CUNA 1EFPB 3I4CA 4RQUA 1IK4A 1JBQA 3P2MA 4X66B 2XE4A 3LBAA 5KNCA 1SIWA 4B5LA 4M1SA 1D04A 2AIRA 3LUJA 1JFFA 3KJQA 3O4IA 2YV4A 3RAGA 4FHZA 5BN5B 5A4KA 2CHUA 3GNQA 4ZQIA 4OYHA 2J9ZB 1VYTA 1SVMA 2JPDA 2KLHA 2H2IA 3VMMA 2KE5A 3K2BA 1BQ3A 3N74A 2HCJB 3BSYA 2NSLA 1KTVA 5BUZA 2UVDA 1U7HA 5DBIA 1J99A 3ETHA 4RZXA 4FWIB 2XRMA 1H0KA 2QQEA 1T35A 3F7TA 4KPFC 2QPLA 4GH5A 3VNVA 3SYMA 4Y2GA 1CRPA 3PK0A 2ZAGA 3EAQA 1KJZA 4MB2A 4NBWA 2WM8A 2HSZA 3C2QA 3FTDA 1RU3A 1W87A 3RAEC 2ZU0C 5FTKA 4WCFC 5D6NA 5ITZA 2YNMA 3GY0A 1V11A 3W06A 1CY6A 5LB2A 1GYQA 3WTBA 2W2LA 3MZ0A 2C2OA 2XA2A 3N70A 3G02A 2G5GX 1TCBA 3OQ1A 5FPKA 3GRZA 4TSRA 1K8YB 2XTMA 1N2IA 5LP6F 1Z6YA 3VR3A 5CG1A 5AI9A 3TLGA 3CN9A 4P58A 4KXUA 4F5WA 1DKPA 4P6VF 2G06A 3S99A 2JJ2D 3O82A 1B1AA 4B6QA 4D4MA 3H1FA 3QWHA 3KHKA 2BH9A 2LBPA 4KQ6A 5EKUA 3P8ZA 1QWOA 2FW0A 5K09A 3TR0A 2WFAA 3PDCA 2XE7A 2B1IA 5KNCD 1LUAA 2E21A 2PMCA 2Z2KA 3HKCB 2DH6A 4NG5A 4CEIA 5HZGA 2HPVA 4X45A 2APJA 3LDHA 2GAJA 1NNLA 1FQWA 4LOIA 3I6YA 3RAPR 3VC2A 3QE4A 1JH8A 2PSSA 3PENA 1Z0AA 1Q74A 3GARA 4HEQA 3LW8A 4MCHA 4RH1A 3QXGA 4TVKA 3I72A 1YR2A 3C3XA 4KLNA 4ICIA 2JCBA 3GB9A 3IVRA 5BO5A 3EYWA 1EVQA 3TJMA 1TT5B 5LXTA 4W5NA 3LIPA 3OJWA 3R3XA 1DO8A 4LZJA 4IICA 2Z83A 3WA7A 2GNOA 2GKGA 2YZ2A 3TS1A 4M0UA 2DY0A 1Z38A 1FFDA 1T4GA 3G3EA 3GLHE 3OZBA 2BELA 1P3JA 4JLPA 4AMUA 4PYJA 4GZMA 5BW8A 5CBPB 2WP0A 1NM5C 1ZVJA 1XTVA 3JPYA 4FLFA 5LBIA 2J9XB 2FY8A 1SK9A 4Z7JA 3NM4A 1G38A 2YNMD 4J8PA 5GVRA 4LY3A 3O3MB 4PC7A 3U3DA 3TX2A 1FP6A 1E5XA 3OFKA 3SQOA 1M72A 2FN3A 1Y4ZA 2WJZB 5B5SA 3NV9A 4ARIA 3DE5X 1XA4A 1YULA 4A6PA 4C0KA 2EFCB 1ZVKA 4CCSA 4MRAA 1ZGCA 2C2HA 1JSRA 2C3PA 2I6UA 3NM5A 1QHXA 3OMWA 4JY7A 4Q19A 2DHCA 1TX4B 4MJ7A 3PTAA 4KQ9A 4I3HA 4Z1MA 3I05A 1T15A 2C5FA 4TTIA 3BQMB 5CJPA 4JB3A 2PBRA 2G4LA 1CF2O 2W8BB 4WQMA 5AJHA 2HBQA 4MCIA 1NC3A 4AK9A 1O9HA 1MAUA 1GN8A 3PGJA 4L5IA 3FCUB 4KXNA 2OSVA 5H70A 4ZTUB 3A4VA 2BYTA 2CJFA 3IIJA 4PHCA 4QO8A 1BDMA 1PF7E 4LJYA 3VA7A 3CG4A 2OFWA 3HB1A 3JQRA 4URHA 4XXHA 2OXCA 1AB6A 1D0SA 1E2KA 3CPJB 2ENUA 2JFWA 2VWPA 1GHTA 2IV2X 5BSMA 2J3KA 3TDMA 2BEWA 3QE0A 3C16C 2XDQA 3GC6A 3OLZA 4ES6A 5K3BA 2QRVA 2JFNA 4ZGWA 5ALJA 4ZMRA 3CB4A 3U61B 3I1JA 4K8RB 1WHSA 4LZAA 3NOXA 3FNHA 3VOAA 2HR1A 4O2AB 1YOBA 2BR3A 3OFSA 5ALKA 1S02A 3T1OA 4M1EA 5EJ8A 2AOTB 1PQPA 1XRLA 3PB3A 5FQOA 4V0MA 3CWZA 4CM4A 4JEUA 2EKPA 3W2FA 3FCCA 1GILA 3BMQA 1OZFA 1I9CA 1XD8A 1BC5A 2O5EA 3DDWA 2QPOA 1GQ2A 3MWGA 4WEQA 3Q3VA 3SJZA 2J45A 4CMIA 4ZEVA 3PYLA 1IXKA 4BGDA 3IPYA 4MAFA 4MUYA 3L4BC 5AWFC 5HMMA 3GPCA 1ITZA 4EYOA 4O0MA 2EDCA 4P22A 3UMJA 5FKJA 2P11A 4EO4A 2IGBA 1V7QA 3DXFA 3KOYA 4GLFA 4ZQBA 4BN5A 5JEEA 3BUSA 4BBAA 2CJPA 3VTZA 2HD4A 2OUIA 3BBPA 4LE1A 2FSVA 4OQEA 2YBDA 5FT9A 1OXKB 1U81A 2X0KA 3NWBA 5D1HA 4CMAA 2QTVB 2VBGA 1AK9A 3ZX5A 2IU6A 1FNCA 3NBUA 4NAUA 3WBBA 1CYEA 3QVUA 5EUCA 2BGIA 1PSDA 5G3ZA 1QDEA 3QFFA 2VH2A 3RC9A 3GAMA 3IQWA 3SZRA 4TT3D 4WZBB 4GPZA 2IITA 4AO6A 3H87A 1P73A 5FBLB 5MFZA 1PKXA 1YL6A 4JQZA 4UQOA 3ZOKA 2H4HA 2AOXA 1FP1D 1SMKA 1OSNA 1XCMA 3ZCXA 4HMOA 2VBCA 1DIGA 3C24A 3F6PA 3RHZA 3CCCA 4EABA 2C4HA 2O8CA 1XMVA 3DAPA 3FRHA 2OO7A 2VOEA 3OQBA 1YS9A 1VKRA 3OTWA 1XMQB 4LNUB 1JHVA 2O4UX 2GN9A 2WWHA 2I34A 4S1NA 1WXDA 1K4MA 1UPFA 2V5AA 1QE0A 3H86A 3C5CA 1BFDA 2P2LA 3HI6A 3PHGA 4MQFB 5CJJA 1ACJA 1D6SA 2C83A 5BXYA 2VWGA 1MCZA 1Y8QA 2P6UA 2ZTMA 3CZPA 2YXEA 5P8WA 1GFWA 2IODA 4HWGA 4LOHA 3TZ6A 1PK9A 3CE6A 3PFIA 5FWNA 3DE3X 3PRHA 3JAKB 2OORC 2HYIC 4GIBA 4TKVB 5EE5B 3GN1A 2ZRHA 1JGTA 3FSRA 1D1SA 3DTYA 3G89A 3OIWA 2G8LA 4N8DA 1I10A 1E79D 2WC1A 3W8FA 4AC9A 5FLXA 4MW7A 1YGPA 3L49A 1NG9A 3A31A 3D2AA 4AW9A 4S1TA 3NZEA 1OFGA 4KRFA 4WKOA 5IC6A 2VUHB 4QAQA 4QNNA 1E2LA 5THKA 5DFAA 3HRIA 1EE2A 3R3ZA 2GN6A 2OAGA 1H2EA 3DBIA 1A69A 2IIBA 2EP7A 1PV2A 4IFIA 2CLSA 4M53A 4ZRDA 4C04A 4UPEA 3SX0A 2GZMA 4Y2VA 3BF8A 2WQZA 3DHNA 4L4YA 5EE3A 3NHSA 5KSOA 1A9SA 1LLCA 2FQWA 3DAYA 4GI2A 3U16A 3BK7A 3HKDA 2X42A 5BNTA 1HE4A 3L04A 4W9MC 4MCJA 4FU0A 2OFFA 3D4IA 4G1EB 2VLIA 4NE9A 1V8FA 2WYHA 4RC9A 2H06A 4EW3A 5KTOA 3R3SA 3JZDA 4WNAA 1Y89A 3PRYA 3ANXA 4Q66C 3HSKA 4UNSA 5ALXA 3REFA 1RPTA 5JNUA 3AFNA 4C20A 4MTLA 2JBHA 4Q93A 2V0GA 4FDAA 3ZDQA 3F5SA 4MDYA 1WXXA 4P4SB 1NX9A 3CIOA 4TTRA 5BP7A 2O3JA 4FR0A 2QTRA 4IYRA 2IF2A 2PO7A 2XUQA 4XDYA 4JT9A 5JRZA 3FCYA 3W8DA 3P9SA 4FHEA 5JD3A 1E4EA 2JKZA 1ZA2A 2CV2A 1TLFA 4GMDA 4ZIRB 3GEMA 2XWSA 2JW5A 3SDZA 1PNTA 1PBNA 1AXGA 5BQ5A 4GC9A 4PGAA 4Q01A 4D6XA 4DKJA 2O2YA 4L4XA 4JBHA 4UEQA 3FFWA 4BNXA 2I3GA 2YC2C 2ZUDA 1X19A 3T99A 1RI4A 4P1ZA 3KUUA 3UFXA 3FYHA 2BCJQ 3U26A 3TSOA 2IOYA 3O9VA 2JJMA 1V41E 1N6RA 2V54A 1SVIA 1WUYA 2DPYA 1CUVA 1ANKA 2JIPA 4INPA 2CVFA 4PG7A 5K3EA 3EWSA 3WRXA 4EFKA 2ZBEA 3PIRA 4PBTA 1RRKA 3N1UA 4F2WA 3R5FA 1V1MB 2OGZA 4Q4JB 4EUEA 3VH3A 2YJTD 2G1JA 3ORFA 2CNBA 4CR6A 3MWJA 3UG6A 3DEJA 2ZAOA 3A8TA 3SM3A 1F5SA 5A03A 3RVPA 4ZPJA 3S81A 1JDBB 1YK1A 3OZRA 1PVOA 2XOXA 3TVDA 3AKZA 1XRRA 5KOHB 1FK8A 5EXEA 4H7DA 4Q47A 5CDGA 1MA3A 5TR9A 1C3VA 3FZNA 3HV0A 1I1HA 1W581 3F67A 4AJLA 4MUBA 3RUFA 3WWDA 4PG6A 2VJBA 2B5OA 2C4KA 3U49A 3NRCA 4WXEA 1B8PA 4TRNA 2Y92A 5LUBA 2O2DA 1VFPA 2VJPA 4NWIA 1IATA 5H8WA 3DULA 2I55A 5KHLB 1QGZA 1SUDA 3ECAA 5A3JA 1QUEA 2J0VA 3HVKA 3EIOA 4HGQA 3CH4B 4OQ4A 1MB9A 4UM9B 4KK3A 3RWMB 5KYGA 3UVEA 5CTJA 3FCAA 3FWPA 4RVFA 4YQYA 2YKGA 4PF1A 3FPFA 1Q95A 2J4CA 4MS4B 3IOCA 5KINB 1CR4A 1EDBA 1KMHA 2QJRA 3KVYA 2EBHX 4YAEA 4UFNA 1WF3A 2WVJA 2AJDA 3GJYA 2V6MA 3UUEA 4AG3A 5WRFA 1L4KA 3DMPA 1JIQA 2QN6A 3K05A 4E5DA 2OBMA 2V97A 4RFVA 3ZS8A 1LC3A 2DWOA 4YLYA 2WM9B 2ON6A 4UTRA 3PNPA 5LA6A 2NP7A 1K75A 3TOSA 3OBBA 2FGJA 1HGXA 3PNVA 1XEWY 5A5DA 4MUMA 1M5RA 5AM4A 1E58A 4NFLA 4XSVA 2D6FA 1N0VC 1PR1A 5LM3A 4RLQA 4KX3A 5KYYA 1FYXA 4BV2A 3TGPA 1KPHA 2XITA 5JH7A 5M3BA 3OM1A 3EEYA 4LF6B 5EXDA 5IPFA 5BPHA 2QB5A 1E2FA 1OH6A 1ECCA 1PS9A 3HRKA 3NCHA 3RYFA 1NRWA 1NQOA 3RRXA 3LYLA 1UR5A 1E7YA 2EJTA 5IWAB 2YNMC 2ZPUA 2QD1A 3DMNA 1AUPA 5J2UA 1TFRA 1LZLA 5CVCA 3GMTA 2VEOA 3D7KA 3S1LA 2RB5A 3RBXA 3NIDB 4IHJB 2NO0A 1WR8A 5BMOA 4ZDJA 2CSUA 5MN6A 3KPVA 3TMKA 2QEQA 1JZQA 3QUTA 4RQBA 2I71A 3Q7QA 3V4PB 4BBJA 4Z53A 1OWLA 4G4SO 2W4QA 4WAUA 4A2PA 1A2BA 1RJFA 1R88A 2WWTA 3D1JA 4EA9A 3G79A 5AM2A 5FUQA 3E8SA 4HX2A 1WUHS 2W6JD 4R54A 2AOUA 4RFSA 4BVAA 3L0YA 4I14A 3VBCA 3OWOA 3OT4A 1ZWKA 4PQEA 1TKAA 1DI0A 1I13A 1PYDA 1V5EA 3AINA 3PNYA 1W36B 3VKUA 1UKAA 3EXAA 1IEWA 4IOMA 4KW7A 1L5NA 3WSWA 2BHNA 3QYPA 4KQGA 3BCRA 2A58A 4HQ6A 3FOFC 3U1TA 5IM4F 2F59A 3VHLB 4MVXA 4YJ2A 5KNCH 5HG0A 4IFBA 3W9SA 2DHDA 1MG5A 3I2HA 1WXFA 1Z5GA 2A0WA 2O2GA 5HCNA 4ZAXA 3I42A 5G4KB 3KZKA 2QW0X 4OPMA 3L07A 1ZC3A 4I7EA 1K08A 1S2LA 2NZ8A 4YCBA 1XVTA 4YMSA 3ZWXA 1Y1KE 2ZWPA 1P1JA 4EEZA 3DBRA 3PJFA 3ZBTA 1KJYA 2D4HA 2PPLA 1K89A 2DR3A 3ZNOA 3ZY3A 2ZT5A 1ZM7A 2ACEA 3QXSA 2CHVA 3GWGA 3IVXA 4GZ3A 1E3SA 2A1UA 4HV4A 3OIFA 1Z4JA 2DUWA 4MVJP 5JOQA 1SKQA 1GRRA 1NXQA 1CUJA 1JDZA 1XAIA 2Q0QA 2QL9A 5JS7A 4W9NA 3R3VA 2DFLA 1JR3A 3DG9A 5D3ZA 1T10A 3LNCA 2G7MC 2CVQA 2AL7A 3W6UA 4AN4A 1F1BA 2QLJA 1SXIA 3QEAZ 4RXMA 4HHEA 3JQAD 4LJ5A 3R24A 1W5SA 3AUKA 1NBME 2QLLA 4ETIA 3NM6B 2O19A 4FHDA 3GEDA 4OGKA 4S1PA 4CLOA 1I4EB 2BEUA 4FQ5A 1E2GA 3BD6A 5ALGA 5IAGA 1CJKC 3ZHTA 4IIJF 1H5QA 3DW3X 4JB0A 4YRRA 3FR8A 1C4WA 3GLRA 1IY2A 2WJVA 4IMRA 1QP8A 1IRIA 1QMGA 4RQAA 3L1KA 4JVOA 5REQB 4CR8A 1II8B 3N2NA 3RTGA 3RABA 2I33A 2BR5A 2D7CA 2RAPA 2O23A 2JBWA 1LRJA 1M5TA 2HMYB 2JAXA 2OGWA 3JV7A 4L3OA 3B3AA 4LZZA 4RZQA 4JLVA 1Z16A 1FMJA 1T6BY 5CHYA 4L4SA 2X4LA 3SEFA 3DS8A 3IV7A 1I6KA 1W88B 2ZAYA 2QLTA 2ZZKA 5J4HA 1IH8A 1W48A 4DV0B 1MD9A 2BGTA 3B82A 1WSAA 4DG8A 4QXPA 2VI5A 3F90A 5K0TA 4UCFA 4AKTA 4DZRA 1YUNA 4J7XA 1YF3A 3IODA 5LPNA 1YIOA 1UFQA 1M2GA 4KFTA 4D42A 2VQDA 3KQLA 1A0OA 3HM9A 2I4TA 2I7DA 2HJWA 3IUPA 4QELA 4HMQA 3W5JA 2BGLA 1B15A 1P1BA 2PWAA 4X8LA 3WYFA 1DV2A 3E1KA 3THRA 2Q2OA 4O08A 1PFVA 1NVMB 3E0XA 3RIEA 3UJ6A 1S3IA 5K6RA 4RK0A 3MIIA 3ISTA 2NGRA 3QY0A 4NCKA 1NN1A 4MICA 3JZIA 4UXHA 2ILVA 2CMHA 3DE4X 4YDRA 2FR0A 5DBFA 3U9LA 1N2EA 2D1QA 4AZ0B 2O5CA 1ENYA 5JDCA 4IKOA 2QAGA 3L79A 1JJVA 1K5PA 4ZVRA 1VBMA 4DDUA 1Q1BA 3CPHA 1VKNA 2E5FA 3GCDA 3SYKA 1M76A 3FPKA 2ZIGA 2GK6A 5ADWA 1W4BA 4FFBA 2FSVC 2BGKA 5CR9A 2Z0MA 3PP8A 3WLEA 2GPTA 2AMJA 2J0UA 4F5DA 3MAJA 4DLKA 2ADMA 4Y6LA 1Z07A 3WL4A 5LQKA 4IIDA 3J7AC 2CUKA 1IAQA 2I4IA 1HKHA 3KFXA 3FD8A 4FMCF 2QTFA 4HK4A 5KVQA 4RJTA 1NASA 4MW9A 4Y6PA 4EITA 3LFHA 1GQRA 3L9XA 3KDAA 4O4HB 4N0EA 2CB0A 2QQFA 5K51A 2VTBA 1AHNA 3LYUA 1A9ZA 4MZXA 2M6RA 1AZTA 3ANSA 3GVPA 1RTTA 1SCKA 2W7TA 3KB6A 3PHLA 4HQ0A 4YRNA 2DE0X 3IT1A 4KK4A 4LY0A 1JSZA 1F8YA 1TJYA 4R0VA 4KQMA 3LLMA 1UDXA 1WB4A 3BWBA 1GTSA 3CLVA 3WJAA 2J7PD 2PUWA 2QVCA 2QT9A 4P84A 4MDFA 2BMEA 2GD2A 5JY1A 2QRPA 4J0DA 4OUDA 4LHSA 4UUQA 3OT5A 4KXXA 1G8YA 3LWZA 4DANA 1IVYA 3W5VA 2OHIA 3T15A 3ULKA 1U28A 4EB6A 4MEBA 3NVMB 2D0OB 1Y80A 2F4NA 4YXWD 2H48A 1A8SA 1PFUA 1W4AA 4EHLA 2ZKLA 2F62A 4DQVA 1E2MA 2V0CA 2IYLD 1J06A 3C0KA 4QTZA 3K72B 1OTYA 1QCZA 4YK7A 5E7JA 3TKLA 4HLCA 4C7VA 4F7WA 2VJNA 1AS2A 3B85A 1O9GA 4MP3A 4OYLA 1WZIA 1XRPA 4XQCA 1AVTA 1NMZA 4B4WA 3ENQA 1YJAA 1NJGA 2XE8A 1XQ1A 1FUKA 3RFVA 2KWIA 1NR1A 1R0WA 2PQ6A 3MAAC 4A6DA 4EO7A 5K3SA 3EGOA 4WECA 5T4EA 3ZGLA 1YZTA 1ZN9A 3HKBA 4N18A 2VDWA 5I9NA 1XVLA 2F3UA 2CFIA 1ZEMA 1E3WB 2EKLA 4KSCA 2EFYA 1PK8A 2G6BA 4FFWA 2QVZX 4JS0A 3NPAA 4YCDA 3WYEA 2QIPA 2H8KA 4AS2A 2H4JA 1WCYA 4MYDA 4DREA 5HK9A 4ILEA 1II0A 2X6QA 4E46A 1MJHA 2BZGA 2G83A 2H1HA 2H92A 4PFQA 4QECA 1GUDA 4X5OA 4F1JA 2ODTX 2R8YA 2ID7A 3L43A 4LJ6A 4QHYA 2I91A 1CR6A 4BNUA 4R0MA 2XCRB 4PTZA 3KSBC 2OZVA 1RLOA 4WN9B 1J1UA 4MUGA 4IY1A 4J2OA 2ZRNA 5CA1F 1TVCA 1CUAA 4FWBA 3JRWA 2SKDA 5A06A 2C5HA 3FZQA 4K5QA 2E82A 5TS3A 5KWEA 3ZJ5A 2W22A 3P9NA 3V3TA 4E3ZA 1PZEA 1YACA 3MVEA 1K27A 1K97A 2PLWA 3OD1A 3AVOA 5EJFA 3F47A 1DIOB 1G5PA 1ZD9A 2VJKA 5AP9A 3C6XA 5LYJB 5EKTA 1Z75A 2G04A 3CLSD 3MG9A 4UREA 4K6OA 5K8JB 3A9SA 5JU6A 2VAVA 3WRXC 1L6RA 1ZHHA 1OVGA 2CVHA 2VA9A 2WHQA 4QVIA 4PVDA 3KR2A 3CNNA 5HX7A 5KWJA 4LC0A 2P3LA 3ZU6A 4A8JB 1UBTS 4Z54A 1YDHA 1Q1AA 1BHO1 2HDWA 2JFQA 1EGMB 1C3OA 1YDMA 2GYVA 2Q5EA 2G4VA 2OMEA 3HWRA 3OZAA 2QJWA 4DXAA 5CLLA 4YRSA 1L4UA 3EMBA 3G0OA 4Q6BA 3WICA 3WWPA 1CDOA 1NBWB 2J59A 3H3JA 3NTUA 3OU7A 1EUCA 2L69A 1Q77A 3DEZA 4REOA 4TV8A 2Y1OA 1T43A 3S6JA 2QL6A 1BWPA 4IDDA 4U5QA 3U13A 3WSVA 3V7FA 2PXXA 3M0EA 2JI6A 4DJ5X 4WUVA 3MCTA 3WGJA 2JFVA 1EQ2A 1VG0B 2OHJA 1VHWA 2V7QA 4I1YA 3T3MB 3X43A 4PAWA 1JEQB 2D5LA 3FGOA 1J8DA 5FWYB 4XFKA 5DLYA 3COSA 4Q18A 3DBLA 3S40A 4ISBA 4WLNA 1J9GA 3UK6A 4BNMA 4CFYA 4ER5A 4EW6A 3WRYA 1EK5A 2XLBA 4FDUA 3PJRA 1I6MA 4KP7A 4QPZA 3LQYA 4XJVA 5CYOA 4EG7A 4EYEA 5GV7A 1GVNB 1P5RA 1EXDA 4L0QA 1Z29A 4CV3A 1U3WA 3MOSA 2L18A 3OOYA 3HPQA 3D3NA 2X8BA 2X9NA 4EDHA 3FCSB 1CV2A 2VO1A 4GECA 1H6DA 4P3KA 3X1YA 1WAMA 1H8EA 2I3BA 1UK7A 2YZGA 2YCBA 2K7FA 4UTPA 3AFIA 3GRYA 3QRWA 4H4DA 2IYXA 2GNAA 1PW5A 2HL6A 5IDQA 4CPDA 1N8NA 1XC7A 4Q02A 2NU9B 5CDYA 1CEXA 7ADHA 2JI8A 1KP3A 1MUUA 1NI5A 3BGIA 1SXJE 2CVPA 4LSWA 4Z0TA 5SYMA 4HVLA 4E70A 3OOEA 4OAOA 4XGNA 5EA2A 4ZYZA 1N36B 2VDUE 1WXIA 2Z2IA 2VT3A 4C43A 2PX3A 3TSAA 4QJ5A 3MBIA 3L8HA 4M83A 1UCFA 5E2IA 2YH2A 4IWYA 4D9EA 5JASA 2WWRA 3GP5A 2OILA 2VJYA 1PTKA 1YR3A 2QYOA 4PRZA 1MC8A 3N6VA 4UOQA 1ECJA 3LDUA 3R5JA 3TNJA 2IVFA 4RA6B 1EP1B 1JLLB 4G5OA 5B1IA 2GKOA 5COQA 4EBBA 1L8LA 1H2BA 1MA0A 3AQIA 1U0OC 2VZ9A 4HDNA 2BHSA 4JMLA 3BZBA 2XQFA 4LK2A 5H16A 3NT2A 1MXHA 2ZUTA 3UWOA 3ZG6A 5HKOA 2KJQA 1CCWA 2DY1A 4F5EA 2QU7A 3BJMA 2AJLI 2Y2VA 3ROFA 4DCPA 2WB2A 4LCJA 1RJ9B 1LC0A 3HLYA 4U7HA 1KO7A 4A3SA 5AXDA 2YC4C 3NDJA 4Y2RA 3Q3GE 4NF2A 5E6SB 3C4QA 1HMPA 4E30A 4L76A 1P4RA 3VNQA 3OZGA 5AJZA 3SC2A 4A16A 7MDHA 2WSMA 4M4SA 1JDVA 5CGZA 2QM8A 3KYIB 4X20A 3COPA 3GVXA 4PTYA 4C0JA 2NM0A 3QQ5A 3C5WP 1WWKA 1XZIA 2PPVA 2QD5A 2R5FA 4H17A 4X1OA 1Y3DE 5B1EA 4BFTA 4M8IA 1A95A 2ZYDA 2FZLA 2WMNB 3AXTA 2FYTA 3MWDA 1WXHA 2NU8B 4D02A 2I4MA 5F33A 2RHDA 5AKHA 1IXSB 4G56A 4IQFA 2HA4A 4BMNA 3O8NA 1EGAA 3IA7A 3J7TA 4G5RA 5CDSA 3FTFA 2BEJA 2EBWA 5GZ3A 1LXCA 4DIUA 1JEYB 5AVQA 3S1AB 1ZP6A 4JKYA 4WDRA 4HBGA 4LFCB 4AY6A 4I3FA 4HH1A 1QVZA 4KQXA 1VI2A 3L5KA 4B7UA 2X1LA 5F1OA 5C8DA 3WYNA 3BQNB 5IH3A 4W9NC 4KXMA 4LQ4A 5K6AA 4UOZA 3CSDA 2UDPA 4N39A 2XA9A 2V45A 3OTIA 3FCOA 4LYEA 4CF7A 1DC8A 5FBHA 4MWGA 5T64A 1DDGA 2E9SA 3VHRA 5A6VA 2ZRAA 1LBIA 2GSDA 2JAUA 3L6EA 3K2EA 1REQB 4ID3A 4MB0A 1AO3A 3D0OA 1B0PA 1X7WB 2IXEA 1NC1A 1SQGA 2JJ1A 4EUNA 1W4RA 4X1IA 1MZPA 5I8ZA 1O94D 5IAAA 2C4WA 4GXNA 4M87A 3W0LB 2R8EA 3N2LA 1P17A 4EGJA 5K0SA 1H2WA 5I45A 2Z5VA 3EG9B 3R0JA 4QZVA 4O1HA 4PFSA 1C8BA 5IKPA 1NJ6A 2GZ1A 3HGTA 4FZJA 3V55A 2FZ5A 5GADl 5F5XA 2R48A 2GH1A 3JQ8A 1YKSA 4M3NA 4Y30A 2Z1NA 4B85A 4BMZA 1WU7A 2P4EA 3L0PA 4MQEB 3AETA 4P7GA 2JFOA 5I9LA 3ZK7A 3AIIA 5BMVA 1D2RA 1NT2A 2FJ0A 5D01A 2QX9A 1QKKA 5A4JA 3KNZA 1NN0A 3LO8A 3N86A 1Q7GA 2J67A 2I2BA 2I03A 5TQ0A 3QEBZ 3FETA 3B9QA 4JLBA 4WFIA 5F2OA 1T0UA 3O93A 4Q7QA 5AVTA 2X77A 1VYUA 3QSYA 2BHLA 1YKFA 3AHJA 1OFTA 1YB1A 4E11A 4IVRA 5J1SB 3KL4A 3RVDA 3ZQ4A 2CUZA 1R9GA 2O7RA 2XXJA 1GADO 3P4YA 3ORHA 1M2VB 2X0IA 3ZVNA 2VDLB 1YQTA 3VPDA 4E07A 3KZCA 1CJTC 1UJNA 4B45A 2GB4A 5JDCC 4E5UA 2QAGC 1P19A 5EIBD 3JVDA 5JZMA 4ZCLA 4BGEA 5E1DA 4RSHA 1LV8A 2WJWA 4K2HA 1D6NA 5ECYA 3HN7A 3PJDA 4XLLA 3GP8A 3LLCA 4WT7A 3I2GA 5FIUA 4DB2A 1KVUA 1GTZA 3JQGB 3OX4A 3VU9B 5A2QA 5JXHA 1QBGA 3NTXA 2DT8A 1C41A 1NYLA 4UXJA 2IY9A 5DGXA 3DWGA 1JLHA 3SYTA 1ID8A 1GQQA 1T4DA 2ATEA 2GZ2A 1NXWA 3CZCA 3HEBA 4G41A 2EIXA 1YJBA 4C08A 3TB6A 5C7LO 1PO7A 2OCKA 1SOMA 2QJFA 2FWPA 1CQZA 1ZOLA 1O8CA 4TGLA 2GERA 1FF9A 2C0CA 1V7CA 3BE6A 3RBAA 5AI4A 3EXEB 5CW1A 2H1OA 1DPGA 1KDTA 3ZJ4A 4KJXA 3RT7A 1A8IA 1JFVA 1L0BA 4MWCA 4ZMBA 1IWBB 3RAFC 3HCDA 2UUAB 4AMBA 1QSGA 3BWYA 3IVCA 2QVBA 4NCBA 3LC7O 3REQB 2NO5A 4HTFA 5BV0A 5I9TA 1U2SA 4ZZIA 1LPNA 3DEAA 3T0GA 3QEJA 5IBRA 4C0HA 1WRBA 2C94A 2EP5A 3CUSA 4GDFA 1FFGA 2J4DA 3L8YA 1U28C 1KTIA 2FW1A 3KELA 4DDKA 4OHVA 4RGYA 4O2AF 3LT1A 7REQB 1ZHFA 1C9JA 5J5VA 4CG3A 1VJTA 1KJJA 2CXHA 5K3FB 1FBTA 4KR6A 2P3SA 2JGLA 4UUAA 3EIUA 4YALA 4CMKA 2QTMA 4JLNA 2K2QB 3V1MA 1YZYA 5F51A 1C2YA 2V9ZA 4RY9A 3K0AB 3TQSA 1ZA1A 3I5UA 4RORA 3A37A 3QA3E 2NP6A 4GVPA 2C3UA 2GZHA 1X3LA 4RF5A 1GUYA 3QNMA 5JYEA 2ZT7A 2A5YB 2O50A 1Q7CA 3D1VA 3K35A 3OY7A 3RVBA 1IIRA 3NHUA 3PHIA 2RFLA 5AI6A 4KRYA 4U6NA 4WADA 2C1XA 4AP6A 4ZAZA 3IH5A 3AESB 3LUGA 1JU9A 3C3BA 3M4ZA 3H65A 4F6LA 3SFVA 2O2XA 3ICWA 3IPRA 2V4UA 1DBQA 2X0JA 1FJGB 2WK1A 2HJ9A 4EY8A 5BORA 3AFGA 4NXMB 4OQQA 1GTVA 3EBOA 3RUPA 5BSRA 2PT9A 2QJOA 4BJHB 2CBGA 2OZEA 1SRQA 2VDOB 4YDSA 3BREA 4TTSA 2E4WA 2XTZA 4NZYA 4F9GA 1S7CA 1GAXA 4EATA 2XX3A 3IAS1 3AZQA 4IO1A 3CVXA 4NBRA 3LJKA 3VVBA 1YQGA 2UYOA 1SVKA 4RBNA 1V47A 1D6JA 4I81A 4ZQGA 4CF3A 4MHTA 4B8WA 1U7DA 5KNBD 1CJSA 1OU0A 2HA7A 5IF3A 5CFOA 4EVQA 2XNJA 3FIUA 4URVR 3L6DA 1FU7A 1E7MA 4BATA 3WNZA 3JQBA 1YHZA 1C4XA 2VUUA 2H0AA 4PZDA 3K0EA 4MO9A 3M4JA 2ORIA 2UZ1B 1U0HC 4TTAA 4ZU1X 2J3JA 2FPSA 2PX0A 3GFSA 4ARVA 1RXUA 1T8WA 5J4YA 4M1QA 5JLJA 1M0TA 5DYGA 2NV6A 4WJLA 1GFIA 1OZAA 2VQ6A 3SHQA 2WKSA 2YIDA 2F1IA 3BEOA 2GS9A 3V5NA 1NRJB 1YZQA 2PMKA 1GOTA 5KC9A 4FYIA 4NZOA 3E9DA 4R9SA 3K8YA 5ALEA 1KZ9A 1FXUA 2W6ZA 3I09A 4EAAA 4C1BA 3KEFA 4JLOA 1K7XB 3H7IA 3MJCA 1RYDA 3PC3A 3LPLA 1U2PA 2EKBA 2R8OA 1DQNA 4B6RA 2JCSA 1X7GA 2PWPA 2EC5A 2H65A 2HTFA 3AF3A 3WP1B 4OB7A 5F35A 1J6UA 2R97A 5E3HA 5LQCA 3ADOA 1UP4A 4I5EA 4YAOA 5EFOA 2QRKA 1D4OA 1B2RA 1YOVA 2VCYA 4MUHA 1KMQA 3WRYC 3RJZA 4RTQA 2JDID 1C7QA 4ESHA 5H0IA 2XKAA 3H6GA 5KAPA 1LSOA 2E1PA 4JA2A 3SHFA 4ZJUA 3EUWA 1M67A 4N5MA 5C53B 3B5JA 1KSGA 1ISJA 1R8QA 3CT4A 3V7UA 4K9RA 2WICA 4JZYA 4AU1A 1J1ZA 2C03A 4EHBA 5J1TB 1G41A 1MW9X 1P0FA 5BV8A 3UH1A 4KJZA 4XW2A 3QFTA 3B13B 3Q88A 4RZIA 3T1HB 3CNBA 2QG6A 3GJ4A 3SP1A 3PLNA 1IIBA 2OZLA 4EJFA 1N0IA 1NBMD 2C77A 4G9BA 2XADA 2WEKA 1JA1A 1XD9A 2ZIVB 3EF0A 2YHUA 2X14A 4AP5A 4RTMA 1Z0IA 4HZIA 1V11B 1XNHA 3UA4A 3RE1A 1JQLB 3QBTA 2XCUA 3UBMA 4ON9A 3UY4A 4TZTA 3K0BA 4GP9A 4CI0B 2I4RA 2BF4A 3OEHA 4ZC8A 3LTEA 1JU4A 4ZQFA 3WK5A 2VTKA 1UH5A 2B1QA 2QE7D 2R87A 1DGQA 2F90A 1O3YA 1R6DA 1TA4A 3TLGB 1H4TA 1OX4B 1HTTA 2OVFA 1F2TA 2FOLA 1SXQA 2ZATA 2YWGA 3CVOA 2AWNA 5BWLA 8OHMA 2JRLA 2G9RA 2JB9A 3ILVA 1HE2A 1AUQA 2Q28A 5C34B 4MOWA 3WNVA 2JAWA 1HM5A 5EXTA 1ZGJA 4PO9A 1WUIS 4NSNA 3WLFA 1FRNA 3DVSX 4J1NA 1S01A 2BKAA 3O95A 1QLJA 3FLMA 4HAYA 3HY6A 1YR7A 1Q6ZA 2VYNA 3HU2A 3PX3A 4X6UA 1BMTA 1YCGA 1YR9A 3U4DA 1D0VA 1Q0PA 4R2XA 3FPEA 1X1RA 1Z6PA 3ETLA 2OP1A 2KM1A 3H4IA 3AOGA 3D3QA 2DTXA 3GNLA 3UFBA 4AUKA 3W3AA 5EJ7A 3EWNA 2DPMA 4KNWA 1N9GA 2WVHA 4J9UE 1K7EB 2NSJA 4IJUA 3PC8A 1M8GA 1FL9A 2X9GA 1PEAA 4PINA 4A5SA 1E1CB 1O96A 1V5IA 2XUOA 4BQFA 4GLLA 2PU7A 3PNMA 2FVYA 4I50A 4MKXA 2RC5A 3IDFA 3ONDA 4DCTA 4YPOA 5ENDA 5EOVA 2R1VA 3PFCA 1IN1A 3ZXUB 3NBKA 4G9EA 1WBBA 3T0IA 1D2HA 1D1QA 1DX6A 3CT6A 3Q9LA 5K9ZA 2ORED 4ALMA 1Q7RA 3GMSA 2Q6LA 3MOGA 3D1LA 4B75A 1EKXA 1MJNA 3OM8A 4XEHA 2ZJOA 2WJ4A 3R5KA 5LQSA 3OZ7A 4LNHA 5GM2A 4FR5A 1IBSA 2O8FA 2ZSHA 3UMVA 1BWQA 1QQAA 3OEHD 4R01A 1TJ5A 1PGQA 1WB6A 3MLEA 4OBXA 2Z2YA 5KNDA 5DYIA 1D4FA 1T2UA 3WADA 4BZXA 1EGVB 2IYNA 1JMKC 2ZYHA 3HA7A 3R41A 2JCVA 2V7BA 4PXSA 4UJ5A 4HAVA 3ASZA 2FRXA 3LZ6A 1RQLA 2PFGA 4TXHA 2C5GA 4JP5A 3N8HA 4XVQA 5SZKB 1CRLA 1NWHA 1D5WA 2OBXA 2XF8A 3E70C 3I9FA 2ZIUB 1XZKA 3UO8B 3KQKA 5GINE 1N8KA 4CT0A 2A86A 4MGEA 5H80A 4DDTA 4QGHA 3GD7A 1EXNA 3GDWA 2J5BA 1GR0A 4B1FA 2QV7A 2VYND 5FFNA 2JCGA 1E0AA 1EE9A 1XLTA 3GCWA 4D92A 4IHJF 2BTQA 5B58T 3ETDA 3W6PA 4WLVA 1IMOA 1IG3A 2IW3A 3GJRA 3WQHA 3KPUA 4NJOA 5IXSA 3UMMA 1BEZA 1QFZA 1V4NA 4HEHA 3AP2A 2GHRA 2GK3A 4DRXB 2O9JA 4DWJA 2XDQB 1UM9B 3EMKA 1FLDA 4YBRA 4OI0A 3VPCA 3GJ3A 4JI7B 1WHSB 3BMNB 1QTQA 3LXUX 3SXJA 3UN1A 2R4UA 3CVVA 3LUAA 2XJ4A 3Q1KA 4ZI7A 3JALB 1TQDA 4LQDA 4OI2A 1UXKA 3LDFA 4YACA 3C48A 3QX7A 2X0FA 4CM4B 4I4CA 4DA7A 4M6WA 2HY7A 3BMQB 3F9IA 3SX2A 4UDXX 3G9QA 3BGOS 3W78A 3UJDA 1AX9A 2QV0A 4CU2A 2P8SA 3IR6A 4NYIQ 3RC8A 4FYKA 1HXHA 3RYCA 1I4DD 4YYZA 4CMIB 4OEHA 4MHSA 2NVBA 2Y99A 3BIJA 4KX5A 3IEVA 4FDMA 3K20A 3HXQA 2N1MA 3LRTA 1SCQA 3RRZA 3AHEA 4OHFA 1AHIA 2DZDA 4N12A 1V48A 1FYDA 4I3GA 5HJ2A 1MOQA 1O5OA 4QIHA 3FGPA 3OMLA 1Z7EA 3RRFA 4AYTA 5K8UA 5BN1A 4M0PA 2RH4A 3VHXB 2WHPA 1ZONA 1D7OA 1R2QA 1Z5PA 2X23A 3DDCA 4P3NA 4ZODA 2NUTA 2BL4A 1E8DA 2DOKA 5B3KA 2WTEA 5I01A 4R1NA 4TS3A 1T5TA 2FRDA 4CDMA 2ZZNA 3KYDA 1LSSA 3BWEA 3DD1A 2O8EB 4JQYA 4II7A 4AKHA 4HWSA 3W8NA 3A6PC 4KPGA 5HCUA 3RR2A 2QG4A 4NBVA 2YWCA 4JUBA 1G5HA 2JHPA 4CKBA 3DC7A 3RYHA 1V8PA 2HREA 2ZT6A 4TMVA 1E3LA 2IYYA 2NTNA 3MYRA 4Q05A 4R69A 3K94A 2I2AA 4BFZA 1W4ZA 5EVJA 2WUGA 3NIBA 4OQYA 5HEKA 3SC3A 1QRUA 2EYQA 1PEKE 2VF2A 4K9DA 5HQJA 1XE3A 1NMXA 1HC7A 2ZRQA 5MFPA 3TSZA 3OZVA 1Y8QB 4JJGA 2AX4A 2PQ2A 4J76A 3TNLA 1R6TA 2V6IA 1BEUB 3BEDA 1KE2A 2JD1A 3EW7A 4PFKA 3RU2A 3EGXB 4U8HA 4ND8A 4OREX 1ES9A 3O2SB 3F6BX 5JZBA 2I6FA 4GM0A 5NLLA 1TKBA 2DP4E 4JYMA 5DOZA 1XTIA 4RTLA 1I4OA 1JHYA 3OO0A 4MKIA 2Y9MB 4OFWA 5BV2P 2C5LA 1ORDA 3EVTA 4WRRA 1ZISA 1QHIA 4RZ2A 3AEZA 5I4BA 4HYTA 1F14A 2HHCA 2QLNA 4MUEA 2EXXA 6CHYA 5AVKA 2IYSA 3KU1A 4FSXA 1NPYA 4P3YA 1O97D 3COZA 4R1QA 1EQAA 1EUZA 2P35A 2ZXFA 4QOHA 1H2HA 1JKJB 3QVWA 2PZJA 4UU0A 1UPUA 4B84A 1NW4A 2CC2A 1SU7A 3M2TA 4TMFA 3A70A 4CUKA 1N7IA 1RXWA 2ZRKA 2OQ2A 1DBWA 3HKDB 2XWBF 5K3CA 2NZXA 3DGEC 4NZZA 2ORWA 5TY0A 5ABPA 1HMYA 4IOJA 3DDNA 4HDKB 4KWEA 3N0VA 5JNTA 4EZIA 2AF4C 4MVJG 1WVIA 2P5YA 1P2UA 2OB2A 3JTEA 3KCQA 4N0DA 4ANFA 4YCSA 3SSAA 4CBVA 4YRIA 1U8FO 2EIHA 1RJDA 2Q2NA 4B3RB 2IEYA 4FLMA 1WQ3A 1KQ3A 3VGJA 1XCOA 1SXJD 2SKEA 3U3JA 4J0KA 3P2EA 4OYYA 4C88A 2QM0A 2NMVA 2H1VA 2G0AA 2QUAA 1C5KA 2XXBA 3QVGA 1QWSA 4H6XA 4A10A 1JPJA 4P54A 5FWDA 4DDHA 1NBEA 2JIDA 5G1OA 4B9AA 4DYHA 1ZOIA 4C30A 1EVLA 4RLHA 5KBYA 1ODFA 1XTPA 3GJSA 2HV9A 4GYYA 3S2GA 2V6BA 2HA2A 2QTHA 4REMA 2CLIB 3WO0A 1WOMA 2CNDA 3I9V1 3NYRA 3TNFA 2J5RA 2FN7A 3NHPA 3QUCA 2XPCA 4PLCA 3V8MA 1VL8A 2IDKA 4O4HF 3IEUA 2ETXA 4GBMA 5B2EA 3KYCB 5K4HA 2H7YA 5JCXA 3IXQA 2Y0PA 2PMFA 2Q6KA 3B20A 3TLBA 3UYLA 3MIZA 2GLUA 2BI4A 5ECDA 4LWZA 1IPFA 1E8NA 1U8CB 4FUTA 4I4NA 4ISCA 2R44A 4JVSB 4O0LA 1W85B 3CXUA 4O25A 2R8RA 3OQJA 3JQBC 3KR9A 4I9GA 2V7PA 2Z04A 3KBOA 2AA3A 3W6ZA 5JNRA 5KNBH 2QVGA 3K70D 4IQ0A 2ZVJA 1T4CA 2UXBB 5HIJA 1X7XA 2WW8A 3DTVD 3STUA 1BYUA 5IM5A 3RD5A 4E2YA 4OF4A 1ZVVA 1JUDA 2E4ZA 2HJVA 3FI9A 2W83A 3T4EA 3MTBA 3ZHZA 2HA6A 4ZOLB 5AUNB 2AFVA 2R79A 1X38A 3QU7A 3PNSA 3ZGNA 4DV5B 3R40A 3R8FA 2GYWA 1VTKA 3A26A 1ZOSA 1W30A 4F21A 1I24A 2W43A 3LWDA 4N7MA 4ZI3A 3C74A 3EB9A 3V1LA 5LN1A 3A1NA 1OAAA 1JB1A 1HG1A 1ZCZA 3IOMA 4QYIA 3UB4A 4CLRA 4ZT4A 2NO1A 3F6RA 3RB8A 1WSBA 5DX1A 2O1EA 3AHCA 4TPKA 1KMHB 1NT4A 5TPWA 1O6FA 4MA5A 3AUTA 1FNDA 1ZXBA 4MNTA 2QYSA 1UZNA 3E3AA 5K3AA 2CF5A 3RF7A 3HA2A 1ZHOA 1VIDA 3AM5A 5HDQA 4I0WB 4OK6A 1DAPA 2OA0A 4D4KA 1DP4A 4L75A 3VPSA 3AR2A 2YHIA 1NVFA 1K6JA 3F1LA 5LA6B 1GRVA 3RVMA 1AZWA 2FE1A 4D2IA 1YA4A 2HBYA 1QH1B 2OT3B 3E5NA 4F46A 4NE7A 1XTJA 2ID4A 1E7SA 2C7RA 1MOPA 1Y8ZA 1V1JA 2D2FA 2CL0X 2LRHA 5KYYB 2G40A 3OCWA 1PFWA 1CP3A 3KALA 1MJGA 2IYZA 4RL4A 5JH7B 4A0HA 1KP9A 4IIBA 2MYTA 1EWYA 1P62B 3ONVA 4JLWA 5FQNA 1U1FA 4HY3A 4F4HA 2IZZA 2EOAA 4OOFA 4Q4LA 3RYFB 3VDMA 1V39A 2FEXA 2OO5A 1ZVMA 4LBVA 3D3EA 4ZV7A 4DQUA 4YX9A 2PK3A 2WJJA 1AQUA 2GAIA 4GX0A 3SS7X 5DYYA 2VSXA 4DCMA 2SCUB 4NOKA 4W7SA 3IEMA 3FMFA 4I5IA 3VVLA 3HI4A 1BQEA 4KV7A 2FWIA 4PZYA 5LYJF 1TO1E 3JQAB 4GP7A 4K9PA 4TV9A 5HHTA 4UNQA 1XWFA 2ZR7A 1UZUA 3B9RA 3PUXA 1YASA 2ZIZA 1ZAYA 1JS1X 1JILA 2FDXA 3FFBA 4ZT3A 3AUSA 4E32A 3AYZB 3WRVA 3HDJA 3JD0A 2Q7DA 4KIGA 3EISA 4UMVA 2BWJA 4ZYTA 2ZUFA 2JHFA 1N5OX 2ZYAA 4YN3A 4LGVA 2OV3A 2M1XA 4NBUA 1RVDA 1Q0QA 4AZ3A 4P4UA 2PS3A 4CM5A 4B6EA 4EX6A 3P2JA 2CSXA 4YJ2B 3X1MA 1A8UA 2H16A 4L57A 5G2OA 1KYZA 3RODA 4C2UA 1DFIA 4FXPA 2DU8A 2P7HA 3C6BA 1SB9A 2EFJA 3F4BA 4M0DA 1H2YA 4NZNA 3MCVA 3PC8C 1XTRA 4O2LA 2ZYSA 2P1RA 5ERXA 2GASA 2XAAA 2AE2A 1TUIA 2V6JA 1BG6A 2BMWA 3S2YA 4R6XA 3PQ7A 2B21A 2ZTHA 3DBRB 4CN8A 4DSZA 4UNRA 3L8MA 4MO2A 3S55A 2VHJA 1QAMA 3B2EA 4DEVA 2VA8A 4O33A 3JQ7B 5LQUA 3HZHA 3PPWA 1Y42X 1FFBA 1OX5A 2A5GA 3V46A 2O2HA 4LJ7A 4XB2A 1L7VC 5BR8B 2BFDB 2AG1A 1IHDA 1RI2A 3H9BA 5AK5A 4UCWA 3MJHA 4EEXA 3CW8X 3F73A 3NP9A 5EWJA 1H85A 1UUFA 3N8KA 2QHXA 4V24A 1FTSA 2FW8A 2VJOA 3BICA 1CY4A 4AD8A 3F5DA 2ZJ0A 1HF3A 1D2MA 1HSZA 1X9IA 4C7JA 4X62B 1EFDN 4KHPB 3RWOA 3TLEA 4RYDA 3GFQA 5AIBA 4CIAA 3RTCA 2IYWA 3WGMA 3OUUA 3ZGYA 4HNUA 3V8NA 4LCEA 4ZV4A 5TE9A 4YRZA 5L3SA 1DAGA 2GGSA 3MMZA 4XZ3A 3EZ9A 4ENVA 2BEUB 1KFEB 4B3IA 1VM6A 1WDKA 2X6TA 4LZWA 4TXNA 3HLTA 4XCVA 4A1OA 4ZK2A 3FMOB 2WJHA 3M4XA 5HRCA 1B0UA 3TR6A 4KWTA 1JTFA 1ORIA 2C7QA 4RDHA 4XJSA 3WZMA 4ENQA 9LDBA 4ND7A 1RAGA 2Z9DA 5D5HA 1W0KD 5I7FA 4CLEA 3O83A 2OCGA 4FE4A 7AT1A 1ENZA 4BQEA 3DZHA 3M6WA 1YKGA 3BRQA 5IVIA 5JAQA 4MXDA 1T9GR 3EQ2A 1XLTC 2IPNA 5HUJA 3KC2A 2LTAA 2NAPA 3GAZA 4Y1RB 2QNIA 4IDEA 5A2GA 2NPIA 3MJEA 5CP8A 5ILGA 5K0BA 1D8TA 1YRLA 5F64A 1QGYA 1N75A 2Q9BA 3OZFA 3F6CA 4OKNA 5K2MA 4INAA