3VK7A

Crystal structure of dna-glycosylase bound to dna containing 5-hydroxyuracil
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
288
Chain Sequence
PQGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of viral ortholog of human DNA glycosylase NEIL1 bound to thymine glycol or 5-hydroxyuracil-containing DNA
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase/dna
molecule keywords Probable formamidopyrimidine-DNA glycosylase
total genus 82
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vk7A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3vk7A01
4JI0M 2UXBM 4GKKM 3VK8A 1FJGM 4X65M 4JI2M 3GPUA 1K3WA 4DUZM 1HNZM 1Z5CA 5ITXE 4DR5M 4DV4M 3GQ4A 3T1YM 1NNJA 2E5LM 1Q39A 4OX9M 4DR7M 3SAUA 2UUBM 4PDIA 1IBLM 3GQ3A 3GP1A 4LF4M 4NRWA 4DV7M 4JYAM 1HNXM 2ZM6M 1IBKM 4DUYM 4G4RA 4X64M 1Z5AA 4K0KM 2F4VM 4YHHM 3U6QA 5ITXA 4LF9M 1XNQM 5A2QS 1L2CA 1KFVA 3A45A 4PDGA 3J81S 3JR4A 2ZBKB 4JI8M 4B3RM 1N36M 2HKJA 1MU5A 3TWLA 1I94M 4CISA 3GPPA 4JI1M 2F5PA 3U6DA 2XZUA 3SBJA 2XZFA 1Q3CA 1Q3BA 1Z5BA 3C58A 2OPFA 1J5EM 1XNRM 2F5QA 3SAWA 4LFCM 4NXMM 3GQ5A 3SAVA 3U6PA 4LF8M 1HR0M 1HNWM 1L1TA 2UXCM 4LFAM 1EE8A 2EA0A 1R2ZA 4B3MM 4B3SM 4DV1M 4DV3M 3OTOM 4DV0M 4PD2A 3U6MA 3U6SA 3T1HM 2F5SA 5IWAM 1N34M 4B3TM 3TWMA 3GPYA 1Z59A 3U6CA 1L2DA 2F5NA 4LF5M 3DOAA 3SASA 4LFBM 4DV6M 4LF6M 5ITTA 3W0FA 4YY3M 5ITUA 5LMNM 4DV5M 4AQYM 1TDZA 1MX0A 3JR5A 1L2BA 3J7AS 5LMUM 1K82A 2UU9M 4ITQA 4JI6M 3A42A 5BR8M 4X66M 5FLXS 3U6LA 3VK7A 2F5OA 4G4NA 4DR6M 4JI4M 5IT9S 4JI5M 1XC8A 2OQ4A 1N33M 2UUCM 4JV5M 1XMQM 5ITQA 3GPXA 4G4OA 4DR1M 2VQEM 4JI7M 1XMOM 1PJJA 5ITRA 3SATA 3TWKA 4DR2M 4PCZA 2UXDM 1TDHA 3J80S 4JI3M 4DR4M 2HHHM 4KHPM 1R2YA 3SARA 4GKJM 4NRVA 1L1ZA 4NXNM 2VQFM 1IBMM 5ITYA 1N32M 1PJIA 2Q2EB 3GO8A 4LF7M 3U6OA 4DV2M 4MB7A 2UUAM 3A46A 3JAMS 4DR3M 4X62M 1K3XA 1PM5A 3U6EA 4G4QA
chains in the Genus database with same CATH superfamily
2DAMA 4JI0M 4IBFA 3KSJA 3VK8A 2XH9A 3M6AA 3FD9A 4RKUF 4JI2M 4IBIA 2YR0A 3C3EA 3Q8XA 1LV7A 3T15A 1QDTA 4AW4A 1TGUA 1G41A 2DWLA 1L8QA 4CIZA 2CFOA 4DR5M 2KNZA 3T1YM 1NNJA 2JA2A 4LZJA 2CV1A 2KW0A 3GLFE 4GHAA 4DR7M 4B7HA 4B7GA 3SAUA 3FRHA 2HAKA 2JY7A 3M7GA 3TL4X 4MGYE 3FUUA 4DV7M 1VEJA 3AFHA 4GHLA 2LXEA 4NOOB 3TPZA 1IBKM 2O5RA 3FUTA 5FTJA 4K0KM 2WSCF 2O25A 4OVZB 5ITXA 2QP9X 4MH0E 3CF0A 4XBOA 1W5SA 3LCUA 4LJAA 2KDLA 2H5XA 4P16A 4LZZA 1OIZA 1N36M 1XXHB 3AKZA 1I94M 3GLGA 1PJTA 2KXEA 2F5PA 3I04M 2LBCA 5EQTA 4IBBA 4MGIE 3U6DA 2XZUA 3SBJA 1OAOC 3SHFA 4B7FA 1E9SA 2D7GA 1XNRM 2OOAA 4L4UA 2F5QA 2LWXA 1N78A 3SAWA 3IHPA 2L09A 4GRIA 5KPTA 4PT5A 3UK6A 3SAVA 4LF8M 1HNWM 2QBYA 4TUWA 2P5TA 2Z4SA 3DA1A 5C18A 1L1TA 4GC5A 1T6OA 1NY5A 4B3MM 1PRBA 2KHHA 5IZ7D 1LTMA 4IJFA 3GLIB 3U6MA 2JZ1A 1T43A 1E9RA 1SXJE 2KZSA 3LVVA 5EP2A 1IN5A 1AUAA 2JUJA 4MGKE 2QBYB 3FRIA 2DNAA 1ZMWA 5KPRA 3DOAA 4FD2A 1OAIA 3L25A 3W0FA 4AQYM 4DV5M 4FW9A 1TDZA 3JR5A 4IBGA 1V33A 3UGJA 1K82A 4CHTB 2UU9M 3RE8A 4ITQA 2R44A 1A5TA 2AHMA 1VG5A 1HQYE 3I4YA 1DGBA 4X66M 3CF2A 1FNNA 1YLAA 1D0MA 2CEAA 3U6LA 3AV0A 3VK7A 4DR6M 1GJSA 5FTMA 4I5SA 4JI4M 2K0BX 5IT9S 3LQRA 1IY0A 2BJVA 2XLJA 4DBGB 2L7HA 4JI5M 2OQ4A 3KOWE 3AL0C 1N33M 4MGZE 3FYDA 2LVQD 2DWNA 1XMQM 2C9OA 4KT0F 1PJSA 4IBEA 3FYCA 3HHXA 2VQEM 1JR3A 1XMOM 4LJ9A 1VDLA 2LHGA 3HU1A 1OKSA 4BBAA 2WSFF 3U61A 3J80S 2WZJA 1AIPC 3KOXE 3C9PA 1R2YA 3FUVA 5KPZA 4NSRA 2KA6B 3GRUA 3CGWA 4WW0A 2VQFM 3IG8A 2G8LA 4Q7JA 1N32M 3CTWB 4QOZC 1WHCA 1PJIA 2Q2EB 2XEPA 2J7NA 4MB7A 1QDRA 2WSEF 3K9OA 1JR3D 2Y0TA 1IN7A 3E21A 3VKGA 3MK6A 1K3XA 1EFUB 1PM5A 1PJQA 2CV2A 2UXBM 1E32A 4S12A 1IY2A 4GKKM 2BJWA 4FCWA 2Y21A 1SG9A 4LY6A 2Z4RA 1K3WA 4BLCA 4GIPA 3KFUG 1J7KA 4M0DA 1IXSB 1QAMA 1Z5CA 2YFQA 4XGIA 3GQ4A 1S3SA 4M0WA 2V6ZM 3PNYA 4QHTA 3KS4A 1Q39A 1GABA 5JI2E 4OX9M 2KNVA 2C96A 2UUBM 4D81A 1WGLA 2DAEA 2LH0A 1G8PA 3GQ3A 4NRWA 4RNAA 1H6UA 2M60A 1VEKA 1IXSA 1QANA 2ZAMA 1WGNA 2ZM6M 4X64M 4DUYM 1Z5AA 2L4FA 2F4VM 4YHHM 2VIIA 1DGHB 5KQ8A 3UZUA 3U6QA 1NO1A 1SXJD 3AOEA 4LF9M 1XNQM 3IG5A 5A2QS 3K1JA 4WURA 3A45A 1L2CA 1QAOA 3QYBA 3FUWA 3LMMA 3JR4A 1MN3A 2C9CA 1J09A 4JI8M 2Y20A 5EJCA 3FKEA 1MU5A 2LVOC 2LVPC 4CISA 1QYRA 3GPPA 4JI1M 2DHRA 2OOBA 2DENA 2LHCA 2XZFA 2YNMD 1R4GA 5EXSA 2OPFA 1YSYA 1J5EM 1GL7A 3AOEC 1E94E 4M9SA 2GNOA 2J7OA 2W82A 2Z8YM 3GQ5A 1SXJB 1XXHA 3K2LA 2JY6B 5JI3E 3KP0E 3C3DA 4LCBA 1HR0M 2VDBB 3W0LB 4FWHA 1NHWC 2B3TA 3BOSA 4I4LA 4LFAM 4AG6A 2UXCM 1EE8A 3GLHA 2EA0A 1GJTA 1R5LA 2DWZB 4B3SM 4R3DA 2QZ4A 2R45A 1UFZA 3NBIA 2X8AA 5DYIA 1UM8A 3VKHA 2F5SA 1ZQ9A 1KYIA 4JN6A 1Z59A 2EKKA 1L2DA 2CUZA 3HWSA 4LFBM 1G4AE 2KEBA 4LF6M 5ITUA 3KSXA 2RRUA 3R8FA 1MX0A 2EUCA 4A3VB 1YUBA 3QAUA 5LMUM 3QYEA 2LVNC 3A42A 3GLGE 1T3TA 3VLFB 4CGYB 4F1IA 2QCUA 3LW5F 5BR8M 4Z8XA 4D82A 2XF3A 4L78A 3FE3A 5FLXS 2JY8A 5EXTA 3FTFA 4HEOA 1TH3A 2CWBA 4L15A 2RGHA 2UUCM 1R6BX 1QAQA 2DAKA 1IY1A 2DXIA 1CUKA 1JQJC 4OU7A 4G4OA 4DR1M 3TWKA 3HY5A 4QNRA 2FE8A 7CATA 2V1UA 1ZV1A 4KHPM 3NWLA 3AOGA 1PGYA 3I51A 3R9XB 1IBMM 2D7HA 1WIVA 2QHOB 3HJQA 2DHYA 3VFDA 2I7PA 3Q8GA 2DZNB 4KO8A 1IFYA 1JR3E 4LJ5A 3TE6A 2QSFX 5KO3A 1N77A 4II7A 4AKGA 3HU3A 3HJ8A 2MGWA 3FTDA 4AZFA 4LF7M 2FNAA 4MM3B 2C99A 3A46A 1IQPA 3PXGA 1QZEA 5EP3A 3J2PB 5EXPA 3JAMS 4ZPXA 4P17A 1XHBA 1C7YA 4G4QA 3ZH9B 4HLQA 5IREB 1FJGM 4X65M 1NJFA 1WXQA 2KRUA 4DUZM 2CV0A 1TR8A 1ZMVA 2CP8A 4IBJA 2DWMA 3KOZE 2XSZD 4OW0A 4JXJA 3L28A 2R46A 3QWLA 4OVZA 4Y28F 3RGPA 2C5RA 2ERCA 3SYLA 2E5LM 2NQ8C 4ANRA 2CHQA 1IN6A 3HJSA 1N75A 2K9DA 2VF8A 3SYKA 3D8LA 1IBLM 3KOYE 4LF4M 4AKHA 1KSFX 4M9ZA 4JYAM 1DGFA 1V34A 1HNXM 1NV9A 2JNHA 4QNMA 1F4IA 4QHSA 2FH0A 1NNUC 2APLA 2DZLA 2LTUA 3MHVC 4LGMA 3U5ZB 2L4EA 3DZDA 3SHGB 2QQ8A 3KXEC 3F92A 4B3RM 2J5YA 4WP2A 1SXJA 2ZANA 4D80A 3GLIE 1DGHA 1WR1B 3GLHE 3J7BA 3GLFA 2H1RA 4LJ7A 1QUTA 4R71A 1Q3CA 3GLHB 2JZ0A 2JWSA 4GEWA 4G6ZA 1WJ7A 5FTLA 2KNAA 1D0KA 2XFSA 3VDPA 2MJ5B 4NXMM 1NHGC 2DI0A 4I8OA 3W68A 1OFHA 3UMMA 5L8RF 3U6PA 2O01F 1JB0F 1QQWA 4IIWA 3MMPA 1R2ZA 2EJSA 3DFZA 2GQFA 2EO2A 3B7NA 2R0IA 4RF0A 2JP7A 3OTOM 4PD2A 5EP1A 4KODA 3T1HM 5IWAM 1N34M 2DKLA 8CATA 3B74A 2FOIC 3WHKA 2X4AA 3RFWA 4LF5M 1GO5A 1HT2E 4AKIA 5ITTA 4YY3M 2I7NA 3KP1E 1V92A 3CF6E 3KVWA 2R18A 3K9PA 3EIEA 4JI6M 2V1CA 2ZTCA 4FWDA 3T38A 3K92A 1G71A 2M5ZA 3SC3A 4G3OA 2DZOB 5DYGA 1IN4A 4AG5A 4GITA 1GLNA 5KQDA 1SXJC 3TQSA 1HQCA 4IBCA 2KRKA 1XC8A 1QVRA 2MROB 5EP4A 4JV5M 1IXZA 3H4MA 3HHWA 2G3QA 2X49A 1VQ1A 1QUSA 4IBDA 1OIPA 4DR2M 2KZUA 2UXDM 4NSOB 1VDDA 2DAIA 4LJ8A 3PVSA 5FTKA 4JI3M 3RGSA 4GMQA 4M9XA 5FSWA 2RGOA 3SARA 4B08A 4GKJM 4NRVA 2OO9A 5E6JA 3H4JA 4REZA 2ZTDA 4NC6A 1D0LA 4Z6YA 4LRSA 1D2NA 3L2AA 3EIHA 2FS1A 4FWGA 3U6OA 2RKOA 2MH8A 4DR3M 3SFZA 3U60B 4X62M 3ZQJA 3U6EA 1XXHE 2EKFA 1HT1E 1IM2A 1IXRC 1OFIA 5DNYA 4I81A 1I4WA 4W5WA 3GPUA 1DGGA 1HNZM 1C1KA 2FFJA 3E4RA 5FTNA 5DFLA 3ZC7B 2QPAA 5ITXE 4DV4M 3HHYA 3A98B 1ZMUA 3B89A 1W5TA 3MJ5A 2JY5A 4LGYA 3J27B 4L16A 4PDIA 3U5ZA 2CHGA 4CJ6A 3GP1A 2R6FA 2CHVA 4GH9A 4XK8F 3B7QA 3GRRA 3LCVB 1OJLA 2D7EA 4G4RA 1MJGM 1HJPA 2BWBA 4FCTA 2L6OA 1DV0A 1NSFA 1XB2B 4F2LA 4IJEA 1RU3A 1KFVA 2HL7A 4PDGA 3J81S 2HWJA 3ZCBB 3HX3A 3KS8A 3I4VA 2ZBKB 3L29A 3HU2A 3L26A 2HKJA 3TWLA 1NJGA 2CE7A 4HL4A 1NV8A 1QZMA 1Q3BA 1Z5BA 3C58A 1DO2A 4AI6A 3HHZA 1BVSA 4LRTA 4LFCM 2QNJA 2R4EA 1X37A 1ZAEA 3HKPA 2HCBA 3GLGB 1G59A 3BXWA 4R7GA 1ORYB 3V76A 1GL6A 2MR9A 5EXXA 5C1BA 3GLFB 2R4JA 2XGNA 4EIWA 3HGIA 1GKIA 4BB9A 1Q02A 3SMSA 5F3WA 3AJIB 3K8ZA 4RF1A 3L27A 5H37D 3SMPA 4LG2A 4DV1M 3UJNA 4DV3M 4LJ6A 4DV0M 3U6SA 3PFIA 4B3TM 3TWMA 3GPYA 1TF0B 2K47A 3T6PA 3U6CA 2F5NA 4LJ4A 2K6BA 4L6V6 3SASA 4DV6M 1TH4A 5LMNM 1Y8GA 1L2BA 3J7AS 2ZAOA 1YE9A 2BWEA 1NY6A 2LVAA 3GLIA 3PNVA 1P3QQ 3W67A 2L7IA 2LNHC 5BPVA 1G3IA 2DVWB 1OTRA 1TTEA 2F5OA 4G4NA 1XWIA 3M0EA 3B7ZA 1R7RA 3IECA 2A5YB 3KDSE 1GVNA 3KW6A 5ITQA 1DO0A 3D8BA 2L2DA 2Z7JA 2CRUA 3B9PA 3BBZA 3HZJA 5GKNA 2R62A 1IN8A 3GPXA 4JI7M 2R65A 2JXNA 1OQYA 2XSZA 3FTCA 2Z3XA 5ITRA 3WHLA 1PJJA 3SATA 2G5GX 4L8RC 4PCZA 2Y0QA 1TDHA 3FTEA 2N35A 4DR4M 3LQQA 2HHHM 3E9SA 3LVWA 2DAGA 2C98A 4KLNA 4FVMA 2BNKA 4GC9A 3FUXA 4FCVA 3THGA 1L1ZA 2QENA 3E46A 4NXNM 3U60A 1EIJA 4IBKA 3I01M 2YQZA 5ITYA 3GRYA 3U61B 4QOSA 1VEGA 3GO8A 1NVMA 3GRVA 4NL4H 4UN2B 4DV2M 2VF7A 2UUAM 2XFTA 5E26A 3NBXX 1TH2A 1Z6TA 3ILKA 4MGHA 3VDUA
chains in the Genus database with same CATH topology
4JI0M 4IBFA 3KSJA 3VK8A 2XH9A 3M6AA 3FD9A 4JI2M 4IBIA 2YR0A 3Q8XA 1LV7A 3T15A 4AW4A 1TGUA 1G41A 2DWLA 1L8QA 4DR5M 2CFOA 3T1YM 1NNJA 2JA2A 4LZJA 2CV1A 2KW0A 4GHAA 4DR7M 4B7HA 4B7GA 3SAUA 3M7GA 3TL4X 4MGYE 3FUUA 4DV7M 3AFHA 4GHLA 2LXEA 4NOOB 3TPZA 1IBKM 2O5RA 3FUTA 5FTJA 4K0KM 4OVZB 5ITXA 2QP9X 4MH0E 3CF0A 4XBOA 1W5SA 4LJAA 4P16A 4LZZA 1N36M 1XXHB 3AKZA 1I94M 3GLGA 2KXEA 2F5PA 5EQTA 4IBBA 4MGIE 3U6DA 2XZUA 3SBJA 3SHFA 4B7FA 1E9SA 2D7GA 1XNRM 4L4UA 2F5QA 2LWXA 1N78A 3SAWA 2L09A 4GRIA 5KPTA 4PT5A 3UK6A 3SAVA 4LF8M 1HNWM 2QBYA 4TUWA 2P5TA 2Z4SA 3DA1A 5C18A 1L1TA 4GC5A 1NY5A 4B3MM 5IZ7D 4IJFA 3GLIB 3U6MA 2KZSA 1E9RA 1SXJE 3LVVA 5EP2A 1IN5A 4MGKE 2QBYB 5KPRA 3DOAA 4FD2A 3L25A 3W0FA 4AQYM 4DV5M 4FW9A 1TDZA 3JR5A 4IBGA 3UGJA 1K82A 4CHTB 2UU9M 3RE8A 4ITQA 2AHMA 1HQYE 3I4YA 1DGBA 4X66M 3CF2A 1FNNA 2CEAA 3U6LA 3AV0A 3VK7A 4DR6M 5FTMA 4I5SA 4JI4M 5IT9S 3LQRA 1IY0A 2BJVA 2XLJA 4JI5M 2L7HA 3AL0C 2OQ4A 3KOWE 1N33M 4MGZE 3FYDA 2DWNA 1XMQM 2C9OA 4IBEA 3FYCA 3HHXA 2VQEM 1JR3A 1XMOM 4LJ9A 3HU1A 4BBAA 3U61A 3J80S 3KOXE 1R2YA 3FUVA 5KPZA 4NSRA 2KA6B 3GRUA 4WW0A 2VQFM 3IG8A 2G8LA 1N32M 3CTWB 4QOZC 1PJIA 2Q2EB 2XEPA 2J7NA 4MB7A 1JR3D 2Y0TA 1IN7A 3VKGA 3MK6A 1K3XA 1PM5A 2CV2A 2UXBM 1E32A 4S12A 1IY2A 4GKKM 2BJWA 4FCWA 2Y21A 4LY6A 2Z4RA 1K3WA 4BLCA 4GIPA 3KFUG 1J7KA 4M0DA 1IXSB 1QAMA 1Z5CA 2YFQA 4XGIA 3GQ4A 1S3SA 4M0WA 2V6ZM 3PNYA 4QHTA 3KS4A 1Q39A 5JI2E 4OX9M 2C96A 2UUBM 4D81A 3GQ3A 2LH0A 1G8PA 4NRWA 4RNAA 1H6UA 2M60A 1QANA 2ZAMA 2ZM6M 4DUYM 4X64M 1Z5AA 2F4VM 4YHHM 2VIIA 1DGHB 5KQ8A 3UZUA 3U6QA 1SXJD 3AOEA 4LF9M 1XNQM 3IG5A 5A2QS 3K1JA 4WURA 3A45A 1L2CA 1QAOA 3FUWA 3LMMA 3JR4A 2C9CA 1J09A 4JI8M 2Y20A 5EJCA 3FKEA 1MU5A 4CISA 4JI1M 1QYRA 3GPPA 2DHRA 2XZFA 2YNMD 5EXSA 2OPFA 1YSYA 1J5EM 1GL7A 3AOEC 1E94E 4M9SA 2J7OA 2W82A 3GQ5A 1SXJB 1XXHA 3K2LA 5JI3E 3KP0E 4LCBA 1HR0M 3W0LB 4FWHA 1NHWC 3BOSA 4I4LA 4LFAM 4AG6A 2UXCM 1EE8A 3GLHA 2EA0A 2DWZB 4B3SM 4R3DA 2QZ4A 2R45A 3NBIA 3VKHA 2X8AA 5DYIA 1UM8A 2F5SA 1ZQ9A 1KYIA 4JN6A 1Z59A 1L2DA 2CUZA 3HWSA 4LFBM 1G4AE 2KEBA 4LF6M 5ITUA 3KSXA 3R8FA 1MX0A 2EUCA 4A3VB 1YUBA 3QAUA 5LMUM 3A42A 1T3TA 3VLFB 4CGYB 5BR8M 2QCUA 4Z8XA 4D82A 2XF3A 4L78A 5FLXS 5EXTA 3FTFA 1TH3A 4L15A 2RGHA 2UUCM 1R6BX 1QAQA 1IY1A 2DXIA 1JQJC 4OU7A 4G4OA 4DR1M 3TWKA 4QNRA 2FE8A 7CATA 2V1UA 4KHPM 3NWLA 3AOGA 3I51A 3R9XB 1IBMM 2D7HA 3HJQA 3VFDA 2I7PA 2DZNB 4KO8A 4LJ5A 3TE6A 5KO3A 4AKGA 1N77A 4II7A 3HU3A 3HJ8A 3FTDA 4AZFA 4LF7M 2FNAA 4MM3B 2C99A 3A46A 1IQPA 3PXGA 3JAMS 5EP3A 3J2PB 5EXPA 4ZPXA 1XHBA 4G4QA 3ZH9B 4HLQA 5IREB 1FJGM 4X65M 1NJFA 1WXQA 2KRUA 4DUZM 2CV0A 4IBJA 2DWMA 3KOZE 2XSZD 4OW0A 4JXJA 3L28A 2R46A 3QWLA 4OVZA 2C5RA 3RGPA 2ERCA 3SYLA 2E5LM 2NQ8C 2CHQA 1IN6A 3HJSA 1N75A 3SYKA 3D8LA 1IBLM 3KOYE 4LF4M 4AKHA 1KSFX 4M9ZA 4JYAM 1DGFA 1HNXM 4QNMA 4QHSA 1NNUC 3MHVC 4LGMA 3U5ZB 3DZDA 3SHGB 3KXEC 4B3RM 1SXJA 2ZANA 4D80A 1DGHA 3J7BA 3GLFA 2H1RA 4LJ7A 1Q3CA 3GLHB 4G6ZA 5FTLA 2XFSA 3VDPA 4NXMM 1NHGC 4I8OA 3UMMA 1OFHA 3U6PA 1QQWA 4IIWA 1R2ZA 3DFZA 2EO2A 4RF0A 3OTOM 4PD2A 5EP1A 4KODA 3T1HM 5IWAM 1N34M 8CATA 2FOIC 3WHKA 2X4AA 3RFWA 4LF5M 1HT2E 4AKIA 5ITTA 4YY3M 2I7NA 3KP1E 3CF6E 3KVWA 2R18A 4JI6M 3EIEA 2V1CA 4FWDA 3T38A 3K92A 3SC3A 2M5ZA 2DZOB 5DYGA 1IN4A 4AG5A 4GITA 1GLNA 5KQDA 1SXJC 3TQSA 1HQCA 4IBCA 2KRKA 1XC8A 1QVRA 5EP4A 4JV5M 1IXZA 3H4MA 3HHWA 2X49A 4IBDA 4DR2M 2KZUA 2UXDM 4NSOB 1VDDA 4JI3M 4LJ8A 3PVSA 5FTKA 3RGSA 4GMQA 4M9XA 5FSWA 2RGOA 3SARA 4B08A 4GKJM 4NRVA 5E6JA 4REZA 4Z6YA 4LRSA 1D2NA 3L2AA 3EIHA 4FWGA 3U6OA 2RKOA 4DR3M 3SFZA 3U60B 4X62M 3U6EA 1IM2A 1HT1E 1IXRC 1OFIA 5DNYA 4I81A 1I4WA 4W5WA 3GPUA 1DGGA 1HNZM 1C1KA 2FFJA 3E4RA 5FTNA 3ZC7B 2QPAA 5ITXE 4DV4M 3HHYA 3A98B 1W5TA 3MJ5A 4LGYA 3J27B 4L16A 4PDIA 3U5ZA 2CHGA 3GP1A 2CHVA 4GH9A 3GRRA 1OJLA 2D7EA 4G4RA 4FCTA 2L6OA 1NSFA 4IJEA 1KFVA 2HL7A 4PDGA 3J81S 3ZCBB 3KS8A 3I4VA 2ZBKB 3L29A 3HU2A 3L26A 2HKJA 3TWLA 1NJGA 2CE7A 4HL4A 1QZMA 1Q3BA 1Z5BA 3C58A 1DO2A 4AI6A 3HHZA 4LRTA 4LFCM 2R4EA 1X37A 1ZAEA 3HKPA 2HCBA 3GLGB 1G59A 4R7GA 1ORYB 1GL6A 5EXXA 5C1BA 3GLFB 2R4JA 2XGNA 4EIWA 3HGIA 1GKIA 4BB9A 3SMSA 4LG2A 5F3WA 3AJIB 3K8ZA 4RF1A 3L27A 5H37D 3SMPA 4DV1M 3UJNA 4DV3M 4LJ6A 4DV0M 3U6SA 3PFIA 4B3TM 3TWMA 3GPYA 2K47A 3U6CA 2F5NA 4LJ4A 3SASA 4DV6M 1TH4A 5LMNM 3J7AS 1L2BA 2ZAOA 1YE9A 1NY6A 3GLIA 3PNVA 2L7IA 2LNHC 5BPVA 1G3IA 2DVWB 2F5OA 4G4NA 1XWIA 3M0EA 1R7RA 2A5YB 3KDSE 1GVNA 3KW6A 5ITQA 1DO0A 3D8BA 5GKNA 2Z7JA 3B9PA 3GPXA 2R62A 1IN8A 4JI7M 2R65A 3FTCA 2Z3XA 2XSZA 1PJJA 5ITRA 3WHLA 3SATA 2G5GX 4L8RC 4PCZA 2Y0QA 1TDHA 3FTEA 4DR4M 3LQQA 2HHHM 3E9SA 3LVWA 2C98A 4KLNA 4FVMA 2BNKA 4GC9A 3FUXA 4FCVA 3THGA 1L1ZA 2QENA 4NXNM 3U60A 4IBKA 2YQZA 5ITYA 3GRYA 3U61B 4QOSA 3GO8A 1NVMA 3GRVA 4NL4H 4DV2M 2UUAM 2XFTA 5E26A 1TH2A 1Z6TA 3ILKA 4MGHA 3VDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI0 M;  2UXB M;  4GKK M;  3VK8 A;  1FJG M;  4X65 M;  4JI2 M;  3GPU A;  1K3W A;  4DUZ M;  1HNZ M;  1Z5C A;  5ITX E;  4DR5 M;  4DV4 M;  3GQ4 A;  3T1Y M;  1NNJ A;  2E5L M;  1Q39 A;  4OX9 M;  4DR7 M;  3SAU A;  2UUB M;  4PDI A;  1IBL M;  3GQ3 A;  3GP1 A;  4LF4 M;  4NRW A;  4DV7 M;  4JYA M;  1HNX M;  2ZM6 M;  1IBK M;  4DUY M;  4G4R A;  4X64 M;  1Z5A A;  4K0K M;  2F4V M;  4YHH M;  3U6Q A;  5ITX A;  4LF9 M;  1XNQ M;  5A2Q S;  1L2C A;  1KFV A;  3A45 A;  4PDG A;  3J81 S;  3JR4 A;  2ZBK B;  4JI8 M;  4B3R M;  1N36 M;  2HKJ A;  1MU5 A;  3TWL A;  1I94 M;  4CIS A;  3GPP A;  4JI1 M;  2F5P A;  3U6D A;  2XZU A;  3SBJ A;  2XZF A;  1Q3C A;  1Q3B A;  1Z5B A;  3C58 A;  2OPF A;  1J5E M;  1XNR M;  2F5Q A;  3SAW A;  4LFC M;  4NXM M;  3GQ5 A;  3SAV A;  3U6P A;  4LF8 M;  1HR0 M;  1HNW M;  1L1T A;  2UXC M;  4LFA M;  1EE8 A;  2EA0 A;  1R2Z A;  4B3M M;  4B3S M;  4DV1 M;  4DV3 M;  3OTO M;  4DV0 M;  4PD2 A;  3U6M A;  3U6S A;  3T1H M;  2F5S A;  5IWA M;  1N34 M;  4B3T M;  3TWM A;  3GPY A;  1Z59 A;  3U6C A;  1L2D A;  2F5N A;  4LF5 M;  3DOA A;  3SAS A;  4LFB M;  4DV6 M;  4LF6 M;  5ITT A;  3W0F A;  4YY3 M;  5ITU A;  5LMN M;  4DV5 M;  4AQY M;  1TDZ A;  1MX0 A;  3JR5 A;  1L2B A;  3J7A S;  5LMU M;  1K82 A;  2UU9 M;  4ITQ A;  4JI6 M;  3A42 A;  5BR8 M;  4X66 M;  5FLX S;  3U6L A;  3VK7 A;  2F5O A;  4G4N A;  4DR6 M;  4JI4 M;  5IT9 S;  4JI5 M;  1XC8 A;  2OQ4 A;  1N33 M;  2UUC M;  4JV5 M;  1XMQ M;  5ITQ A;  3GPX A;  4G4O A;  4DR1 M;  2VQE M;  4JI7 M;  1XMO M;  1PJJ A;  5ITR A;  3SAT A;  3TWK A;  4DR2 M;  4PCZ A;  2UXD M;  1TDH A;  3J80 S;  4JI3 M;  4DR4 M;  2HHH M;  4KHP M;  1R2Y A;  3SAR A;  4GKJ M;  4NRV A;  1L1Z A;  4NXN M;  2VQF M;  1IBM M;  5ITY A;  1N32 M;  1PJI A;  2Q2E B;  3GO8 A;  4LF7 M;  3U6O A;  4DV2 M;  4MB7 A;  2UUA M;  3A46 A;  3JAM S;  4DR3 M;  4X62 M;  1K3X A;  1PM5 A;  3U6E A;  4G4Q A; 
#chains in the Genus database with same CATH topology
 2DAM A;  4JI0 M;  4IBF A;  3KSJ A;  3VK8 A;  2XH9 A;  3M6A A;  3FD9 A;  4RKU F;  4JI2 M;  4IBI A;  2YR0 A;  3C3E A;  3Q8X A;  1LV7 A;  3T15 A;  1QDT A;  4AW4 A;  1TGU A;  1G41 A;  2DWL A;  1L8Q A;  4CIZ A;  2CFO A;  4DR5 M;  2KNZ A;  3T1Y M;  1NNJ A;  2JA2 A;  4LZJ A;  2CV1 A;  2KW0 A;  3GLF E;  4GHA A;  4DR7 M;  4B7H A;  4B7G A;  3SAU A;  3FRH A;  2HAK A;  2JY7 A;  3M7G A;  3TL4 X;  4MGY E;  3FUU A;  4DV7 M;  1VEJ A;  3AFH A;  4GHL A;  2LXE A;  4NOO B;  3TPZ A;  1IBK M;  2O5R A;  3FUT A;  5FTJ A;  4K0K M;  2WSC F;  2O25 A;  4OVZ B;  5ITX A;  2QP9 X;  4MH0 E;  3CF0 A;  4XBO A;  1W5S A;  3LCU A;  4LJA A;  2KDL A;  2H5X A;  4P16 A;  4LZZ A;  1OIZ A;  1N36 M;  1XXH B;  3AKZ A;  1I94 M;  3GLG A;  1PJT A;  2KXE A;  2F5P A;  3I04 M;  2LBC A;  5EQT A;  4IBB A;  4MGI E;  3U6D A;  2XZU A;  3SBJ A;  1OAO C;  3SHF A;  4B7F A;  1E9S A;  2D7G A;  1XNR M;  2OOA A;  4L4U A;  2F5Q A;  2LWX A;  1N78 A;  3SAW A;  3IHP A;  2L09 A;  4GRI A;  5KPT A;  4PT5 A;  3UK6 A;  3SAV A;  4LF8 M;  1HNW M;  2QBY A;  4TUW A;  2P5T A;  2Z4S A;  3DA1 A;  5C18 A;  1L1T A;  4GC5 A;  1T6O A;  1NY5 A;  4B3M M;  1PRB A;  2KHH A;  5IZ7 D;  1LTM A;  4IJF A;  3GLI B;  3U6M A;  2JZ1 A;  1T43 A;  1E9R A;  1SXJ E;  2KZS A;  3LVV A;  5EP2 A;  1IN5 A;  1AUA A;  2JUJ A;  4MGK E;  2QBY B;  3FRI A;  2DNA A;  1ZMW A;  5KPR A;  3DOA A;  4FD2 A;  1OAI A;  3L25 A;  3W0F A;  4AQY M;  4DV5 M;  4FW9 A;  1TDZ A;  3JR5 A;  4IBG A;  1V33 A;  3UGJ A;  1K82 A;  4CHT B;  2UU9 M;  3RE8 A;  4ITQ A;  2R44 A;  1A5T A;  2AHM A;  1VG5 A;  1HQY E;  3I4Y A;  1DGB A;  4X66 M;  3CF2 A;  1FNN A;  1YLA A;  1D0M A;  2CEA A;  3U6L A;  3AV0 A;  3VK7 A;  4DR6 M;  1GJS A;  5FTM A;  4I5S A;  4JI4 M;  2K0B X;  5IT9 S;  3LQR A;  1IY0 A;  2BJV A;  2XLJ A;  4DBG B;  2L7H A;  4JI5 M;  2OQ4 A;  3KOW E;  3AL0 C;  1N33 M;  4MGZ E;  3FYD A;  2LVQ D;  2DWN A;  1XMQ M;  2C9O A;  4KT0 F;  1PJS A;  4IBE A;  3FYC A;  3HHX A;  2VQE M;  1JR3 A;  1XMO M;  4LJ9 A;  1VDL A;  2LHG A;  3HU1 A;  1OKS A;  4BBA A;  2WSF F;  3U61 A;  3J80 S;  2WZJ A;  1AIP C;  3KOX E;  3C9P A;  1R2Y A;  3FUV A;  5KPZ A;  4NSR A;  2KA6 B;  3GRU A;  3CGW A;  4WW0 A;  2VQF M;  3IG8 A;  2G8L A;  4Q7J A;  1N32 M;  3CTW B;  4QOZ C;  1WHC A;  1PJI A;  2Q2E B;  2XEP A;  2J7N A;  4MB7 A;  1QDR A;  2WSE F;  3K9O A;  1JR3 D;  2Y0T A;  1IN7 A;  3E21 A;  3VKG A;  3MK6 A;  1K3X A;  1EFU B;  1PM5 A;  1PJQ A;  2CV2 A;  2UXB M;  1E32 A;  4S12 A;  1IY2 A;  4GKK M;  2BJW A;  4FCW A;  2Y21 A;  1SG9 A;  4LY6 A;  2Z4R A;  1K3W A;  4BLC A;  4GIP A;  3KFU G;  1J7K A;  4M0D A;  1IXS B;  1QAM A;  1Z5C A;  2YFQ A;  4XGI A;  3GQ4 A;  1S3S A;  4M0W A;  2V6Z M;  3PNY A;  4QHT A;  3KS4 A;  1Q39 A;  1GAB A;  5JI2 E;  4OX9 M;  2KNV A;  2C96 A;  2UUB M;  4D81 A;  1WGL A;  2DAE A;  2LH0 A;  1G8P A;  3GQ3 A;  4NRW A;  4RNA A;  1H6U A;  2M60 A;  1VEK A;  1IXS A;  1QAN A;  2ZAM A;  1WGN A;  2ZM6 M;  4X64 M;  4DUY M;  1Z5A A;  2L4F A;  2F4V M;  4YHH M;  2VII A;  1DGH B;  5KQ8 A;  3UZU A;  3U6Q A;  1NO1 A;  1SXJ D;  3AOE A;  4LF9 M;  1XNQ M;  3IG5 A;  5A2Q S;  3K1J A;  4WUR A;  3A45 A;  1L2C A;  1QAO A;  3QYB A;  3FUW A;  3LMM A;  3JR4 A;  1MN3 A;  2C9C A;  1J09 A;  4JI8 M;  2Y20 A;  5EJC A;  3FKE A;  1MU5 A;  2LVO C;  2LVP C;  4CIS A;  1QYR A;  3GPP A;  4JI1 M;  2DHR A;  2OOB A;  2DEN A;  2LHC A;  2XZF A;  2YNM D;  1R4G A;  5EXS A;  2OPF A;  1YSY A;  1J5E M;  1GL7 A;  3AOE C;  1E94 E;  4M9S A;  2GNO A;  2J7O A;  2W82 A;  2Z8Y M;  3GQ5 A;  1SXJ B;  1XXH A;  3K2L A;  2JY6 B;  5JI3 E;  3KP0 E;  3C3D A;  4LCB A;  1HR0 M;  2VDB B;  3W0L B;  4FWH A;  1NHW C;  2B3T A;  3BOS A;  4I4L A;  4LFA M;  4AG6 A;  2UXC M;  1EE8 A;  3GLH A;  2EA0 A;  1GJT A;  1R5L A;  2DWZ B;  4B3S M;  4R3D A;  2QZ4 A;  2R45 A;  1UFZ A;  3NBI A;  2X8A A;  5DYI A;  1UM8 A;  3VKH A;  2F5S A;  1ZQ9 A;  1KYI A;  4JN6 A;  1Z59 A;  2EKK A;  1L2D A;  2CUZ A;  3HWS A;  4LFB M;  1G4A E;  2KEB A;  4LF6 M;  5ITU A;  3KSX A;  2RRU A;  3R8F A;  1MX0 A;  2EUC A;  4A3V B;  1YUB A;  3QAU A;  5LMU M;  3QYE A;  2LVN C;  3A42 A;  3GLG E;  1T3T A;  3VLF B;  4CGY B;  4F1I A;  2QCU A;  3LW5 F;  5BR8 M;  4Z8X A;  4D82 A;  2XF3 A;  4L78 A;  3FE3 A;  5FLX S;  2JY8 A;  5EXT A;  3FTF A;  4HEO A;  1TH3 A;  2CWB A;  4L15 A;  2RGH A;  2UUC M;  1R6B X;  1QAQ A;  2DAK A;  1IY1 A;  2DXI A;  1CUK A;  1JQJ C;  4OU7 A;  4G4O A;  4DR1 M;  3TWK A;  3HY5 A;  4QNR A;  2FE8 A;  7CAT A;  2V1U A;  1ZV1 A;  4KHP M;  3NWL A;  3AOG A;  1PGY A;  3I51 A;  3R9X B;  1IBM M;  2D7H A;  1WIV A;  2QHO B;  3HJQ A;  2DHY A;  3VFD A;  2I7P A;  3Q8G A;  2DZN B;  4KO8 A;  1IFY A;  1JR3 E;  4LJ5 A;  3TE6 A;  2QSF X;  5KO3 A;  1N77 A;  4II7 A;  4AKG A;  3HU3 A;  3HJ8 A;  2MGW A;  3FTD A;  4AZF A;  4LF7 M;  2FNA A;  4MM3 B;  2C99 A;  3A46 A;  1IQP A;  3PXG A;  1QZE A;  5EP3 A;  3J2P B;  5EXP A;  3JAM S;  4ZPX A;  4P17 A;  1XHB A;  1C7Y A;  4G4Q A;  3ZH9 B;  4HLQ A;  5IRE B;  1FJG M;  4X65 M;  1NJF A;  1WXQ A;  2KRU A;  4DUZ M;  2CV0 A;  1TR8 A;  1ZMV A;  2CP8 A;  4IBJ A;  2DWM A;  3KOZ E;  2XSZ D;  4OW0 A;  4JXJ A;  3L28 A;  2R46 A;  3QWL A;  4OVZ A;  4Y28 F;  3RGP A;  2C5R A;  2ERC A;  3SYL A;  2E5L M;  2NQ8 C;  4ANR A;  2CHQ A;  1IN6 A;  3HJS A;  1N75 A;  2K9D A;  2VF8 A;  3SYK A;  3D8L A;  1IBL M;  3KOY E;  4LF4 M;  4AKH A;  1KSF X;  4M9Z A;  4JYA M;  1DGF A;  1V34 A;  1HNX M;  1NV9 A;  2JNH A;  4QNM A;  1F4I A;  4QHS A;  2FH0 A;  1NNU C;  2APL A;  2DZL A;  2LTU A;  3MHV C;  4LGM A;  3U5Z B;  2L4E A;  3DZD A;  3SHG B;  2QQ8 A;  3KXE C;  3F92 A;  4B3R M;  2J5Y A;  4WP2 A;  1SXJ A;  2ZAN A;  4D80 A;  3GLI E;  1DGH A;  1WR1 B;  3GLH E;  3J7B A;  3GLF A;  2H1R A;  4LJ7 A;  1QUT A;  4R71 A;  1Q3C A;  3GLH B;  2JZ0 A;  2JWS A;  4GEW A;  4G6Z A;  1WJ7 A;  5FTL A;  2KNA A;  1D0K A;  2XFS A;  3VDP A;  2MJ5 B;  4NXM M;  1NHG C;  2DI0 A;  4I8O A;  3W68 A;  1OFH A;  3UMM A;  5L8R F;  3U6P A;  2O01 F;  1JB0 F;  1QQW A;  4IIW A;  3MMP A;  1R2Z A;  2EJS A;  3DFZ A;  2GQF A;  2EO2 A;  3B7N A;  2R0I A;  4RF0 A;  2JP7 A;  3OTO M;  4PD2 A;  5EP1 A;  4KOD A;  3T1H M;  5IWA M;  1N34 M;  2DKL A;  8CAT A;  3B74 A;  2FOI C;  3WHK A;  2X4A A;  3RFW A;  4LF5 M;  1GO5 A;  1HT2 E;  4AKI A;  5ITT A;  4YY3 M;  2I7N A;  3KP1 E;  1V92 A;  3CF6 E;  3KVW A;  2R18 A;  3K9P A;  3EIE A;  4JI6 M;  2V1C A;  2ZTC A;  4FWD A;  3T38 A;  3K92 A;  1G71 A;  2M5Z A;  3SC3 A;  4G3O A;  2DZO B;  5DYG A;  1IN4 A;  4AG5 A;  4GIT A;  1GLN A;  5KQD A;  1SXJ C;  3TQS A;  1HQC A;  4IBC A;  2KRK A;  1XC8 A;  1QVR A;  2MRO B;  5EP4 A;  4JV5 M;  1IXZ A;  3H4M A;  3HHW A;  2G3Q A;  2X49 A;  1VQ1 A;  1QUS A;  4IBD A;  1OIP A;  4DR2 M;  2KZU A;  2UXD M;  4NSO B;  1VDD A;  2DAI A;  4LJ8 A;  3PVS A;  5FTK A;  4JI3 M;  3RGS A;  4GMQ A;  4M9X A;  5FSW A;  2RGO A;  3SAR A;  4B08 A;  4GKJ M;  4NRV A;  2OO9 A;  5E6J A;  3H4J A;  4REZ A;  2ZTD A;  4NC6 A;  1D0L A;  4Z6Y A;  4LRS A;  1D2N A;  3L2A A;  3EIH A;  2FS1 A;  4FWG A;  3U6O A;  2RKO A;  2MH8 A;  4DR3 M;  3SFZ A;  3U60 B;  4X62 M;  3ZQJ A;  3U6E A;  1XXH E;  2EKF A;  1HT1 E;  1IM2 A;  1IXR C;  1OFI A;  5DNY A;  4I81 A;  1I4W A;  4W5W A;  3GPU A;  1DGG A;  1HNZ M;  1C1K A;  2FFJ A;  3E4R A;  5FTN A;  5DFL A;  3ZC7 B;  2QPA A;  5ITX E;  4DV4 M;  3HHY A;  3A98 B;  1ZMU A;  3B89 A;  1W5T A;  3MJ5 A;  2JY5 A;  4LGY A;  3J27 B;  4L16 A;  4PDI A;  3U5Z A;  2CHG A;  4CJ6 A;  3GP1 A;  2R6F A;  2CHV A;  4GH9 A;  4XK8 F;  3B7Q A;  3GRR A;  3LCV B;  1OJL A;  2D7E A;  4G4R A;  1MJG M;  1HJP A;  2BWB A;  4FCT A;  2L6O A;  1DV0 A;  1NSF A;  1XB2 B;  4F2L A;  4IJE A;  1RU3 A;  1KFV A;  2HL7 A;  4PDG A;  3J81 S;  2HWJ A;  3ZCB B;  3HX3 A;  3KS8 A;  3I4V A;  2ZBK B;  3L29 A;  3HU2 A;  3L26 A;  2HKJ A;  3TWL A;  1NJG A;  2CE7 A;  4HL4 A;  1NV8 A;  1QZM A;  1Q3B A;  1Z5B A;  3C58 A;  1DO2 A;  4AI6 A;  3HHZ A;  1BVS A;  4LRT A;  4LFC M;  2QNJ A;  2R4E A;  1X37 A;  1ZAE A;  3HKP A;  2HCB A;  3GLG B;  1G59 A;  3BXW A;  4R7G A;  1ORY B;  3V76 A;  1GL6 A;  2MR9 A;  5EXX A;  5C1B A;  3GLF B;  2R4J A;  2XGN A;  4EIW A;  3HGI A;  1GKI A;  4BB9 A;  1Q02 A;  3SMS A;  5F3W A;  3AJI B;  3K8Z A;  4RF1 A;  3L27 A;  5H37 D;  3SMP A;  4LG2 A;  4DV1 M;  3UJN A;  4DV3 M;  4LJ6 A;  4DV0 M;  3U6S A;  3PFI A;  4B3T M;  3TWM A;  3GPY A;  1TF0 B;  2K47 A;  3T6P A;  3U6C A;  2F5N A;  4LJ4 A;  2K6B A;  4L6V 6;  3SAS A;  4DV6 M;  1TH4 A;  5LMN M;  1Y8G A;  1L2B A;  3J7A S;  2ZAO A;  1YE9 A;  2BWE A;  1NY6 A;  2LVA A;  3GLI A;  3PNV A;  1P3Q Q;  3W67 A;  2L7I A;  2LNH C;  5BPV A;  1G3I A;  2DVW B;  1OTR A;  1TTE A;  2F5O A;  4G4N A;  1XWI A;  3M0E A;  3B7Z A;  1R7R A;  3IEC A;  2A5Y B;  3KDS E;  1GVN A;  3KW6 A;  5ITQ A;  1DO0 A;  3D8B A;  2L2D A;  2Z7J A;  2CRU A;  3B9P A;  3BBZ A;  3HZJ A;  5GKN A;  2R62 A;  1IN8 A;  3GPX A;  4JI7 M;  2R65 A;  2JXN A;  1OQY A;  2XSZ A;  3FTC A;  2Z3X A;  5ITR A;  3WHL A;  1PJJ A;  3SAT A;  2G5G X;  4L8R C;  4PCZ A;  2Y0Q A;  1TDH A;  3FTE A;  2N35 A;  4DR4 M;  3LQQ A;  2HHH M;  3E9S A;  3LVW A;  2DAG A;  2C98 A;  4KLN A;  4FVM A;  2BNK A;  4GC9 A;  3FUX A;  4FCV A;  3THG A;  1L1Z A;  2QEN A;  3E46 A;  4NXN M;  3U60 A;  1EIJ A;  4IBK A;  3I01 M;  2YQZ A;  5ITY A;  3GRY A;  3U61 B;  4QOS A;  1VEG A;  3GO8 A;  1NVM A;  3GRV A;  4NL4 H;  4UN2 B;  4DV2 M;  2VF7 A;  2UUA M;  2XFT A;  5E26 A;  3NBX X;  1TH2 A;  1Z6T A;  3ILK A;  4MGH A;  3VDU A; 
#chains in the Genus database with same CATH homology
 4JI0 M;  4IBF A;  3KSJ A;  3VK8 A;  2XH9 A;  3M6A A;  3FD9 A;  4JI2 M;  4IBI A;  2YR0 A;  3Q8X A;  1LV7 A;  3T15 A;  4AW4 A;  1TGU A;  1G41 A;  2DWL A;  1L8Q A;  4DR5 M;  2CFO A;  3T1Y M;  1NNJ A;  2JA2 A;  4LZJ A;  2CV1 A;  2KW0 A;  4GHA A;  4DR7 M;  4B7H A;  4B7G A;  3SAU A;  3M7G A;  3TL4 X;  4MGY E;  3FUU A;  4DV7 M;  3AFH A;  4GHL A;  2LXE A;  4NOO B;  3TPZ A;  1IBK M;  2O5R A;  3FUT A;  5FTJ A;  4K0K M;  4OVZ B;  5ITX A;  2QP9 X;  4MH0 E;  3CF0 A;  4XBO A;  1W5S A;  4LJA A;  4P16 A;  4LZZ A;  1N36 M;  1XXH B;  3AKZ A;  1I94 M;  3GLG A;  2KXE A;  2F5P A;  5EQT A;  4IBB A;  4MGI E;  3U6D A;  2XZU A;  3SBJ A;  3SHF A;  4B7F A;  1E9S A;  2D7G A;  1XNR M;  4L4U A;  2F5Q A;  2LWX A;  1N78 A;  3SAW A;  2L09 A;  4GRI A;  5KPT A;  4PT5 A;  3UK6 A;  3SAV A;  4LF8 M;  1HNW M;  2QBY A;  4TUW A;  2P5T A;  2Z4S A;  3DA1 A;  5C18 A;  1L1T A;  4GC5 A;  1NY5 A;  4B3M M;  5IZ7 D;  4IJF A;  3GLI B;  3U6M A;  2KZS A;  1E9R A;  1SXJ E;  3LVV A;  5EP2 A;  1IN5 A;  4MGK E;  2QBY B;  5KPR A;  3DOA A;  4FD2 A;  3L25 A;  3W0F A;  4AQY M;  4DV5 M;  4FW9 A;  1TDZ A;  3JR5 A;  4IBG A;  3UGJ A;  1K82 A;  4CHT B;  2UU9 M;  3RE8 A;  4ITQ A;  2AHM A;  1HQY E;  3I4Y A;  1DGB A;  4X66 M;  3CF2 A;  1FNN A;  2CEA A;  3U6L A;  3AV0 A;  3VK7 A;  4DR6 M;  5FTM A;  4I5S A;  4JI4 M;  5IT9 S;  3LQR A;  1IY0 A;  2BJV A;  2XLJ A;  4JI5 M;  2L7H A;  3AL0 C;  2OQ4 A;  3KOW E;  1N33 M;  4MGZ E;  3FYD A;  2DWN A;  1XMQ M;  2C9O A;  4IBE A;  3FYC A;  3HHX A;  2VQE M;  1JR3 A;  1XMO M;  4LJ9 A;  3HU1 A;  4BBA A;  3U61 A;  3J80 S;  3KOX E;  1R2Y A;  3FUV A;  5KPZ A;  4NSR A;  2KA6 B;  3GRU A;  4WW0 A;  2VQF M;  3IG8 A;  2G8L A;  1N32 M;  3CTW B;  4QOZ C;  1PJI A;  2Q2E B;  2XEP A;  2J7N A;  4MB7 A;  1JR3 D;  2Y0T A;  1IN7 A;  3VKG A;  3MK6 A;  1K3X A;  1PM5 A;  2CV2 A;  2UXB M;  1E32 A;  4S12 A;  1IY2 A;  4GKK M;  2BJW A;  4FCW A;  2Y21 A;  4LY6 A;  2Z4R A;  1K3W A;  4BLC A;  4GIP A;  3KFU G;  1J7K A;  4M0D A;  1IXS B;  1QAM A;  1Z5C A;  2YFQ A;  4XGI A;  3GQ4 A;  1S3S A;  4M0W A;  2V6Z M;  3PNY A;  4QHT A;  3KS4 A;  1Q39 A;  5JI2 E;  4OX9 M;  2C96 A;  2UUB M;  4D81 A;  3GQ3 A;  2LH0 A;  1G8P A;  4NRW A;  4RNA A;  1H6U A;  2M60 A;  1QAN A;  2ZAM A;  2ZM6 M;  4DUY M;  4X64 M;  1Z5A A;  2F4V M;  4YHH M;  2VII A;  1DGH B;  5KQ8 A;  3UZU A;  3U6Q A;  1SXJ D;  3AOE A;  4LF9 M;  1XNQ M;  3IG5 A;  5A2Q S;  3K1J A;  4WUR A;  3A45 A;  1L2C A;  1QAO A;  3FUW A;  3LMM A;  3JR4 A;  2C9C A;  1J09 A;  4JI8 M;  2Y20 A;  5EJC A;  3FKE A;  1MU5 A;  4CIS A;  4JI1 M;  1QYR A;  3GPP A;  2DHR A;  2XZF A;  2YNM D;  5EXS A;  2OPF A;  1YSY A;  1J5E M;  1GL7 A;  3AOE C;  1E94 E;  4M9S A;  2J7O A;  2W82 A;  3GQ5 A;  1SXJ B;  1XXH A;  3K2L A;  5JI3 E;  3KP0 E;  4LCB A;  1HR0 M;  3W0L B;  4FWH A;  1NHW C;  3BOS A;  4I4L A;  4LFA M;  4AG6 A;  2UXC M;  1EE8 A;  3GLH A;  2EA0 A;  2DWZ B;  4B3S M;  4R3D A;  2QZ4 A;  2R45 A;  3NBI A;  3VKH A;  2X8A A;  5DYI A;  1UM8 A;  2F5S A;  1ZQ9 A;  1KYI A;  4JN6 A;  1Z59 A;  1L2D A;  2CUZ A;  3HWS A;  4LFB M;  1G4A E;  2KEB A;  4LF6 M;  5ITU A;  3KSX A;  3R8F A;  1MX0 A;  2EUC A;  4A3V B;  1YUB A;  3QAU A;  5LMU M;  3A42 A;  1T3T A;  3VLF B;  4CGY B;  5BR8 M;  2QCU A;  4Z8X A;  4D82 A;  2XF3 A;  4L78 A;  5FLX S;  5EXT A;  3FTF A;  1TH3 A;  4L15 A;  2RGH A;  2UUC M;  1R6B X;  1QAQ A;  1IY1 A;  2DXI A;  1JQJ C;  4OU7 A;  4G4O A;  4DR1 M;  3TWK A;  4QNR A;  2FE8 A;  7CAT A;  2V1U A;  4KHP M;  3NWL A;  3AOG A;  3I51 A;  3R9X B;  1IBM M;  2D7H A;  3HJQ A;  3VFD A;  2I7P A;  2DZN B;  4KO8 A;  4LJ5 A;  3TE6 A;  5KO3 A;  4AKG A;  1N77 A;  4II7 A;  3HU3 A;  3HJ8 A;  3FTD A;  4AZF A;  4LF7 M;  2FNA A;  4MM3 B;  2C99 A;  3A46 A;  1IQP A;  3PXG A;  3JAM S;  5EP3 A;  3J2P B;  5EXP A;  4ZPX A;  1XHB A;  4G4Q A;  3ZH9 B;  4HLQ A;  5IRE B;  1FJG M;  4X65 M;  1NJF A;  1WXQ A;  2KRU A;  4DUZ M;  2CV0 A;  4IBJ A;  2DWM A;  3KOZ E;  2XSZ D;  4OW0 A;  4JXJ A;  3L28 A;  2R46 A;  3QWL A;  4OVZ A;  2C5R A;  3RGP A;  2ERC A;  3SYL A;  2E5L M;  2NQ8 C;  2CHQ A;  1IN6 A;  3HJS A;  1N75 A;  3SYK A;  3D8L A;  1IBL M;  3KOY E;  4LF4 M;  4AKH A;  1KSF X;  4M9Z A;  4JYA M;  1DGF A;  1HNX M;  4QNM A;  4QHS A;  1NNU C;  3MHV C;  4LGM A;  3U5Z B;  3DZD A;  3SHG B;  3KXE C;  4B3R M;  1SXJ A;  2ZAN A;  4D80 A;  1DGH A;  3J7B A;  3GLF A;  2H1R A;  4LJ7 A;  1Q3C A;  3GLH B;  4G6Z A;  5FTL A;  2XFS A;  3VDP A;  4NXM M;  1NHG C;  4I8O A;  3UMM A;  1OFH A;  3U6P A;  1QQW A;  4IIW A;  1R2Z A;  3DFZ A;  2EO2 A;  4RF0 A;  3OTO M;  4PD2 A;  5EP1 A;  4KOD A;  3T1H M;  5IWA M;  1N34 M;  8CAT A;  2FOI C;  3WHK A;  2X4A A;  3RFW A;  4LF5 M;  1HT2 E;  4AKI A;  5ITT A;  4YY3 M;  2I7N A;  3KP1 E;  3CF6 E;  3KVW A;  2R18 A;  4JI6 M;  3EIE A;  2V1C A;  4FWD A;  3T38 A;  3K92 A;  3SC3 A;  2M5Z A;  2DZO B;  5DYG A;  1IN4 A;  4AG5 A;  4GIT A;  1GLN A;  5KQD A;  1SXJ C;  3TQS A;  1HQC A;  4IBC A;  2KRK A;  1XC8 A;  1QVR A;  5EP4 A;  4JV5 M;  1IXZ A;  3H4M A;  3HHW A;  2X49 A;  4IBD A;  4DR2 M;  2KZU A;  2UXD M;  4NSO B;  1VDD A;  4JI3 M;  4LJ8 A;  3PVS A;  5FTK A;  3RGS A;  4GMQ A;  4M9X A;  5FSW A;  2RGO A;  3SAR A;  4B08 A;  4GKJ M;  4NRV A;  5E6J A;  4REZ A;  4Z6Y A;  4LRS A;  1D2N A;  3L2A A;  3EIH A;  4FWG A;  3U6O A;  2RKO A;  4DR3 M;  3SFZ A;  3U60 B;  4X62 M;  3U6E A;  1IM2 A;  1HT1 E;  1IXR C;  1OFI A;  5DNY A;  4I81 A;  1I4W A;  4W5W A;  3GPU A;  1DGG A;  1HNZ M;  1C1K A;  2FFJ A;  3E4R A;  5FTN A;  3ZC7 B;  2QPA A;  5ITX E;  4DV4 M;  3HHY A;  3A98 B;  1W5T A;  3MJ5 A;  4LGY A;  3J27 B;  4L16 A;  4PDI A;  3U5Z A;  2CHG A;  3GP1 A;  2CHV A;  4GH9 A;  3GRR A;  1OJL A;  2D7E A;  4G4R A;  4FCT A;  2L6O A;  1NSF A;  4IJE A;  1KFV A;  2HL7 A;  4PDG A;  3J81 S;  3ZCB B;  3KS8 A;  3I4V A;  2ZBK B;  3L29 A;  3HU2 A;  3L26 A;  2HKJ A;  3TWL A;  1NJG A;  2CE7 A;  4HL4 A;  1QZM A;  1Q3B A;  1Z5B A;  3C58 A;  1DO2 A;  4AI6 A;  3HHZ A;  4LRT A;  4LFC M;  2R4E A;  1X37 A;  1ZAE A;  3HKP A;  2HCB A;  3GLG B;  1G59 A;  4R7G A;  1ORY B;  1GL6 A;  5EXX A;  5C1B A;  3GLF B;  2R4J A;  2XGN A;  4EIW A;  3HGI A;  1GKI A;  4BB9 A;  3SMS A;  4LG2 A;  5F3W A;  3AJI B;  3K8Z A;  4RF1 A;  3L27 A;  5H37 D;  3SMP A;  4DV1 M;  3UJN A;  4DV3 M;  4LJ6 A;  4DV0 M;  3U6S A;  3PFI A;  4B3T M;  3TWM A;  3GPY A;  2K47 A;  3U6C A;  2F5N A;  4LJ4 A;  3SAS A;  4DV6 M;  1TH4 A;  5LMN M;  3J7A S;  1L2B A;  2ZAO A;  1YE9 A;  1NY6 A;  3GLI A;  3PNV A;  2L7I A;  2LNH C;  5BPV A;  1G3I A;  2DVW B;  2F5O A;  4G4N A;  1XWI A;  3M0E A;  1R7R A;  2A5Y B;  3KDS E;  1GVN A;  3KW6 A;  5ITQ A;  1DO0 A;  3D8B A;  5GKN A;  2Z7J A;  3B9P A;  3GPX A;  2R62 A;  1IN8 A;  4JI7 M;  2R65 A;  3FTC A;  2Z3X A;  2XSZ A;  1PJJ A;  5ITR A;  3WHL A;  3SAT A;  2G5G X;  4L8R C;  4PCZ A;  2Y0Q A;  1TDH A;  3FTE A;  4DR4 M;  3LQQ A;  2HHH M;  3E9S A;  3LVW A;  2C98 A;  4KLN A;  4FVM A;  2BNK A;  4GC9 A;  3FUX A;  4FCV A;  3THG A;  1L1Z A;  2QEN A;  4NXN M;  3U60 A;  4IBK A;  2YQZ A;  5ITY A;  3GRY A;  3U61 B;  4QOS A;  3GO8 A;  1NVM A;  3GRV A;  4NL4 H;  4DV2 M;  2UUA M;  2XFT A;  5E26 A;  1TH2 A;  1Z6T A;  3ILK A;  4MGH A;  3VDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...