3VK7A

Crystal structure of dna-glycosylase bound to dna containing 5-hydroxyuracil
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
288
structure length
288
Chain Sequence
b'PQGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTGMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable formamidopyrimidine-DNA glycosylase
molecule tags Hydrolase/dna
source organism Acanthamoeba polyphaga mimivirus
publication title Structural characterization of viral ortholog of human DNA glycosylase NEIL1 bound to thymine glycol or 5-hydroxyuracil-containing DNA
pubmed doi rcsb
total genus 82
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2011-11-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01149 Fapy_DNA_glyco Formamidopyrimidine-DNA glycosylase N-terminal domain
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 3vk7A02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 3vk7A01
1Q3BA 1Z5AA 3GQ3A 4JI5M 1R2YA 1IBKM 3TWKA 1NNJA 4DV5M 3U6CA 2UU9M 4JI1M 3GPPA 1N33M 3SBJA 4G4OA 2F5PA 3A42A 4B3MM 4PD2A 4GKKM 4JI4M 4LF6M 4X66M 3SASA 5ITTA 2EA0A 1TDZA 1PM5A 1J5EM 5BR8M 1L1ZA 2F5QA 4DR3M 4B3SM 1N32M 1K3XA 2ZBKB 3GP1A 4YHHM 3C58A 2F4VM 2UUAM 5FLXS 2HKJA 4JI2M 4LF9M 3GQ4A 4MB7A 3U6LA 1N36M 4JI6M 4CISA 3A45A 2OPFA 2Q2EB 2ZM6M 1FJGM 4DR6M 4X65M 3U6QA 1XMOM 5ITRA 5A2QS 1IBLM 4JI0M 5ITQA 4DR5M 4DUZM 1Z5BA 3GPXA 3GPYA 3SATA 4LF5M 3A46A 4X62M 1HNXM 3U6MA 3TWMA 3J81S 3GO8A 4DV6M 3SARA 5IT9S 1HNWM 2XZUA 3U6EA 5ITXE 4LF4M 1Z5CA 3U6PA 1L2BA 2UXBM 4DV0M 1EE8A 3JR5A 3J7AS 3GQ5A 3U6OA 2F5NA 2XZFA 4OX9M 4LFAM 1KFVA 5ITUA 4K0KM 5LMUM 4DV4M 3T1YM 2E5LM 1Z59A 1L2DA 4X64M 3T1HM 3SAWA 4LF8M 3VK7A 4PDIA 3GPUA 1XC8A 4DV3M 3VK8A 1TDHA 2F5OA 4LF7M 1L1TA 4DV1M 2F5SA 2UUBM 4YY3M 3W0FA 2VQEM 2UXDM 4JI3M 1R2ZA 3U6DA 4LFBM 2OQ4A 1XNQM 3J80S 3JAMS 4DV7M 1N34M 1HR0M 1IBMM 1Q3CA 4ITQA 3SAUA 1Q39A 4B3TM 4JV5M 4NXMM 1I94M 3OTOM 4KHPM 5ITYA 1K82A 1HNZM 1MX0A 2UXCM 3TWLA 3SAVA 4JYAM 1PJIA 1K3WA 3JR4A 4JI7M 2VQFM 2HHHM 4DUYM 4B3RM 1L2CA 1MU5A 4NXNM 4JI8M 1XNRM 5IWAM 5ITXA 3U6SA 4LFCM 4NRWA 4GKJM 4G4RA 2UUCM 4AQYM 4NRVA 5LMNM 4DR4M 4DR1M 4PCZA 4G4QA 4G4NA 4DR7M 4PDGA 1XMQM 3DOAA 4DR2M 4DV2M 1PJJA
chains in the Genus database with same CATH superfamily
1Z5AA 3GQ3A 3GLIE 1T3TA 1IBKM 3TWKA 3M0EA 3VKHA 2Z3XA 3GPPA 2C99A 4GITA 3SBJA 4IBFA 2F5PA 1G3IA 2CHGA 2KRKA 4IBJA 4B3MM 3AKZA 2I7PA 2XGNA 5GKNA 1SG9A 2JY7A 2QSFX 1NV9A 3L2AA 5EQTA 2EA0A 1IQPA 2OO9A 1VEKA 1Z6TA 3HJQA 1QAMA 3ZQJA 4WP2A 4MGIE 4AI6A 2HL7A 5IREB 1HQCA 1R4GA 3T38A 2QNJA 3B7NA 1K3XA 3E46A 4M9XA 1N78A 3B89A 3C58A 4OVZB 2JY8A 2HKJA 4D82A 1OFIA 1MN3A 1TH2A 3CF0A 3AOEC 1JR3E 1N36M 3IHPA 3TPZA 2WSCF 3SYLA 2ZM6M 3FKEA 2AHMA 3BOSA 1FJGM 3U6QA 5KPZA 4B7FA 1D2NA 4LZZA 3RGSA 4D81A 5ITRA 4IBBA 4KODA 2Y0QA 3M7GA 2JNHA 2X49A 3KDSE 4JI0M 5KQDA 3ZC7B 3GPXA 3GPYA 4DUZM 4DR5M 4X62M 1G8PA 2H1RA 2XFTA 2VDBB 2JZ1A 4LZJA 3PVSA 3J81S 2DNAA 4B7GA 5JI3E 3SARA 2G5GX 4XK8F 5IT9S 4G6ZA 1HNWM 1Z5CA 3KFUG 3HX3A 4IBGA 5FTJA 4DV0M 1EE8A 2YFQA 3LQRA 5FTMA 1IM2A 1DO0A 1IN5A 1VEGA 2JWSA 2DWNA 1NHGC 2F5NA 1ZV1A 4LFAM 3L26A 4OX9M 3HWSA 4QOZC 2CHVA 4K0KM 1E9SA 2WSEF 2OOBA 5FTNA 4DV4M 3T1YM 4Z8XA 2W82A 4LF8M 1V34A 1NVMA 1N75A 4I5SA 4FW9A 2BWEA 1XC8A 1A5TA 1GVNA 3LCVB 1TDHA 1QDTA 2R65A 2F5OA 1GKIA 2QENA 5DYIA 4B08A 4DV1M 2FE8A 4CGYB 1JQJC 2D7HA 4GHLA 3QYBA 3FTDA 5EP1A 2VQEM 1IN4A 3B9PA 4HLQA 1S3SA 4DV7M 3U5ZB 1IBMM 1NJFA 4ITQA 1QQWA 4M9SA 3KW6A 2QPAA 4KHPM 1K82A 2QCUA 1MX0A 4Q7JA 3SAVA 3HKPA 1IN7A 1QZMA 2XSZD 4L4UA 2LVNC 4S12A 1PJIA 1K3WA 1OAOC 3IG5A 4F2LA 2LNHC 4GC5A 4NC6A 5FTKA 1DGBA 5KPTA 2D7GA 2V6ZM 3GRYA 2C9OA 4II7A 4LJAA 1GL6A 3UGJA 2LTUA 3UK6A 2C96A 1L8QA 3CTWB 3IECA 3SYKA 1ZAEA 3H4JA 4KLNA 4REZA 3W0LB 3GLFE 2DKLA 4NRWA 4AZFA 4OU7A 2UUCM 4OW0A 2V1CA 2CRUA 3AOEA 2DAGA 1OKSA 2FH0A 1LV7A 3TE6A 4DR4M 4DR7M 3FYCA 1ZMUA 3U60B 3DOAA 3GLGB 3ZCBB 4DV2M 1PJJA 2L2DA 2C9CA 1Q3BA 2CP8A 3EIEA 3PNYA 1JR3D 1IN8A 4IBKA 2N35A 3SMPA 4JI1M 4QNMA 1OJLA 2EKKA 4IIWA 1LTMA 1DGHA 1IXZA 2EKFA 3A42A 3MK6A 1V92A 2JZ0A 2WZJA 5E6JA 3RE8A 2HAKA 3GLFA 4LJ6A 1N77A 1C7YA 2V1UA 2J7OA 4X66M 3SASA 1N33M 2MROB 1OQYA 1PM5A 5FTLA 5BR8M 4IBEA 1L1ZA 2F5QA 1TR8A 2L4EA 3KOXE 2JXNA 4DR3M 4B3SM 2CFOA 1QYRA 2LH0A 2ZBKB 3FTEA 1NHWC 4YHHM 4IJFA 3QWLA 4P17A 1KYIA 2DHYA 4LF9M 4KO8A 2DHRA 3TQSA 3GQ4A 2CWBA 3ZH9B 3E21A 3THGA 4LGYA 4Y28F 3K9OA 4X65M 4GIPA 4CIZA 3SFZA 4M0DA 4RF0A 4BB9A 2LHGA 2KZSA 1JB0F 2EO2A 4AKHA 1Z5BA 2DI0A 2DAIA 1PJSA 3DA1A 3SATA 4LF5M 4D80A 4GEWA 3KOZE 1TGUA 4MGHA 1HNXM 4P16A 1QAOA 1XXHB 3TWMA 2Z8YM 1SXJC 2KA6B 2K47A 5EJCA 3KOWE 4LF4M 3L29A 4AKIA 2L7HA 1E94E 4JXJA 3U6PA 2UXBM 2BWBA 1D0MA 1OTRA 1UM8A 3HZJA 3J7AS 3GRVA 1WR1B 2Y0TA 2BJWA 1SXJA 5EP2A 4GC9A 4FWGA 2XZFA 5LMUM 2E5LM 4LG2A 4X64M 3T1HM 3QYEA 3SAWA 3MHVC 1XXHA 5E26A 3KP1E 3FUXA 3GPUA 4IBIA 4L6V6 3VK8A 4GHAA 1W5TA 1F4IA 2XEPA 2RGHA 2MR9A 3GRRA 2DENA 2CV0A 2O25A 4RF1A 4L8RC 3BXWA 2FNAA 2KRUA 2UUBM 3HHZA 2DXIA 1IY0A 1QANA 3FUTA 2UXDM 3I4YA 3W67A 2DZOB 1PJQA 2O01F 4LFBM 3AOGA 4FCWA 3SHGB 1Q3CA 2R62A 2RGOA 3SAUA 4JV5M 3PXGA 2FS1A 3GRUA 3U60A 1I94M 1CUKA 2LBCA 2KHHA 1WXQA 2UXCM 1WHCA 3J7BA 3HHYA 3Q8XA 1R5LA 4MGKE 2VIIA 2VQFM 4A3VB 2HHHM 3U61B 2DWMA 1H6UA 3RGPA 4B3RM 2O5RA 2XF3A 3LCUA 5KO3A 1MU5A 3FD9A 3BBZA 4JI8M 1QZEA 1NNUC 4LCBA 5L8RF 3CF2A 4RNAA 1HQYE 1TF0B 3U6SA 4LFCM 4I81A 2LVPC 3UMMA 5LMNM 3DFZA 2VF7A 3H4MA 1XMQM 5EXTA 2KW0A 2J7NA 1SXJE 2ZTCA 4JI5M 4GRIA 1T6OA 5EXSA 1C1KA 4LRTA 5JI2E 1NNJA 1NY6A 4LJ5A 2KXEA 2Y20A 1V33A 3FUWA 4FD2A 3HU1A 3KSJA 4DV5M 3E9SA 4G4OA 1QUSA 1HJPA 1OIPA 1T43A 2FOIC 2A5YB 2CE7A 4PD2A 4AKGA 2R6FA 1VDDA 2ZANA 3I01M 4LF6M 1SXJB 1TDZA 3AV0A 2LVQD 4M0WA 3ILKA 4LGMA 3I51A 2ZAMA 3F92A 1HT1E 3NBXX 2CV1A 1N32M 3B7QA 2YQZA 2R45A 1YUBA 3HJ8A 1VDLA 3LQQA 4IJEA 4XGIA 2QP9X 4R71A 1EIJA 3K1JA 1P3QQ 2UUAM 3VDUA 1OIZA 1R7RA 5FLXS 4W5WA 2DWLA 2JP7A 4GMQA 4JI2M 3CF6E 5C1BA 2KNVA 4TUWA 4R7GA 1IN6A 3D8LA 2CV2A 4CISA 2OPFA 2Q2EB 1NO1A 1W5SA 1YSYA 2KEBA 2YR0A 5FSWA 1YLAA 1XMOM 2QBYA 1VEJA 1WJ7A 4QHSA 1IY1A 3D8BA 4LRSA 1IBLM 2QBYB 2Z7JA 5KQ8A 3SMSA 3L28A 4FWDA 4FVMA 3VKGA 1HT2E 2MJ5B 3DZDA 3U6MA 3J2PB 2NQ8C 3I04M 2K9DA 3T6PA 3GO8A 2JY5A 3WHKA 4DV6M 2XZUA 1GJTA 2RRUA 1EFUB 3KOYE 4ZPXA 1ZMWA 1L2BA 1QUTA 3K9PA 1DV0A 2C98A 2LVOC 1MJGM 3A98B 3GQ5A 3U6OA 1OAIA 2G8LA 2YNMD 3U61A 2VF8A 1G59A 1GABA 4EIWA 2KDLA 3UJNA 3IG8A 1WGLA 1UFZA 1Z59A 4OVZA 5BPVA 1L2DA 1AIPC 4NSOB 1PGYA 3UZUA 4PDIA 3FE3A 3TL4X 4MM3B 4DV3M 3HU3A 1G41A 1NSFA 3GLGA 4B7HA 4LF7M 4MGZE 1L1TA 4WURA 2ZAOA 1XWIA 2XFSA 3QAUA 1QVRA 2R46A 2XLJA 3T15A 2K0BX 4FCTA 3W0FA 1ORYB 4YY3M 1I4WA 2R4JA 4FWHA 2L09A 2LWXA 1R6BX 3FTFA 2OQ4A 4JN6A 5EP4A 3J80S 3JAMS 3J27B 3HHXA 1HR0M 5C18A 7CATA 2M5ZA 1Q39A 1D0LA 4NXMM 2QHOB 2QZ4A 3OTOM 3HHWA 1GJSA 5ITYA 5KPRA 1HNZM 1Q02A 3HU2A 3GLHB 4BBAA 4XBOA 3SHFA 1J09A 3JR4A 2R4EA 3I4VA 4LJ7A 3U5ZA 4AG5A 1L2CA 2B3TA 2OOAA 1KSFX 4I8OA 4LJ4A 4NXNM 2KNAA 2DAKA 3HJSA 1PJTA 4AW4A 3VDPA 1XB2B 3GLHA 1E9RA 4MGYE 4FCVA 4QOSA 4I4LA 2R18A 4G4RA 4NOOB 3LMMA 2CEAA 4AG6A 3M6AA 4PCZA 4G4QA 4G4NA 4DR1M 2BNKA 2EJSA 3AFHA 3KXEC 2LXEA 4CJ6A 1R2YA 2G3QA 3KS4A 3B7ZA 5DFLA 4PT5A 3U6CA 2BJVA 3MJ5A 2UU9M 1IY2A 1OFHA 1PRBA 2WSFF 2XH9A 4Z6YA 1AUAA 4JI4M 1QDRA 3LW5F 4LJ8A 4RKUF 4UN2B 3WHLA 1SXJD 3GLIA 3K92A 5ITTA 4NL4H 1G71A 4LJ9A 1J5EM 2LVAA 2J5YA 3FTCA 2ZTDA 2JY6B 2P5TA 4M9ZA 2R44A 3FRHA 3GP1A 3K2LA 2KNZA 3FYDA 2F4VM 2Z4SA 5EP3A 1G4AE 1TH4A 1ZQ9A 3NBIA 3FRIA 2DAEA 3KVWA 4L16A 4MB7A 4GKKM 1NV8A 2K6BA 3U6LA 4JI6M 2L7IA 3A45A 2C5RA 2GNOA 5H37D 4GH9A 2HWJA 3KS8A 1ZMVA 4DBGB 4DR6M 1IXSB 1FNNA 3Q8GA 2RKOA 2Z4RA 3AJIB 3EIHA 1IXSA 5A2QS 1DGHB 2APLA 2EUCA 2XSZA 1GO5A 1DGGA 5ITQA 2LHCA 1GLNA 2KZUA 3CGWA 3A46A 1XHBA 2R0IA 1VG5A 3GLGE 1TH3A 4IBDA 2JUJA 3VFDA 8CATA 4F1IA 3MMPA 3U6EA 5ITXE 3VLFB 2JA2A 5EXXA 2L6OA 3SC3A 3LVVA 3JR5A 3KSXA 2CHQA 3RFWA 3V76A 1IFYA 3FUUA 5ITUA 1KFVA 3C3EA 1NY5A 1YE9A 2D7EA 2L4FA 4L15A 3VK7A 1VQ1A 5IZ7D 2X4AA 5F3WA 3FUVA 2H5XA 2Y21A 4QNRA 3R9XB 3K8ZA 2DAMA 3HY5A 2HCBA 3E4RA 2FFJA 2F5SA 1DGFA 2QQ8A 2M60A 1D0KA 2MH8A 2I7NA 1TTEA 3C3DA 3PNVA 4JI3M 1R2ZA 4WW0A 3NWLA 3U6DA 3L25A 1JR3A 4ANRA 1XNQM 1N34M 4IBCA 2CUZA 3R8FA 2ERCA 4B3TM 1E32A 2DZLA 2GQFA 2DZNB 3PFIA 4NSRA 3TWLA 4G3OA 4JYAM 3W68A 1QAQA 2X8AA 4CHTB 1GL7A 3LVWA 4KT0F 3GLHE 3B74A 3L27A 5EXPA 1X37A 4JI7M 1RU3A 4L78A 4DUYM 1BVSA 1WIVA 1IXRC 4HL4A 2DWZB 3AL0C 1J7KA 3KP0E 4MH0E 3HGIA 4R3DA 3GLIB 1XXHE 4HEOA 3GLFB 1XNRM 5DYGA 5IWAM 4QHTA 5ITXA 1WGNA 1Y8GA 2DVWB 3C9PA 4GKJM 4AQYM 4NRVA 5DNYA 4PDGA 4LY6A 4DR2M 1DO2A 2MGWA 4BLCA 1NJGA
chains in the Genus database with same CATH topology
1Z5AA 3GQ3A 1T3TA 1IBKM 3TWKA 3M0EA 3VKHA 2Z3XA 3GPPA 2C99A 4GITA 3SBJA 4IBFA 2F5PA 1G3IA 2CHGA 2KRKA 4IBJA 4B3MM 3AKZA 2I7PA 2XGNA 5GKNA 3L2AA 5EQTA 2EA0A 1IQPA 1Z6TA 3HJQA 1QAMA 4AI6A 4MGIE 2HL7A 5IREB 1HQCA 3T38A 1K3XA 4M9XA 1N78A 3C58A 4OVZB 2HKJA 4D82A 1OFIA 1TH2A 3CF0A 3AOEC 1N36M 3TPZA 3SYLA 2ZM6M 3FKEA 2AHMA 3BOSA 1FJGM 3U6QA 5KPZA 4B7FA 1D2NA 4LZZA 3RGSA 4D81A 5ITRA 4IBBA 4KODA 2Y0QA 3M7GA 4JI0M 2X49A 3KDSE 5KQDA 4DR5M 3ZC7B 3GPXA 3GPYA 4DUZM 4X62M 1G8PA 2H1RA 2XFTA 4LZJA 3PVSA 3J81S 4B7GA 5JI3E 3SARA 2G5GX 5IT9S 4G6ZA 1HNWM 1Z5CA 3KFUG 4IBGA 5FTJA 4DV0M 1EE8A 2YFQA 3LQRA 5FTMA 1IM2A 1DO0A 1IN5A 2DWNA 1NHGC 2F5NA 4OX9M 4LFAM 3L26A 3HWSA 4QOZC 2CHVA 4K0KM 1E9SA 5FTNA 4DV4M 3T1YM 4Z8XA 2W82A 4LF8M 1NVMA 1N75A 4I5SA 4FW9A 1XC8A 1GVNA 1TDHA 2R65A 2F5OA 1GKIA 2QENA 5DYIA 4B08A 4DV1M 2FE8A 4CGYB 1JQJC 2D7HA 4GHLA 3FTDA 5EP1A 2VQEM 1IN4A 3B9PA 4HLQA 1S3SA 4DV7M 3U5ZB 1IBMM 1NJFA 4ITQA 1QQWA 4M9SA 3KW6A 2QPAA 4KHPM 1K82A 2QCUA 1MX0A 3SAVA 3HKPA 1IN7A 1QZMA 2XSZD 4L4UA 4S12A 1PJIA 1K3WA 3IG5A 2LNHC 4GC5A 5FTKA 5KPTA 1DGBA 2D7GA 2V6ZM 3GRYA 2C9OA 4II7A 4LJAA 1GL6A 3UGJA 3UK6A 2C96A 1L8QA 3CTWB 3SYKA 1ZAEA 4KLNA 4REZA 3W0LB 4NRWA 4AZFA 4OU7A 2UUCM 4OW0A 2V1CA 3TE6A 3AOEA 4DR4M 4DR7M 1LV7A 3FYCA 3U60B 3DOAA 3GLGB 3ZCBB 4DV2M 1PJJA 2C9CA 1Q3BA 3EIEA 3PNYA 1JR3D 1IN8A 4IBKA 4JI1M 3SMPA 4QNMA 1OJLA 4IIWA 3A42A 1DGHA 1IXZA 3GLFA 4GKKM 3MK6A 3RE8A 2V1UA 5E6JA 1N77A 4LJ6A 2J7OA 4X66M 3SASA 1PM5A 5FTLA 5BR8M 4IBEA 1L1ZA 2F5QA 4DR3M 4B3SM 3KOXE 2CFOA 1QYRA 2LH0A 2ZBKB 3FTEA 1NHWC 4YHHM 4IJFA 3QWLA 1KYIA 4LF9M 4KO8A 2DHRA 3TQSA 3GQ4A 3ZH9B 3THGA 4LGYA 4X65M 4GIPA 3SFZA 4M0DA 4RF0A 4BB9A 2KZSA 2EO2A 4AKHA 1Z5BA 3DA1A 3SATA 4LF5M 4D80A 3KOZE 1TGUA 4MGHA 1HNXM 4P16A 1QAOA 1XXHB 3TWMA 1SXJC 2KA6B 2K47A 5EJCA 3KOWE 4LF4M 3L29A 4AKIA 2L7HA 1E94E 4JXJA 3U6PA 2UXBM 3J7AS 1UM8A 3GRVA 2Y0TA 2BJWA 1SXJA 5EP2A 4GC9A 4FWGA 2XZFA 5LMUM 2E5LM 4LG2A 4X64M 3T1HM 3SAWA 3MHVC 1XXHA 5E26A 3KP1E 3FUXA 3GPUA 4IBIA 3VK8A 4GHAA 1W5TA 2XEPA 2RGHA 3GRRA 2CV0A 4RF1A 4L8RC 2FNAA 2KRUA 2UUBM 3HHZA 2DXIA 1IY0A 1QANA 3FUTA 2UXDM 3I4YA 2DZOB 4LFBM 3AOGA 4FCWA 3SHGB 1Q3CA 2R62A 2RGOA 3SAUA 4JV5M 3PXGA 3U60A 3GRUA 1I94M 1WXQA 2UXCM 3J7BA 3HHYA 3Q8XA 4MGKE 2VIIA 2VQFM 4A3VB 2HHHM 3U61B 2DWMA 1H6UA 3RGPA 4B3RM 2O5RA 2XF3A 5KO3A 1MU5A 3FD9A 4JI8M 1NNUC 4LCBA 3CF2A 4RNAA 1HQYE 3U6SA 4LFCM 4I81A 3UMMA 5LMNM 3DFZA 3H4MA 1XMQM 5EXTA 2KW0A 2J7NA 1SXJE 4JI5M 4GRIA 5EXSA 1C1KA 4LRTA 5JI2E 1NNJA 1NY6A 4LJ5A 2KXEA 2Y20A 3FUWA 4FD2A 4DV5M 3HU1A 3KSJA 1N33M 3E9SA 4G4OA 4AKGA 2FOIC 2CE7A 2A5YB 4PD2A 1VDDA 2ZANA 4LF6M 1SXJB 1TDZA 3AV0A 4M0WA 3ILKA 4LGMA 3I51A 2ZAMA 2CV1A 1HT1E 1N32M 2YQZA 2R45A 1YUBA 3HJ8A 3LQQA 4IJEA 4XGIA 2QP9X 3K1JA 2UUAM 3VDUA 1R7RA 5FLXS 4W5WA 2DWLA 4JI2M 4GMQA 3CF6E 5C1BA 4TUWA 4R7GA 1IN6A 3D8LA 2CV2A 4CISA 2OPFA 2Q2EB 1W5SA 1YSYA 2KEBA 2YR0A 5FSWA 2QBYA 1XMOM 4QHSA 1IY1A 3D8BA 4LRSA 1IBLM 2QBYB 2Z7JA 5KQ8A 3SMSA 3L28A 4FWDA 4FVMA 3VKGA 1HT2E 3DZDA 3U6MA 3J2PB 2NQ8C 3GO8A 4DV6M 3WHKA 2XZUA 3KOYE 4ZPXA 1L2BA 2C98A 3GQ5A 3A98B 3U6OA 2G8LA 2YNMD 3U61A 1G59A 4EIWA 3UJNA 3IG8A 1Z59A 4OVZA 5BPVA 1L2DA 4NSOB 3UZUA 4PDIA 3TL4X 4MM3B 4DV3M 3HU3A 1G41A 1NSFA 3GLGA 4B7HA 4LF7M 4MGZE 1L1TA 4WURA 2ZAOA 1XWIA 2XFSA 3QAUA 1QVRA 2R46A 2XLJA 3T15A 4YY3M 4FCTA 3W0FA 1ORYB 1I4WA 2R4JA 4FWHA 2L09A 2LWXA 1R6BX 3FTFA 2OQ4A 4JN6A 5EP4A 3J80S 3JAMS 3J27B 3HHXA 1HR0M 5C18A 7CATA 2M5ZA 1Q39A 4NXMM 2QZ4A 3OTOM 3HHWA 5ITYA 5KPRA 1HNZM 3HU2A 3GLHB 4BBAA 4XBOA 3SHFA 1J09A 3JR4A 2R4EA 3I4VA 4LJ7A 3U5ZA 4AG5A 1L2CA 1KSFX 4LJ4A 4I8OA 4NXNM 3HJSA 4AW4A 3VDPA 3GLHA 1E9RA 4MGYE 4FCVA 4QOSA 4I4LA 2R18A 4G4RA 4NOOB 3LMMA 2CEAA 4AG6A 3M6AA 4PCZA 4G4QA 4G4NA 4DR1M 2BNKA 3AFHA 3KXEC 2LXEA 1R2YA 3KS4A 4PT5A 3U6CA 2BJVA 3MJ5A 2UU9M 1IY2A 1OFHA 2XH9A 4Z6YA 4JI4M 4LJ8A 3GLIA 3WHLA 1SXJD 3K92A 5ITTA 4NL4H 4LJ9A 1J5EM 3FTCA 2P5TA 4M9ZA 3GP1A 3K2LA 3FYDA 2F4VM 2Z4SA 5EP3A 1G4AE 1TH4A 1ZQ9A 3NBIA 3KVWA 4L16A 4MB7A 3U6LA 4JI6M 2L7IA 3A45A 2C5RA 5H37D 4GH9A 3KS8A 4DR6M 1IXSB 1FNNA 2RKOA 2Z4RA 3AJIB 3EIHA 5A2QS 1DGHB 2EUCA 2XSZA 1DGGA 5ITQA 1GLNA 2KZUA 3A46A 1XHBA 1TH3A 4IBDA 3VFDA 8CATA 3U6EA 5ITXE 3VLFB 2JA2A 5EXXA 2L6OA 3SC3A 3LVVA 3JR5A 3KSXA 2CHQA 3RFWA 3FUUA 5ITUA 1KFVA 1NY5A 1YE9A 2D7EA 4L15A 3VK7A 5IZ7D 2X4AA 5F3WA 3FUVA 2Y21A 4QNRA 3R9XB 3K8ZA 2HCBA 3E4RA 2FFJA 2F5SA 1DGFA 2M60A 2I7NA 3PNVA 4JI3M 1R2ZA 4WW0A 3NWLA 3U6DA 3L25A 1JR3A 1XNQM 1N34M 4IBCA 2CUZA 3R8FA 2ERCA 4B3TM 1E32A 2DZNB 3PFIA 4NSRA 3TWLA 4JYAM 1QAQA 2X8AA 4CHTB 1GL7A 3LVWA 4JI7M 3L27A 5EXPA 1X37A 4L78A 4DUYM 1IXRC 4HL4A 2DWZB 3AL0C 1J7KA 3KP0E 4MH0E 3HGIA 4R3DA 3GLIB 3GLFB 1XNRM 5DYGA 5IWAM 4QHTA 5ITXA 2DVWB 4GKJM 4AQYM 4NRVA 5DNYA 4PDGA 4LY6A 4DR2M 1DO2A 4BLCA 1NJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q3B A;  1Z5A A;  3GQ3 A;  4JI5 M;  1R2Y A;  1IBK M;  3TWK A;  1NNJ A;  4DV5 M;  3U6C A;  2UU9 M;  4JI1 M;  3GPP A;  1N33 M;  3SBJ A;  4G4O A;  2F5P A;  3A42 A;  4B3M M;  4PD2 A;  4GKK M;  4JI4 M;  4LF6 M;  4X66 M;  3SAS A;  5ITT A;  2EA0 A;  1TDZ A;  1PM5 A;  1J5E M;  5BR8 M;  1L1Z A;  2F5Q A;  4DR3 M;  4B3S M;  1N32 M;  1K3X A;  2ZBK B;  3GP1 A;  4YHH M;  3C58 A;  2F4V M;  2UUA M;  5FLX S;  2HKJ A;  4JI2 M;  4LF9 M;  3GQ4 A;  4MB7 A;  3U6L A;  1N36 M;  4JI6 M;  4CIS A;  3A45 A;  2OPF A;  2Q2E B;  2ZM6 M;  1FJG M;  4DR6 M;  4X65 M;  3U6Q A;  1XMO M;  5ITR A;  5A2Q S;  1IBL M;  4JI0 M;  5ITQ A;  4DR5 M;  4DUZ M;  1Z5B A;  3GPX A;  3GPY A;  3SAT A;  4LF5 M;  3A46 A;  4X62 M;  1HNX M;  3U6M A;  3TWM A;  3J81 S;  3GO8 A;  4DV6 M;  3SAR A;  5IT9 S;  1HNW M;  2XZU A;  3U6E A;  5ITX E;  4LF4 M;  1Z5C A;  3U6P A;  1L2B A;  2UXB M;  4DV0 M;  1EE8 A;  3JR5 A;  3J7A S;  3GQ5 A;  3U6O A;  2F5N A;  2XZF A;  4OX9 M;  4LFA M;  1KFV A;  5ITU A;  4K0K M;  5LMU M;  4DV4 M;  3T1Y M;  2E5L M;  1Z59 A;  1L2D A;  4X64 M;  3T1H M;  3SAW A;  4LF8 M;  3VK7 A;  4PDI A;  3GPU A;  1XC8 A;  4DV3 M;  3VK8 A;  1TDH A;  2F5O A;  4LF7 M;  1L1T A;  4DV1 M;  2F5S A;  2UUB M;  4YY3 M;  3W0F A;  2VQE M;  2UXD M;  4JI3 M;  1R2Z A;  3U6D A;  4LFB M;  2OQ4 A;  1XNQ M;  3J80 S;  3JAM S;  4DV7 M;  1N34 M;  1HR0 M;  1IBM M;  1Q3C A;  4ITQ A;  3SAU A;  1Q39 A;  4B3T M;  4JV5 M;  4NXM M;  1I94 M;  3OTO M;  4KHP M;  5ITY A;  1K82 A;  1HNZ M;  1MX0 A;  2UXC M;  3TWL A;  3SAV A;  4JYA M;  1PJI A;  1K3W A;  3JR4 A;  4JI7 M;  2VQF M;  2HHH M;  4DUY M;  4B3R M;  1L2C A;  1MU5 A;  4NXN M;  4JI8 M;  1XNR M;  5IWA M;  5ITX A;  3U6S A;  4LFC M;  4NRW A;  4GKJ M;  4G4R A;  2UUC M;  4AQY M;  4NRV A;  5LMN M;  4DR4 M;  4DR1 M;  4PCZ A;  4G4Q A;  4G4N A;  4DR7 M;  4PDG A;  1XMQ M;  3DOA A;  4DR2 M;  4DV2 M;  1PJJ A; 
#chains in the Genus database with same CATH topology
 1Z5A A;  3GQ3 A;  3GLI E;  1T3T A;  1IBK M;  3TWK A;  3M0E A;  3VKH A;  2Z3X A;  3GPP A;  2C99 A;  4GIT A;  3SBJ A;  4IBF A;  2F5P A;  1G3I A;  2CHG A;  2KRK A;  4IBJ A;  4B3M M;  3AKZ A;  2I7P A;  2XGN A;  5GKN A;  1SG9 A;  2JY7 A;  2QSF X;  1NV9 A;  3L2A A;  5EQT A;  2EA0 A;  1IQP A;  2OO9 A;  1VEK A;  1Z6T A;  3HJQ A;  1QAM A;  3ZQJ A;  4WP2 A;  4MGI E;  4AI6 A;  2HL7 A;  5IRE B;  1HQC A;  1R4G A;  3T38 A;  2QNJ A;  3B7N A;  1K3X A;  3E46 A;  4M9X A;  1N78 A;  3B89 A;  3C58 A;  4OVZ B;  2JY8 A;  2HKJ A;  4D82 A;  1OFI A;  1MN3 A;  1TH2 A;  3CF0 A;  3AOE C;  1JR3 E;  1N36 M;  3IHP A;  3TPZ A;  2WSC F;  3SYL A;  2ZM6 M;  3FKE A;  2AHM A;  3BOS A;  1FJG M;  3U6Q A;  5KPZ A;  4B7F A;  1D2N A;  4LZZ A;  3RGS A;  4D81 A;  5ITR A;  4IBB A;  4KOD A;  2Y0Q A;  3M7G A;  2JNH A;  2X49 A;  3KDS E;  4JI0 M;  5KQD A;  3ZC7 B;  3GPX A;  3GPY A;  4DUZ M;  4DR5 M;  4X62 M;  1G8P A;  2H1R A;  2XFT A;  2VDB B;  2JZ1 A;  4LZJ A;  3PVS A;  3J81 S;  2DNA A;  4B7G A;  5JI3 E;  3SAR A;  2G5G X;  4XK8 F;  5IT9 S;  4G6Z A;  1HNW M;  1Z5C A;  3KFU G;  3HX3 A;  4IBG A;  5FTJ A;  4DV0 M;  1EE8 A;  2YFQ A;  3LQR A;  5FTM A;  1IM2 A;  1DO0 A;  1IN5 A;  1VEG A;  2JWS A;  2DWN A;  1NHG C;  2F5N A;  1ZV1 A;  4LFA M;  3L26 A;  4OX9 M;  3HWS A;  4QOZ C;  2CHV A;  4K0K M;  1E9S A;  2WSE F;  2OOB A;  5FTN A;  4DV4 M;  3T1Y M;  4Z8X A;  2W82 A;  4LF8 M;  1V34 A;  1NVM A;  1N75 A;  4I5S A;  4FW9 A;  2BWE A;  1XC8 A;  1A5T A;  1GVN A;  3LCV B;  1TDH A;  1QDT A;  2R65 A;  2F5O A;  1GKI A;  2QEN A;  5DYI A;  4B08 A;  4DV1 M;  2FE8 A;  4CGY B;  1JQJ C;  2D7H A;  4GHL A;  3QYB A;  3FTD A;  5EP1 A;  2VQE M;  1IN4 A;  3B9P A;  4HLQ A;  1S3S A;  4DV7 M;  3U5Z B;  1IBM M;  1NJF A;  4ITQ A;  1QQW A;  4M9S A;  3KW6 A;  2QPA A;  4KHP M;  1K82 A;  2QCU A;  1MX0 A;  4Q7J A;  3SAV A;  3HKP A;  1IN7 A;  1QZM A;  2XSZ D;  4L4U A;  2LVN C;  4S12 A;  1PJI A;  1K3W A;  1OAO C;  3IG5 A;  4F2L A;  2LNH C;  4GC5 A;  4NC6 A;  5FTK A;  1DGB A;  5KPT A;  2D7G A;  2V6Z M;  3GRY A;  2C9O A;  4II7 A;  4LJA A;  1GL6 A;  3UGJ A;  2LTU A;  3UK6 A;  2C96 A;  1L8Q A;  3CTW B;  3IEC A;  3SYK A;  1ZAE A;  3H4J A;  4KLN A;  4REZ A;  3W0L B;  3GLF E;  2DKL A;  4NRW A;  4AZF A;  4OU7 A;  2UUC M;  4OW0 A;  2V1C A;  2CRU A;  3AOE A;  2DAG A;  1OKS A;  2FH0 A;  1LV7 A;  3TE6 A;  4DR4 M;  4DR7 M;  3FYC A;  1ZMU A;  3U60 B;  3DOA A;  3GLG B;  3ZCB B;  4DV2 M;  1PJJ A;  2L2D A;  2C9C A;  1Q3B A;  2CP8 A;  3EIE A;  3PNY A;  1JR3 D;  1IN8 A;  4IBK A;  2N35 A;  3SMP A;  4JI1 M;  4QNM A;  1OJL A;  2EKK A;  4IIW A;  1LTM A;  1DGH A;  1IXZ A;  2EKF A;  3A42 A;  3MK6 A;  1V92 A;  2JZ0 A;  2WZJ A;  5E6J A;  3RE8 A;  2HAK A;  3GLF A;  4LJ6 A;  1N77 A;  1C7Y A;  2V1U A;  2J7O A;  4X66 M;  3SAS A;  1N33 M;  2MRO B;  1OQY A;  1PM5 A;  5FTL A;  5BR8 M;  4IBE A;  1L1Z A;  2F5Q A;  1TR8 A;  2L4E A;  3KOX E;  2JXN A;  4DR3 M;  4B3S M;  2CFO A;  1QYR A;  2LH0 A;  2ZBK B;  3FTE A;  1NHW C;  4YHH M;  4IJF A;  3QWL A;  4P17 A;  1KYI A;  2DHY A;  4LF9 M;  4KO8 A;  2DHR A;  3TQS A;  3GQ4 A;  2CWB A;  3ZH9 B;  3E21 A;  3THG A;  4LGY A;  4Y28 F;  3K9O A;  4X65 M;  4GIP A;  4CIZ A;  3SFZ A;  4M0D A;  4RF0 A;  4BB9 A;  2LHG A;  2KZS A;  1JB0 F;  2EO2 A;  4AKH A;  1Z5B A;  2DI0 A;  2DAI A;  1PJS A;  3DA1 A;  3SAT A;  4LF5 M;  4D80 A;  4GEW A;  3KOZ E;  1TGU A;  4MGH A;  1HNX M;  4P16 A;  1QAO A;  1XXH B;  3TWM A;  2Z8Y M;  1SXJ C;  2KA6 B;  2K47 A;  5EJC A;  3KOW E;  4LF4 M;  3L29 A;  4AKI A;  2L7H A;  1E94 E;  4JXJ A;  3U6P A;  2UXB M;  2BWB A;  1D0M A;  1OTR A;  1UM8 A;  3HZJ A;  3J7A S;  3GRV A;  1WR1 B;  2Y0T A;  2BJW A;  1SXJ A;  5EP2 A;  4GC9 A;  4FWG A;  2XZF A;  5LMU M;  2E5L M;  4LG2 A;  4X64 M;  3T1H M;  3QYE A;  3SAW A;  3MHV C;  1XXH A;  5E26 A;  3KP1 E;  3FUX A;  3GPU A;  4IBI A;  4L6V 6;  3VK8 A;  4GHA A;  1W5T A;  1F4I A;  2XEP A;  2RGH A;  2MR9 A;  3GRR A;  2DEN A;  2CV0 A;  2O25 A;  4RF1 A;  4L8R C;  3BXW A;  2FNA A;  2KRU A;  2UUB M;  3HHZ A;  2DXI A;  1IY0 A;  1QAN A;  3FUT A;  2UXD M;  3I4Y A;  3W67 A;  2DZO B;  1PJQ A;  2O01 F;  4LFB M;  3AOG A;  4FCW A;  3SHG B;  1Q3C A;  2R62 A;  2RGO A;  3SAU A;  4JV5 M;  3PXG A;  2FS1 A;  3GRU A;  3U60 A;  1I94 M;  1CUK A;  2LBC A;  2KHH A;  1WXQ A;  2UXC M;  1WHC A;  3J7B A;  3HHY A;  3Q8X A;  1R5L A;  4MGK E;  2VII A;  2VQF M;  4A3V B;  2HHH M;  3U61 B;  2DWM A;  1H6U A;  3RGP A;  4B3R M;  2O5R A;  2XF3 A;  3LCU A;  5KO3 A;  1MU5 A;  3FD9 A;  3BBZ A;  4JI8 M;  1QZE A;  1NNU C;  4LCB A;  5L8R F;  3CF2 A;  4RNA A;  1HQY E;  1TF0 B;  3U6S A;  4LFC M;  4I81 A;  2LVP C;  3UMM A;  5LMN M;  3DFZ A;  2VF7 A;  3H4M A;  1XMQ M;  5EXT A;  2KW0 A;  2J7N A;  1SXJ E;  2ZTC A;  4JI5 M;  4GRI A;  1T6O A;  5EXS A;  1C1K A;  4LRT A;  5JI2 E;  1NNJ A;  1NY6 A;  4LJ5 A;  2KXE A;  2Y20 A;  1V33 A;  3FUW A;  4FD2 A;  3HU1 A;  3KSJ A;  4DV5 M;  3E9S A;  4G4O A;  1QUS A;  1HJP A;  1OIP A;  1T43 A;  2FOI C;  2A5Y B;  2CE7 A;  4PD2 A;  4AKG A;  2R6F A;  1VDD A;  2ZAN A;  3I01 M;  4LF6 M;  1SXJ B;  1TDZ A;  3AV0 A;  2LVQ D;  4M0W A;  3ILK A;  4LGM A;  3I51 A;  2ZAM A;  3F92 A;  1HT1 E;  3NBX X;  2CV1 A;  1N32 M;  3B7Q A;  2YQZ A;  2R45 A;  1YUB A;  3HJ8 A;  1VDL A;  3LQQ A;  4IJE A;  4XGI A;  2QP9 X;  4R71 A;  1EIJ A;  3K1J A;  1P3Q Q;  2UUA M;  3VDU A;  1OIZ A;  1R7R A;  5FLX S;  4W5W A;  2DWL A;  2JP7 A;  4GMQ A;  4JI2 M;  3CF6 E;  5C1B A;  2KNV A;  4TUW A;  4R7G A;  1IN6 A;  3D8L A;  2CV2 A;  4CIS A;  2OPF A;  2Q2E B;  1NO1 A;  1W5S A;  1YSY A;  2KEB A;  2YR0 A;  5FSW A;  1YLA A;  1XMO M;  2QBY A;  1VEJ A;  1WJ7 A;  4QHS A;  1IY1 A;  3D8B A;  4LRS A;  1IBL M;  2QBY B;  2Z7J A;  5KQ8 A;  3SMS A;  3L28 A;  4FWD A;  4FVM A;  3VKG A;  1HT2 E;  2MJ5 B;  3DZD A;  3U6M A;  3J2P B;  2NQ8 C;  3I04 M;  2K9D A;  3T6P A;  3GO8 A;  2JY5 A;  3WHK A;  4DV6 M;  2XZU A;  1GJT A;  2RRU A;  1EFU B;  3KOY E;  4ZPX A;  1ZMW A;  1L2B A;  1QUT A;  3K9P A;  1DV0 A;  2C98 A;  2LVO C;  1MJG M;  3A98 B;  3GQ5 A;  3U6O A;  1OAI A;  2G8L A;  2YNM D;  3U61 A;  2VF8 A;  1G59 A;  1GAB A;  4EIW A;  2KDL A;  3UJN A;  3IG8 A;  1WGL A;  1UFZ A;  1Z59 A;  4OVZ A;  5BPV A;  1L2D A;  1AIP C;  4NSO B;  1PGY A;  3UZU A;  4PDI A;  3FE3 A;  3TL4 X;  4MM3 B;  4DV3 M;  3HU3 A;  1G41 A;  1NSF A;  3GLG A;  4B7H A;  4LF7 M;  4MGZ E;  1L1T A;  4WUR A;  2ZAO A;  1XWI A;  2XFS A;  3QAU A;  1QVR A;  2R46 A;  2XLJ A;  3T15 A;  2K0B X;  4FCT A;  3W0F A;  1ORY B;  4YY3 M;  1I4W A;  2R4J A;  4FWH A;  2L09 A;  2LWX A;  1R6B X;  3FTF A;  2OQ4 A;  4JN6 A;  5EP4 A;  3J80 S;  3JAM S;  3J27 B;  3HHX A;  1HR0 M;  5C18 A;  7CAT A;  2M5Z A;  1Q39 A;  1D0L A;  4NXM M;  2QHO B;  2QZ4 A;  3OTO M;  3HHW A;  1GJS A;  5ITY A;  5KPR A;  1HNZ M;  1Q02 A;  3HU2 A;  3GLH B;  4BBA A;  4XBO A;  3SHF A;  1J09 A;  3JR4 A;  2R4E A;  3I4V A;  4LJ7 A;  3U5Z A;  4AG5 A;  1L2C A;  2B3T A;  2OOA A;  1KSF X;  4I8O A;  4LJ4 A;  4NXN M;  2KNA A;  2DAK A;  3HJS A;  1PJT A;  4AW4 A;  3VDP A;  1XB2 B;  3GLH A;  1E9R A;  4MGY E;  4FCV A;  4QOS A;  4I4L A;  2R18 A;  4G4R A;  4NOO B;  3LMM A;  2CEA A;  4AG6 A;  3M6A A;  4PCZ A;  4G4Q A;  4G4N A;  4DR1 M;  2BNK A;  2EJS A;  3AFH A;  3KXE C;  2LXE A;  4CJ6 A;  1R2Y A;  2G3Q A;  3KS4 A;  3B7Z A;  5DFL A;  4PT5 A;  3U6C A;  2BJV A;  3MJ5 A;  2UU9 M;  1IY2 A;  1OFH A;  1PRB A;  2WSF F;  2XH9 A;  4Z6Y A;  1AUA A;  4JI4 M;  1QDR A;  3LW5 F;  4LJ8 A;  4RKU F;  4UN2 B;  3WHL A;  1SXJ D;  3GLI A;  3K92 A;  5ITT A;  4NL4 H;  1G71 A;  4LJ9 A;  1J5E M;  2LVA A;  2J5Y A;  3FTC A;  2ZTD A;  2JY6 B;  2P5T A;  4M9Z A;  2R44 A;  3FRH A;  3GP1 A;  3K2L A;  2KNZ A;  3FYD A;  2F4V M;  2Z4S A;  5EP3 A;  1G4A E;  1TH4 A;  1ZQ9 A;  3NBI A;  3FRI A;  2DAE A;  3KVW A;  4L16 A;  4MB7 A;  4GKK M;  1NV8 A;  2K6B A;  3U6L A;  4JI6 M;  2L7I A;  3A45 A;  2C5R A;  2GNO A;  5H37 D;  4GH9 A;  2HWJ A;  3KS8 A;  1ZMV A;  4DBG B;  4DR6 M;  1IXS B;  1FNN A;  3Q8G A;  2RKO A;  2Z4R A;  3AJI B;  3EIH A;  1IXS A;  5A2Q S;  1DGH B;  2APL A;  2EUC A;  2XSZ A;  1GO5 A;  1DGG A;  5ITQ A;  2LHC A;  1GLN A;  2KZU A;  3CGW A;  3A46 A;  1XHB A;  2R0I A;  1VG5 A;  3GLG E;  1TH3 A;  4IBD A;  2JUJ A;  3VFD A;  8CAT A;  4F1I A;  3MMP A;  3U6E A;  5ITX E;  3VLF B;  2JA2 A;  5EXX A;  2L6O A;  3SC3 A;  3LVV A;  3JR5 A;  3KSX A;  2CHQ A;  3RFW A;  3V76 A;  1IFY A;  3FUU A;  5ITU A;  1KFV A;  3C3E A;  1NY5 A;  1YE9 A;  2D7E A;  2L4F A;  4L15 A;  3VK7 A;  1VQ1 A;  5IZ7 D;  2X4A A;  5F3W A;  3FUV A;  2H5X A;  2Y21 A;  4QNR A;  3R9X B;  3K8Z A;  2DAM A;  3HY5 A;  2HCB A;  3E4R A;  2FFJ A;  2F5S A;  1DGF A;  2QQ8 A;  2M60 A;  1D0K A;  2MH8 A;  2I7N A;  1TTE A;  3C3D A;  3PNV A;  4JI3 M;  1R2Z A;  4WW0 A;  3NWL A;  3U6D A;  3L25 A;  1JR3 A;  4ANR A;  1XNQ M;  1N34 M;  4IBC A;  2CUZ A;  3R8F A;  2ERC A;  4B3T M;  1E32 A;  2DZL A;  2GQF A;  2DZN B;  3PFI A;  4NSR A;  3TWL A;  4G3O A;  4JYA M;  3W68 A;  1QAQ A;  2X8A A;  4CHT B;  1GL7 A;  3LVW A;  4KT0 F;  3GLH E;  3B74 A;  3L27 A;  5EXP A;  1X37 A;  4JI7 M;  1RU3 A;  4L78 A;  4DUY M;  1BVS A;  1WIV A;  1IXR C;  4HL4 A;  2DWZ B;  3AL0 C;  1J7K A;  3KP0 E;  4MH0 E;  3HGI A;  4R3D A;  3GLI B;  1XXH E;  4HEO A;  3GLF B;  1XNR M;  5DYG A;  5IWA M;  4QHT A;  5ITX A;  1WGN A;  1Y8G A;  2DVW B;  3C9P A;  4GKJ M;  4AQY M;  4NRV A;  5DNY A;  4PDG A;  4LY6 A;  4DR2 M;  1DO2 A;  2MGW A;  4BLC A;  1NJG A; 
#chains in the Genus database with same CATH homology
 1Z5A A;  3GQ3 A;  1T3T A;  1IBK M;  3TWK A;  3M0E A;  3VKH A;  2Z3X A;  3GPP A;  2C99 A;  4GIT A;  3SBJ A;  4IBF A;  2F5P A;  1G3I A;  2CHG A;  2KRK A;  4IBJ A;  4B3M M;  3AKZ A;  2I7P A;  2XGN A;  5GKN A;  3L2A A;  5EQT A;  2EA0 A;  1IQP A;  1Z6T A;  3HJQ A;  1QAM A;  4AI6 A;  4MGI E;  2HL7 A;  5IRE B;  1HQC A;  3T38 A;  1K3X A;  4M9X A;  1N78 A;  3C58 A;  4OVZ B;  2HKJ A;  4D82 A;  1OFI A;  1TH2 A;  3CF0 A;  3AOE C;  1N36 M;  3TPZ A;  3SYL A;  2ZM6 M;  3FKE A;  2AHM A;  3BOS A;  1FJG M;  3U6Q A;  5KPZ A;  4B7F A;  1D2N A;  4LZZ A;  3RGS A;  4D81 A;  5ITR A;  4IBB A;  4KOD A;  2Y0Q A;  3M7G A;  4JI0 M;  2X49 A;  3KDS E;  5KQD A;  4DR5 M;  3ZC7 B;  3GPX A;  3GPY A;  4DUZ M;  4X62 M;  1G8P A;  2H1R A;  2XFT A;  4LZJ A;  3PVS A;  3J81 S;  4B7G A;  5JI3 E;  3SAR A;  2G5G X;  5IT9 S;  4G6Z A;  1HNW M;  1Z5C A;  3KFU G;  4IBG A;  5FTJ A;  4DV0 M;  1EE8 A;  2YFQ A;  3LQR A;  5FTM A;  1IM2 A;  1DO0 A;  1IN5 A;  2DWN A;  1NHG C;  2F5N A;  4OX9 M;  4LFA M;  3L26 A;  3HWS A;  4QOZ C;  2CHV A;  4K0K M;  1E9S A;  5FTN A;  4DV4 M;  3T1Y M;  4Z8X A;  2W82 A;  4LF8 M;  1NVM A;  1N75 A;  4I5S A;  4FW9 A;  1XC8 A;  1GVN A;  1TDH A;  2R65 A;  2F5O A;  1GKI A;  2QEN A;  5DYI A;  4B08 A;  4DV1 M;  2FE8 A;  4CGY B;  1JQJ C;  2D7H A;  4GHL A;  3FTD A;  5EP1 A;  2VQE M;  1IN4 A;  3B9P A;  4HLQ A;  1S3S A;  4DV7 M;  3U5Z B;  1IBM M;  1NJF A;  4ITQ A;  1QQW A;  4M9S A;  3KW6 A;  2QPA A;  4KHP M;  1K82 A;  2QCU A;  1MX0 A;  3SAV A;  3HKP A;  1IN7 A;  1QZM A;  2XSZ D;  4L4U A;  4S12 A;  1PJI A;  1K3W A;  3IG5 A;  2LNH C;  4GC5 A;  5FTK A;  5KPT A;  1DGB A;  2D7G A;  2V6Z M;  3GRY A;  2C9O A;  4II7 A;  4LJA A;  1GL6 A;  3UGJ A;  3UK6 A;  2C96 A;  1L8Q A;  3CTW B;  3SYK A;  1ZAE A;  4KLN A;  4REZ A;  3W0L B;  4NRW A;  4AZF A;  4OU7 A;  2UUC M;  4OW0 A;  2V1C A;  3TE6 A;  3AOE A;  4DR4 M;  4DR7 M;  1LV7 A;  3FYC A;  3U60 B;  3DOA A;  3GLG B;  3ZCB B;  4DV2 M;  1PJJ A;  2C9C A;  1Q3B A;  3EIE A;  3PNY A;  1JR3 D;  1IN8 A;  4IBK A;  4JI1 M;  3SMP A;  4QNM A;  1OJL A;  4IIW A;  3A42 A;  1DGH A;  1IXZ A;  3GLF A;  4GKK M;  3MK6 A;  3RE8 A;  2V1U A;  5E6J A;  1N77 A;  4LJ6 A;  2J7O A;  4X66 M;  3SAS A;  1PM5 A;  5FTL A;  5BR8 M;  4IBE A;  1L1Z A;  2F5Q A;  4DR3 M;  4B3S M;  3KOX E;  2CFO A;  1QYR A;  2LH0 A;  2ZBK B;  3FTE A;  1NHW C;  4YHH M;  4IJF A;  3QWL A;  1KYI A;  4LF9 M;  4KO8 A;  2DHR A;  3TQS A;  3GQ4 A;  3ZH9 B;  3THG A;  4LGY A;  4X65 M;  4GIP A;  3SFZ A;  4M0D A;  4RF0 A;  4BB9 A;  2KZS A;  2EO2 A;  4AKH A;  1Z5B A;  3DA1 A;  3SAT A;  4LF5 M;  4D80 A;  3KOZ E;  1TGU A;  4MGH A;  1HNX M;  4P16 A;  1QAO A;  1XXH B;  3TWM A;  1SXJ C;  2KA6 B;  2K47 A;  5EJC A;  3KOW E;  4LF4 M;  3L29 A;  4AKI A;  2L7H A;  1E94 E;  4JXJ A;  3U6P A;  2UXB M;  3J7A S;  1UM8 A;  3GRV A;  2Y0T A;  2BJW A;  1SXJ A;  5EP2 A;  4GC9 A;  4FWG A;  2XZF A;  5LMU M;  2E5L M;  4LG2 A;  4X64 M;  3T1H M;  3SAW A;  3MHV C;  1XXH A;  5E26 A;  3KP1 E;  3FUX A;  3GPU A;  4IBI A;  3VK8 A;  4GHA A;  1W5T A;  2XEP A;  2RGH A;  3GRR A;  2CV0 A;  4RF1 A;  4L8R C;  2FNA A;  2KRU A;  2UUB M;  3HHZ A;  2DXI A;  1IY0 A;  1QAN A;  3FUT A;  2UXD M;  3I4Y A;  2DZO B;  4LFB M;  3AOG A;  4FCW A;  3SHG B;  1Q3C A;  2R62 A;  2RGO A;  3SAU A;  4JV5 M;  3PXG A;  3U60 A;  3GRU A;  1I94 M;  1WXQ A;  2UXC M;  3J7B A;  3HHY A;  3Q8X A;  4MGK E;  2VII A;  2VQF M;  4A3V B;  2HHH M;  3U61 B;  2DWM A;  1H6U A;  3RGP A;  4B3R M;  2O5R A;  2XF3 A;  5KO3 A;  1MU5 A;  3FD9 A;  4JI8 M;  1NNU C;  4LCB A;  3CF2 A;  4RNA A;  1HQY E;  3U6S A;  4LFC M;  4I81 A;  3UMM A;  5LMN M;  3DFZ A;  3H4M A;  1XMQ M;  5EXT A;  2KW0 A;  2J7N A;  1SXJ E;  4JI5 M;  4GRI A;  5EXS A;  1C1K A;  4LRT A;  5JI2 E;  1NNJ A;  1NY6 A;  4LJ5 A;  2KXE A;  2Y20 A;  3FUW A;  4FD2 A;  4DV5 M;  3HU1 A;  3KSJ A;  1N33 M;  3E9S A;  4G4O A;  4AKG A;  2FOI C;  2CE7 A;  2A5Y B;  4PD2 A;  1VDD A;  2ZAN A;  4LF6 M;  1SXJ B;  1TDZ A;  3AV0 A;  4M0W A;  3ILK A;  4LGM A;  3I51 A;  2ZAM A;  2CV1 A;  1HT1 E;  1N32 M;  2YQZ A;  2R45 A;  1YUB A;  3HJ8 A;  3LQQ A;  4IJE A;  4XGI A;  2QP9 X;  3K1J A;  2UUA M;  3VDU A;  1R7R A;  5FLX S;  4W5W A;  2DWL A;  4JI2 M;  4GMQ A;  3CF6 E;  5C1B A;  4TUW A;  4R7G A;  1IN6 A;  3D8L A;  2CV2 A;  4CIS A;  2OPF A;  2Q2E B;  1W5S A;  1YSY A;  2KEB A;  2YR0 A;  5FSW A;  2QBY A;  1XMO M;  4QHS A;  1IY1 A;  3D8B A;  4LRS A;  1IBL M;  2QBY B;  2Z7J A;  5KQ8 A;  3SMS A;  3L28 A;  4FWD A;  4FVM A;  3VKG A;  1HT2 E;  3DZD A;  3U6M A;  3J2P B;  2NQ8 C;  3GO8 A;  4DV6 M;  3WHK A;  2XZU A;  3KOY E;  4ZPX A;  1L2B A;  2C98 A;  3GQ5 A;  3A98 B;  3U6O A;  2G8L A;  2YNM D;  3U61 A;  1G59 A;  4EIW A;  3UJN A;  3IG8 A;  1Z59 A;  4OVZ A;  5BPV A;  1L2D A;  4NSO B;  3UZU A;  4PDI A;  3TL4 X;  4MM3 B;  4DV3 M;  3HU3 A;  1G41 A;  1NSF A;  3GLG A;  4B7H A;  4LF7 M;  4MGZ E;  1L1T A;  4WUR A;  2ZAO A;  1XWI A;  2XFS A;  3QAU A;  1QVR A;  2R46 A;  2XLJ A;  3T15 A;  4YY3 M;  4FCT A;  3W0F A;  1ORY B;  1I4W A;  2R4J A;  4FWH A;  2L09 A;  2LWX A;  1R6B X;  3FTF A;  2OQ4 A;  4JN6 A;  5EP4 A;  3J80 S;  3JAM S;  3J27 B;  3HHX A;  1HR0 M;  5C18 A;  7CAT A;  2M5Z A;  1Q39 A;  4NXM M;  2QZ4 A;  3OTO M;  3HHW A;  5ITY A;  5KPR A;  1HNZ M;  3HU2 A;  3GLH B;  4BBA A;  4XBO A;  3SHF A;  1J09 A;  3JR4 A;  2R4E A;  3I4V A;  4LJ7 A;  3U5Z A;  4AG5 A;  1L2C A;  1KSF X;  4LJ4 A;  4I8O A;  4NXN M;  3HJS A;  4AW4 A;  3VDP A;  3GLH A;  1E9R A;  4MGY E;  4FCV A;  4QOS A;  4I4L A;  2R18 A;  4G4R A;  4NOO B;  3LMM A;  2CEA A;  4AG6 A;  3M6A A;  4PCZ A;  4G4Q A;  4G4N A;  4DR1 M;  2BNK A;  3AFH A;  3KXE C;  2LXE A;  1R2Y A;  3KS4 A;  4PT5 A;  3U6C A;  2BJV A;  3MJ5 A;  2UU9 M;  1IY2 A;  1OFH A;  2XH9 A;  4Z6Y A;  4JI4 M;  4LJ8 A;  3GLI A;  3WHL A;  1SXJ D;  3K92 A;  5ITT A;  4NL4 H;  4LJ9 A;  1J5E M;  3FTC A;  2P5T A;  4M9Z A;  3GP1 A;  3K2L A;  3FYD A;  2F4V M;  2Z4S A;  5EP3 A;  1G4A E;  1TH4 A;  1ZQ9 A;  3NBI A;  3KVW A;  4L16 A;  4MB7 A;  3U6L A;  4JI6 M;  2L7I A;  3A45 A;  2C5R A;  5H37 D;  4GH9 A;  3KS8 A;  4DR6 M;  1IXS B;  1FNN A;  2RKO A;  2Z4R A;  3AJI B;  3EIH A;  5A2Q S;  1DGH B;  2EUC A;  2XSZ A;  1DGG A;  5ITQ A;  1GLN A;  2KZU A;  3A46 A;  1XHB A;  1TH3 A;  4IBD A;  3VFD A;  8CAT A;  3U6E A;  5ITX E;  3VLF B;  2JA2 A;  5EXX A;  2L6O A;  3SC3 A;  3LVV A;  3JR5 A;  3KSX A;  2CHQ A;  3RFW A;  3FUU A;  5ITU A;  1KFV A;  1NY5 A;  1YE9 A;  2D7E A;  4L15 A;  3VK7 A;  5IZ7 D;  2X4A A;  5F3W A;  3FUV A;  2Y21 A;  4QNR A;  3R9X B;  3K8Z A;  2HCB A;  3E4R A;  2FFJ A;  2F5S A;  1DGF A;  2M60 A;  2I7N A;  3PNV A;  4JI3 M;  1R2Z A;  4WW0 A;  3NWL A;  3U6D A;  3L25 A;  1JR3 A;  1XNQ M;  1N34 M;  4IBC A;  2CUZ A;  3R8F A;  2ERC A;  4B3T M;  1E32 A;  2DZN B;  3PFI A;  4NSR A;  3TWL A;  4JYA M;  1QAQ A;  2X8A A;  4CHT B;  1GL7 A;  3LVW A;  4JI7 M;  3L27 A;  5EXP A;  1X37 A;  4L78 A;  4DUY M;  1IXR C;  4HL4 A;  2DWZ B;  3AL0 C;  1J7K A;  3KP0 E;  4MH0 E;  3HGI A;  4R3D A;  3GLI B;  3GLF B;  1XNR M;  5DYG A;  5IWA M;  4QHT A;  5ITX A;  2DVW B;  4GKJ M;  4AQY M;  4NRV A;  5DNY A;  4PDG A;  4LY6 A;  4DR2 M;  1DO2 A;  4BLC A;  1NJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...