3VKIA

Monoclinic crystal structure of salmonella flga in closed form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
198
structure length
198
Chain Sequence
QDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMTGSAKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural flexibility of the periplasmic protein, FlgA, regulates flagellar P-ring assembly in Salmonella enterica
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
molecule keywords Flagella basal body P-ring formation protein flgA
total genus 41
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.760 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vkiA02
3FRNA 3TEEA 3VJPA 3VKIA
chains in the Genus database with same CATH superfamily
4M77B 1ARKA 3CMAA 4MZTA 2EGAA 5LJ5h 2YLBA 2JTMA 4PLIA 3CC4A 5GAMd 4FSSA 4M75C 2D9TA 2C0OA 1WHLA 1XTDA 1N5ZA 1JXOA 1MV3A 2X4YA 4J5YA 2CKKA 4A4EA 5GAN8 4DOWA 2CP7A 4JRKA 1PM3A 4M7AG 3CCVQ 4BI3A 3FDRA 1C6VX 2OTJQ 1WXTA 1OZ3A 4RUGA 3EFOA 1IGQA 3C12A 4M78B 2LVMA 1X27A 2HQXA 4QVDA 4M7DE 1P92A 2DVJA 3I56Q 1WFWA 4MDWA 3RMQA 1LPLA 1GFDA 4LDYA 2K3YA 2L3QA 1VQ4Q 3RNJA 2YHTA 2IIMA 2MPXC 2VC8A 3I5RA 3X20B 3OYFA 4HXJA 3OYHA 3THKA 2KXCA 3JCMe 5LJ3d 2IPOB 2W10A 2K79A 1R0BG 2YRVA 1MMGA 3MP6A 5GAMf 3N5BB 4DBRA 2K4YA 3VS4A 1AZEA 3JCMW 1UG1A 1G5VA 2CZ7B 1U06A 1X69A 2EQIA 1UTIA 5GANh 1JJ2S 2DRMA 3LWIA 7AT1B 2H3EB 3GIBA 2XDPA 5GAN2 2MWOA 3I55A 1N8RU 5L8RE 3PE0A 1NPRA 5I2SA 1MNDA 5ECAA 3JCMX 2MYSA 3VS1A 3M56A 2RK2A 1RAGB 5DM7R 2XHCA 4XAXB 2X4XA 4ELZC 1BK2A 5J39A 2O2OA 5IHNA 1CKAA 2DPPB 2CP6A 3P8DA 4QQDA 3OYKA 1LNXA 1WLPB 2VB6A 3VS6A 3RDVA 1B7TA 5FRMA 1RABB 3UWNA 2GQVA 4LDXA 4PJJA 1VYVA 2NWMA 2ZGWA 1BI0A 2RPNA 4M75E 4M78F 5KYXB 2YT6A 1N8RR 4PNOA 1VQ5Q 4F7UB 3C94A 3G7ZA 3VS2A 3MEVA 1W2BA 3H8ZA 1SHGA 1XOVA 1VQMQ 1Y71A 1QVGS 2QA4A 5KYYA 3X25B 4HCKA 1O75A 4M7AA 4DBFA 4LD6A 1PNJA 5GMKm 1M5Q1 5LJ5j 1PC0A 4QQ6A 1I07A 1R0CB 2RMOA 4A54A 4E7KA 2LZ6B 5KYNA 4C0FA 1WQWA 1U5SA 3UATA 1YI2Q 2GNCA 3VV0A 5LJ5f 5GAOl 2X51A 4LDVA 3TSZA 8ATCB 1HJDA 3GNGA 3IQLA 5HCKA 4ZGJB 2GTJA 4HVUA 5FLXE 2KAFA 2DZ9A 3QKJA 5GAMg 3L2QA 1QCOA 3CC4T 5DLOA 2VXFA 3FLGA 1AWWA 1M3BA 3AT1B 5DLQE 4MZPA 2RD1A 2M1HA 5GAMe 2DTIA 1YITQ 1PKTA 2X3XD 4D8KA 2QEXA 3CMEA 1PD0A 3CCRT 3J81E 3G71A 1VYUA 2ESWA 2DEUA 1BI3A 1Y0MA 3CXCS 5CCAA 4PJNA 2JN0A 3LH0A 3EFSA 2DL5A 2QEXQ 4LDWA 4M78A 2E5QA 2EJ9A 4M7DB 2P0KA 2DLPA 1YHQQ 1SEMA 1VQ6A 2RQWA 1AD5A 3S6WA 2A7YA 4JZ3A 4M75A 2FRYA 2VKNA 4PJOB 1PG5B 1YITT 4J9BA 4OF1A 2LX9A 4RTWA 3VYHB 1MMAA 1ZBXA 2F2WA 2QEXT 3WVEB 5KYWA 1LJOA 5GAOp 1KQSP 3CBPA 2FZCB 1HYOA 1X6GA 2FG0A 3JCMQ 3GF5A 5HY6A 3SDZA 1N27A 4AFQC 2ZAEA 1Q82R 1K73U 2XMFA 2EYWA 2KI7A 1IB8A 1YI2T 1XQHA 1Q81C 1VQKQ 2E64A 2IVWA 3ME9A 4E7SA 4WF2A 3WXMB 1VQ9T 2LJ0A 4OMLA 1D0YA 1ZX6A 3CXCA 5A0GA 3UPUA 3KXTA 1UHFA 1K0SA 1IO6A 3FB9A 2EPDA 4A4KA 2E65A 3SFMA 3OS2A 1YJ9A 1XNIA 3M0SA 3JCMJ 3EAEA 3Q1JA 1M1KR 3A8HB 3TCJA 1WYXA 1UJYA 1VQ4T 1B34B 2H3JA 2DKGA 1B34A 2QA4T 1RADB 3VUZA 1WGSA 2P4RA 3SD4A 2M02A 4PJOF 5GAMh 1K9AA 2HL5C 5D6YA 3EGDA 4M7DG 5KYWB 3BY7A 2KYBA 1NBEB 1AWJA 5GAN7 4X1VA 2K7AA 3MP8A 2V1QA 2LQ8A 4EPCA 1KQSA 2J6KA 4KH1B 4BUGA 4LDUA 2QYZA 4RKUE 1KSWA 3E19A 2LQWA 2RF0A 2VXEA 4TVRA 1U1SA 1N9SA 3NTHA 2DJQA 3I35A 2FYKA 2YXYA 1M30A 4IUQA 2E1HA 2WSFE 2KY9A 1WQ7A 1WJSA 2XG8D 2YDLA 4C8QE 5GMKi 2JS0A 1RAHB 3CMAT 2HSEB 4PK4A 1S1NA 1B07A 3CEYA 3U23A 3ZL7C 4M7AE 2WACA 3E2UA 4J83A 3L2RA 3OSVA 2JTEA 4C5GA 2DILA 2V26A 1NJIU 2XD0A 2GTOA 3UA7A 4XTYA 4MMLA 2PVGB 4J6WA 3CCMT 3OB9A 2DTHA 3PIOA 5KYYB 5FW9A 3BE3A 2KROA 4C92G 3GNFB 5A0DA 1X6BA 5HKCA 2FRWA 4QKUA 5KE3A 3V7RA 2JMCA 5KYXA 1AZGB 3FRNA 3EHQA 3QDFA 4R0KA 4PFOA 4Z02A 4C8QC 2NUPA 4QT7A 1RLQC 1GCQC 4KGXB 1MHNA 5CO7A 4L5GA 2V8JA 3VRYA 3JSCA 1WHJA 3M0TA 2XK0A 1WHHA 8AT1B 1X2KA 2FPFA 2DTOA 3MEUA 2R57A 2BIVA 4HVVA 1BKBA 5FROA 2P0QA 5CKHA 2L89A 2ABLA 3OSSC 3RMSA 5LJ3f 4HKEA 2QGFB 1VQ9Q 3M55A 3QBYA 3RIRA 1FX7A 2KRSA 3JV3A 2KSSA 4HCCA 1UGRB 3SWNB 5GAOn 3CXCP 5FU6C 2D8HA 5FU7B 1YCSB 3BDLA 4GLKA 1ZSZC 4QVCA 1YJNT 3BFMA 5EG2A 2EKHA 2RO0A 2OTLT 3V8LA 2MMPA 2QAZA 1UB4A 2KRMA 3MEWA 1PCXA 3HFOA 3OQ5A 3CCSA 3M0PA 2X35A 2NLUA 4ZN3A 2IG0A 4O5VA 2R58A 2KYMA 1KQ1A 1YIJA 2SEMA 1NE8A 4C92E 1NJIR 2DD4A 1PSEA 4PL6A 1SF9A 4YTLA 3AHUA 4RG8A 2V1RA 1UHCA 3GOXA 1S72Q 2EYXA 3CBOA 2K9GA 4A4HA 2OAUA 3PGGA 1UEBA 1V76A 2AZSA 2D0QB 3CPFA 3FJ5A 1PRLC 3MPUB 1RAAB 3NPFA 1VQNQ 2L3SA 1OEBA 4C8QB 4ME7A 2HBPA 3DLMA 2GFUA 5IAYA 1D3BB 1MV0B 1KD1C 1OU8A 4MDXA 3O5ZA 2LJ3A 1VYTA 1E7OA 2DNUA 2LCCA 2QTXA 3EG2A 1K0XA 1Q7YU 4HCBA 1G3TA 1ZUKA 1M9SA 4LUDA 2RQRA 3M57A 3MP1A 2MK5A 2M9UA 1UE9A 5CQXA 1ZUUA 4C8QF 4ORZA 2OTJA 4Y92A 3NHNA 1C0MA 4JZ4A 1M1KU 2YUQA 3JRZA 1KQSS 2XI9A 3CMAQ 2ATCB 4M7AF 2Y4YA 2DXCA 3CCET 3TSWA 2AZVA 2PQWA 2NYSA 4BD3A 1OV3A 1TG0A 1H641 4RTZA 2LNVA 2COYA 2OI3A 4F7UE 3QHSA 4GLMA 3UT1A 4B6MA 1EZZB 4CC3A 3CCVA 3JB9H 1M90C 3E1SA 2YUNA 3M59A 4O6JA 3J7AF 3KUFA 5LL6S 1AT1B 1UFFA 5IXFA 5GANj 3PFSA 1QKWA 1FYNA 3I56A 1UGPB 1ZSGA 2LTOA 4AFUC 1NJIC 2VUBA 4AG2C 2YWWA 3M54A 5D7UA 1DJ7B 2HKQB 1VQ4A 4CC7A 5L23A 2LCLA 4J9FA 1G3YA 5GAN3 2HQEA 5CK9A 4IIOA 2DD5A 4QQGA 4BE2A 1JU5C 3OMCA 1KC8U 4FYVB 4C0DB 4FIBA 4FYYB 3RUXA 5GMKj 3SEMA 3CCUT 2RH2A 3OYLA 3JCMh 1PHTA 4JJDA 5I11A 2A0FB 1SRLA 2CREA 2HCKA 1QP3A 1TU0B 2F5TX 2X4WA 2CDTA 2K2MA 1VQ8Q 1UGVA 4OVAA 1FWZA 4XTXA 2LT1A 1Q7YC 1K9MR 2NUTA 1AVZC 3JCMd 4FU6A 1OZ2A 4ATOA 4KULA 4C5HA 3CCUA 2DL3A 2CT4A 5GAN6 1RUWA 2E6ZA 5GAN4 3UA6A 2L2PA 1K9MC 1SKUB 3EGUA 2VVKA 3EG1A 2J6FA 4M75D 2QGGA 3EHRA 1E6HA 2P0PA 3G6EA 5C6SA 3MHXA 2EKOA 4JDSA 1BBZA 1YJWT 2DL7A 2EGEA 3OBYA 2ZPFB 1J3TA 4MMKA 2KK4A 5FRNA 2O4XA 3OYBA 2E5KA 3G4SA 1VQMA 1BIAA 4M7DA 1K9MU 3NTKA 1Y57A 1U1TA 3QO3A 4JRPA 2EJGA 5LJ5g 5HK3A 3CPWA 4C92C 3X28B 3RERA 3G4SQ 1D3BA 1PRMC 1VQ7A 1GRIA 4F17A 4EMKA 3G71T 1WZOA 2G3RA 2J05A 4AT1B 4B9XA 3CC7T 1KC8R 1V29B 5GMKe 2EFIA 3CMET 2SRCA 1RLPC 2ECZA 2VASA 2CZ6B 2PZ1A 3CC4Q 3A8OB 1TTHB 2JTFA 3MEAA 1IGUA 1K4US 4M75F 4V2SA 1ZQ1A 2HZYA 2D1XA 1M90R 2CP2A 2H8HA 3OYIA 3A1PA 1T3LA 1N9RA 1W70A 1KK7A 2O9VA 2DIQA 4OMPA 5KH6A 3M0RA 4ANJA 1YITA 3CQTA 4C8QG 4WCIA 2MF2A 2B8AA 3EH2A 4RG2A 5CAIA 3CMEQ 2LCSA 4OMNA 2EQKA 4F7UF 1UECA 1Y96B 2JMAA 2JUFA 1WJRA 4Z8AA 2XDDA 1WA7A 1G8XA 1Q81U 5J26A 1OI1A 4PJOG 3JCMg 1VA7A 4IURA 1M1KC 2ZPIB 2DM1A 2HL3A 2DF6A 1YHQT 1VQ6Q 3PVQA 4EMKB 2YLCA 3H9NA 4Y91A 2EJFA 1QW1A 3A8GB 1EFNA 4F16A 3MCAB 2K3XA 4P5NA 4A53A 2BKDN 2CH4W 1NYFA 2BZXA 3CCVT 3JB9J 1YJ9T 4GY5A 2QDLA 1MNEA 4IIMA 3EG9A 4AMCA 2KT1A 4N0AA 3JCMf 3EG3A 1WIEA 2HMAA 5IHKA 3OW2A 2LP5A 2KQWA 3LYIA 2W0ZA 1BU1A 2JNGA 1JEGA 5J3BA 2CP3A 4RTUA 5IXBA 4JJCA 1JJ2A 4LE9A 3EFRA 3GLXA 2DA9A 1VQKA 4XQ3A 1WNLA 1EX4A 1SG5A 2MOXA 3EGXA 3TREA 3ZFJA 5HK0A 1K73C 2M51A 2EQMA 1BCOA 1WJQA 2WSEE 1NEBA 3JB9G 3PTAA 3PT9A 4C5IA 4JJBA 4E7IA 2FVUA 4OB3B 4M78D 1TUGB 1KG1A 2XICA 2RJEA 1VQ5A 3LLRA 2VWFA 2RN8A 4XU2A 5AT1B 3QWYA 1W1FA 1UJ0A 5GANe 5KCHA 1VQ6T 3CCMQ 2A3LA 3MKDA 2MI6A 2QK0A 4M7DD 1QVGP 1K8AC 5I21A 2QA4Q 2RHXA 3P8BB 1ZSZA 4J9EA 1VQ5T 4PFPA 1VQOT 2NUPB 4C92D 3FC3A 4E6RA 1BIBA 3DB4A 4J6XA 3QPHA 3CCRA 2DX1A 3QYHB 2RJDA 3OS0A 5A2QE 4RTVA 1TUDA 4M75G 1VQLQ 1K1ZA 2HBWA 2VV5A 2QI2A 4M77A 3PNWC 3T9NA 1Q95G 2JM9A 4JS5A 2BZYA 2YUPA 5CVIA 4DBQA 2QG9B 2E41A 3HRTA 2KE9A 4E7ZA 1SRMA 2RQUA 1YJNA 2OTLA 3H0HA 4C0GA 4PJOE 5GAOr 5GAN5 2O31A 3A8LB 4XTVA 2PVOB 1D1CA 4J9DA 2DL8A 4Z88A 1YJNQ 2OTLQ 2RJFA 1PD1A 1FMVA 3G71Q 2BE7D 2FO0A 4QVZA 2ROTA 4JLIA 4C92A 2L0AA 1N8RC 1IHVA 3M58A 2KBTA 3P8HA 3VJPA 3VS0A 2O88A 3BW1A 1QP2A 1PWTA 2AKKA 2F2XA 2JZ2A 3J80E 3QDRB 2HAXA 2FPEA 1VQOA 3R6NA 2RJCA 4PJMA 2HSPA 4N4HA 1Y07A 1NEGA 4KH0B 2DYIA 4KUIA 2A08A 2JOYA 3OYGA 1S72T 1Q86U 3CCLQ 1M27C 3S3NA 1JB0E 4BY6B 1RAFB 4XK8E 2QQRA 4FYXB 3VRZA 2P4TA 3A8MB 3V8JA 2AHJB 4KUDK 4EMGA 4JJNK 1H92A 2CZ0B 2WSCE 3QYGB 3JAME 5GANf 3L1AA 4X9CA 3VS7A 2GGRA 1ZLMA 4UC4A 4BDZA 3S3MA 2AT1B 2CSQA 5AYFA 2D6FA 5D6XA 5M9OA 3I55T 4E7JA 3UF4A 4HCZA 2DJZA 2HD0A 1IRXA 1TH7A 2GF7A 5EC7A 3CC7A 3LH5A 1IREB 1YJ9Q 1VQLT 3CC2Q 4FSXA 1X6OA 4ZNXA 2DAQA 2KNBB 2Z0WA 3CD6A 2RQVA 1OPKA 3L2WA 2EQUA 2YUOA 1Q86R 1UGSB 2CT3A 3EGXB 1TXQA 2EAYA 1ZBJA 4M77F 1ABOA 1OULA 1Q82U 1TWBA 1MGQA 5C0MA 2EGCA 1VQNA 1U8RA 2ENMA 4OGEA 4OMFB 3JCMb 2DXTA 1Q86C 1KC8C 3CPWS 1YBYA 3L2VA 3G6ET 3E9GA 2AIRB 2B86A 5FWCA 1QVFP 3HRSA 1WHMA 1MMNA 3LW5E 1AOJA 3DLLA 4DOVA 5KCOA 2FPDA 1M1FA 2HNIA 4C92F 1W4SA 1AWOA 3H0IA 1JJ2P 4OB0B 2DZCA 4J7FA 2E70A 5LJ5d 4M75B 1VQKT 2CP5A 2JXBA 1VQPQ 1FMKA 2VGNA 2X3WD 1K8AU 3LGFA 2BUDA 2A28A 2XKOC 4BE0A 3OYEA 1LVKA 3EH1A 1W6XA 1TUCA 2A37A 3HRUA 3JCMc 2CUBA 2BZ8A 5CKBA 2AKLA 4CI0C 2FEIA 3E9FA 3V7CA 2ZCFB 2E4HA 3VS3A 4J9HA 1JO8A 1RAIB 1IXDA 2FB7A 1ACMB 3HPWA 4J8OA 3I5SA 3OYYA 3OW2S 1GL5A 3RR6A 4LD9K 5CKFA 1C1AA 3QG1A 2PVDB 3SWNC 1QVFS 1IHWA 2FZGB 4L6V5 1ZUYA 4J9IA 3CCLT 1NM7A 4R56A 3CCQQ 5GANg 2RK1A 1BYMA 2EVRA 2DMOA 2KRNA 1VQNT 1M8MA 1B3QA 4BI4A 4NOYA 4JRIA 2LQNA 4EIKA 1QWFA 1D1BA 1YJWQ 1SPKA 1T3SA 4BDYA 1GBQA 4D6WA 3HSBA 4PJOA 3JCMV 3BDUA 4IKFA 2YRCA 1OOTA 5GANd 1Z9QA 2EYZA 1QVPA 5FWBA 1KQ2A 4N4GA 5CQYA 4KRTA 2NUTB 2CYZB 2Y4XA 3C0CA 3CCJA 4C8QA 1KD1R 1GCQA 1K76A 4RMOA 2QQ9A 3M9QA 2J7IA 2KVQG 4VUBA 1OX8A 2RM4A 5CR2A 1KJWA 2RA2A 1VQPT 1Q82C 1O9SA 5KE2A 1AHJB 2K57A 2P84A 3QXEB 3L2ZA 4XU1A 2M0OA 2V8IA 5FU7C 1YCYA 2EYYA 3EFOB 2CSIA 2FL7A 4WTOB 3LGLA 1NPPA 2EWNA 2DETA 2DERA 1M2VB 2EBPA 1W2BP 2EQJA 4BE1A 3I9QA 1Y96A 2JW4A 3F70A 5IN1A 2JS2A 4KGZB 3VYGA 4FW2A 2QTVA 4PJLA 2COWA 2E3HA 3OY9A 5GAOq 1YP5A 4C0DC 2CGHA 4M7AB 3REBB 1GBRA 2F69A 4ZTFA 2O9SA 4KBMB 1JRIA 3ULRB 1QMCA 3G6EQ 1VQ7Q 2JM8A 2DYBA 2DE0X 3WVDB 4M7DF 1LOJA 2CUDA 1NZ9A 3CCEQ 2GCXA 2G6FX 3M53A 4F7UA 1PKSA 5LJ3j 5IH2A 3CD6T 1FMWA 2BTTA 1ZA2B 3A5ZB 2DXUA 3X26B 3QZ9B 3QJ6A 1YI2A 1HD3A 2E3IA 2DFUA 2PUKB 4JS4A 2C06A 1KFZA 4ZGDB 1HXDA 3VU3C 2A36A 2C0IA 1BB9A 5GMKh 1Y7XA 2CP0A 1SSFA 4EMKC 2K5IA 2YSQA 2M16A 1YNZA 3C95A 1YFNA 2PTKA 4FT2A 4FT4A 5A0LA 2LX7A 1VQ7T 2MIOA 3OW2P 1M1GA 2D0NA 3RESA 5D6WA 4JPBW 4M77C 4OGCA 1I81A 3OYNA 3V7SA 3O8VA 4M4ZA 1TOVA 1E6GA 5GMKl 2OX7A 3OYJA 4ESRA 2KGTA 1G3WA 1KHCA 3S3OA 3TQ7P 4RCBA 5CIUA 1IZ6A 1VIFA 1K8AR 2ZPHB 1BCMA 3TU4K 2COZA 3I55Q 1WPYA 3NFCA 3PMTA 1BI2A 4IUUA 1G3SA 1OPLA 3JB9I 2E10A 2E6NA 5GJWB 2DEQA 3CC2T 2JT4A 1R8OB 2QQBA 3NTIA 3PMIA 1VQ8A 4RTXA 3OA6A 3H6ZA 1HSQA 3CPWP 3GP8A 2XDBA 3RKYA 3SWNA 2QASA 1Z9ZA 4M78E 1VUBA 4LXCA 5LJ3h 1M90U 3ZEHA 5DY9A 4NL2A 5GJVB 2C0TA 1R77A 4ZGEB 1QVGA 1N6AA 4C5EA 4OB2B 2L5QA 3NMZC 4RTTA 4Y28E 3X24B 2RHIA 1QCNA 3QZ5B 3LWHA 2RNAA 3TEEA 1OU9A 4M7AC 4OB1B 3HL8A 2DXBA 4XTZA 1CSKA 4RCCA 1X01A 3L2UA 1GXIE 1WDXA 4Q5WA 2RHUA 5FU6B 2LC4A 1YWOA 1M3CA 2L8DA 2J06A 3DB3A 4EMHA 2X4JA 1BI1A 2MCNA 4X34A 2MAMA 3PIPA 4PFZA 4F04B 2QQAA 3CCQT 2HKNA 3QJYA 1SSHA 5CKEA 2K6DA 4MZMA 4ZTJA 4JRQA 4CC2A 3EG9B 3CCST 3CCMA 2XIDA 4QW2A 4JLGA 2LNHB 2DBKA 4L59A 1V1CA 2PUOB 2DO3A 1F1BB 4D8DA 1UDLA 4R55A 4EDUA 1G2BA 2QQSA 2GBQA 4DBHA 3TVTA 4IUVA 4BI8B 3QWXX 2V8KA 1X2QA 1I0CA 2ZPGB 2RI5A 2K5FA 4C0ZA 2ED1A 2I2LA 2RB6A 1ABQA 5I22A 1RI0A 3VKIA 1X43A 5LJ5e 1RI9A 4X9DA 1OX9A 5GAMj 2R5AA 4K11A 4RTYA 2HEQA 2F2VA 1I1JA 4XTWA 3SHWA 4OMMA 1VQOQ 1WHKA 2LMJA 2GFAA 3CBMA 1VOMA 4M7AD 4M78G 1I4K1 1YHQA 2I0NA 5I2MA 4E2FB 1X75C 2DVEA 3MO8A 1U3OA 1HK9A 3H0FA 4NS5A 3REAB 4J9GA 3MJXA 3V8KA 4CC4B 1TSFA 2CH4A 1ZHIA 2J6OA 2EYQA 2KXDA 3KFVA 1LCKA 4HVWA 2AK5A 3HFNA 2FZKB 2VGMA 1QCFA 4E47A 1VQ9A 2KR3A 1M3AA 5IHIA 2PU9B 1D0XA 4BB7A 1GFCA 2LQKA 3URGA 2CS7A 3RKXA 4DEYA 3JB9F 3INZA 3FIFA 2PNIA 4N0AC 2MWPA 1Q7YR 2K3BA 4C8QD 3FEOA 3CCSQ 3M4GA 2KEAA 3C4SA 1FXXA 3EG0A 3QSUA 1G83A 5CKDA 1YIJQ 4OMOA 4LNPA 2KT8A 2ROLA 2HQHA 1XJWB 3ER0A 3D7SB 4FCYA 1NYGA 4M77D 4FL6A 3ASKA 2RI2A 3OMGA 1NG2A 3CC7Q 3A98A 2GQIA 2RQTA 1M8VA 1WI7A 3RBBB 3L42A 1M2OA 2XU8A 3HKSA 1RACB 3GBQA 1ZSZB 2DRKA 3CCRQ 4J7IA 3NGPA 2K5LA 1AWXA 1W2BS 1VQLA 2ZZDA 4FW1A 2DBMA 2O01E 1QWEA 2D8JA 1T0JA 2DIGA 6AT1B 3EGDB 1VQPA 4DA4A 2HDAA 2LRQA 2EW3A 4PLLA 2OTJT 4IUPA 2F5KA 4M78C 2E12A 4F7UG 4M77E 1AEYA 4C92B 4PKCC 3DKMA 1RAEB 1K73R 2LT4A 5KYUB 2ZPEB 1Q81R 4DQ2A 4AG1C 1SHFA 3JCMP 1A0NB 2R5MA 4BY6C 2LDMA 1QLYA 2K2VA 4KT0E 3OYCA 4II1A 1ZA1B 1D0ZA 4AFSC 4AFZC 3JB9D 1CKBA 2QDYB 2M0YA 4OMQA 2Y90A 4DEXA 1VIEA 2NUZA 4J6YA 5GAOm 1RL2A 1H3HA 2EIFA 1M2VA 2VYTA 3OBWA 3CCQA 2ZPBB 1WHGA 3OS5A 4N4IA 1PSFA 3RKWA 3ZBDA 2RHZA 3HTRA 4ZN1A 1VQMT 2OAWA 1JBMA 1JQQA 1H8KA 3VS5A 3HP9A 3VUBA 4HA8A 4LN2A 3SB2A 4IUTA 1OQKA 1YJWA 4J9CA 3I56T 3CCLA 2RI3A 3OYMA 1YN8A 1JXMA 1T0HA 4F14A 4A63B 4FYWB 4CRIA 1NLOC 4E7LA 1WXUA 4OP0A 3M0UA 2L3RA 1YIJT 2F1LA 1YWPA 4XU0A 3OYDA 2CZ1B 3CCJQ 5KYUA 3M5AA 1MMDA 3R6OA 1OYXA 4BACA 1I8FA 2YRDA 4LUEA 1QVFA 1GCPA 1H3ZA 4XU3A 1EIFA 4A4FA 3QIIA 2QXFA 4PJOC 4A4GA 3OYAA 1VQ8T 3FJPA 5IT9E 3CC2A 3M0QA 4ELYC 3CCJT 3OS1A 2OJ2A 3H41A 2JJ9A 4M7DC 3CCUQ 1UGQB 4Z89A 3CD6Q 2L3PA 2KDSA 4HT9A 1D09B 1I5OB 1TS9A 3UDCA 2BE9B 2DK3A 1D1AA 1M4ZA 4JUVA 1WX6A 2ED0A 1QKXA 1S72A 1KHIA 9ATCB 2KMTA 3META 1KD1U 4XTUA 2JVVA 1QQJA 2DL4A 4E7HA 2X9HA 3G4ST 1I5LA 2LJ1A 4FM4B 1UUEA 4HT8A 1NLPC 4M77G 4KGVB 3G1JA 5LJ3g 3QUIA 3LX7A 3GPLA 4GBQA 4PJOD 2RHYA 3CCEA 1KIKA 4NL3A 4B9WA 1WXBA 2O4XB 3KBGA 1MUZA 5LJ3e 3HHTB 2FHDA 3PVLA 3M4YA
chains in the Genus database with same CATH topology
1R8OB 2QQBA 4M77B 3OSSC 3RMSA 5LJ3f 2VV5A 4HKEA 3CMAA 2QI2A 4M77A 3PNWC 4MZTA 3NTIA 3T9NA 3PMIA 1VQ8A 3M55A 3QBYA 3RIRA 3H6ZA 3OA6A 5LJ5h 1FX7A 2YLBA 3GP8A 2XDBA 3RKYA 3SWNA 2JTMA 2KSSA 4PLIA 4JS5A 1UGRB 3SWNB 3CC4A 5CVIA 4HCCA 4M78E 5GAMd 4M75C 1VUBA 5GAOn 2D9TA 5LJ3h 5FU6C 5FU7B 2E41A 3BDLA 3HRTA 1M90U 1XTDA 3ZEHA 5DY9A 2X4YA 4NL2A 1YJNA 4J5YA 4GLKA 2CKKA 4A4EA 5GAN8 4QVCA 2OTLA 4DOWA 1YJNT 3BFMA 4JRKA 5EG2A 2RO0A 4C0GA 3V8LA 4BI3A 4ZGEB 1QVGA 1N6AA 3FDRA 4C5EA 2MMPA 4OB2B 2L5QA 5GAOr 1UB4A 3MEWA 5GAN5 3HFOA 3OQ5A 4Y28E 3CCSA 1OZ3A 3A8LB 2X35A 2NLUA 4ZN3A 4XTVA 2PVOB 3C12A 2RHIA 2IG0A 3QZ5B 4M78B 3X24B 2LVMA 4O5VA 3TEEA 3LWHA 4QVDA 2HQXA 2R58A 1KQ1A 4M7AC 2RJFA 1P92A 4OB1B 1YIJA 4M7DE 3HL8A 1NE8A 2DXBA 4XTZA 4QVZA 4RCCA 4C92E 4JLIA 4MDWA 3RMQA 4LDYA 1X01A 4C92A 2K3YA 3L2UA 1GXIE 1N8RC 4Q5WA 2RHUA 2YHTA 3M58A 3P8HA 3VJPA 2DD4A 5FU6B 1PSEA 3BW1A 2LC4A 1QP2A 4PL6A 4YTLA 3AHUA 2L8DA 4RG8A 2JZ2A 3J80E 3QDRB 2VC8A 3GOXA 2HAXA 4M7AG 3DB3A 4EMHA 3X20B 3OYFA 3CBOA 2X4JA 4A4HA 3OYHA 2OAUA 1BI1A 1VQOA 3PGGA 1UEBA 2RJCA 3JCMe 5LJ3d 2D0QB 4N4HA 1Y07A 2MAMA 3CPFA 4X34A 3PIPA 4KUIA 4C8QB 2QQAA 2JOYA 3OYGA 2YRVA 4ME7A 1S72T 2HBPA 1Q86U 3MP6A 5GAMf 3CCQT 3N5BB 3DLMA 3QJYA 2K4YA 5CKEA 3JCMW 1JB0E 2GFUA 4BY6B 5IAYA 3S3NA 4XK8E 4MZMA 2QQRA 4ZTJA 1D3BB 1G5VA 4JRQA 2CZ7B 1KD1C 2P4TA 3CCST 4MDXA 3CCMA 3A8MB 5GANh 2XIDA 3V8JA 2AHJB 4JLGA 4QW2A 4EMGA 1JJ2S 4KUDK 4JJNK 4L59A 2LCCA 2CZ0B 3CC2T 2QTXA 3LWIA 1Q7YU 2WSCE 3QYGB 2PUOB 2DO3A 4HCBA 3JAME 1G3TA 5GANf 1M9SA 4R55A 3L1AA 4X9CA 3GIBA 2XDPA 5GAN2 3M57A 3MP1A 2MWOA 3I55A 1N8RU 4EDUA 4UC4A 4BDZA 2QQSA 5L8RE 2M9UA 3S3MA 1NPRA 5I2SA 4IUVA 5CQXA 4BI8B 3JCMX 2V8KA 5AYFA 2D6FA 4C8QF 5D6XA 5M9OA 2ZPGB 3M56A 3I55T 2OTJA 4E7JA 2RK2A 4HCZA 2DJZA 5DM7R 2XHCA 4XAXB 2X4XA 4ELZC 2HD0A 1M1KU 2RI5A 2K5FA 3JRZA 1TH7A 5J39A 1KQSS 4C0ZA 2XI9A 2GF7A 4M7AF 2Y4YA 2DPPB 2DXCA 3CC7A 2I2LA 2RB6A 3P8DA 3CCET 1RI0A 1IREB 5CKHA 3VKIA 5LJ5e 1VQLT 2PQWA 4X9DA 4BD3A 4QQDA 5GAMj 3OYKA 4FSXA 2R5AA 1H641 1X6OA 2DAQA 1LNXA 2LNVA 3CD6A 4F7UE 3QHSA 3UT1A 3L2WA 5FRMA 4XTWA 2EQUA 4PJOE 3UWNA 2GQVA 4LDXA 3JB9H 3CCVA 1UGSB 2ZGWA 1M90C 1BI0A 2EAYA 3E1SA 4M75E 4M78F 4PNOA 3M59A 4O6JA 4M77F 3J7AF 4F7UB 3C94A 3G7ZA 3KUFA 3MEVA 1W2BA 1Q82U 5LL6S 3H8ZA 1MGQA 5C0MA 5GANj 3PFSA 1VQNA 1XOVA 2GFAA 3CBMA 1U8RA 4OGEA 4OMFB 3JCMb 3I56A 2DXTA 4M78G 4M7AD 1Q86C 1I4K1 1KC8C 1Y71A 3CPWS 1YHQA 1QVGS 1UGPB 5I2MA 1YBYA 2LTOA 1NJIC 2VUBA 3L2VA 1X75C 2DVEA 3G6ET 3M54A 2QA4A 3X25B 3E9GA 1O75A 1DJ7B 3MO8A 1VQ4A 4M7AA 2LCLA 1HK9A 1G3YA 4NS5A 3HRSA 4LD6A 3LW5E 5GAN3 2HQEA 5CK9A 3DLLA 2DD5A 4DOVA 5KCOA 4QQGA 5GMKm 4BE2A 2HNIA 1M1FA 1M5Q1 1W4SA 3OMCA 4C92F 4QQ6A 5LJ5j 1KC8U 3V8KA 4C0DB 4FIBA 2DZCA 4OB0B 3RUXA 4A54A 5GMKj 4E7KA 4J7FA 2E70A 5LJ5d 4M75B 1VQKT 2L89A 4C0FA 1WQWA 3CCUT 1ZHIA 2RH2A 3JCMh 3OYLA 3VV0A 2VGNA 2EYQA 1K8AU 5LJ5f 3LGFA 2BUDA 5GAOl 2VGMA 3HFNA 1QP3A 2F5TX 2X4WA 2XKOC 4E47A 3OYEA 4BE0A 1VQ9A 4OVAA 1FWZA 4XTXA 3HRUA 4LDVA 2LT1A 2PU9B 4BB7A 1Q7YC 2LQKA 3URGA 2CS7A 3RKXA 5CKBA 3JCMc 3GNGA 3JB9F 3INZA 3JCMd 4FU6A 4ZGJB 3FIFA 4CI0C 1OZ2A 5FLXE 4ATOA 2KAFA 3E9FA 2ZCFB 2DZ9A 3QKJA 3V7CA 5GAMg 3L2QA 3CC4T 4KULA 4C5HA 2FB7A 2MWPA 4N0AC 3CCUA 5GAN6 5DLOA 3HPWA 4J8OA 3OYYA 2VXFA 3OW2S 3FLGA 2E6ZA 5GAN4 4PJOC 5DLQE 4C8QD 3FEOA 4MZPA 1K9MC 4LD9K 2RD1A 2M1HA 3QG1A 5CKFA 3M4GA 5GAMe 2PVDB 1FXXA 3C4SA 3QSUA 2DTIA 3SWNC 1QVFS 5CKDA 2QEXA 3CMEA 4L6V5 4M75D 3CCRT 3J81E 3G71A 2P0PA 3G6EA 3CCLT 3ER0A 5C6SA 3MHXA 4R56A 2EKOA 4JDSA 1BI3A 1YJWT 5GANg 2RK1A 3OBYA 1BYMA 4M77D 3CXCS 5CCAA 2JN0A 3LH0A 4FL6A 2ZPFB 3ASKA 3EFSA 2OTLT 1VQNT 2RI2A 4MMKA 2KK4A 5FRNA 2O4XA 3OMGA 3OYBA 4LDWA 4M78A 3G4SA 4BI4A 1BIAA 4NOYA 1VQMA 1K9MU 2E5QA 2EJ9A 4JRIA 2P0KA 4M7DA 4M7DB 3NTKA 1M8VA 1U1TA 3L42A 3QO3A 2XU8A 3HKSA 1VQ6A 4JRPA 3S6WA 2A7YA 4BDYA 2EJGA 4M75A 5LJ5g 5HK3A 4D6WA 3HSBA 3CPWA 4C92C 4PJOA 3X28B 3JCMV 3RERA 4PJOB 4J7IA 3BDUA 4IKFA 1D3BA 2K5LA 1YITT 4OF1A 1VQ7A 1W2BS 5GANd 1VQLA 2ZZDA 4EMKA 2LX9A 1QVPA 3G71T 2O01E 2G3RA 1KQ2A 3VYHB 4B9XA 4N4GA 5CQYA 3CC7T 2DIGA 1V29B 5GMKe 2EFIA 1ZBXA 3CMET 2QEXT 1VQPA 2CYZB 3WVEB 5GAOp 1LJOA 2Y4XA 4DA4A 2CZ6B 3CBPA 3A8OB 2LRQA 3CCJA 4C8QA 4PLLA 2OTJT 2JTFA 3GF5A 3MEAA 3JCMQ 4IUPA 4RMOA 5HY6A 4M75F 4V2SA 3SDZA 2F5KA 1ZQ1A 2E12A 4M78C 4M77E 4F7UG 1N27A 2QQ9A 3M9QA 4C92B 2KVQG 4PKCC 3DKMA 4VUBA 2RM4A 5CR2A 2LT4A 2ZPEB 1K73U 3OYIA 4DQ2A 2RA2A 3JCMP 1VQPT 1Q82C 1YI2T 1O9SA 5KE2A 2R5MA 1XQHA 1AHJB 2K57A 3QXEB 4BY6C 2LDMA 3L2ZA 1Q81C 2E64A 1N9RA 2IVWA 2K2VA 3ME9A 4WF2A 3WXMB 1VQ9T 4KT0E 2DIQA 4XU1A 2M0OA 2V8IA 4II1A 5FU7C 1YCYA 3OYCA 3CXCA 5KH6A 5A0GA 3JB9D 1YITA 2FL7A 2QDYB 2MF2A 2B8AA 4RG2A 4C8QG 5CAIA 3KXTA 3UPUA 2Y90A 3FB9A 3LGLA 1VIEA 4J6YA 1NPPA 2E65A 2EWNA 4A4KA 2EQKA 3SFMA 5GAOm 3OS2A 1RL2A 4F7UF 2EIFA 1Y96B 1XNIA 2EQJA 2VYTA 3OBWA 4BE1A 3CCQA 1Y96A 2ZPBB 2JUFA 3F70A 3OS5A 5IN1A 3JCMJ 3EAEA 4N4IA 1PSFA 1WJRA 3RKWA 3ZBDA 3Q1JA 2XDDA 3VYGA 2RHZA 3A8HB 3TCJA 4ZN1A 1VQMT 1Q81U 5J26A 1JBMA 1OI1A 4PJOG 3JCMg 1VQ4T 1B34B 4IURA 2H3JA 2DKGA 3HP9A 1M1KC 1B34A 2QA4T 3OY9A 2ZPIB 3VUBA 4HA8A 3SB2A 1YHQT 4IUTA 1YJWA 3VUZA 4EMKB 3I56T 1WGSA 2YLCA 3SD4A 2RI3A 5GAOq 3OYMA 3CCLA 4Y91A 1YJ9A 4PJOF 2EJFA 5GAMh 1QW1A 2CGHA 4M7AB 5D6YA 4C0DC 4M7DG 3A8GB 2F69A 4ZTFA 3BY7A 4KBMB 3MCAB 2K3XA 1JRIA 4P5NA 4A53A 5GAN7 2BKDN 4CRIA 4E7LA 3MP8A 2LQ8A 4OP0A 4EPCA 1KQSA 3CCVT 2L3RA 1YIJT 3JB9J 3WVDB 4GY5A 1LOJA 4BUGA 1YJ9T 1NZ9A 4M7DF 2GCXA 3M53A 4LDUA 4F7UA 5LJ3j 4RKUE 3CD6T 4XU0A 3E19A 3OYDA 2CZ1B 3M5AA 4N0AA 3A5ZB 3JCMf 2DXUA 3X26B 2VXEA 3R6OA 1OYXA 1U1SA 3QZ9B 4TVRA 4BACA 1I8FA 3QJ6A 1YI2A 1N9SA 3OW2A 3NTHA 2KQWA 1QVFA 1H3ZA 3LYIA 4XU3A 1EIFA 2JNGA 5J3BA 2FYKA 4IUQA 2E1HA 2WSFE 2KY9A 1JJ2A 2PUKB 1WQ7A 1WJSA 2XG8D 2QXFA 3EFRA 3GLXA 3QIIA 4A4FA 4A4GA 4JS4A 2C06A 1VQKA 4ZGDB 4XQ3A 1WNLA 1HXDA 4C8QE 5GMKi 3OYAA 3VU3C 1VQ8T 3CMAT 5GMKh 1Y7XA 3FJPA 5IT9E 1SSFA 3CC2A 4EMKC 3TREA 3ZFJA 5HK0A 4ELYC 3CCJT 1K73C 3OS1A 2K5IA 2EQMA 1WJQA 2WSEE 3CEYA 3JB9G 2WACA 4M7DC 1UGQB 2M16A 3C95A 4J83A 3PTAA 4M7AE 4FT2A 3PT9A 4C5IA 3L2RA 3OSVA 1NJIU 4C5GA 4E7IA 2XD0A 4FT4A 2FVUA 5A0LA 4XTYA 4MMLA 4OB3B 2KDSA 4HT9A 2PVGB 4J6WA 4M78D 3CCMT 1VQ7T 3OB9A 1KG1A 1M1GA 2DTHA 3RESA 3PIOA 5D6WA 3UDCA 2DK3A 2XICA 2RJEA 4M77C 4C92G 3GNFB 4OGCA 1VQ5A 1M4ZA 1I81A 3LLRA 5A0DA 5HKCA 4XU2A 3OYNA 3V7SA 3O8VA 4JUVA 5GMKl 3OYJA 5KE3A 5GANe 3V7RA 5KCHA 1VQ6T 2A3LA 1S72A 2MI6A 1KHIA 2KMTA 1G3WA 3FRNA 3META 1KD1U 4M7DD 4XTUA 2JVVA 5I21A 4E7HA 1K8AC 1KHCA 3S3OA 3G4ST 1I5LA 4FM4B 4RCBA 2RHXA 4HT8A 3P8BB 1VQ5T 5CIUA 1IZ6A 1VIFA 4M77G 4Z02A 4C8QC 1VQOT 2ZPHB 5LJ3g 4C92D 3QUIA 3FC3A 3TU4K 1MHNA 1BIBA 1WPYA 3DB4A 4J6XA 3LX7A 4L5GA 2V8JA 5CO7A 3GPLA 3NFCA 3JSCA 4PJOD 2RHYA 2XK0A 3PMTA 3CCEA 1BI2A 3QPHA 4IUUA 3CCRA 4NL3A 3QYHB 1G3SA 4B9WA 2RJDA 2O4XB 3JB9I 3OS0A 2DTOA 3KBGA 3MEUA 5LJ3e 5A2QE 2E10A 2BIVA 2R57A 3HHTB 2E6NA 1BKBA 2FHDA 4M75G 2DEQA 5FROA 2P0QA 3M4YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FRN A;  3TEE A;  3VJP A;  3VKI A; 
#chains in the Genus database with same CATH topology
 4M77 B;  1ARK A;  3CMA A;  4MZT A;  2EGA A;  5LJ5 h;  2YLB A;  2JTM A;  4PLI A;  3CC4 A;  5GAM d;  4FSS A;  4M75 C;  2D9T A;  2C0O A;  1WHL A;  1XTD A;  1N5Z A;  1JXO A;  1MV3 A;  2X4Y A;  4J5Y A;  2CKK A;  4A4E A;  5GAN 8;  4DOW A;  2CP7 A;  4JRK A;  1PM3 A;  4M7A G;  3CCV Q;  4BI3 A;  3FDR A;  1C6V X;  2OTJ Q;  1WXT A;  1OZ3 A;  4RUG A;  3EFO A;  1IGQ A;  3C12 A;  4M78 B;  2LVM A;  1X27 A;  2HQX A;  4QVD A;  4M7D E;  1P92 A;  2DVJ A;  3I56 Q;  1WFW A;  4MDW A;  3RMQ A;  1LPL A;  1GFD A;  4LDY A;  2K3Y A;  2L3Q A;  1VQ4 Q;  3RNJ A;  2YHT A;  2IIM A;  2MPX C;  2VC8 A;  3I5R A;  3X20 B;  3OYF A;  4HXJ A;  3OYH A;  3THK A;  2KXC A;  3JCM e;  5LJ3 d;  2IPO B;  2W10 A;  2K79 A;  1R0B G;  2YRV A;  1MMG A;  3MP6 A;  5GAM f;  3N5B B;  4DBR A;  2K4Y A;  3VS4 A;  1AZE A;  3JCM W;  1UG1 A;  1G5V A;  2CZ7 B;  1U06 A;  1X69 A;  2EQI A;  1UTI A;  5GAN h;  1JJ2 S;  2DRM A;  3LWI A;  7AT1 B;  2H3E B;  3GIB A;  2XDP A;  5GAN 2;  2MWO A;  3I55 A;  1N8R U;  5L8R E;  3PE0 A;  1NPR A;  5I2S A;  1MND A;  5ECA A;  3JCM X;  2MYS A;  3VS1 A;  3M56 A;  2RK2 A;  1RAG B;  5DM7 R;  2XHC A;  4XAX B;  2X4X A;  4ELZ C;  1BK2 A;  5J39 A;  2O2O A;  5IHN A;  1CKA A;  2DPP B;  2CP6 A;  3P8D A;  4QQD A;  3OYK A;  1LNX A;  1WLP B;  2VB6 A;  3VS6 A;  3RDV A;  1B7T A;  5FRM A;  1RAB B;  3UWN A;  2GQV A;  4LDX A;  4PJJ A;  1VYV A;  2NWM A;  2ZGW A;  1BI0 A;  2RPN A;  4M75 E;  4M78 F;  5KYX B;  2YT6 A;  1N8R R;  4PNO A;  1VQ5 Q;  4F7U B;  3C94 A;  3G7Z A;  3VS2 A;  3MEV A;  1W2B A;  3H8Z A;  1SHG A;  1XOV A;  1VQM Q;  1Y71 A;  1QVG S;  2QA4 A;  5KYY A;  3X25 B;  4HCK A;  1O75 A;  4M7A A;  4DBF A;  4LD6 A;  1PNJ A;  5GMK m;  1M5Q 1;  5LJ5 j;  1PC0 A;  4QQ6 A;  1I07 A;  1R0C B;  2RMO A;  4A54 A;  4E7K A;  2LZ6 B;  5KYN A;  4C0F A;  1WQW A;  1U5S A;  3UAT A;  1YI2 Q;  2GNC A;  3VV0 A;  5LJ5 f;  5GAO l;  2X51 A;  4LDV A;  3TSZ A;  8ATC B;  1HJD A;  3GNG A;  3IQL A;  5HCK A;  4ZGJ B;  2GTJ A;  4HVU A;  5FLX E;  2KAF A;  2DZ9 A;  3QKJ A;  5GAM g;  3L2Q A;  1QCO A;  3CC4 T;  5DLO A;  2VXF A;  3FLG A;  1AWW A;  1M3B A;  3AT1 B;  5DLQ E;  4MZP A;  2RD1 A;  2M1H A;  5GAM e;  2DTI A;  1YIT Q;  1PKT A;  2X3X D;  4D8K A;  2QEX A;  3CME A;  1PD0 A;  3CCR T;  3J81 E;  3G71 A;  1VYU A;  2ESW A;  2DEU A;  1BI3 A;  1Y0M A;  3CXC S;  5CCA A;  4PJN A;  2JN0 A;  3LH0 A;  3EFS A;  2DL5 A;  2QEX Q;  4LDW A;  4M78 A;  2E5Q A;  2EJ9 A;  4M7D B;  2P0K A;  2DLP A;  1YHQ Q;  1SEM A;  1VQ6 A;  2RQW A;  1AD5 A;  3S6W A;  2A7Y A;  4JZ3 A;  4M75 A;  2FRY A;  2VKN A;  4PJO B;  1PG5 B;  1YIT T;  4J9B A;  4OF1 A;  2LX9 A;  4RTW A;  3VYH B;  1MMA A;  1ZBX A;  2F2W A;  2QEX T;  3WVE B;  5KYW A;  1LJO A;  5GAO p;  1KQS P;  3CBP A;  2FZC B;  1HYO A;  1X6G A;  2FG0 A;  3JCM Q;  3GF5 A;  5HY6 A;  3SDZ A;  1N27 A;  4AFQ C;  2ZAE A;  1Q82 R;  1K73 U;  2XMF A;  2EYW A;  2KI7 A;  1IB8 A;  1YI2 T;  1XQH A;  1Q81 C;  1VQK Q;  2E64 A;  2IVW A;  3ME9 A;  4E7S A;  4WF2 A;  3WXM B;  1VQ9 T;  2LJ0 A;  4OML A;  1D0Y A;  1ZX6 A;  3CXC A;  5A0G A;  3UPU A;  3KXT A;  1UHF A;  1K0S A;  1IO6 A;  3FB9 A;  2EPD A;  4A4K A;  2E65 A;  3SFM A;  3OS2 A;  1YJ9 A;  1XNI A;  3M0S A;  3JCM J;  3EAE A;  3Q1J A;  1M1K R;  3A8H B;  3TCJ A;  1WYX A;  1UJY A;  1VQ4 T;  1B34 B;  2H3J A;  2DKG A;  1B34 A;  2QA4 T;  1RAD B;  3VUZ A;  1WGS A;  2P4R A;  3SD4 A;  2M02 A;  4PJO F;  5GAM h;  1K9A A;  2HL5 C;  5D6Y A;  3EGD A;  4M7D G;  5KYW B;  3BY7 A;  2KYB A;  1NBE B;  1AWJ A;  5GAN 7;  4X1V A;  2K7A A;  3MP8 A;  2V1Q A;  2LQ8 A;  4EPC A;  1KQS A;  2J6K A;  4KH1 B;  4BUG A;  4LDU A;  2QYZ A;  4RKU E;  1KSW A;  3E19 A;  2LQW A;  2RF0 A;  2VXE A;  4TVR A;  1U1S A;  1N9S A;  3NTH A;  2DJQ A;  3I35 A;  2FYK A;  2YXY A;  1M30 A;  4IUQ A;  2E1H A;  2WSF E;  2KY9 A;  1WQ7 A;  1WJS A;  2XG8 D;  2YDL A;  4C8Q E;  5GMK i;  2JS0 A;  1RAH B;  3CMA T;  2HSE B;  4PK4 A;  1S1N A;  1B07 A;  3CEY A;  3U23 A;  3ZL7 C;  4M7A E;  2WAC A;  3E2U A;  4J83 A;  3L2R A;  3OSV A;  2JTE A;  4C5G A;  2DIL A;  2V26 A;  1NJI U;  2XD0 A;  2GTO A;  3UA7 A;  4XTY A;  4MML A;  2PVG B;  4J6W A;  3CCM T;  3OB9 A;  2DTH A;  3PIO A;  5KYY B;  5FW9 A;  3BE3 A;  2KRO A;  4C92 G;  3GNF B;  5A0D A;  1X6B A;  5HKC A;  2FRW A;  4QKU A;  5KE3 A;  3V7R A;  2JMC A;  5KYX A;  1AZG B;  3FRN A;  3EHQ A;  3QDF A;  4R0K A;  4PFO A;  4Z02 A;  4C8Q C;  2NUP A;  4QT7 A;  1RLQ C;  1GCQ C;  4KGX B;  1MHN A;  5CO7 A;  4L5G A;  2V8J A;  3VRY A;  3JSC A;  1WHJ A;  3M0T A;  2XK0 A;  1WHH A;  8AT1 B;  1X2K A;  2FPF A;  2DTO A;  3MEU A;  2R57 A;  2BIV A;  4HVV A;  1BKB A;  5FRO A;  2P0Q A;  5CKH A;  2L89 A;  2ABL A;  3OSS C;  3RMS A;  5LJ3 f;  4HKE A;  2QGF B;  1VQ9 Q;  3M55 A;  3QBY A;  3RIR A;  1FX7 A;  2KRS A;  3JV3 A;  2KSS A;  4HCC A;  1UGR B;  3SWN B;  5GAO n;  3CXC P;  5FU6 C;  2D8H A;  5FU7 B;  1YCS B;  3BDL A;  4GLK A;  1ZSZ C;  4QVC A;  1YJN T;  3BFM A;  5EG2 A;  2EKH A;  2RO0 A;  2OTL T;  3V8L A;  2MMP A;  2QAZ A;  1UB4 A;  2KRM A;  3MEW A;  1PCX A;  3HFO A;  3OQ5 A;  3CCS A;  3M0P A;  2X35 A;  2NLU A;  4ZN3 A;  2IG0 A;  4O5V A;  2R58 A;  2KYM A;  1KQ1 A;  1YIJ A;  2SEM A;  1NE8 A;  4C92 E;  1NJI R;  2DD4 A;  1PSE A;  4PL6 A;  1SF9 A;  4YTL A;  3AHU A;  4RG8 A;  2V1R A;  1UHC A;  3GOX A;  1S72 Q;  2EYX A;  3CBO A;  2K9G A;  4A4H A;  2OAU A;  3PGG A;  1UEB A;  1V76 A;  2AZS A;  2D0Q B;  3CPF A;  3FJ5 A;  1PRL C;  3MPU B;  1RAA B;  3NPF A;  1VQN Q;  2L3S A;  1OEB A;  4C8Q B;  4ME7 A;  2HBP A;  3DLM A;  2GFU A;  5IAY A;  1D3B B;  1MV0 B;  1KD1 C;  1OU8 A;  4MDX A;  3O5Z A;  2LJ3 A;  1VYT A;  1E7O A;  2DNU A;  2LCC A;  2QTX A;  3EG2 A;  1K0X A;  1Q7Y U;  4HCB A;  1G3T A;  1ZUK A;  1M9S A;  4LUD A;  2RQR A;  3M57 A;  3MP1 A;  2MK5 A;  2M9U A;  1UE9 A;  5CQX A;  1ZUU A;  4C8Q F;  4ORZ A;  2OTJ A;  4Y92 A;  3NHN A;  1C0M A;  4JZ4 A;  1M1K U;  2YUQ A;  3JRZ A;  1KQS S;  2XI9 A;  3CMA Q;  2ATC B;  4M7A F;  2Y4Y A;  2DXC A;  3CCE T;  3TSW A;  2AZV A;  2PQW A;  2NYS A;  4BD3 A;  1OV3 A;  1TG0 A;  1H64 1;  4RTZ A;  2LNV A;  2COY A;  2OI3 A;  4F7U E;  3QHS A;  4GLM A;  3UT1 A;  4B6M A;  1EZZ B;  4CC3 A;  3CCV A;  3JB9 H;  1M90 C;  3E1S A;  2YUN A;  3M59 A;  4O6J A;  3J7A F;  3KUF A;  5LL6 S;  1AT1 B;  1UFF A;  5IXF A;  5GAN j;  3PFS A;  1QKW A;  1FYN A;  3I56 A;  1UGP B;  1ZSG A;  2LTO A;  4AFU C;  1NJI C;  2VUB A;  4AG2 C;  2YWW A;  3M54 A;  5D7U A;  1DJ7 B;  2HKQ B;  1VQ4 A;  4CC7 A;  5L23 A;  2LCL A;  4J9F A;  1G3Y A;  5GAN 3;  2HQE A;  5CK9 A;  4IIO A;  2DD5 A;  4QQG A;  4BE2 A;  1JU5 C;  3OMC A;  1KC8 U;  4FYV B;  4C0D B;  4FIB A;  4FYY B;  3RUX A;  5GMK j;  3SEM A;  3CCU T;  2RH2 A;  3OYL A;  3JCM h;  1PHT A;  4JJD A;  5I11 A;  2A0F B;  1SRL A;  2CRE A;  2HCK A;  1QP3 A;  1TU0 B;  2F5T X;  2X4W A;  2CDT A;  2K2M A;  1VQ8 Q;  1UGV A;  4OVA A;  1FWZ A;  4XTX A;  2LT1 A;  1Q7Y C;  1K9M R;  2NUT A;  1AVZ C;  3JCM d;  4FU6 A;  1OZ2 A;  4ATO A;  4KUL A;  4C5H A;  3CCU A;  2DL3 A;  2CT4 A;  5GAN 6;  1RUW A;  2E6Z A;  5GAN 4;  3UA6 A;  2L2P A;  1K9M C;  1SKU B;  3EGU A;  2VVK A;  3EG1 A;  2J6F A;  4M75 D;  2QGG A;  3EHR A;  1E6H A;  2P0P A;  3G6E A;  5C6S A;  3MHX A;  2EKO A;  4JDS A;  1BBZ A;  1YJW T;  2DL7 A;  2EGE A;  3OBY A;  2ZPF B;  1J3T A;  4MMK A;  2KK4 A;  5FRN A;  2O4X A;  3OYB A;  2E5K A;  3G4S A;  1VQM A;  1BIA A;  4M7D A;  1K9M U;  3NTK A;  1Y57 A;  1U1T A;  3QO3 A;  4JRP A;  2EJG A;  5LJ5 g;  5HK3 A;  3CPW A;  4C92 C;  3X28 B;  3RER A;  3G4S Q;  1D3B A;  1PRM C;  1VQ7 A;  1GRI A;  4F17 A;  4EMK A;  3G71 T;  1WZO A;  2G3R A;  2J05 A;  4AT1 B;  4B9X A;  3CC7 T;  1KC8 R;  1V29 B;  5GMK e;  2EFI A;  3CME T;  2SRC A;  1RLP C;  2ECZ A;  2VAS A;  2CZ6 B;  2PZ1 A;  3CC4 Q;  3A8O B;  1TTH B;  2JTF A;  3MEA A;  1IGU A;  1K4U S;  4M75 F;  4V2S A;  1ZQ1 A;  2HZY A;  2D1X A;  1M90 R;  2CP2 A;  2H8H A;  3OYI A;  3A1P A;  1T3L A;  1N9R A;  1W70 A;  1KK7 A;  2O9V A;  2DIQ A;  4OMP A;  5KH6 A;  3M0R A;  4ANJ A;  1YIT A;  3CQT A;  4C8Q G;  4WCI A;  2MF2 A;  2B8A A;  3EH2 A;  4RG2 A;  5CAI A;  3CME Q;  2LCS A;  4OMN A;  2EQK A;  4F7U F;  1UEC A;  1Y96 B;  2JMA A;  2JUF A;  1WJR A;  4Z8A A;  2XDD A;  1WA7 A;  1G8X A;  1Q81 U;  5J26 A;  1OI1 A;  4PJO G;  3JCM g;  1VA7 A;  4IUR A;  1M1K C;  2ZPI B;  2DM1 A;  2HL3 A;  2DF6 A;  1YHQ T;  1VQ6 Q;  3PVQ A;  4EMK B;  2YLC A;  3H9N A;  4Y91 A;  2EJF A;  1QW1 A;  3A8G B;  1EFN A;  4F16 A;  3MCA B;  2K3X A;  4P5N A;  4A53 A;  2BKD N;  2CH4 W;  1NYF A;  2BZX A;  3CCV T;  3JB9 J;  1YJ9 T;  4GY5 A;  2QDL A;  1MNE A;  4IIM A;  3EG9 A;  4AMC A;  2KT1 A;  4N0A A;  3JCM f;  3EG3 A;  1WIE A;  2HMA A;  5IHK A;  3OW2 A;  2LP5 A;  2KQW A;  3LYI A;  2W0Z A;  1BU1 A;  2JNG A;  1JEG A;  5J3B A;  2CP3 A;  4RTU A;  5IXB A;  4JJC A;  1JJ2 A;  4LE9 A;  3EFR A;  3GLX A;  2DA9 A;  1VQK A;  4XQ3 A;  1WNL A;  1EX4 A;  1SG5 A;  2MOX A;  3EGX A;  3TRE A;  3ZFJ A;  5HK0 A;  1K73 C;  2M51 A;  2EQM A;  1BCO A;  1WJQ A;  2WSE E;  1NEB A;  3JB9 G;  3PTA A;  3PT9 A;  4C5I A;  4JJB A;  4E7I A;  2FVU A;  4OB3 B;  4M78 D;  1TUG B;  1KG1 A;  2XIC A;  2RJE A;  1VQ5 A;  3LLR A;  2VWF A;  2RN8 A;  4XU2 A;  5AT1 B;  3QWY A;  1W1F A;  1UJ0 A;  5GAN e;  5KCH A;  1VQ6 T;  3CCM Q;  2A3L A;  3MKD A;  2MI6 A;  2QK0 A;  4M7D D;  1QVG P;  1K8A C;  5I21 A;  2QA4 Q;  2RHX A;  3P8B B;  1ZSZ A;  4J9E A;  1VQ5 T;  4PFP A;  1VQO T;  2NUP B;  4C92 D;  3FC3 A;  4E6R A;  1BIB A;  3DB4 A;  4J6X A;  3QPH A;  3CCR A;  2DX1 A;  3QYH B;  2RJD A;  3OS0 A;  5A2Q E;  4RTV A;  1TUD A;  4M75 G;  1VQL Q;  1K1Z A;  2HBW A;  2VV5 A;  2QI2 A;  4M77 A;  3PNW C;  3T9N A;  1Q95 G;  2JM9 A;  4JS5 A;  2BZY A;  2YUP A;  5CVI A;  4DBQ A;  2QG9 B;  2E41 A;  3HRT A;  2KE9 A;  4E7Z A;  1SRM A;  2RQU A;  1YJN A;  2OTL A;  3H0H A;  4C0G A;  4PJO E;  5GAO r;  5GAN 5;  2O31 A;  3A8L B;  4XTV A;  2PVO B;  1D1C A;  4J9D A;  2DL8 A;  4Z88 A;  1YJN Q;  2OTL Q;  2RJF A;  1PD1 A;  1FMV A;  3G71 Q;  2BE7 D;  2FO0 A;  4QVZ A;  2ROT A;  4JLI A;  4C92 A;  2L0A A;  1N8R C;  1IHV A;  3M58 A;  2KBT A;  3P8H A;  3VJP A;  3VS0 A;  2O88 A;  3BW1 A;  1QP2 A;  1PWT A;  2AKK A;  2F2X A;  2JZ2 A;  3J80 E;  3QDR B;  2HAX A;  2FPE A;  1VQO A;  3R6N A;  2RJC A;  4PJM A;  2HSP A;  4N4H A;  1Y07 A;  1NEG A;  4KH0 B;  2DYI A;  4KUI A;  2A08 A;  2JOY A;  3OYG A;  1S72 T;  1Q86 U;  3CCL Q;  1M27 C;  3S3N A;  1JB0 E;  4BY6 B;  1RAF B;  4XK8 E;  2QQR A;  4FYX B;  3VRZ A;  2P4T A;  3A8M B;  3V8J A;  2AHJ B;  4KUD K;  4EMG A;  4JJN K;  1H92 A;  2CZ0 B;  2WSC E;  3QYG B;  3JAM E;  5GAN f;  3L1A A;  4X9C A;  3VS7 A;  2GGR A;  1ZLM A;  4UC4 A;  4BDZ A;  3S3M A;  2AT1 B;  2CSQ A;  5AYF A;  2D6F A;  5D6X A;  5M9O A;  3I55 T;  4E7J A;  3UF4 A;  4HCZ A;  2DJZ A;  2HD0 A;  1IRX A;  1TH7 A;  2GF7 A;  5EC7 A;  3CC7 A;  3LH5 A;  1IRE B;  1YJ9 Q;  1VQL T;  3CC2 Q;  4FSX A;  1X6O A;  4ZNX A;  2DAQ A;  2KNB B;  2Z0W A;  3CD6 A;  2RQV A;  1OPK A;  3L2W A;  2EQU A;  2YUO A;  1Q86 R;  1UGS B;  2CT3 A;  3EGX B;  1TXQ A;  2EAY A;  1ZBJ A;  4M77 F;  1ABO A;  1OUL A;  1Q82 U;  1TWB A;  1MGQ A;  5C0M A;  2EGC A;  1VQN A;  1U8R A;  2ENM A;  4OGE A;  4OMF B;  3JCM b;  2DXT A;  1Q86 C;  1KC8 C;  3CPW S;  1YBY A;  3L2V A;  3G6E T;  3E9G A;  2AIR B;  2B86 A;  5FWC A;  1QVF P;  3HRS A;  1WHM A;  1MMN A;  3LW5 E;  1AOJ A;  3DLL A;  4DOV A;  5KCO A;  2FPD A;  1M1F A;  2HNI A;  4C92 F;  1W4S A;  1AWO A;  3H0I A;  1JJ2 P;  4OB0 B;  2DZC A;  4J7F A;  2E70 A;  5LJ5 d;  4M75 B;  1VQK T;  2CP5 A;  2JXB A;  1VQP Q;  1FMK A;  2VGN A;  2X3W D;  1K8A U;  3LGF A;  2BUD A;  2A28 A;  2XKO C;  4BE0 A;  3OYE A;  1LVK A;  3EH1 A;  1W6X A;  1TUC A;  2A37 A;  3HRU A;  3JCM c;  2CUB A;  2BZ8 A;  5CKB A;  2AKL A;  4CI0 C;  2FEI A;  3E9F A;  3V7C A;  2ZCF B;  2E4H A;  3VS3 A;  4J9H A;  1JO8 A;  1RAI B;  1IXD A;  2FB7 A;  1ACM B;  3HPW A;  4J8O A;  3I5S A;  3OYY A;  3OW2 S;  1GL5 A;  3RR6 A;  4LD9 K;  5CKF A;  1C1A A;  3QG1 A;  2PVD B;  3SWN C;  1QVF S;  1IHW A;  2FZG B;  4L6V 5;  1ZUY A;  4J9I A;  3CCL T;  1NM7 A;  4R56 A;  3CCQ Q;  5GAN g;  2RK1 A;  1BYM A;  2EVR A;  2DMO A;  2KRN A;  1VQN T;  1M8M A;  1B3Q A;  4BI4 A;  4NOY A;  4JRI A;  2LQN A;  4EIK A;  1QWF A;  1D1B A;  1YJW Q;  1SPK A;  1T3S A;  4BDY A;  1GBQ A;  4D6W A;  3HSB A;  4PJO A;  3JCM V;  3BDU A;  4IKF A;  2YRC A;  1OOT A;  5GAN d;  1Z9Q A;  2EYZ A;  1QVP A;  5FWB A;  1KQ2 A;  4N4G A;  5CQY A;  4KRT A;  2NUT B;  2CYZ B;  2Y4X A;  3C0C A;  3CCJ A;  4C8Q A;  1KD1 R;  1GCQ A;  1K76 A;  4RMO A;  2QQ9 A;  3M9Q A;  2J7I A;  2KVQ G;  4VUB A;  1OX8 A;  2RM4 A;  5CR2 A;  1KJW A;  2RA2 A;  1VQP T;  1Q82 C;  1O9S A;  5KE2 A;  1AHJ B;  2K57 A;  2P84 A;  3QXE B;  3L2Z A;  4XU1 A;  2M0O A;  2V8I A;  5FU7 C;  1YCY A;  2EYY A;  3EFO B;  2CSI A;  2FL7 A;  4WTO B;  3LGL A;  1NPP A;  2EWN A;  2DET A;  2DER A;  1M2V B;  2EBP A;  1W2B P;  2EQJ A;  4BE1 A;  3I9Q A;  1Y96 A;  2JW4 A;  3F70 A;  5IN1 A;  2JS2 A;  4KGZ B;  3VYG A;  4FW2 A;  2QTV A;  4PJL A;  2COW A;  2E3H A;  3OY9 A;  5GAO q;  1YP5 A;  4C0D C;  2CGH A;  4M7A B;  3REB B;  1GBR A;  2F69 A;  4ZTF A;  2O9S A;  4KBM B;  1JRI A;  3ULR B;  1QMC A;  3G6E Q;  1VQ7 Q;  2JM8 A;  2DYB A;  2DE0 X;  3WVD B;  4M7D F;  1LOJ A;  2CUD A;  1NZ9 A;  3CCE Q;  2GCX A;  2G6F X;  3M53 A;  4F7U A;  1PKS A;  5LJ3 j;  5IH2 A;  3CD6 T;  1FMW A;  2BTT A;  1ZA2 B;  3A5Z B;  2DXU A;  3X26 B;  3QZ9 B;  3QJ6 A;  1YI2 A;  1HD3 A;  2E3I A;  2DFU A;  2PUK B;  4JS4 A;  2C06 A;  1KFZ A;  4ZGD B;  1HXD A;  3VU3 C;  2A36 A;  2C0I A;  1BB9 A;  5GMK h;  1Y7X A;  2CP0 A;  1SSF A;  4EMK C;  2K5I A;  2YSQ A;  2M16 A;  1YNZ A;  3C95 A;  1YFN A;  2PTK A;  4FT2 A;  4FT4 A;  5A0L A;  2LX7 A;  1VQ7 T;  2MIO A;  3OW2 P;  1M1G A;  2D0N A;  3RES A;  5D6W A;  4JPB W;  4M77 C;  4OGC A;  1I81 A;  3OYN A;  3V7S A;  3O8V A;  4M4Z A;  1TOV A;  1E6G A;  5GMK l;  2OX7 A;  3OYJ A;  4ESR A;  2KGT A;  1G3W A;  1KHC A;  3S3O A;  3TQ7 P;  4RCB A;  5CIU A;  1IZ6 A;  1VIF A;  1K8A R;  2ZPH B;  1BCM A;  3TU4 K;  2COZ A;  3I55 Q;  1WPY A;  3NFC A;  3PMT A;  1BI2 A;  4IUU A;  1G3S A;  1OPL A;  3JB9 I;  2E10 A;  2E6N A;  5GJW B;  2DEQ A;  3CC2 T;  2JT4 A;  1R8O B;  2QQB A;  3NTI A;  3PMI A;  1VQ8 A;  4RTX A;  3OA6 A;  3H6Z A;  1HSQ A;  3CPW P;  3GP8 A;  2XDB A;  3RKY A;  3SWN A;  2QAS A;  1Z9Z A;  4M78 E;  1VUB A;  4LXC A;  5LJ3 h;  1M90 U;  3ZEH A;  5DY9 A;  4NL2 A;  5GJV B;  2C0T A;  1R77 A;  4ZGE B;  1QVG A;  1N6A A;  4C5E A;  4OB2 B;  2L5Q A;  3NMZ C;  4RTT A;  4Y28 E;  3X24 B;  2RHI A;  1QCN A;  3QZ5 B;  3LWH A;  2RNA A;  3TEE A;  1OU9 A;  4M7A C;  4OB1 B;  3HL8 A;  2DXB A;  4XTZ A;  1CSK A;  4RCC A;  1X01 A;  3L2U A;  1GXI E;  1WDX A;  4Q5W A;  2RHU A;  5FU6 B;  2LC4 A;  1YWO A;  1M3C A;  2L8D A;  2J06 A;  3DB3 A;  4EMH A;  2X4J A;  1BI1 A;  2MCN A;  4X34 A;  2MAM A;  3PIP A;  4PFZ A;  4F04 B;  2QQA A;  3CCQ T;  2HKN A;  3QJY A;  1SSH A;  5CKE A;  2K6D A;  4MZM A;  4ZTJ A;  4JRQ A;  4CC2 A;  3EG9 B;  3CCS T;  3CCM A;  2XID A;  4QW2 A;  4JLG A;  2LNH B;  2DBK A;  4L59 A;  1V1C A;  2PUO B;  2DO3 A;  1F1B B;  4D8D A;  1UDL A;  4R55 A;  4EDU A;  1G2B A;  2QQS A;  2GBQ A;  4DBH A;  3TVT A;  4IUV A;  4BI8 B;  3QWX X;  2V8K A;  1X2Q A;  1I0C A;  2ZPG B;  2RI5 A;  2K5F A;  4C0Z A;  2ED1 A;  2I2L A;  2RB6 A;  1ABQ A;  5I22 A;  1RI0 A;  3VKI A;  1X43 A;  5LJ5 e;  1RI9 A;  4X9D A;  1OX9 A;  5GAM j;  2R5A A;  4K11 A;  4RTY A;  2HEQ A;  2F2V A;  1I1J A;  4XTW A;  3SHW A;  4OMM A;  1VQO Q;  1WHK A;  2LMJ A;  2GFA A;  3CBM A;  1VOM A;  4M7A D;  4M78 G;  1I4K 1;  1YHQ A;  2I0N A;  5I2M A;  4E2F B;  1X75 C;  2DVE A;  3MO8 A;  1U3O A;  1HK9 A;  3H0F A;  4NS5 A;  3REA B;  4J9G A;  3MJX A;  3V8K A;  4CC4 B;  1TSF A;  2CH4 A;  1ZHI A;  2J6O A;  2EYQ A;  2KXD A;  3KFV A;  1LCK A;  4HVW A;  2AK5 A;  3HFN A;  2FZK B;  2VGM A;  1QCF A;  4E47 A;  1VQ9 A;  2KR3 A;  1M3A A;  5IHI A;  2PU9 B;  1D0X A;  4BB7 A;  1GFC A;  2LQK A;  3URG A;  2CS7 A;  3RKX A;  4DEY A;  3JB9 F;  3INZ A;  3FIF A;  2PNI A;  4N0A C;  2MWP A;  1Q7Y R;  2K3B A;  4C8Q D;  3FEO A;  3CCS Q;  3M4G A;  2KEA A;  3C4S A;  1FXX A;  3EG0 A;  3QSU A;  1G83 A;  5CKD A;  1YIJ Q;  4OMO A;  4LNP A;  2KT8 A;  2ROL A;  2HQH A;  1XJW B;  3ER0 A;  3D7S B;  4FCY A;  1NYG A;  4M77 D;  4FL6 A;  3ASK A;  2RI2 A;  3OMG A;  1NG2 A;  3CC7 Q;  3A98 A;  2GQI A;  2RQT A;  1M8V A;  1WI7 A;  3RBB B;  3L42 A;  1M2O A;  2XU8 A;  3HKS A;  1RAC B;  3GBQ A;  1ZSZ B;  2DRK A;  3CCR Q;  4J7I A;  3NGP A;  2K5L A;  1AWX A;  1W2B S;  1VQL A;  2ZZD A;  4FW1 A;  2DBM A;  2O01 E;  1QWE A;  2D8J A;  1T0J A;  2DIG A;  6AT1 B;  3EGD B;  1VQP A;  4DA4 A;  2HDA A;  2LRQ A;  2EW3 A;  4PLL A;  2OTJ T;  4IUP A;  2F5K A;  4M78 C;  2E12 A;  4F7U G;  4M77 E;  1AEY A;  4C92 B;  4PKC C;  3DKM A;  1RAE B;  1K73 R;  2LT4 A;  5KYU B;  2ZPE B;  1Q81 R;  4DQ2 A;  4AG1 C;  1SHF A;  3JCM P;  1A0N B;  2R5M A;  4BY6 C;  2LDM A;  1QLY A;  2K2V A;  4KT0 E;  3OYC A;  4II1 A;  1ZA1 B;  1D0Z A;  4AFS C;  4AFZ C;  3JB9 D;  1CKB A;  2QDY B;  2M0Y A;  4OMQ A;  2Y90 A;  4DEX A;  1VIE A;  2NUZ A;  4J6Y A;  5GAO m;  1RL2 A;  1H3H A;  2EIF A;  1M2V A;  2VYT A;  3OBW A;  3CCQ A;  2ZPB B;  1WHG A;  3OS5 A;  4N4I A;  1PSF A;  3RKW A;  3ZBD A;  2RHZ A;  3HTR A;  4ZN1 A;  1VQM T;  2OAW A;  1JBM A;  1JQQ A;  1H8K A;  3VS5 A;  3HP9 A;  3VUB A;  4HA8 A;  4LN2 A;  3SB2 A;  4IUT A;  1OQK A;  1YJW A;  4J9C A;  3I56 T;  3CCL A;  2RI3 A;  3OYM A;  1YN8 A;  1JXM A;  1T0H A;  4F14 A;  4A63 B;  4FYW B;  4CRI A;  1NLO C;  4E7L A;  1WXU A;  4OP0 A;  3M0U A;  2L3R A;  1YIJ T;  2F1L A;  1YWP A;  4XU0 A;  3OYD A;  2CZ1 B;  3CCJ Q;  5KYU A;  3M5A A;  1MMD A;  3R6O A;  1OYX A;  4BAC A;  1I8F A;  2YRD A;  4LUE A;  1QVF A;  1GCP A;  1H3Z A;  4XU3 A;  1EIF A;  4A4F A;  3QII A;  2QXF A;  4PJO C;  4A4G A;  3OYA A;  1VQ8 T;  3FJP A;  5IT9 E;  3CC2 A;  3M0Q A;  4ELY C;  3CCJ T;  3OS1 A;  2OJ2 A;  3H41 A;  2JJ9 A;  4M7D C;  3CCU Q;  1UGQ B;  4Z89 A;  3CD6 Q;  2L3P A;  2KDS A;  4HT9 A;  1D09 B;  1I5O B;  1TS9 A;  3UDC A;  2BE9 B;  2DK3 A;  1D1A A;  1M4Z A;  4JUV A;  1WX6 A;  2ED0 A;  1QKX A;  1S72 A;  1KHI A;  9ATC B;  2KMT A;  3MET A;  1KD1 U;  4XTU A;  2JVV A;  1QQJ A;  2DL4 A;  4E7H A;  2X9H A;  3G4S T;  1I5L A;  2LJ1 A;  4FM4 B;  1UUE A;  4HT8 A;  1NLP C;  4M77 G;  4KGV B;  3G1J A;  5LJ3 g;  3QUI A;  3LX7 A;  3GPL A;  4GBQ A;  4PJO D;  2RHY A;  3CCE A;  1KIK A;  4NL3 A;  4B9W A;  1WXB A;  2O4X B;  3KBG A;  1MUZ A;  5LJ3 e;  3HHT B;  2FHD A;  3PVL A;  3M4Y A; 
#chains in the Genus database with same CATH homology
 1R8O B;  2QQB A;  4M77 B;  3OSS C;  3RMS A;  5LJ3 f;  2VV5 A;  4HKE A;  3CMA A;  2QI2 A;  4M77 A;  3PNW C;  4MZT A;  3NTI A;  3T9N A;  3PMI A;  1VQ8 A;  3M55 A;  3QBY A;  3RIR A;  3H6Z A;  3OA6 A;  5LJ5 h;  1FX7 A;  2YLB A;  3GP8 A;  2XDB A;  3RKY A;  3SWN A;  2JTM A;  2KSS A;  4PLI A;  4JS5 A;  1UGR B;  3SWN B;  3CC4 A;  5CVI A;  4HCC A;  4M78 E;  5GAM d;  4M75 C;  1VUB A;  5GAO n;  2D9T A;  5LJ3 h;  5FU6 C;  5FU7 B;  2E41 A;  3BDL A;  3HRT A;  1M90 U;  1XTD A;  3ZEH A;  5DY9 A;  2X4Y A;  4NL2 A;  1YJN A;  4J5Y A;  4GLK A;  2CKK A;  4A4E A;  5GAN 8;  4QVC A;  2OTL A;  4DOW A;  1YJN T;  3BFM A;  4JRK A;  5EG2 A;  2RO0 A;  4C0G A;  3V8L A;  4BI3 A;  4ZGE B;  1QVG A;  1N6A A;  3FDR A;  4C5E A;  2MMP A;  4OB2 B;  2L5Q A;  5GAO r;  1UB4 A;  3MEW A;  5GAN 5;  3HFO A;  3OQ5 A;  4Y28 E;  3CCS A;  1OZ3 A;  3A8L B;  2X35 A;  2NLU A;  4ZN3 A;  4XTV A;  2PVO B;  3C12 A;  2RHI A;  2IG0 A;  3QZ5 B;  4M78 B;  3X24 B;  2LVM A;  4O5V A;  3TEE A;  3LWH A;  4QVD A;  2HQX A;  2R58 A;  1KQ1 A;  4M7A C;  2RJF A;  1P92 A;  4OB1 B;  1YIJ A;  4M7D E;  3HL8 A;  1NE8 A;  2DXB A;  4XTZ A;  4QVZ A;  4RCC A;  4C92 E;  4JLI A;  4MDW A;  3RMQ A;  4LDY A;  1X01 A;  4C92 A;  2K3Y A;  3L2U A;  1GXI E;  1N8R C;  4Q5W A;  2RHU A;  2YHT A;  3M58 A;  3P8H A;  3VJP A;  2DD4 A;  5FU6 B;  1PSE A;  3BW1 A;  2LC4 A;  1QP2 A;  4PL6 A;  4YTL A;  3AHU A;  2L8D A;  4RG8 A;  2JZ2 A;  3J80 E;  3QDR B;  2VC8 A;  3GOX A;  2HAX A;  4M7A G;  3DB3 A;  4EMH A;  3X20 B;  3OYF A;  3CBO A;  2X4J A;  4A4H A;  3OYH A;  2OAU A;  1BI1 A;  1VQO A;  3PGG A;  1UEB A;  2RJC A;  3JCM e;  5LJ3 d;  2D0Q B;  4N4H A;  1Y07 A;  2MAM A;  3CPF A;  4X34 A;  3PIP A;  4KUI A;  4C8Q B;  2QQA A;  2JOY A;  3OYG A;  2YRV A;  4ME7 A;  1S72 T;  2HBP A;  1Q86 U;  3MP6 A;  5GAM f;  3CCQ T;  3N5B B;  3DLM A;  3QJY A;  2K4Y A;  5CKE A;  3JCM W;  1JB0 E;  2GFU A;  4BY6 B;  5IAY A;  3S3N A;  4XK8 E;  4MZM A;  2QQR A;  4ZTJ A;  1D3B B;  1G5V A;  4JRQ A;  2CZ7 B;  1KD1 C;  2P4T A;  3CCS T;  4MDX A;  3CCM A;  3A8M B;  5GAN h;  2XID A;  3V8J A;  2AHJ B;  4JLG A;  4QW2 A;  4EMG A;  1JJ2 S;  4KUD K;  4JJN K;  4L59 A;  2LCC A;  2CZ0 B;  3CC2 T;  2QTX A;  3LWI A;  1Q7Y U;  2WSC E;  3QYG B;  2PUO B;  2DO3 A;  4HCB A;  3JAM E;  1G3T A;  5GAN f;  1M9S A;  4R55 A;  3L1A A;  4X9C A;  3GIB A;  2XDP A;  5GAN 2;  3M57 A;  3MP1 A;  2MWO A;  3I55 A;  1N8R U;  4EDU A;  4UC4 A;  4BDZ A;  2QQS A;  5L8R E;  2M9U A;  3S3M A;  1NPR A;  5I2S A;  4IUV A;  5CQX A;  4BI8 B;  3JCM X;  2V8K A;  5AYF A;  2D6F A;  4C8Q F;  5D6X A;  5M9O A;  2ZPG B;  3M56 A;  3I55 T;  2OTJ A;  4E7J A;  2RK2 A;  4HCZ A;  2DJZ A;  5DM7 R;  2XHC A;  4XAX B;  2X4X A;  4ELZ C;  2HD0 A;  1M1K U;  2RI5 A;  2K5F A;  3JRZ A;  1TH7 A;  5J39 A;  1KQS S;  4C0Z A;  2XI9 A;  2GF7 A;  4M7A F;  2Y4Y A;  2DPP B;  2DXC A;  3CC7 A;  2I2L A;  2RB6 A;  3P8D A;  3CCE T;  1RI0 A;  1IRE B;  5CKH A;  3VKI A;  5LJ5 e;  1VQL T;  2PQW A;  4X9D A;  4BD3 A;  4QQD A;  5GAM j;  3OYK A;  4FSX A;  2R5A A;  1H64 1;  1X6O A;  2DAQ A;  1LNX A;  2LNV A;  3CD6 A;  4F7U E;  3QHS A;  3UT1 A;  3L2W A;  5FRM A;  4XTW A;  2EQU A;  4PJO E;  3UWN A;  2GQV A;  4LDX A;  3JB9 H;  3CCV A;  1UGS B;  2ZGW A;  1M90 C;  1BI0 A;  2EAY A;  3E1S A;  4M75 E;  4M78 F;  4PNO A;  3M59 A;  4O6J A;  4M77 F;  3J7A F;  4F7U B;  3C94 A;  3G7Z A;  3KUF A;  3MEV A;  1W2B A;  1Q82 U;  5LL6 S;  3H8Z A;  1MGQ A;  5C0M A;  5GAN j;  3PFS A;  1VQN A;  1XOV A;  2GFA A;  3CBM A;  1U8R A;  4OGE A;  4OMF B;  3JCM b;  3I56 A;  2DXT A;  4M78 G;  4M7A D;  1Q86 C;  1I4K 1;  1KC8 C;  1Y71 A;  3CPW S;  1YHQ A;  1QVG S;  1UGP B;  5I2M A;  1YBY A;  2LTO A;  1NJI C;  2VUB A;  3L2V A;  1X75 C;  2DVE A;  3G6E T;  3M54 A;  2QA4 A;  3X25 B;  3E9G A;  1O75 A;  1DJ7 B;  3MO8 A;  1VQ4 A;  4M7A A;  2LCL A;  1HK9 A;  1G3Y A;  4NS5 A;  3HRS A;  4LD6 A;  3LW5 E;  5GAN 3;  2HQE A;  5CK9 A;  3DLL A;  2DD5 A;  4DOV A;  5KCO A;  4QQG A;  5GMK m;  4BE2 A;  2HNI A;  1M1F A;  1M5Q 1;  1W4S A;  3OMC A;  4C92 F;  4QQ6 A;  5LJ5 j;  1KC8 U;  3V8K A;  4C0D B;  4FIB A;  2DZC A;  4OB0 B;  3RUX A;  4A54 A;  5GMK j;  4E7K A;  4J7F A;  2E70 A;  5LJ5 d;  4M75 B;  1VQK T;  2L89 A;  4C0F A;  1WQW A;  3CCU T;  1ZHI A;  2RH2 A;  3JCM h;  3OYL A;  3VV0 A;  2VGN A;  2EYQ A;  1K8A U;  5LJ5 f;  3LGF A;  2BUD A;  5GAO l;  2VGM A;  3HFN A;  1QP3 A;  2F5T X;  2X4W A;  2XKO C;  4E47 A;  3OYE A;  4BE0 A;  1VQ9 A;  4OVA A;  1FWZ A;  4XTX A;  3HRU A;  4LDV A;  2LT1 A;  2PU9 B;  4BB7 A;  1Q7Y C;  2LQK A;  3URG A;  2CS7 A;  3RKX A;  5CKB A;  3JCM c;  3GNG A;  3JB9 F;  3INZ A;  3JCM d;  4FU6 A;  4ZGJ B;  3FIF A;  4CI0 C;  1OZ2 A;  5FLX E;  4ATO A;  2KAF A;  3E9F A;  2ZCF B;  2DZ9 A;  3QKJ A;  3V7C A;  5GAM g;  3L2Q A;  3CC4 T;  4KUL A;  4C5H A;  2FB7 A;  2MWP A;  4N0A C;  3CCU A;  5GAN 6;  5DLO A;  3HPW A;  4J8O A;  3OYY A;  2VXF A;  3OW2 S;  3FLG A;  2E6Z A;  5GAN 4;  4PJO C;  5DLQ E;  4C8Q D;  3FEO A;  4MZP A;  1K9M C;  4LD9 K;  2RD1 A;  2M1H A;  3QG1 A;  5CKF A;  3M4G A;  5GAM e;  2PVD B;  1FXX A;  3C4S A;  3QSU A;  2DTI A;  3SWN C;  1QVF S;  5CKD A;  2QEX A;  3CME A;  4L6V 5;  4M75 D;  3CCR T;  3J81 E;  3G71 A;  2P0P A;  3G6E A;  3CCL T;  3ER0 A;  5C6S A;  3MHX A;  4R56 A;  2EKO A;  4JDS A;  1BI3 A;  1YJW T;  5GAN g;  2RK1 A;  3OBY A;  1BYM A;  4M77 D;  3CXC S;  5CCA A;  2JN0 A;  3LH0 A;  4FL6 A;  2ZPF B;  3ASK A;  3EFS A;  2OTL T;  1VQN T;  2RI2 A;  4MMK A;  2KK4 A;  5FRN A;  2O4X A;  3OMG A;  3OYB A;  4LDW A;  4M78 A;  3G4S A;  4BI4 A;  1BIA A;  4NOY A;  1VQM A;  1K9M U;  2E5Q A;  2EJ9 A;  4JRI A;  2P0K A;  4M7D A;  4M7D B;  3NTK A;  1M8V A;  1U1T A;  3L42 A;  3QO3 A;  2XU8 A;  3HKS A;  1VQ6 A;  4JRP A;  3S6W A;  2A7Y A;  4BDY A;  2EJG A;  4M75 A;  5LJ5 g;  5HK3 A;  4D6W A;  3HSB A;  3CPW A;  4C92 C;  4PJO A;  3X28 B;  3JCM V;  3RER A;  4PJO B;  4J7I A;  3BDU A;  4IKF A;  1D3B A;  2K5L A;  1YIT T;  4OF1 A;  1VQ7 A;  1W2B S;  5GAN d;  1VQL A;  2ZZD A;  4EMK A;  2LX9 A;  1QVP A;  3G71 T;  2O01 E;  2G3R A;  1KQ2 A;  3VYH B;  4B9X A;  4N4G A;  5CQY A;  3CC7 T;  2DIG A;  1V29 B;  5GMK e;  2EFI A;  1ZBX A;  3CME T;  2QEX T;  1VQP A;  2CYZ B;  3WVE B;  5GAO p;  1LJO A;  2Y4X A;  4DA4 A;  2CZ6 B;  3CBP A;  3A8O B;  2LRQ A;  3CCJ A;  4C8Q A;  4PLL A;  2OTJ T;  2JTF A;  3GF5 A;  3MEA A;  3JCM Q;  4IUP A;  4RMO A;  5HY6 A;  4M75 F;  4V2S A;  3SDZ A;  2F5K A;  1ZQ1 A;  2E12 A;  4M78 C;  4M77 E;  4F7U G;  1N27 A;  2QQ9 A;  3M9Q A;  4C92 B;  2KVQ G;  4PKC C;  3DKM A;  4VUB A;  2RM4 A;  5CR2 A;  2LT4 A;  2ZPE B;  1K73 U;  3OYI A;  4DQ2 A;  2RA2 A;  3JCM P;  1VQP T;  1Q82 C;  1YI2 T;  1O9S A;  5KE2 A;  2R5M A;  1XQH A;  1AHJ B;  2K57 A;  3QXE B;  4BY6 C;  2LDM A;  3L2Z A;  1Q81 C;  2E64 A;  1N9R A;  2IVW A;  2K2V A;  3ME9 A;  4WF2 A;  3WXM B;  1VQ9 T;  4KT0 E;  2DIQ A;  4XU1 A;  2M0O A;  2V8I A;  4II1 A;  5FU7 C;  1YCY A;  3OYC A;  3CXC A;  5KH6 A;  5A0G A;  3JB9 D;  1YIT A;  2FL7 A;  2QDY B;  2MF2 A;  2B8A A;  4RG2 A;  4C8Q G;  5CAI A;  3KXT A;  3UPU A;  2Y90 A;  3FB9 A;  3LGL A;  1VIE A;  4J6Y A;  1NPP A;  2E65 A;  2EWN A;  4A4K A;  2EQK A;  3SFM A;  5GAO m;  3OS2 A;  1RL2 A;  4F7U F;  2EIF A;  1Y96 B;  1XNI A;  2EQJ A;  2VYT A;  3OBW A;  4BE1 A;  3CCQ A;  1Y96 A;  2ZPB B;  2JUF A;  3F70 A;  3OS5 A;  5IN1 A;  3JCM J;  3EAE A;  4N4I A;  1PSF A;  1WJR A;  3RKW A;  3ZBD A;  3Q1J A;  2XDD A;  3VYG A;  2RHZ A;  3A8H B;  3TCJ A;  4ZN1 A;  1VQM T;  1Q81 U;  5J26 A;  1JBM A;  1OI1 A;  4PJO G;  3JCM g;  1VQ4 T;  1B34 B;  4IUR A;  2H3J A;  2DKG A;  3HP9 A;  1M1K C;  1B34 A;  2QA4 T;  3OY9 A;  2ZPI B;  3VUB A;  4HA8 A;  3SB2 A;  1YHQ T;  4IUT A;  1YJW A;  3VUZ A;  4EMK B;  3I56 T;  1WGS A;  2YLC A;  3SD4 A;  2RI3 A;  5GAO q;  3OYM A;  3CCL A;  4Y91 A;  1YJ9 A;  4PJO F;  2EJF A;  5GAM h;  1QW1 A;  2CGH A;  4M7A B;  5D6Y A;  4C0D C;  4M7D G;  3A8G B;  2F69 A;  4ZTF A;  3BY7 A;  4KBM B;  3MCA B;  2K3X A;  1JRI A;  4P5N A;  4A53 A;  5GAN 7;  2BKD N;  4CRI A;  4E7L A;  3MP8 A;  2LQ8 A;  4OP0 A;  4EPC A;  1KQS A;  3CCV T;  2L3R A;  1YIJ T;  3JB9 J;  3WVD B;  4GY5 A;  1LOJ A;  4BUG A;  1YJ9 T;  1NZ9 A;  4M7D F;  2GCX A;  3M53 A;  4LDU A;  4F7U A;  5LJ3 j;  4RKU E;  3CD6 T;  4XU0 A;  3E19 A;  3OYD A;  2CZ1 B;  3M5A A;  4N0A A;  3A5Z B;  3JCM f;  2DXU A;  3X26 B;  2VXE A;  3R6O A;  1OYX A;  1U1S A;  3QZ9 B;  4TVR A;  4BAC A;  1I8F A;  3QJ6 A;  1YI2 A;  1N9S A;  3OW2 A;  3NTH A;  2KQW A;  1QVF A;  1H3Z A;  3LYI A;  4XU3 A;  1EIF A;  2JNG A;  5J3B A;  2FYK A;  4IUQ A;  2E1H A;  2WSF E;  2KY9 A;  1JJ2 A;  2PUK B;  1WQ7 A;  1WJS A;  2XG8 D;  2QXF A;  3EFR A;  3GLX A;  3QII A;  4A4F A;  4A4G A;  4JS4 A;  2C06 A;  1VQK A;  4ZGD B;  4XQ3 A;  1WNL A;  1HXD A;  4C8Q E;  5GMK i;  3OYA A;  3VU3 C;  1VQ8 T;  3CMA T;  5GMK h;  1Y7X A;  3FJP A;  5IT9 E;  1SSF A;  3CC2 A;  4EMK C;  3TRE A;  3ZFJ A;  5HK0 A;  4ELY C;  3CCJ T;  1K73 C;  3OS1 A;  2K5I A;  2EQM A;  1WJQ A;  2WSE E;  3CEY A;  3JB9 G;  2WAC A;  4M7D C;  1UGQ B;  2M16 A;  3C95 A;  4J83 A;  3PTA A;  4M7A E;  4FT2 A;  3PT9 A;  4C5I A;  3L2R A;  3OSV A;  1NJI U;  4C5G A;  4E7I A;  2XD0 A;  4FT4 A;  2FVU A;  5A0L A;  4XTY A;  4MML A;  4OB3 B;  2KDS A;  4HT9 A;  2PVG B;  4J6W A;  4M78 D;  3CCM T;  1VQ7 T;  3OB9 A;  1KG1 A;  1M1G A;  2DTH A;  3RES A;  3PIO A;  5D6W A;  3UDC A;  2DK3 A;  2XIC A;  2RJE A;  4M77 C;  4C92 G;  3GNF B;  4OGC A;  1VQ5 A;  1M4Z A;  1I81 A;  3LLR A;  5A0D A;  5HKC A;  4XU2 A;  3OYN A;  3V7S A;  3O8V A;  4JUV A;  5GMK l;  3OYJ A;  5KE3 A;  5GAN e;  3V7R A;  5KCH A;  1VQ6 T;  2A3L A;  1S72 A;  2MI6 A;  1KHI A;  2KMT A;  1G3W A;  3FRN A;  3MET A;  1KD1 U;  4M7D D;  4XTU A;  2JVV A;  5I21 A;  4E7H A;  1K8A C;  1KHC A;  3S3O A;  3G4S T;  1I5L A;  4FM4 B;  4RCB A;  2RHX A;  4HT8 A;  3P8B B;  1VQ5 T;  5CIU A;  1IZ6 A;  1VIF A;  4M77 G;  4Z02 A;  4C8Q C;  1VQO T;  2ZPH B;  5LJ3 g;  4C92 D;  3QUI A;  3FC3 A;  3TU4 K;  1MHN A;  1BIB A;  1WPY A;  3DB4 A;  4J6X A;  3LX7 A;  4L5G A;  2V8J A;  5CO7 A;  3GPL A;  3NFC A;  3JSC A;  4PJO D;  2RHY A;  2XK0 A;  3PMT A;  3CCE A;  1BI2 A;  3QPH A;  4IUU A;  3CCR A;  4NL3 A;  3QYH B;  1G3S A;  4B9W A;  2RJD A;  2O4X B;  3JB9 I;  3OS0 A;  2DTO A;  3KBG A;  3MEU A;  5LJ3 e;  5A2Q E;  2E10 A;  2BIV A;  2R57 A;  3HHT B;  2E6N A;  1BKB A;  2FHD A;  4M75 G;  2DEQ A;  5FRO A;  2P0Q A;  3M4Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...