3VKIA

Monoclinic crystal structure of salmonella flga in closed form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
198
structure length
198
Chain Sequence
QDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMTGSAKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagella basal body P-ring formation protein flgA
publication title Structural flexibility of the periplasmic protein, FlgA, regulates flagellar P-ring assembly in Salmonella enterica
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 41
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.760 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vkiA02
3VJPA 3VKIA 3FRNA 3TEEA
chains in the Genus database with same CATH superfamily
4HA8A 4ZGJB 2JTFA 3EGDA 4NOYA 1UHFA 2KNBB 2D9TA 2JJ9A 5KYYB 3J81E 1BI1A 2NUZA 4DBFA 2VVKA 2JM8A 1D1AA 1P92A 3HL8A 2DEUA 3CMEQ 3PE0A 4OMOA 2A7YA 4M7AB 4DA4A 2OI3A 1RAEB 1TG0A 4F7UA 2E5KA 4MZTA 4AT1B 4C92E 2R5MA 2ENMA 2DLPA 4C8QB 1R77A 1IZ6A 1FMVA 2DMOA 3G6EA 2FHDA 3OSVA 2OTJA 1Q82R 2EBPA 4OMNA 1ZHIA 1XQHA 3A8GB 3L2ZA 2K79A 3EGXB 4HT8A 2OJ2A 1BI2A 5CQXA 2E12A 2E6ZA 1VQKT 2JS0A 2A36A 3MEUA 2CUBA 1K9MC 2AK5A 1GXIE 4D6WA 3QZ5B 2HNIA 4CC7A 2QA4T 4HCBA 1GCQA 2ZPGB 3LX7A 3TREA 5LJ5d 5D7UA 2BZ8A 1H3ZA 1OOTA 4C92F 4Z8AA 1N8RR 2DYBA 3X25B 1YJ9T 3OYNA 3JCMd 3X20B 1LOJA 2O4XB 1YWOA 1RL2A 3NTIA 2DILA 5GMKi 2AZSA 2K6DA 4ZGEB 2LRQA 3I5RA 5CVIA 3HRUA 3DKMA 5FWCA 5GJWB 1W1FA 3G1JA 2YUQA 2E41A 4EPCA 1SSHA 1UECA 2EQKA 2J6KA 4O5VA 4PJJA 5GANj 6AT1B 1M5Q1 3OYFA 3CCQA 2FPFA 1BKBA 3L2WA 2XDDA 4X9DA 3LWHA 5FWBA 1Q7YU 2ESWA 2QG9B 1ZX6A 3KUFA 1HYOA 2CP2A 2F1LA 4M7DD 3CCSA 5M9OA 3RMSA 1CKAA 3JAME 4BI3A 2KROA 1QW1A 1RAIB 3GNFB 5KYXB 2COYA 1K0XA 4C8QE 2HD0A 3OYKA 4R55A 3CPWA 3M0QA 3MP8A 4HCKA 3M58A 1IB8A 5KYWA 2CP3A 2W0ZA 3X26B 2VGNA 1YIJT 4WF2A 1Q7YC 1AEYA 3VYGA 2HAXA 5CKFA 3H9NA 4L6V5 3OYGA 2OTLT 1MMDA 2GFUA 4C92C 4EIKA 3CXCP 2DERA 4M4ZA 3NFCA 2ROLA 4M7AF 2HL3A 2FB7A 4ELYC 1C6VX 3LGFA 1C0MA 3JCMW 1OI1A 1Z9QA 2K5LA 5GANh 1K8AR 2PUOB 3WVEB 1W6XA 2ZPHB 3WXMB 3UA7A 2ZAEA 4HKEA 4C8QF 3S6WA 3GOXA 2PTKA 2EGAA 2OAWA 4XU3A 1X2KA 2MK5A 1ARKA 5C6SA 4BD3A 1HK9A 2DJZA 2C06A 1SRMA 1WYXA 2RQRA 3E9GA 2LCSA 1VUBA 1X6BA 1Y07A 3I56A 1BIAA 3QBYA 2RF0A 1NZ9A 2A28A 3CC4A 2D6FA 2JS2A 5CKDA 3JB9F 3IQLA 3FJPA 2RMOA 4C92A 2F2WA 2DK3A 2DRMA 3REAB 2YUPA 1RI0A 3CCMQ 1WXTA 1KC8U 3V8JA 1I5OB 3QUIA 1Y0MA 3MO8A 2DBKA 3L1AA 3CMEA 1F1BB 1YP5A 4JS5A 3CC7A 4M77G 2E5QA 1MV0B 2QEXT 9ATCB 3OS1A 3QDRB 1M2VA 4J6WA 3CCET 1VQOA 4MDWA 3JCMQ 1U8RA 2A08A 3VS0A 3QWYA 4M7AC 3DLMA 1YHQA 5LJ3j 1JJ2S 2DYIA 5IH2A 3V8KA 1N9RA 3CQTA 1TUCA 4M77C 1YJNQ 4OB0B 4R56A 2NUPA 1TS9A 1N9SA 1Q82U 2PVDB 4C8QC 5GAMf 2NYSA 4C0DB 1M27C 4JLIA 2HQHA 4XU1A 2G6FX 4JRIA 1WJRA 4MMLA 3FLGA 2GCXA 4OMMA 2VV5A 1ZBJA 3CCUQ 2KQWA 2RJFA 1VQ8A 1TUGB 2VGMA 2E64A 4PJOB 2EYWA 1NPRA 3I5SA 4FYXB 2LCLA 2V1QA 2DTHA 3L2UA 1QVFP 1WHGA 1X2QA 2RA2A 3S3NA 2LDMA 2KR3A 1Q82C 3TCJA 3OS2A 3CCJA 4FYWB 2BTTA 1N8RU 3L2RA 2AHJB 1UDLA 4Y91A 2BE7D 1HJDA 1Q95G 5KYYA 2LT1A 4M78B 4OB1B 1WXUA 2JOYA 2JUFA 2K57A 4LNPA 2M9UA 2RQVA 3JSCA 2J7IA 2P4RA 1YJWA 4M7AA 1GFCA 4CC2A 3M0RA 3VYHB 3QIIA 2KRNA 5FRNA 1ABOA 1WLPB 4M77A 3GLXA 1QP2A 4QVCA 1N8RC 1H3HA 4A53A 1PNJA 2EIFA 3HFOA 4LDWA 4JRQA 4C8QA 3P8DA 4JRKA 1UGSB 4EMHA 2NUTB 2XI9A 2JT4A 1W70A 1UB4A 1SPKA 3QXEB 4HVUA 3I55Q 2NWMA 3EGXA 2EQMA 3QDFA 5LJ5h 1X01A 2VC8A 2EGCA 2YLCA 3OYEA 2CZ6B 2F69A 2XICA 3EG9B 1VQ4Q 1K1ZA 4AG2C 3JCMh 3OW2P 3M5AA 3L2QA 2RQWA 4FIBA 2A0FB 4FT4A 3VS7A 3GF5A 4M75B 4GLMA 3V8LA 1OZ2A 2R57A 2O4XA 4OP0A 1W2BS 5GAMe 4D8DA 2EPDA 4E7KA 1IO6A 3QO3A 1HSQA 1K8AU 4PJNA 1PRMC 4FU6A 1SRLA 3VRZA 3MP6A 2QA4Q 4FW2A 1VQ9Q 2QTXA 1QVGS 1VQMA 1GBQA 4FSXA 2E4HA 1I5LA 2Z0WA 1NM7A 3CCRA 3PMIA 2KXDA 1U1SA 1ZA2B 4EMKB 5IHKA 3E19A 1KSWA 1NPPA 1K8AC 1VQ6A 3GNGA 1MUZA 1YITT 3CMAT 2PQWA 2QDYB 1UGVA 3ZEHA 4GY5A 3JV3A 4RTUA 3GP8A 1Y57A 4PJOF 3R6OA 2LMJA 4M7DG 4D8KA 3ME9A 3VS6A 2DAQA 5KYXA 2ED1A 3CCMA 2D0NA 2RHXA 3ZFJA 5LJ5g 2EQJA 4M78F 2XG8D 5IN1A 2RO0A 4FT2A 3OB9A 5J26A 4XAXB 1BCMA 4ZTFA 4QT7A 2AIRB 2EKHA 2RB6A 3JCMg 2B8AA 1TSFA 2X35A 2GFAA 1KQSS 2CZ0B 2DBMA 2BZXA 2BIVA 1X6OA 1FYNA 3S3OA 1G5VA 2W10A 1JXMA 2DXUA 3H41A 4RUGA 3JB9J 2K3BA 3RKXA 5IXBA 4IURA 3REBB 4E47A 2DL7A 5LJ5e 1OZ3A 1N27A 4AFUC 2AKLA 3MPUB 2M0OA 4C0DC 1UG1A 1QWEA 1Q86U 1B07A 1YJNT 3JCMe 2QTVA 3C4SA 1IHWA 3CPWP 3OYIA 1R0CB 2F5KA 2FG0A 1M4ZA 1QKWA 3EG2A 3QG1A 4M7AD 4PJOC 1ZLMA 2ZGWA 2RHUA 4PFZA 2LT4A 4XQ3A 3LLRA 5IHIA 4M77D 3JCMb 2DXCA 4M75F 3CCUT 1Y7XA 1KJWA 4F7UG 1I4K1 1OPKA 4L5GA 5CKHA 1VQNT 1IXDA 3H0FA 2CH4A 4M78C 1M8MA 4A4HA 1VQPQ 4KH0B 3RDVA 4F04B 4E7IA 1QVGP 3H0HA 1KQ2A 5CAIA 1I0CA 1OQKA 1PHTA 2J6FA 5IAYA 2F2VA 4ELZC 1NEGA 2XDPA 5DLQE 5GAMd 1PRLC 2V8KA 1GBRA 2EW3A 4IIMA 3V7CA 3JB9D 4OMQA 2O88A 3VJPA 1B34B 2E3HA 5FU6B 4C5EA 2WSEE 3Q1JA 1BK2A 3LH0A 5CR2A 5KE3A 1RAAB 3MEVA 4CC3A 3H0IA 2A37A 2C0IA 1M3BA 3A8MB 4QQDA 4PJOA 3M0UA 4IUVA 1QVPA 3JCMJ 5KCOA 1YFNA 4AFSC 1D0YA 3PFSA 3CCEQ 3I55T 2LNHB 1M3AA 2VXEA 5CKBA 1U1TA 1KC8R 1KQSP 2HQEA 3CCLQ 3M0TA 1LJOA 5HK3A 3O8VA 5GAN2 4M78A 3MJXA 1VQ4T 3I9QA 3X24B 4JJDA 3QKJA 4M75C 5I22A 1WIEA 5GAOm 2HZYA 2VASA 2XHCA 4RG2A 2CZ1B 2L2PA 2E10A 3NHNA 2E1HA 1VQKA 2QDLA 1WQWA 1K0SA 3CXCS 4BE0A 2GQIA 1N5ZA 4RMOA 2KDSA 1NJIR 2QA4A 1O75A 1JJ2A 2OAUA 3A8LB 3GBQA 2PU9B 2EQIA 3M59A 2NUTA 2YRCA 5KE2A 1SHFA 5I2MA 2X4WA 1PKSA 1YJ9A 1BI0A 2CP5A 3ZBDA 4EMKC 2QYZA 4E2FB 1VQ9T 3EG9A 4OMPA 2DX1A 2QQRA 3JCMX 4N4GA 5HK0A 1H92A 1UFFA 2HEQA 4Z88A 2QK0A 1PD0A 2X4XA 2CREA 2DL3A 2LJ0A 2LQNA 2RJDA 1S72T 3PIPA 1O9SA 2LCCA 1QLYA 1SHGA 2RHIA 1MV3A 4M75A 4PL6A 4JJCA 4LDYA 3MHXA 5DM7R 2BZYA 3PIOA 4FYVB 3JB9I 1JEGA 3UF4A 1KIKA 2LQ8A 2Y4YA 2HL5C 5J39A 3AT1B 2DTIA 1M8VA 4J7IA 2Y90A 3MKDA 5DY9A 2X3WD 1WHHA 2X3XD 3G71Q 3A98A 3OA6A 1D0ZA 1MHNA 5D6WA 1WXBA 1YIJA 4DBHA 1BCOA 1YN8A 1T0HA 2QQAA 4EMKA 4HVWA 4OB2B 2OTLA 2O9VA 2FZCB 4F17A 1E6HA 3PVLA 2JVVA 3EFSA 4A63B 4BY6B 2ZPFB 2K9GA 4C92G 4PLIA 8ATCB 1TH7A 2DL4A 1WI7A 4AFZC 1QMCA 2DO3A 2CUDA 2I0NA 3M53A 2J6OA 3CBPA 4A4EA 4HT9A 1WGSA 1R0BG 2JTMA 4QKUA 4XU0A 1T3LA 2E3IA 1FXXA 3CPFA 1QVFS 2CSIA 2QQ9A 1BYMA 4ZGDB 3CCQT 2PVOB 3NMZC 3ZL7C 1I81A 1W2BA 3ULRB 2OX7A 3EH1A 2KE9A 1B7TA 4KGXB 3CCST 2CT3A 1YITQ 3CMAQ 1PD1A 1AWOA 4PJOD 1VQPT 1X69A 1D3BB 3QZ9B 2GF7A 2KYMA 5FW9A 3CCVQ 2DETA 2QXFA 1YI2A 1WQ7A 3NGPA 1C1AA 1UJYA 1PG5B 1H8KA 4OVAA 1PCXA 3M0SA 3BW1A 4M78D 5FU6C 1OX9A 3HPWA 4DQ2A 2QEXA 2XMFA 5IXFA 8AT1B 2K3XA 3EG1A 4FW1A 5GANf 1VQLT 5HKCA 2GQVA 2WSFE 2RHYA 4AG1C 2JW4A 3FRNA 4AFQC 2DVEA 4M7AG 3CBOA 3CD6T 4FSSA 3UDCA 4OB3B 3HKSA 3OW2S 2K3YA 3QWXX 4PFPA 1M9SA 5GAMh 4C8QG 1WJSA 2J05A 3OYDA 1X6GA 3CCLT 2DJQA 4BACA 2EYZA 2O2OA 2YXYA 1KC8C 1NJIU 3QSUA 4BI4A 5GAOr 4J9FA 4J9BA 3LW5E 4BE1A 4HCCA 4DEYA 3M9QA 3SHWA 3JB9G 3VS3A 1B34A 4J9HA 3QYGB 1Q86R 3RKYA 4M75D 2QI2A 3CC7T 3NTKA 1NJIC 1VQNQ 5LJ5j 5J3BA 1G3SA 2DM1A 3M54A 4Q5WA 3OYMA 2KBTA 3MCAB 4DOWA 1WDXA 3HSBA 4J9EA 1JU5C 4RCBA 3M56A 2PNIA 4LDXA 1AWWA 5GMKe 3BFMA 1M3CA 1D0XA 2K5IA 1AVZC 2D8HA 2ZPIB 1ZUUA 3EH2A 2LZ6B 3LH5A 1TU0B 1HXDA 3SFMA 1WNLA 2FYKA 3S3MA 2DVJA 1U5SA 2V1RA 3JRZA 2VWFA 1I1JA 3MP1A 1IGUA 4J5YA 1VQ7Q 3O5ZA 3G4SQ 1VQ8T 1RI9A 1VQ5Q 5KYNA 5FRMA 2IG0A 2EYQA 2CP6A 2ZPEB 4ANJA 1N6AA 2P84A 3TU4K 2C0TA 1PC0A 5GMKl 5GAMg 4IUUA 5D6XA 4M7DE 2COZA 4Z89A 3C95A 3OYCA 3OBWA 5LJ3f 2PZ1A 1KFZA 2KMTA 3G71T 1BB9A 3INZA 2RHZA 2QGFB 4J83A 4BY6C 1UGPB 5AT1B 4XTVA 3E2UA 3CEYA 2CP0A 4FYYB 4FCYA 3DB3A 4J9IA 4LUEA 2KAFA 3CPWS 4ESRA 1FMKA 1I8FA 5EG2A 3BDLA 1BI3A 1M2OA 2QAZA 4XTXA 1Y96B 2V8IA 4E6RA 2DFUA 4J7FA 1D09B 1RAHB 4JDSA 3P8BB 1YITA 2P0PA 1AHJB 2GNCA 1G3TA 3KBGA 1J3TA 1JRIA 2LQWA 3CXCA 2EYYA 2DD4A 3MEWA 2LJ1A 5IT9E 1RUWA 4OF1A 4RCCA 1XJWB 3RR6A 4LXCA 5A0LA 2HSPA 4KT0E 1K9MR 1T3SA 4LDVA 1S72Q 2K5FA 4C92D 3HP9A 5IHNA 4WTOB 1IGQA 2L0AA 1NLOC 3R6NA 3C94A 3FEOA 5LL6S 2DKGA 2M02A 4K11A 2K4YA 1WFWA 2KT1A 1EZZB 2RK2A 2CGHA 4J9DA 4ZN1A 4RTZA 3CCVT 5A0DA 3J7AF 2ATCB 4F7UE 4RTYA 2H8HA 1WHLA 1UEBA 2EYXA 3PTAA 3H6ZA 3JCMV 2DL8A 1SF9A 3SEMA 3EFRA 3ASKA 5KYWB 4GBQA 4N4IA 1I07A 4KGVB 4ORZA 2E65A 4E7JA 2ZPBB 2QASA 4F14A 1KD1R 4X9CA 5LJ3e 2XK0A 5CKEA 1YJNA 1G3WA 1TXQA 1AWXA 1V76A 2BKDN 3NPFA 4KBMB 4A4GA 2X9HA 1MNEA 1ZUKA 1AD5A 1E6GA 4JUVA 1D3BA 4LE9A 4DEXA 4PJOG 1ZSZB 2CS7A 4C5HA 3CCUA 4PLLA 4PJMA 4PFOA 4Y92A 1B3QA 1XOVA 3L42A 1VQNA 5GANd 1VA7A 3VS2A 4XU2A 2DD5A 3A8OB 2MF2A 3V7RA 1IREB 3CCQQ 2EJGA 4C0GA 4M78G 4MMKA 1ZA1B 5D6YA 4C0ZA 2CYZB 2X51A 2R58A 3EGUA 3CCSQ 2IVWA 4X1VA 1Q86C 2YRDA 3OYLA 4C8QD 2DZCA 3NTHA 4GLKA 2FEIA 5FU7B 3I35A 3HHTB 3CC2T 1KG1A 2J06A 3UT1A 4TVRA 1LVKA 2WSCE 3HRTA 4LD9K 2DIQA 1WPYA 4LN2A 2KT8A 4PK4A 4IUPA 3DLLA 1D1BA 3I55A 1VQLQ 1JB0E 4JS4A 2ZCFB 4A54A 1VQ7T 4WCIA 2XKOC 4II1A 1OU8A 3G4ST 3CD6Q 1VQ4A 1VQ5T 2FZKB 2B86A 2DXTA 3QJ6A 3SWNB 4A4KA 3M4GA 3OY9A 4M75G 2YSQA 5GAN5 1VYTA 1M1FA 4HCZA 4C5IA 2RI5A 4QQGA 3M0PA 1CSKA 1ZSGA 1YWPA 4E7HA 2XD0A 3I56Q 5GJVB 5DLOA 3VUZA 4IIOA 3CC4Q 2NLUA 3QPHA 2EQUA 5KH6A 4BI8B 1RLPC 3OW2A 1WA7A 2DTOA 2L89A 2FRYA 1NG2A 4YTLA 1RACB 1ZQ1A 3RKWA 2CT4A 2EVRA 3RERA 1MMGA 1VQ9A 3OBYA 4NL3A 1WZOA 3M55A 4E7LA 3E1SA 3CC7Q 2XU8A 2PVGB 2HBWA 4QQ6A 1MMNA 1WX6A 2QQBA 1G3YA 4M77B 1S72A 1VQOQ 5LJ3d 1K9MU 1PSEA 2M51A 1YHQQ 2KSSA 3FJ5A 4ZNXA 3JCMc 1NBEB 2EJFA 1K73R 2EGEA 1LPLA 1JXOA 1U06A 3RNJA 4ZN3A 1FMWA 2FVUA 2DEQA 2JTEA 1QCFA 2RQTA 3TQ7P 1CKBA 3OQ5A 3SB2A 2E70A 3BE3A 2EKOA 1VQ8Q 1ZUYA 4ZTJA 2CSQA 3G6ET 5GAN3 1SSFA 1OULA 2OTJT 1R8OB 2MWPA 3EAEA 2R5AA 1Y96A 1VYVA 2ROTA 3CCJQ 2DIGA 2LC4A 5GMKj 1WHKA 3EG3A 1KD1U 2AZVA 4B9WA 4P5NA 2KK4A 2HKQB 2LP5A 2RM4A 3PGGA 5GAOp 1NE8A 4BDYA 1ACMB 3HFNA 1MMAA 5KCHA 2SEMA 3TSZA 1QQJA 2RN8A 1YJWQ 5I21A 1M1GA 1BBZA 1TTHB 3OMCA 3CBMA 3EFOB 5ECAA 4NS5A 4BB7A 2KVQG 1KD1C 1SKUB 1K76A 1AT1B 1QCNA 1ZSZC 4F16A 3EHQA 4CRIA 2P0KA 3A1PA 2DE0X 3PT9A 5HY6A 1RABB 4M7AE 1NLPC 4KUDK 4B9XA 2KGTA 4M77E 2ED0A 1U3OA 4AMCA 4IUTA 3TEEA 2QGGA 1AZGB 2RI2A 5GMKh 3GIBA 2FPEA 3RUXA 2DZ9A 1VQPA 5KYUB 1EX4A 1A0NB 4RTWA 3OYJA 2MIOA 2COWA 2O01E 3G7ZA 2ECZA 2CZ7B 2LX7A 2MWOA 1M1KR 5GAMj 3T9NA 5FU7C 3UPUA 3VS4A 4JZ3A 4JZ4A 1JO8A 4OMFB 4JRPA 1VQLA 2F2XA 2X4YA 2HMAA 4JJNK 2PUKB 4RTXA 3D7SB 4M77F 3RESA 1S1NA 1EFNA 1QVGA 2MI6A 3OYHA 2HKNA 3CD6A 1QP3A 3OS5A 1ZSZA 2GBQA 3FIFA 3FC3A 3GPLA 2XIDA 3VUBA 1PSFA 1PWTA 3SD4A 1NYGA 2RPNA 2DL5A 3CCEA 1VQMQ 1BU1A 3HTRA 1UE9A 3SWNC 1XTDA 2E6NA 4B6MA 3CCRQ 1WJQA 3CCLA 3OYAA 1OU9A 1VOMA 5L23A 1VQ6Q 2RJEA 2O9SA 2L3SA 3OS0A 2GGRA 3A5ZB 1AWJA 1M90R 3JCMP 4KGZB 4NL2A 4M7DB 2YUOA 4QVDA 1XNIA 2KRMA 5GAOq 3VRYA 1YI2T 2K7AA 3META 2LX9A 3I56T 1KQSA 4J8OA 4ME7A 1NYFA 2XDBA 3CC4T 2C0OA 2HBPA 3A8HB 1KHIA 2CH4W 1OEBA 2AT1B 2BUDA 2DF6A 4UC4A 3UWNA 1V29B 1GRIA 4KUIA 1G83A 1UHCA 2QQSA 1K9AA 2D8JA 2L8DA 2LQKA 3CMET 1E7OA 5L8RE 1WHMA 1X75C 3VKIA 1K73U 3SWNA 3EHRA 1VIFA 1AOJA 4KULA 1PKTA 4LD6A 2I2LA 2BE9B 1VQOT 4JLGA 3LGLA 3QYHB 4HVVA 5GANg 1YHQT 3CC2Q 1UGRB 1MGQA 3DB4A 2VUBA 1W4SA 1QCOA 2LVMA 7AT1B 4X34A 5I11A 1K73C 3VV0A 1GL5A 3EGDB 1VYUA 2FO0A 5CCAA 1UGQB 2SRCA 1FX7A 1ABQA 1G8XA 2FL7A 4RTVA 3VS1A 3QJYA 5LJ3h 2GTJA 3G71A 4VUBA 2L3QA 5GANe 4DBRA 2H3EB 4F7UB 4J6XA 1K4US 2JXBA 4BE2A 2D1XA 4A4FA 2RD1A 4Y28E 3CCJT 1OV3A 1GFDA 2DNUA 2LJ3A 4QVZA 2JMCA 4E7SA 2KEAA 1ZBXA 3KXTA 2EAYA 2YWWA 1Q81R 1LCKA 2CP7A 2A3LA 2DXBA 1YCSB 4N0AC 2MPXC 1QKXA 4OGEA 2YT6A 5CO7A 2L5QA 1YJWT 2F5TX 2FPDA 3OYYA 3WVDB 1QWFA 4KRTA 2X4JA 5GAN6 3V7SA 2RH2A 4O6JA 2EFIA 1T0JA 2EWNA 4MZPA 4R0KA 2KI7A 1X43A 4V2SA 2IPOB 3TVTA 3VU3C 2FRWA 1JQQA 1LNXA 5I2SA 3URGA 1RAFB 5CIUA 2WACA 1H641 2VB6A 4MDXA 4J9CA 4EMGA 5LJ5f 4M7DF 3TSWA 1UJ0A 1X27A 5CK9A 3CMAA 2CDTA 1JJ2P 1TUDA 1VIEA 3OMGA 4L59A 1M1KU 3JCMf 2HSEB 3PNWC 2ABLA 4JPBW 1HD3A 4MZMA 2M0YA 4DOVA 4PJOE 4OGCA 4LDUA 2RNAA 3CCVA 3KFVA 1YNZA 2O31A 5GAN8 1Y71A 3H8ZA 2KYBA 1IHVA 1M30A 1G2BA 2YUNA 2HDAA 3OYBA 3L2VA 1VQKQ 4Z02A 5GAN4 3EFOA 4N0AA 2KY9A 2MYSA 1IRXA 1OPLA 1UTIA 3P8HA 4M78E 4QW2A 1M1KC 3G6EQ 5GAOl 5LJ3g 3HRSA 2OTJQ 5A2QE 2P4TA 2V26A 2K2MA 2MMPA 2KRSA 1NEBA 4XK8E 2MCNA 4KH1B 1YJ9Q 5GAOn 2M16A 1OX8A 3UA6A 2K2VA 2LTOA 3BDUA 4ATOA 3N5BB 1TWBA 2D0QB 4CC4B 3PVQA 1AZEA 2EJ9A 2LNVA 4FL6A 1M90U 3U23A 5GAN7 1UUEA 1VQMT 1WHJA 1RADB 1MNDA 2MOXA 2RK1A 2MAMA 4XTUA 5KYUA 3VS5A 4IKFA 3UATA 3CCRT 5CQYA 3LYIA 2JN0A 4DBQA 1FWZA 1VQ6T 4XTZA 4N4HA 2GTOA 5EC7A 4M7DC 2HCKA 2HQXA 1SEMA 3F70A 1BIBA 4PKCC 2L3RA 1M90C 4F7UF 4PNOA 4EDUA 3M4YA 4J6YA 4FM4B 3C12A 2DPPB 3CCMT 3RMQA 4M75E 4RG8A 2YRVA 4C0FA 3SDZA 4LUDA 1Q7YR 2IIMA 2AKKA 2KXCA 3C0CA 1OYXA 1JBMA 3JB9H 1YIJQ 3CC2A 1Z9ZA 2RJCA 2OTLQ 3THKA 1KHCA 3FB9A 3X28B 2JM9A 4XTWA 3EG0A 4IUQA 4JJBA 4J9GA 2M1HA 1W2BP 1GCPA 3LWIA 2L3PA 1QVFA 2JMAA 4C92B 1SG5A 1V1CA 4HXJA 2FZGB 5GMKm 2G3RA 1VQ7A 2YLBA 4M7DA 3RIRA 1YBYA 3G4SA 2YDLA 2RI3A 4RKUE 3J80E 1VQ5A 1KK7A 4PJLA 1EIFA 5FLXE 3OSSC 2P0QA 1TOVA 1M2VB 2DA9A 4RTTA 4E7ZA 5C0MA 2VKNA 1RAGB 3PMTA 3FDRA 2H3JA 2DRKA 2VXFA 2ZZDA 5FROA 2VYTA 3AHUA 4C5GA 2V8JA 2JZ2A 3M57A 2NUPB 2RQUA 3BY7A 1Q81U 5A0GA 3RBBB 4OMLA 1KQ1A 2Y4XA 3MEAA 2CKKA 4XTYA 5HCKA 4BDZA 5AYFA 4BUGA 3E9FA 2JNGA 1YI2Q 1YCYA 1D1CA 1DJ7B 2YHTA 3QHSA 4CI0C 3ER0A 1PM3A 1RLQC 2QEXQ 1Q81C 1GCQC
chains in the Genus database with same CATH topology
2RI2A 5GMKh 5GMKe 3CCMA 3GIBA 3BFMA 4HA8A 4ZGJB 3RUXA 2DZ9A 1VQPA 2K5IA 2RHXA 3ZFJA 2JTFA 4NOYA 5LJ5g 2D9TA 2EQJA 4M78F 3J81E 2ZPIB 2XG8D 1BI1A 5IN1A 2RO0A 4FT2A 3OYJA 3OB9A 5J26A 1HXDA 4XAXB 3SFMA 1P92A 1WNLA 2FYKA 3S3MA 3HL8A 4ZTFA 2O01E 3G7ZA 2CZ7B 2RB6A 3JRZA 3JCMg 2MWOA 2A7YA 2B8AA 4M7AB 4DA4A 3MP1A 4J5YA 5GAMj 3T9NA 2X35A 5FU7C 2GFAA 1KQSS 3UPUA 2CZ0B 1VQ8T 2BIVA 4OMFB 4JRPA 1X6OA 4F7UA 5FRMA 3S3OA 1VQLA 1G5VA 2IG0A 2X4YA 4MZTA 4JJNK 2PUKB 4C92E 2EYQA 2R5MA 4M77F 3RESA 2DXUA 4C8QB 1QVGA 2ZPEB 1N6AA 1IZ6A 2MI6A 3TU4K 3JB9J 3OYHA 3CD6A 1QP3A 3RKXA 5GMKl 5GAMg 3OS5A 3FIFA 3FC3A 3G6EA 2FHDA 3OSVA 3GPLA 2XIDA 2OTJA 3VUBA 4IURA 1PSFA 4IUUA 4E47A 5LJ5e 5D6XA 1OZ3A 1ZHIA 4M7DE 1XQHA 3A8GB 3L2ZA 3SD4A 1N27A 3OYCA 3C95A 3OBWA 5LJ3f 4HT8A 1BI2A 5CQXA 2E12A 4C0DC 2M0OA 2KMTA 1Q86U 3CCEA 2E6ZA 1YJNT 1VQKT 3MEUA 3JCMe 3G71T 3C4SA 3SWNC 1XTDA 2E6NA 3INZA 1K9MC 2RHZA 4J83A 2F5KA 3OYIA 1GXIE 4D6WA 3QZ5B 1WJQA 2HNIA 4BY6C 3CCLA 3OYAA 1M4ZA 1UGPB 2QA4T 4HCBA 2ZPGB 3LX7A 4XTVA 3QG1A 4M7AD 3TREA 3CEYA 2RJEA 4PJOC 2ZGWA 5LJ5d 3DB3A 3OS0A 2KAFA 2RHUA 3CPWS 2LT4A 3A5ZB 4XQ3A 3LLRA 1I8FA 4M77D 3JCMb 2DXCA 3JCMP 1H3ZA 4C92F 4M75F 5EG2A 3CCUT 3BDLA 1BI3A 1Y7XA 4F7UG 3X25B 4XTXA 4NL2A 1I4K1 3OYNA 3JCMd 3X20B 4L5GA 1YJ9T 4QVDA 1LOJA 1Y96B 1XNIA 2O4XB 2V8IA 1RL2A 5CKHA 5GAOq 1VQKA 1VQNT 1YI2T 4M78C 3NTIA 3META 4A4HA 2LX9A 4J7FA 5GMKi 3I56T 4ZGEB 4JDSA 1KQSA 4J8OA 4ME7A 2LRQA 4E7IA 3P8BB 1YITA 2P0PA 1KQ2A 5CAIA 2XDBA 3CC4T 1AHJB 2HBPA 5CVIA 3HRUA 5IAYA 1G3TA 3A8HB 3KBGA 1JRIA 3DKMA 1KHIA 4ELZC 3CXCA 2XDPA 5DLQE 2DD4A 3MEWA 5GAMd 2BUDA 2E41A 2V8KA 5IT9E 4EPCA 5A0LA 4OF1A 4RCCA 4UC4A 3UWNA 1V29B 4KUIA 3V7CA 2QQSA 4KT0E 2EQKA 3JB9D 4O5VA 4LDVA 5GANj 3OYFA 1M5Q1 2K5FA 4C92D 3HP9A 3CCQA 2L8DA 1BKBA 2LQKA 3L2WA 3CMET 2XDDA 4X9DA 3VJPA 5L8RE 1B34B 5FU6B 3VKIA 1X75C 4C5EA 3C94A 2WSEE 3FEOA 3Q1JA 3LWHA 1Q7YU 1K73U 3SWNA 5LL6S 2DKGA 3LH0A 5CR2A 1VIFA 3KUFA 4KULA 5KE3A 2K4YA 3MEVA 4LD6A 2I2LA 4M7DD 3CCSA 1VQOT 4JLGA 3LGLA 3QYHB 2RK2A 3RMSA 2CGHA 5M9OA 4ZN1A 4BI3A 3A8MB 4QQDA 5GANg 3JAME 3CCVT 4PJOA 1QW1A 5A0DA 4IUVA 1YHQT 3GNFB 1UGRB 1QVPA 3J7AF 3JCMJ 5KCOA 1MGQA 4C8QE 4F7UE 2HD0A 3OYKA 3PFSA 3DB4A 4R55A 2VUBA 3CPWA 3MP8A 3I55T 1W4SA 1UEBA 3M58A 3PTAA 3H6ZA 3JCMV 2VXEA 5CKBA 2LVMA 3EFRA 4X34A 3X26B 1U1TA 3ASKA 2VGNA 2HQEA 1K73C 1LJOA 4WF2A 3VV0A 3O8VA 5HK3A 1YIJT 1Q7YC 5CCAA 5GAN2 4M78A 1UGQB 3VYGA 1VQ4T 4N4IA 2HAXA 5CKFA 4L6V5 3OYGA 3X24B 2OTLT 2GFUA 3QKJA 4M75C 4C92C 2E65A 4E7JA 1FX7A 2ZPBB 5GAOm 2XHCA 4RG2A 2FL7A 2CZ1B 3NFCA 2E10A 4M7AF 2E1HA 2FB7A 4X9CA 3QJYA 5LJ3h 2XK0A 5CKEA 1WQWA 5LJ3e 4ELYC 1YJNA 1G3WA 3G71A 4VUBA 3LGFA 3CXCS 4BE0A 3JCMW 1OI1A 2K5LA 5GANe 5GANh 2BKDN 2PUOB 3WVEB 4F7UB 4J6XA 4RMOA 2KDSA 4KBMB 2ZPHB 3WXMB 4A4GA 2QA4A 4BE2A 4A4FA 2RD1A 1O75A 4Y28E 2OAUA 3CCJT 1JJ2A 4HKEA 4QVZA 3A8LB 3S6WA 4C8QF 3GOXA 4JUVA 1D3BA 2PU9B 1ZBXA 4PJOG 3M59A 3KXTA 2CS7A 2EAYA 4C5HA 3CCUA 4XU3A 4PLLA 2A3LA 5KE2A 2DXBA 5I2MA 2X4WA 4N0AC 5C6SA 4BD3A 1YJ9A 4OGEA 1HK9A 2DJZA 5CO7A 1XOVA 3L42A 2C06A 1BI0A 3E9GA 1VQNA 2L5QA 5GANd 1YJWT 4XU2A 2DD5A 2F5TX 3ZBDA 3OYYA 3WVDB 1VUBA 2X4JA 5GAN6 1Y07A 2MF2A 3A8OB 3V7RA 1IREB 3V7SA 4EMKC 3I56A 2EJGA 2RH2A 1VQ9T 1BIAA 4O6JA 4C0GA 3QBYA 4M78G 2EFIA 2EWNA 4MZPA 2QQRA 1NZ9A 3CC4A 4MMKA 3JCMX 2D6FA 4N4GA 5HK0A 4V2SA 5D6YA 4C0ZA 2CYZB 5CKDA 3JB9F 2R58A 2X4XA 3FJPA 2RJDA 3VU3C 1S72T 2IVWA 3PIPA 1O9SA 1Q86C 1LNXA 3OYLA 2LCCA 5I2SA 3URGA 4C8QD 5CIUA 2WACA 1H641 2RHIA 4M75A 2DZCA 4C92A 2DK3A 4PL6A 4MDXA 4EMGA 1RI0A 4LDYA 3MHXA 3NTHA 5LJ5f 3V8JA 5DM7R 3QUIA 3PIOA 1KC8U 3MO8A 4M7DF 4GLKA 3JB9I 3L1AA 3CMEA 4M7DB 5CK9A 3CMAA 4JS5A 3CC7A 4M77G 5FU7B 2E5QA 2LQ8A 2Y4YA 2QEXT 3HHTB 1VIEA 3OMGA 4L59A 3CC2T 1KG1A 1M1KU 3OS1A 3QDRB 3JCMf 3PNWC 4J6WA 5J39A 3CCET 2DTIA 3UT1A 1M8VA 1VQOA 4MZMA 4TVRA 4DOVA 4PJOE 4MDWA 4OGCA 3JCMQ 1U8RA 4J7IA 2WSCE 2Y90A 3HRTA 4LDUA 3CCVA 4LD9K 4M7AC 3DLMA 1YHQA 5LJ3j 1JJ2S 2DIQA 1WPYA 5GAN8 1Y71A 3H8ZA 5DY9A 3V8KA 1N9RA 4IUPA 3DLLA 3L2VA 4M77C 3OYBA 3I55A 4Z02A 5GAN4 4OB0B 1JB0E 4R56A 4N0AA 2KY9A 3OA6A 4JS4A 2ZCFB 1MHNA 4A54A 1VQ7T 1N9SA 5D6WA 1Q82U 2PVDB 4C8QC 5GAMf 1YIJA 3P8HA 2XKOC 4II1A 4M78E 3G4ST 4C0DB 4QW2A 1VQ4A 4JLIA 1M1KC 1VQ5T 5GAOl 5LJ3g 2QQAA 3HRSA 2DXTA 4EMKA 4OB2B 3QJ6A 4XU1A 2P4TA 5A2QE 2OTLA 3SWNB 4JRIA 1WJRA 4MMLA 3FLGA 2GCXA 4A4KA 3M4GA 2VV5A 3OY9A 2JVVA 3EFSA 2MMPA 4M75G 2KQWA 2RJFA 2ZPFB 4PLIA 4BY6B 4C92G 1M1FA 5GAN5 1VQ8A 1TH7A 2VGMA 4HCZA 2E64A 4XK8E 4C5IA 2DO3A 2RI5A 4PJOB 1NPRA 2LCLA 5GAOn 2M16A 2DTHA 4QQGA 3L2UA 3M53A 2K2VA 3CBPA 2RA2A 4A4EA 2LTOA 3S3NA 4HT9A 3BDUA 4ATOA 1WGSA 2LDMA 4E7HA 3N5BB 2D0QB 2JTMA 1Q82C 3TCJA 4XU0A 3OS2A 2XD0A 5DLOA 2EJ9A 2LNVA 4FL6A 3CCJA 1M90U 5GAN7 3VUZA 1VQMT 2NLUA 2RK1A 1N8RU 3L2RA 2AHJB 2MAMA 3QPHA 4XTUA 4IKFA 1FXXA 4Y91A 3CPFA 1QVFS 3CCRT 2QQ9A 5CQYA 2EQUA 1BYMA 2LT1A 3LYIA 4M78B 4OB1B 4BI8B 5KH6A 4ZGDB 3OW2A 2JN0A 2DTOA 2L89A 3CCQT 2JOYA 2JUFA 1FWZA 1VQ6T 4XTZA 2K57A 2PVOB 4N4HA 1I81A 2M9UA 4YTLA 3JSCA 1W2BA 4M7DC 1ZQ1A 3RKWA 1YJWA 4M7AA 2HQXA 3VYHB 3RERA 3QIIA 5FRNA 3F70A 1VQ9A 3OBYA 1BIBA 4NL3A 3CCST 4PKCC 2L3RA 3M55A 4E7LA 1M90C 3E1SA 4M77A 4F7UF 3GLXA 1QP2A 4PNOA 2XU8A 4EDUA 3M4YA 4QVCA 2PVGB 4J6YA 1N8RC 4QQ6A 4FM4B 2QQBA 1G3YA 3C12A 4A53A 2DPPB 2EIFA 3HFOA 4LDWA 4M77B 3CCMT 4C8QA 4JRQA 3P8DA 3RMQA 1S72A 1VQPT 4JRKA 1D3BB 1UGSB 3QZ9B 2GF7A 5LJ3d 1K9MU 4EMHA 4M75E 4M7DA 4RG8A 1PSEA 2KSSA 2XI9A 2YRVA 2QXFA 1YI2A 1UB4A 3SDZA 3QXEB 1WQ7A 3JCMc 4C0FA 2EJFA 2EQMA 4OVAA 5LJ5h 1X01A 1OYXA 2VC8A 3BW1A 4ZN3A 2YLCA 4M78D 5FU6C 3OYEA 3HPWA 1JBMA 2FVUA 4DQ2A 2CZ6B 2QEXA 2DEQA 3CC2A 2F69A 3JB9H 2XICA 2K3XA 2RJCA 3OQ5A 5GANf 3SB2A 5HKCA 1VQLT 2GQVA 2WSFE 2RHYA 3JCMh 1KHCA 2E70A 3FB9A 3M5AA 3X28B 3L2QA 4XTWA 2EKOA 3FRNA 4FIBA 4IUQA 4ZTJA 2DVEA 4M7AG 3CBOA 2M1HA 3CD6T 3UDCA 4FT4A 3LWIA 4OB3B 3HKSA 3GF5A 3G6ET 1QVFA 5GAN3 1SSFA 4C92B 4M75B 2OTJT 3OW2S 5GMKm 2K3YA 2G3RA 3V8LA 1VQ7A 2YLBA 1R8OB 1OZ2A 3RIRA 1YBYA 2MWPA 3EAEA 2R5AA 1Y96A 2R57A 2O4XA 3G4SA 2RI3A 4RKUE 4OP0A 3J80E 1W2BS 1M9SA 1VQ5A 5GAMe 5GAMh 2DIGA 2LC4A 4C8QG 1WJSA 5GMKj 4E7KA 1EIFA 1KD1U 4B9WA 5FLXE 3OYDA 3OSSC 4P5NA 2P0QA 2KK4A 3QO3A 5C0MA 3PGGA 2RM4A 5GAOp 1NE8A 3CCLT 4BDYA 1K8AU 3HFNA 3PMTA 4FU6A 3FDRA 2H3JA 5KCHA 2ZZDA 2VXFA 5FROA 4BACA 2VYTA 4BI4A 1KC8C 1NJIU 3AHUA 3QSUA 4PJOD 5GAOr 4C5GA 5I21A 1M1GA 2V8JA 3MP6A 2JZ2A 3OMCA 3CBMA 3LW5E 4BE1A 2QTXA 3M57A 1QVGS 4HCCA 1VQMA 4FSXA 3BY7A 1Q81U 5A0GA 4NS5A 4BB7A 1I5LA 3M9QA 3CCRA 2KVQG 1KD1C 3PMIA 3JB9G 1B34A 1U1SA 3QYGB 3RKYA 4EMKB 1KQ1A 2Y4XA 3E19A 2CKKA 3MEAA 4XTYA 4M75D 4CRIA 1NPPA 2P0KA 1K8AC 1VQ6A 2QI2A 3GNGA 4BDZA 1YITT 3CMAT 5AYFA 2PQWA 2QDYB 3PT9A 5HY6A 3CC7T 4M7AE 3NTKA 1NJIC 4KUDK 3ZEHA 4GY5A 4B9XA 4BUGA 3E9FA 2JNGA 3GP8A 5LJ5j 5J3BA 3R6OA 4PJOF 1G3SA 4M7DG 1YCYA 3M54A 1DJ7B 3ME9A 4Q5WA 2DAQA 2YHTA 4M77E 3OYMA 3MCAB 3QHSA 3ER0A 4DOWA 4CI0C 3HSBA 4IUTA 1Q81C 4RCBA 3M56A 3TEEA 4LDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VJP A;  3VKI A;  3FRN A;  3TEE A; 
#chains in the Genus database with same CATH topology
 4HA8 A;  4ZGJ B;  2JTF A;  3EGD A;  4NOY A;  1UHF A;  2KNB B;  2D9T A;  2JJ9 A;  5KYY B;  3J81 E;  1BI1 A;  2NUZ A;  4DBF A;  2VVK A;  2JM8 A;  1D1A A;  1P92 A;  3HL8 A;  2DEU A;  3CME Q;  3PE0 A;  4OMO A;  2A7Y A;  4M7A B;  4DA4 A;  2OI3 A;  1RAE B;  1TG0 A;  4F7U A;  2E5K A;  4MZT A;  4AT1 B;  4C92 E;  2R5M A;  2ENM A;  2DLP A;  4C8Q B;  1R77 A;  1IZ6 A;  1FMV A;  2DMO A;  3G6E A;  2FHD A;  3OSV A;  2OTJ A;  1Q82 R;  2EBP A;  4OMN A;  1ZHI A;  1XQH A;  3A8G B;  3L2Z A;  2K79 A;  3EGX B;  4HT8 A;  2OJ2 A;  1BI2 A;  5CQX A;  2E12 A;  2E6Z A;  1VQK T;  2JS0 A;  2A36 A;  3MEU A;  2CUB A;  1K9M C;  2AK5 A;  1GXI E;  4D6W A;  3QZ5 B;  2HNI A;  4CC7 A;  2QA4 T;  4HCB A;  1GCQ A;  2ZPG B;  3LX7 A;  3TRE A;  5LJ5 d;  5D7U A;  2BZ8 A;  1H3Z A;  1OOT A;  4C92 F;  4Z8A A;  1N8R R;  2DYB A;  3X25 B;  1YJ9 T;  3OYN A;  3JCM d;  3X20 B;  1LOJ A;  2O4X B;  1YWO A;  1RL2 A;  3NTI A;  2DIL A;  5GMK i;  2AZS A;  2K6D A;  4ZGE B;  2LRQ A;  3I5R A;  5CVI A;  3HRU A;  3DKM A;  5FWC A;  5GJW B;  1W1F A;  3G1J A;  2YUQ A;  2E41 A;  4EPC A;  1SSH A;  1UEC A;  2EQK A;  2J6K A;  4O5V A;  4PJJ A;  5GAN j;  6AT1 B;  1M5Q 1;  3OYF A;  3CCQ A;  2FPF A;  1BKB A;  3L2W A;  2XDD A;  4X9D A;  3LWH A;  5FWB A;  1Q7Y U;  2ESW A;  2QG9 B;  1ZX6 A;  3KUF A;  1HYO A;  2CP2 A;  2F1L A;  4M7D D;  3CCS A;  5M9O A;  3RMS A;  1CKA A;  3JAM E;  4BI3 A;  2KRO A;  1QW1 A;  1RAI B;  3GNF B;  5KYX B;  2COY A;  1K0X A;  4C8Q E;  2HD0 A;  3OYK A;  4R55 A;  3CPW A;  3M0Q A;  3MP8 A;  4HCK A;  3M58 A;  1IB8 A;  5KYW A;  2CP3 A;  2W0Z A;  3X26 B;  2VGN A;  1YIJ T;  4WF2 A;  1Q7Y C;  1AEY A;  3VYG A;  2HAX A;  5CKF A;  3H9N A;  4L6V 5;  3OYG A;  2OTL T;  1MMD A;  2GFU A;  4C92 C;  4EIK A;  3CXC P;  2DER A;  4M4Z A;  3NFC A;  2ROL A;  4M7A F;  2HL3 A;  2FB7 A;  4ELY C;  1C6V X;  3LGF A;  1C0M A;  3JCM W;  1OI1 A;  1Z9Q A;  2K5L A;  5GAN h;  1K8A R;  2PUO B;  3WVE B;  1W6X A;  2ZPH B;  3WXM B;  3UA7 A;  2ZAE A;  4HKE A;  4C8Q F;  3S6W A;  3GOX A;  2PTK A;  2EGA A;  2OAW A;  4XU3 A;  1X2K A;  2MK5 A;  1ARK A;  5C6S A;  4BD3 A;  1HK9 A;  2DJZ A;  2C06 A;  1SRM A;  1WYX A;  2RQR A;  3E9G A;  2LCS A;  1VUB A;  1X6B A;  1Y07 A;  3I56 A;  1BIA A;  3QBY A;  2RF0 A;  1NZ9 A;  2A28 A;  3CC4 A;  2D6F A;  2JS2 A;  5CKD A;  3JB9 F;  3IQL A;  3FJP A;  2RMO A;  4C92 A;  2F2W A;  2DK3 A;  2DRM A;  3REA B;  2YUP A;  1RI0 A;  3CCM Q;  1WXT A;  1KC8 U;  3V8J A;  1I5O B;  3QUI A;  1Y0M A;  3MO8 A;  2DBK A;  3L1A A;  3CME A;  1F1B B;  1YP5 A;  4JS5 A;  3CC7 A;  4M77 G;  2E5Q A;  1MV0 B;  2QEX T;  9ATC B;  3OS1 A;  3QDR B;  1M2V A;  4J6W A;  3CCE T;  1VQO A;  4MDW A;  3JCM Q;  1U8R A;  2A08 A;  3VS0 A;  3QWY A;  4M7A C;  3DLM A;  1YHQ A;  5LJ3 j;  1JJ2 S;  2DYI A;  5IH2 A;  3V8K A;  1N9R A;  3CQT A;  1TUC A;  4M77 C;  1YJN Q;  4OB0 B;  4R56 A;  2NUP A;  1TS9 A;  1N9S A;  1Q82 U;  2PVD B;  4C8Q C;  5GAM f;  2NYS A;  4C0D B;  1M27 C;  4JLI A;  2HQH A;  4XU1 A;  2G6F X;  4JRI A;  1WJR A;  4MML A;  3FLG A;  2GCX A;  4OMM A;  2VV5 A;  1ZBJ A;  3CCU Q;  2KQW A;  2RJF A;  1VQ8 A;  1TUG B;  2VGM A;  2E64 A;  4PJO B;  2EYW A;  1NPR A;  3I5S A;  4FYX B;  2LCL A;  2V1Q A;  2DTH A;  3L2U A;  1QVF P;  1WHG A;  1X2Q A;  2RA2 A;  3S3N A;  2LDM A;  2KR3 A;  1Q82 C;  3TCJ A;  3OS2 A;  3CCJ A;  4FYW B;  2BTT A;  1N8R U;  3L2R A;  2AHJ B;  1UDL A;  4Y91 A;  2BE7 D;  1HJD A;  1Q95 G;  5KYY A;  2LT1 A;  4M78 B;  4OB1 B;  1WXU A;  2JOY A;  2JUF A;  2K57 A;  4LNP A;  2M9U A;  2RQV A;  3JSC A;  2J7I A;  2P4R A;  1YJW A;  4M7A A;  1GFC A;  4CC2 A;  3M0R A;  3VYH B;  3QII A;  2KRN A;  5FRN A;  1ABO A;  1WLP B;  4M77 A;  3GLX A;  1QP2 A;  4QVC A;  1N8R C;  1H3H A;  4A53 A;  1PNJ A;  2EIF A;  3HFO A;  4LDW A;  4JRQ A;  4C8Q A;  3P8D A;  4JRK A;  1UGS B;  4EMH A;  2NUT B;  2XI9 A;  2JT4 A;  1W70 A;  1UB4 A;  1SPK A;  3QXE B;  4HVU A;  3I55 Q;  2NWM A;  3EGX A;  2EQM A;  3QDF A;  5LJ5 h;  1X01 A;  2VC8 A;  2EGC A;  2YLC A;  3OYE A;  2CZ6 B;  2F69 A;  2XIC A;  3EG9 B;  1VQ4 Q;  1K1Z A;  4AG2 C;  3JCM h;  3OW2 P;  3M5A A;  3L2Q A;  2RQW A;  4FIB A;  2A0F B;  4FT4 A;  3VS7 A;  3GF5 A;  4M75 B;  4GLM A;  3V8L A;  1OZ2 A;  2R57 A;  2O4X A;  4OP0 A;  1W2B S;  5GAM e;  4D8D A;  2EPD A;  4E7K A;  1IO6 A;  3QO3 A;  1HSQ A;  1K8A U;  4PJN A;  1PRM C;  4FU6 A;  1SRL A;  3VRZ A;  3MP6 A;  2QA4 Q;  4FW2 A;  1VQ9 Q;  2QTX A;  1QVG S;  1VQM A;  1GBQ A;  4FSX A;  2E4H A;  1I5L A;  2Z0W A;  1NM7 A;  3CCR A;  3PMI A;  2KXD A;  1U1S A;  1ZA2 B;  4EMK B;  5IHK A;  3E19 A;  1KSW A;  1NPP A;  1K8A C;  1VQ6 A;  3GNG A;  1MUZ A;  1YIT T;  3CMA T;  2PQW A;  2QDY B;  1UGV A;  3ZEH A;  4GY5 A;  3JV3 A;  4RTU A;  3GP8 A;  1Y57 A;  4PJO F;  3R6O A;  2LMJ A;  4M7D G;  4D8K A;  3ME9 A;  3VS6 A;  2DAQ A;  5KYX A;  2ED1 A;  3CCM A;  2D0N A;  2RHX A;  3ZFJ A;  5LJ5 g;  2EQJ A;  4M78 F;  2XG8 D;  5IN1 A;  2RO0 A;  4FT2 A;  3OB9 A;  5J26 A;  4XAX B;  1BCM A;  4ZTF A;  4QT7 A;  2AIR B;  2EKH A;  2RB6 A;  3JCM g;  2B8A A;  1TSF A;  2X35 A;  2GFA A;  1KQS S;  2CZ0 B;  2DBM A;  2BZX A;  2BIV A;  1X6O A;  1FYN A;  3S3O A;  1G5V A;  2W10 A;  1JXM A;  2DXU A;  3H41 A;  4RUG A;  3JB9 J;  2K3B A;  3RKX A;  5IXB A;  4IUR A;  3REB B;  4E47 A;  2DL7 A;  5LJ5 e;  1OZ3 A;  1N27 A;  4AFU C;  2AKL A;  3MPU B;  2M0O A;  4C0D C;  1UG1 A;  1QWE A;  1Q86 U;  1B07 A;  1YJN T;  3JCM e;  2QTV A;  3C4S A;  1IHW A;  3CPW P;  3OYI A;  1R0C B;  2F5K A;  2FG0 A;  1M4Z A;  1QKW A;  3EG2 A;  3QG1 A;  4M7A D;  4PJO C;  1ZLM A;  2ZGW A;  2RHU A;  4PFZ A;  2LT4 A;  4XQ3 A;  3LLR A;  5IHI A;  4M77 D;  3JCM b;  2DXC A;  4M75 F;  3CCU T;  1Y7X A;  1KJW A;  4F7U G;  1I4K 1;  1OPK A;  4L5G A;  5CKH A;  1VQN T;  1IXD A;  3H0F A;  2CH4 A;  4M78 C;  1M8M A;  4A4H A;  1VQP Q;  4KH0 B;  3RDV A;  4F04 B;  4E7I A;  1QVG P;  3H0H A;  1KQ2 A;  5CAI A;  1I0C A;  1OQK A;  1PHT A;  2J6F A;  5IAY A;  2F2V A;  4ELZ C;  1NEG A;  2XDP A;  5DLQ E;  5GAM d;  1PRL C;  2V8K A;  1GBR A;  2EW3 A;  4IIM A;  3V7C A;  3JB9 D;  4OMQ A;  2O88 A;  3VJP A;  1B34 B;  2E3H A;  5FU6 B;  4C5E A;  2WSE E;  3Q1J A;  1BK2 A;  3LH0 A;  5CR2 A;  5KE3 A;  1RAA B;  3MEV A;  4CC3 A;  3H0I A;  2A37 A;  2C0I A;  1M3B A;  3A8M B;  4QQD A;  4PJO A;  3M0U A;  4IUV A;  1QVP A;  3JCM J;  5KCO A;  1YFN A;  4AFS C;  1D0Y A;  3PFS A;  3CCE Q;  3I55 T;  2LNH B;  1M3A A;  2VXE A;  5CKB A;  1U1T A;  1KC8 R;  1KQS P;  2HQE A;  3CCL Q;  3M0T A;  1LJO A;  5HK3 A;  3O8V A;  5GAN 2;  4M78 A;  3MJX A;  1VQ4 T;  3I9Q A;  3X24 B;  4JJD A;  3QKJ A;  4M75 C;  5I22 A;  1WIE A;  5GAO m;  2HZY A;  2VAS A;  2XHC A;  4RG2 A;  2CZ1 B;  2L2P A;  2E10 A;  3NHN A;  2E1H A;  1VQK A;  2QDL A;  1WQW A;  1K0S A;  3CXC S;  4BE0 A;  2GQI A;  1N5Z A;  4RMO A;  2KDS A;  1NJI R;  2QA4 A;  1O75 A;  1JJ2 A;  2OAU A;  3A8L B;  3GBQ A;  2PU9 B;  2EQI A;  3M59 A;  2NUT A;  2YRC A;  5KE2 A;  1SHF A;  5I2M A;  2X4W A;  1PKS A;  1YJ9 A;  1BI0 A;  2CP5 A;  3ZBD A;  4EMK C;  2QYZ A;  4E2F B;  1VQ9 T;  3EG9 A;  4OMP A;  2DX1 A;  2QQR A;  3JCM X;  4N4G A;  5HK0 A;  1H92 A;  1UFF A;  2HEQ A;  4Z88 A;  2QK0 A;  1PD0 A;  2X4X A;  2CRE A;  2DL3 A;  2LJ0 A;  2LQN A;  2RJD A;  1S72 T;  3PIP A;  1O9S A;  2LCC A;  1QLY A;  1SHG A;  2RHI A;  1MV3 A;  4M75 A;  4PL6 A;  4JJC A;  4LDY A;  3MHX A;  5DM7 R;  2BZY A;  3PIO A;  4FYV B;  3JB9 I;  1JEG A;  3UF4 A;  1KIK A;  2LQ8 A;  2Y4Y A;  2HL5 C;  5J39 A;  3AT1 B;  2DTI A;  1M8V A;  4J7I A;  2Y90 A;  3MKD A;  5DY9 A;  2X3W D;  1WHH A;  2X3X D;  3G71 Q;  3A98 A;  3OA6 A;  1D0Z A;  1MHN A;  5D6W A;  1WXB A;  1YIJ A;  4DBH A;  1BCO A;  1YN8 A;  1T0H A;  2QQA A;  4EMK A;  4HVW A;  4OB2 B;  2OTL A;  2O9V A;  2FZC B;  4F17 A;  1E6H A;  3PVL A;  2JVV A;  3EFS A;  4A63 B;  4BY6 B;  2ZPF B;  2K9G A;  4C92 G;  4PLI A;  8ATC B;  1TH7 A;  2DL4 A;  1WI7 A;  4AFZ C;  1QMC A;  2DO3 A;  2CUD A;  2I0N A;  3M53 A;  2J6O A;  3CBP A;  4A4E A;  4HT9 A;  1WGS A;  1R0B G;  2JTM A;  4QKU A;  4XU0 A;  1T3L A;  2E3I A;  1FXX A;  3CPF A;  1QVF S;  2CSI A;  2QQ9 A;  1BYM A;  4ZGD B;  3CCQ T;  2PVO B;  3NMZ C;  3ZL7 C;  1I81 A;  1W2B A;  3ULR B;  2OX7 A;  3EH1 A;  2KE9 A;  1B7T A;  4KGX B;  3CCS T;  2CT3 A;  1YIT Q;  3CMA Q;  1PD1 A;  1AWO A;  4PJO D;  1VQP T;  1X69 A;  1D3B B;  3QZ9 B;  2GF7 A;  2KYM A;  5FW9 A;  3CCV Q;  2DET A;  2QXF A;  1YI2 A;  1WQ7 A;  3NGP A;  1C1A A;  1UJY A;  1PG5 B;  1H8K A;  4OVA A;  1PCX A;  3M0S A;  3BW1 A;  4M78 D;  5FU6 C;  1OX9 A;  3HPW A;  4DQ2 A;  2QEX A;  2XMF A;  5IXF A;  8AT1 B;  2K3X A;  3EG1 A;  4FW1 A;  5GAN f;  1VQL T;  5HKC A;  2GQV A;  2WSF E;  2RHY A;  4AG1 C;  2JW4 A;  3FRN A;  4AFQ C;  2DVE A;  4M7A G;  3CBO A;  3CD6 T;  4FSS A;  3UDC A;  4OB3 B;  3HKS A;  3OW2 S;  2K3Y A;  3QWX X;  4PFP A;  1M9S A;  5GAM h;  4C8Q G;  1WJS A;  2J05 A;  3OYD A;  1X6G A;  3CCL T;  2DJQ A;  4BAC A;  2EYZ A;  2O2O A;  2YXY A;  1KC8 C;  1NJI U;  3QSU A;  4BI4 A;  5GAO r;  4J9F A;  4J9B A;  3LW5 E;  4BE1 A;  4HCC A;  4DEY A;  3M9Q A;  3SHW A;  3JB9 G;  3VS3 A;  1B34 A;  4J9H A;  3QYG B;  1Q86 R;  3RKY A;  4M75 D;  2QI2 A;  3CC7 T;  3NTK A;  1NJI C;  1VQN Q;  5LJ5 j;  5J3B A;  1G3S A;  2DM1 A;  3M54 A;  4Q5W A;  3OYM A;  2KBT A;  3MCA B;  4DOW A;  1WDX A;  3HSB A;  4J9E A;  1JU5 C;  4RCB A;  3M56 A;  2PNI A;  4LDX A;  1AWW A;  5GMK e;  3BFM A;  1M3C A;  1D0X A;  2K5I A;  1AVZ C;  2D8H A;  2ZPI B;  1ZUU A;  3EH2 A;  2LZ6 B;  3LH5 A;  1TU0 B;  1HXD A;  3SFM A;  1WNL A;  2FYK A;  3S3M A;  2DVJ A;  1U5S A;  2V1R A;  3JRZ A;  2VWF A;  1I1J A;  3MP1 A;  1IGU A;  4J5Y A;  1VQ7 Q;  3O5Z A;  3G4S Q;  1VQ8 T;  1RI9 A;  1VQ5 Q;  5KYN A;  5FRM A;  2IG0 A;  2EYQ A;  2CP6 A;  2ZPE B;  4ANJ A;  1N6A A;  2P84 A;  3TU4 K;  2C0T A;  1PC0 A;  5GMK l;  5GAM g;  4IUU A;  5D6X A;  4M7D E;  2COZ A;  4Z89 A;  3C95 A;  3OYC A;  3OBW A;  5LJ3 f;  2PZ1 A;  1KFZ A;  2KMT A;  3G71 T;  1BB9 A;  3INZ A;  2RHZ A;  2QGF B;  4J83 A;  4BY6 C;  1UGP B;  5AT1 B;  4XTV A;  3E2U A;  3CEY A;  2CP0 A;  4FYY B;  4FCY A;  3DB3 A;  4J9I A;  4LUE A;  2KAF A;  3CPW S;  4ESR A;  1FMK A;  1I8F A;  5EG2 A;  3BDL A;  1BI3 A;  1M2O A;  2QAZ A;  4XTX A;  1Y96 B;  2V8I A;  4E6R A;  2DFU A;  4J7F A;  1D09 B;  1RAH B;  4JDS A;  3P8B B;  1YIT A;  2P0P A;  1AHJ B;  2GNC A;  1G3T A;  3KBG A;  1J3T A;  1JRI A;  2LQW A;  3CXC A;  2EYY A;  2DD4 A;  3MEW A;  2LJ1 A;  5IT9 E;  1RUW A;  4OF1 A;  4RCC A;  1XJW B;  3RR6 A;  4LXC A;  5A0L A;  2HSP A;  4KT0 E;  1K9M R;  1T3S A;  4LDV A;  1S72 Q;  2K5F A;  4C92 D;  3HP9 A;  5IHN A;  4WTO B;  1IGQ A;  2L0A A;  1NLO C;  3R6N A;  3C94 A;  3FEO A;  5LL6 S;  2DKG A;  2M02 A;  4K11 A;  2K4Y A;  1WFW A;  2KT1 A;  1EZZ B;  2RK2 A;  2CGH A;  4J9D A;  4ZN1 A;  4RTZ A;  3CCV T;  5A0D A;  3J7A F;  2ATC B;  4F7U E;  4RTY A;  2H8H A;  1WHL A;  1UEB A;  2EYX A;  3PTA A;  3H6Z A;  3JCM V;  2DL8 A;  1SF9 A;  3SEM A;  3EFR A;  3ASK A;  5KYW B;  4GBQ A;  4N4I A;  1I07 A;  4KGV B;  4ORZ A;  2E65 A;  4E7J A;  2ZPB B;  2QAS A;  4F14 A;  1KD1 R;  4X9C A;  5LJ3 e;  2XK0 A;  5CKE A;  1YJN A;  1G3W A;  1TXQ A;  1AWX A;  1V76 A;  2BKD N;  3NPF A;  4KBM B;  4A4G A;  2X9H A;  1MNE A;  1ZUK A;  1AD5 A;  1E6G A;  4JUV A;  1D3B A;  4LE9 A;  4DEX A;  4PJO G;  1ZSZ B;  2CS7 A;  4C5H A;  3CCU A;  4PLL A;  4PJM A;  4PFO A;  4Y92 A;  1B3Q A;  1XOV A;  3L42 A;  1VQN A;  5GAN d;  1VA7 A;  3VS2 A;  4XU2 A;  2DD5 A;  3A8O B;  2MF2 A;  3V7R A;  1IRE B;  3CCQ Q;  2EJG A;  4C0G A;  4M78 G;  4MMK A;  1ZA1 B;  5D6Y A;  4C0Z A;  2CYZ B;  2X51 A;  2R58 A;  3EGU A;  3CCS Q;  2IVW A;  4X1V A;  1Q86 C;  2YRD A;  3OYL A;  4C8Q D;  2DZC A;  3NTH A;  4GLK A;  2FEI A;  5FU7 B;  3I35 A;  3HHT B;  3CC2 T;  1KG1 A;  2J06 A;  3UT1 A;  4TVR A;  1LVK A;  2WSC E;  3HRT A;  4LD9 K;  2DIQ A;  1WPY A;  4LN2 A;  2KT8 A;  4PK4 A;  4IUP A;  3DLL A;  1D1B A;  3I55 A;  1VQL Q;  1JB0 E;  4JS4 A;  2ZCF B;  4A54 A;  1VQ7 T;  4WCI A;  2XKO C;  4II1 A;  1OU8 A;  3G4S T;  3CD6 Q;  1VQ4 A;  1VQ5 T;  2FZK B;  2B86 A;  2DXT A;  3QJ6 A;  3SWN B;  4A4K A;  3M4G A;  3OY9 A;  4M75 G;  2YSQ A;  5GAN 5;  1VYT A;  1M1F A;  4HCZ A;  4C5I A;  2RI5 A;  4QQG A;  3M0P A;  1CSK A;  1ZSG A;  1YWP A;  4E7H A;  2XD0 A;  3I56 Q;  5GJV B;  5DLO A;  3VUZ A;  4IIO A;  3CC4 Q;  2NLU A;  3QPH A;  2EQU A;  5KH6 A;  4BI8 B;  1RLP C;  3OW2 A;  1WA7 A;  2DTO A;  2L89 A;  2FRY A;  1NG2 A;  4YTL A;  1RAC B;  1ZQ1 A;  3RKW A;  2CT4 A;  2EVR A;  3RER A;  1MMG A;  1VQ9 A;  3OBY A;  4NL3 A;  1WZO A;  3M55 A;  4E7L A;  3E1S A;  3CC7 Q;  2XU8 A;  2PVG B;  2HBW A;  4QQ6 A;  1MMN A;  1WX6 A;  2QQB A;  1G3Y A;  4M77 B;  1S72 A;  1VQO Q;  5LJ3 d;  1K9M U;  1PSE A;  2M51 A;  1YHQ Q;  2KSS A;  3FJ5 A;  4ZNX A;  3JCM c;  1NBE B;  2EJF A;  1K73 R;  2EGE A;  1LPL A;  1JXO A;  1U06 A;  3RNJ A;  4ZN3 A;  1FMW A;  2FVU A;  2DEQ A;  2JTE A;  1QCF A;  2RQT A;  3TQ7 P;  1CKB A;  3OQ5 A;  3SB2 A;  2E70 A;  3BE3 A;  2EKO A;  1VQ8 Q;  1ZUY A;  4ZTJ A;  2CSQ A;  3G6E T;  5GAN 3;  1SSF A;  1OUL A;  2OTJ T;  1R8O B;  2MWP A;  3EAE A;  2R5A A;  1Y96 A;  1VYV A;  2ROT A;  3CCJ Q;  2DIG A;  2LC4 A;  5GMK j;  1WHK A;  3EG3 A;  1KD1 U;  2AZV A;  4B9W A;  4P5N A;  2KK4 A;  2HKQ B;  2LP5 A;  2RM4 A;  3PGG A;  5GAO p;  1NE8 A;  4BDY A;  1ACM B;  3HFN A;  1MMA A;  5KCH A;  2SEM A;  3TSZ A;  1QQJ A;  2RN8 A;  1YJW Q;  5I21 A;  1M1G A;  1BBZ A;  1TTH B;  3OMC A;  3CBM A;  3EFO B;  5ECA A;  4NS5 A;  4BB7 A;  2KVQ G;  1KD1 C;  1SKU B;  1K76 A;  1AT1 B;  1QCN A;  1ZSZ C;  4F16 A;  3EHQ A;  4CRI A;  2P0K A;  3A1P A;  2DE0 X;  3PT9 A;  5HY6 A;  1RAB B;  4M7A E;  1NLP C;  4KUD K;  4B9X A;  2KGT A;  4M77 E;  2ED0 A;  1U3O A;  4AMC A;  4IUT A;  3TEE A;  2QGG A;  1AZG B;  2RI2 A;  5GMK h;  3GIB A;  2FPE A;  3RUX A;  2DZ9 A;  1VQP A;  5KYU B;  1EX4 A;  1A0N B;  4RTW A;  3OYJ A;  2MIO A;  2COW A;  2O01 E;  3G7Z A;  2ECZ A;  2CZ7 B;  2LX7 A;  2MWO A;  1M1K R;  5GAM j;  3T9N A;  5FU7 C;  3UPU A;  3VS4 A;  4JZ3 A;  4JZ4 A;  1JO8 A;  4OMF B;  4JRP A;  1VQL A;  2F2X A;  2X4Y A;  2HMA A;  4JJN K;  2PUK B;  4RTX A;  3D7S B;  4M77 F;  3RES A;  1S1N A;  1EFN A;  1QVG A;  2MI6 A;  3OYH A;  2HKN A;  3CD6 A;  1QP3 A;  3OS5 A;  1ZSZ A;  2GBQ A;  3FIF A;  3FC3 A;  3GPL A;  2XID A;  3VUB A;  1PSF A;  1PWT A;  3SD4 A;  1NYG A;  2RPN A;  2DL5 A;  3CCE A;  1VQM Q;  1BU1 A;  3HTR A;  1UE9 A;  3SWN C;  1XTD A;  2E6N A;  4B6M A;  3CCR Q;  1WJQ A;  3CCL A;  3OYA A;  1OU9 A;  1VOM A;  5L23 A;  1VQ6 Q;  2RJE A;  2O9S A;  2L3S A;  3OS0 A;  2GGR A;  3A5Z B;  1AWJ A;  1M90 R;  3JCM P;  4KGZ B;  4NL2 A;  4M7D B;  2YUO A;  4QVD A;  1XNI A;  2KRM A;  5GAO q;  3VRY A;  1YI2 T;  2K7A A;  3MET A;  2LX9 A;  3I56 T;  1KQS A;  4J8O A;  4ME7 A;  1NYF A;  2XDB A;  3CC4 T;  2C0O A;  2HBP A;  3A8H B;  1KHI A;  2CH4 W;  1OEB A;  2AT1 B;  2BUD A;  2DF6 A;  4UC4 A;  3UWN A;  1V29 B;  1GRI A;  4KUI A;  1G83 A;  1UHC A;  2QQS A;  1K9A A;  2D8J A;  2L8D A;  2LQK A;  3CME T;  1E7O A;  5L8R E;  1WHM A;  1X75 C;  3VKI A;  1K73 U;  3SWN A;  3EHR A;  1VIF A;  1AOJ A;  4KUL A;  1PKT A;  4LD6 A;  2I2L A;  2BE9 B;  1VQO T;  4JLG A;  3LGL A;  3QYH B;  4HVV A;  5GAN g;  1YHQ T;  3CC2 Q;  1UGR B;  1MGQ A;  3DB4 A;  2VUB A;  1W4S A;  1QCO A;  2LVM A;  7AT1 B;  4X34 A;  5I11 A;  1K73 C;  3VV0 A;  1GL5 A;  3EGD B;  1VYU A;  2FO0 A;  5CCA A;  1UGQ B;  2SRC A;  1FX7 A;  1ABQ A;  1G8X A;  2FL7 A;  4RTV A;  3VS1 A;  3QJY A;  5LJ3 h;  2GTJ A;  3G71 A;  4VUB A;  2L3Q A;  5GAN e;  4DBR A;  2H3E B;  4F7U B;  4J6X A;  1K4U S;  2JXB A;  4BE2 A;  2D1X A;  4A4F A;  2RD1 A;  4Y28 E;  3CCJ T;  1OV3 A;  1GFD A;  2DNU A;  2LJ3 A;  4QVZ A;  2JMC A;  4E7S A;  2KEA A;  1ZBX A;  3KXT A;  2EAY A;  2YWW A;  1Q81 R;  1LCK A;  2CP7 A;  2A3L A;  2DXB A;  1YCS B;  4N0A C;  2MPX C;  1QKX A;  4OGE A;  2YT6 A;  5CO7 A;  2L5Q A;  1YJW T;  2F5T X;  2FPD A;  3OYY A;  3WVD B;  1QWF A;  4KRT A;  2X4J A;  5GAN 6;  3V7S A;  2RH2 A;  4O6J A;  2EFI A;  1T0J A;  2EWN A;  4MZP A;  4R0K A;  2KI7 A;  1X43 A;  4V2S A;  2IPO B;  3TVT A;  3VU3 C;  2FRW A;  1JQQ A;  1LNX A;  5I2S A;  3URG A;  1RAF B;  5CIU A;  2WAC A;  1H64 1;  2VB6 A;  4MDX A;  4J9C A;  4EMG A;  5LJ5 f;  4M7D F;  3TSW A;  1UJ0 A;  1X27 A;  5CK9 A;  3CMA A;  2CDT A;  1JJ2 P;  1TUD A;  1VIE A;  3OMG A;  4L59 A;  1M1K U;  3JCM f;  2HSE B;  3PNW C;  2ABL A;  4JPB W;  1HD3 A;  4MZM A;  2M0Y A;  4DOV A;  4PJO E;  4OGC A;  4LDU A;  2RNA A;  3CCV A;  3KFV A;  1YNZ A;  2O31 A;  5GAN 8;  1Y71 A;  3H8Z A;  2KYB A;  1IHV A;  1M30 A;  1G2B A;  2YUN A;  2HDA A;  3OYB A;  3L2V A;  1VQK Q;  4Z02 A;  5GAN 4;  3EFO A;  4N0A A;  2KY9 A;  2MYS A;  1IRX A;  1OPL A;  1UTI A;  3P8H A;  4M78 E;  4QW2 A;  1M1K C;  3G6E Q;  5GAO l;  5LJ3 g;  3HRS A;  2OTJ Q;  5A2Q E;  2P4T A;  2V26 A;  2K2M A;  2MMP A;  2KRS A;  1NEB A;  4XK8 E;  2MCN A;  4KH1 B;  1YJ9 Q;  5GAO n;  2M16 A;  1OX8 A;  3UA6 A;  2K2V A;  2LTO A;  3BDU A;  4ATO A;  3N5B B;  1TWB A;  2D0Q B;  4CC4 B;  3PVQ A;  1AZE A;  2EJ9 A;  2LNV A;  4FL6 A;  1M90 U;  3U23 A;  5GAN 7;  1UUE A;  1VQM T;  1WHJ A;  1RAD B;  1MND A;  2MOX A;  2RK1 A;  2MAM A;  4XTU A;  5KYU A;  3VS5 A;  4IKF A;  3UAT A;  3CCR T;  5CQY A;  3LYI A;  2JN0 A;  4DBQ A;  1FWZ A;  1VQ6 T;  4XTZ A;  4N4H A;  2GTO A;  5EC7 A;  4M7D C;  2HCK A;  2HQX A;  1SEM A;  3F70 A;  1BIB A;  4PKC C;  2L3R A;  1M90 C;  4F7U F;  4PNO A;  4EDU A;  3M4Y A;  4J6Y A;  4FM4 B;  3C12 A;  2DPP B;  3CCM T;  3RMQ A;  4M75 E;  4RG8 A;  2YRV A;  4C0F A;  3SDZ A;  4LUD A;  1Q7Y R;  2IIM A;  2AKK A;  2KXC A;  3C0C A;  1OYX A;  1JBM A;  3JB9 H;  1YIJ Q;  3CC2 A;  1Z9Z A;  2RJC A;  2OTL Q;  3THK A;  1KHC A;  3FB9 A;  3X28 B;  2JM9 A;  4XTW A;  3EG0 A;  4IUQ A;  4JJB A;  4J9G A;  2M1H A;  1W2B P;  1GCP A;  3LWI A;  2L3P A;  1QVF A;  2JMA A;  4C92 B;  1SG5 A;  1V1C A;  4HXJ A;  2FZG B;  5GMK m;  2G3R A;  1VQ7 A;  2YLB A;  4M7D A;  3RIR A;  1YBY A;  3G4S A;  2YDL A;  2RI3 A;  4RKU E;  3J80 E;  1VQ5 A;  1KK7 A;  4PJL A;  1EIF A;  5FLX E;  3OSS C;  2P0Q A;  1TOV A;  1M2V B;  2DA9 A;  4RTT A;  4E7Z A;  5C0M A;  2VKN A;  1RAG B;  3PMT A;  3FDR A;  2H3J A;  2DRK A;  2VXF A;  2ZZD A;  5FRO A;  2VYT A;  3AHU A;  4C5G A;  2V8J A;  2JZ2 A;  3M57 A;  2NUP B;  2RQU A;  3BY7 A;  1Q81 U;  5A0G A;  3RBB B;  4OML A;  1KQ1 A;  2Y4X A;  3MEA A;  2CKK A;  4XTY A;  5HCK A;  4BDZ A;  5AYF A;  4BUG A;  3E9F A;  2JNG A;  1YI2 Q;  1YCY A;  1D1C A;  1DJ7 B;  2YHT A;  3QHS A;  4CI0 C;  3ER0 A;  1PM3 A;  1RLQ C;  2QEX Q;  1Q81 C;  1GCQ C; 
#chains in the Genus database with same CATH homology
 2RI2 A;  5GMK h;  5GMK e;  3CCM A;  3GIB A;  3BFM A;  4HA8 A;  4ZGJ B;  3RUX A;  2DZ9 A;  1VQP A;  2K5I A;  2RHX A;  3ZFJ A;  2JTF A;  4NOY A;  5LJ5 g;  2D9T A;  2EQJ A;  4M78 F;  3J81 E;  2ZPI B;  2XG8 D;  1BI1 A;  5IN1 A;  2RO0 A;  4FT2 A;  3OYJ A;  3OB9 A;  5J26 A;  1HXD A;  4XAX B;  3SFM A;  1P92 A;  1WNL A;  2FYK A;  3S3M A;  3HL8 A;  4ZTF A;  2O01 E;  3G7Z A;  2CZ7 B;  2RB6 A;  3JRZ A;  3JCM g;  2MWO A;  2A7Y A;  2B8A A;  4M7A B;  4DA4 A;  3MP1 A;  4J5Y A;  5GAM j;  3T9N A;  2X35 A;  5FU7 C;  2GFA A;  1KQS S;  3UPU A;  2CZ0 B;  1VQ8 T;  2BIV A;  4OMF B;  4JRP A;  1X6O A;  4F7U A;  5FRM A;  3S3O A;  1VQL A;  1G5V A;  2IG0 A;  2X4Y A;  4MZT A;  4JJN K;  2PUK B;  4C92 E;  2EYQ A;  2R5M A;  4M77 F;  3RES A;  2DXU A;  4C8Q B;  1QVG A;  2ZPE B;  1N6A A;  1IZ6 A;  2MI6 A;  3TU4 K;  3JB9 J;  3OYH A;  3CD6 A;  1QP3 A;  3RKX A;  5GMK l;  5GAM g;  3OS5 A;  3FIF A;  3FC3 A;  3G6E A;  2FHD A;  3OSV A;  3GPL A;  2XID A;  2OTJ A;  3VUB A;  4IUR A;  1PSF A;  4IUU A;  4E47 A;  5LJ5 e;  5D6X A;  1OZ3 A;  1ZHI A;  4M7D E;  1XQH A;  3A8G B;  3L2Z A;  3SD4 A;  1N27 A;  3OYC A;  3C95 A;  3OBW A;  5LJ3 f;  4HT8 A;  1BI2 A;  5CQX A;  2E12 A;  4C0D C;  2M0O A;  2KMT A;  1Q86 U;  3CCE A;  2E6Z A;  1YJN T;  1VQK T;  3MEU A;  3JCM e;  3G71 T;  3C4S A;  3SWN C;  1XTD A;  2E6N A;  3INZ A;  1K9M C;  2RHZ A;  4J83 A;  2F5K A;  3OYI A;  1GXI E;  4D6W A;  3QZ5 B;  1WJQ A;  2HNI A;  4BY6 C;  3CCL A;  3OYA A;  1M4Z A;  1UGP B;  2QA4 T;  4HCB A;  2ZPG B;  3LX7 A;  4XTV A;  3QG1 A;  4M7A D;  3TRE A;  3CEY A;  2RJE A;  4PJO C;  2ZGW A;  5LJ5 d;  3DB3 A;  3OS0 A;  2KAF A;  2RHU A;  3CPW S;  2LT4 A;  3A5Z B;  4XQ3 A;  3LLR A;  1I8F A;  4M77 D;  3JCM b;  2DXC A;  3JCM P;  1H3Z A;  4C92 F;  4M75 F;  5EG2 A;  3CCU T;  3BDL A;  1BI3 A;  1Y7X A;  4F7U G;  3X25 B;  4XTX A;  4NL2 A;  1I4K 1;  3OYN A;  3JCM d;  3X20 B;  4L5G A;  1YJ9 T;  4QVD A;  1LOJ A;  1Y96 B;  1XNI A;  2O4X B;  2V8I A;  1RL2 A;  5CKH A;  5GAO q;  1VQK A;  1VQN T;  1YI2 T;  4M78 C;  3NTI A;  3MET A;  4A4H A;  2LX9 A;  4J7F A;  5GMK i;  3I56 T;  4ZGE B;  4JDS A;  1KQS A;  4J8O A;  4ME7 A;  2LRQ A;  4E7I A;  3P8B B;  1YIT A;  2P0P A;  1KQ2 A;  5CAI A;  2XDB A;  3CC4 T;  1AHJ B;  2HBP A;  5CVI A;  3HRU A;  5IAY A;  1G3T A;  3A8H B;  3KBG A;  1JRI A;  3DKM A;  1KHI A;  4ELZ C;  3CXC A;  2XDP A;  5DLQ E;  2DD4 A;  3MEW A;  5GAM d;  2BUD A;  2E41 A;  2V8K A;  5IT9 E;  4EPC A;  5A0L A;  4OF1 A;  4RCC A;  4UC4 A;  3UWN A;  1V29 B;  4KUI A;  3V7C A;  2QQS A;  4KT0 E;  2EQK A;  3JB9 D;  4O5V A;  4LDV A;  5GAN j;  3OYF A;  1M5Q 1;  2K5F A;  4C92 D;  3HP9 A;  3CCQ A;  2L8D A;  1BKB A;  2LQK A;  3L2W A;  3CME T;  2XDD A;  4X9D A;  3VJP A;  5L8R E;  1B34 B;  5FU6 B;  3VKI A;  1X75 C;  4C5E A;  3C94 A;  2WSE E;  3FEO A;  3Q1J A;  3LWH A;  1Q7Y U;  1K73 U;  3SWN A;  5LL6 S;  2DKG A;  3LH0 A;  5CR2 A;  1VIF A;  3KUF A;  4KUL A;  5KE3 A;  2K4Y A;  3MEV A;  4LD6 A;  2I2L A;  4M7D D;  3CCS A;  1VQO T;  4JLG A;  3LGL A;  3QYH B;  2RK2 A;  3RMS A;  2CGH A;  5M9O A;  4ZN1 A;  4BI3 A;  3A8M B;  4QQD A;  5GAN g;  3JAM E;  3CCV T;  4PJO A;  1QW1 A;  5A0D A;  4IUV A;  1YHQ T;  3GNF B;  1UGR B;  1QVP A;  3J7A F;  3JCM J;  5KCO A;  1MGQ A;  4C8Q E;  4F7U E;  2HD0 A;  3OYK A;  3PFS A;  3DB4 A;  4R55 A;  2VUB A;  3CPW A;  3MP8 A;  3I55 T;  1W4S A;  1UEB A;  3M58 A;  3PTA A;  3H6Z A;  3JCM V;  2VXE A;  5CKB A;  2LVM A;  3EFR A;  4X34 A;  3X26 B;  1U1T A;  3ASK A;  2VGN A;  2HQE A;  1K73 C;  1LJO A;  4WF2 A;  3VV0 A;  3O8V A;  5HK3 A;  1YIJ T;  1Q7Y C;  5CCA A;  5GAN 2;  4M78 A;  1UGQ B;  3VYG A;  1VQ4 T;  4N4I A;  2HAX A;  5CKF A;  4L6V 5;  3OYG A;  3X24 B;  2OTL T;  2GFU A;  3QKJ A;  4M75 C;  4C92 C;  2E65 A;  4E7J A;  1FX7 A;  2ZPB B;  5GAO m;  2XHC A;  4RG2 A;  2FL7 A;  2CZ1 B;  3NFC A;  2E10 A;  4M7A F;  2E1H A;  2FB7 A;  4X9C A;  3QJY A;  5LJ3 h;  2XK0 A;  5CKE A;  1WQW A;  5LJ3 e;  4ELY C;  1YJN A;  1G3W A;  3G71 A;  4VUB A;  3LGF A;  3CXC S;  4BE0 A;  3JCM W;  1OI1 A;  2K5L A;  5GAN e;  5GAN h;  2BKD N;  2PUO B;  3WVE B;  4F7U B;  4J6X A;  4RMO A;  2KDS A;  4KBM B;  2ZPH B;  3WXM B;  4A4G A;  2QA4 A;  4BE2 A;  4A4F A;  2RD1 A;  1O75 A;  4Y28 E;  2OAU A;  3CCJ T;  1JJ2 A;  4HKE A;  4QVZ A;  3A8L B;  3S6W A;  4C8Q F;  3GOX A;  4JUV A;  1D3B A;  2PU9 B;  1ZBX A;  4PJO G;  3M59 A;  3KXT A;  2CS7 A;  2EAY A;  4C5H A;  3CCU A;  4XU3 A;  4PLL A;  2A3L A;  5KE2 A;  2DXB A;  5I2M A;  2X4W A;  4N0A C;  5C6S A;  4BD3 A;  1YJ9 A;  4OGE A;  1HK9 A;  2DJZ A;  5CO7 A;  1XOV A;  3L42 A;  2C06 A;  1BI0 A;  3E9G A;  1VQN A;  2L5Q A;  5GAN d;  1YJW T;  4XU2 A;  2DD5 A;  2F5T X;  3ZBD A;  3OYY A;  3WVD B;  1VUB A;  2X4J A;  5GAN 6;  1Y07 A;  2MF2 A;  3A8O B;  3V7R A;  1IRE B;  3V7S A;  4EMK C;  3I56 A;  2EJG A;  2RH2 A;  1VQ9 T;  1BIA A;  4O6J A;  4C0G A;  3QBY A;  4M78 G;  2EFI A;  2EWN A;  4MZP A;  2QQR A;  1NZ9 A;  3CC4 A;  4MMK A;  3JCM X;  2D6F A;  4N4G A;  5HK0 A;  4V2S A;  5D6Y A;  4C0Z A;  2CYZ B;  5CKD A;  3JB9 F;  2R58 A;  2X4X A;  3FJP A;  2RJD A;  3VU3 C;  1S72 T;  2IVW A;  3PIP A;  1O9S A;  1Q86 C;  1LNX A;  3OYL A;  2LCC A;  5I2S A;  3URG A;  4C8Q D;  5CIU A;  2WAC A;  1H64 1;  2RHI A;  4M75 A;  2DZC A;  4C92 A;  2DK3 A;  4PL6 A;  4MDX A;  4EMG A;  1RI0 A;  4LDY A;  3MHX A;  3NTH A;  5LJ5 f;  3V8J A;  5DM7 R;  3QUI A;  3PIO A;  1KC8 U;  3MO8 A;  4M7D F;  4GLK A;  3JB9 I;  3L1A A;  3CME A;  4M7D B;  5CK9 A;  3CMA A;  4JS5 A;  3CC7 A;  4M77 G;  5FU7 B;  2E5Q A;  2LQ8 A;  2Y4Y A;  2QEX T;  3HHT B;  1VIE A;  3OMG A;  4L59 A;  3CC2 T;  1KG1 A;  1M1K U;  3OS1 A;  3QDR B;  3JCM f;  3PNW C;  4J6W A;  5J39 A;  3CCE T;  2DTI A;  3UT1 A;  1M8V A;  1VQO A;  4MZM A;  4TVR A;  4DOV A;  4PJO E;  4MDW A;  4OGC A;  3JCM Q;  1U8R A;  4J7I A;  2WSC E;  2Y90 A;  3HRT A;  4LDU A;  3CCV A;  4LD9 K;  4M7A C;  3DLM A;  1YHQ A;  5LJ3 j;  1JJ2 S;  2DIQ A;  1WPY A;  5GAN 8;  1Y71 A;  3H8Z A;  5DY9 A;  3V8K A;  1N9R A;  4IUP A;  3DLL A;  3L2V A;  4M77 C;  3OYB A;  3I55 A;  4Z02 A;  5GAN 4;  4OB0 B;  1JB0 E;  4R56 A;  4N0A A;  2KY9 A;  3OA6 A;  4JS4 A;  2ZCF B;  1MHN A;  4A54 A;  1VQ7 T;  1N9S A;  5D6W A;  1Q82 U;  2PVD B;  4C8Q C;  5GAM f;  1YIJ A;  3P8H A;  2XKO C;  4II1 A;  4M78 E;  3G4S T;  4C0D B;  4QW2 A;  1VQ4 A;  4JLI A;  1M1K C;  1VQ5 T;  5GAO l;  5LJ3 g;  2QQA A;  3HRS A;  2DXT A;  4EMK A;  4OB2 B;  3QJ6 A;  4XU1 A;  2P4T A;  5A2Q E;  2OTL A;  3SWN B;  4JRI A;  1WJR A;  4MML A;  3FLG A;  2GCX A;  4A4K A;  3M4G A;  2VV5 A;  3OY9 A;  2JVV A;  3EFS A;  2MMP A;  4M75 G;  2KQW A;  2RJF A;  2ZPF B;  4PLI A;  4BY6 B;  4C92 G;  1M1F A;  5GAN 5;  1VQ8 A;  1TH7 A;  2VGM A;  4HCZ A;  2E64 A;  4XK8 E;  4C5I A;  2DO3 A;  2RI5 A;  4PJO B;  1NPR A;  2LCL A;  5GAO n;  2M16 A;  2DTH A;  4QQG A;  3L2U A;  3M53 A;  2K2V A;  3CBP A;  2RA2 A;  4A4E A;  2LTO A;  3S3N A;  4HT9 A;  3BDU A;  4ATO A;  1WGS A;  2LDM A;  4E7H A;  3N5B B;  2D0Q B;  2JTM A;  1Q82 C;  3TCJ A;  4XU0 A;  3OS2 A;  2XD0 A;  5DLO A;  2EJ9 A;  2LNV A;  4FL6 A;  3CCJ A;  1M90 U;  5GAN 7;  3VUZ A;  1VQM T;  2NLU A;  2RK1 A;  1N8R U;  3L2R A;  2AHJ B;  2MAM A;  3QPH A;  4XTU A;  4IKF A;  1FXX A;  4Y91 A;  3CPF A;  1QVF S;  3CCR T;  2QQ9 A;  5CQY A;  2EQU A;  1BYM A;  2LT1 A;  3LYI A;  4M78 B;  4OB1 B;  4BI8 B;  5KH6 A;  4ZGD B;  3OW2 A;  2JN0 A;  2DTO A;  2L89 A;  3CCQ T;  2JOY A;  2JUF A;  1FWZ A;  1VQ6 T;  4XTZ A;  2K57 A;  2PVO B;  4N4H A;  1I81 A;  2M9U A;  4YTL A;  3JSC A;  1W2B A;  4M7D C;  1ZQ1 A;  3RKW A;  1YJW A;  4M7A A;  2HQX A;  3VYH B;  3RER A;  3QII A;  5FRN A;  3F70 A;  1VQ9 A;  3OBY A;  1BIB A;  4NL3 A;  3CCS T;  4PKC C;  2L3R A;  3M55 A;  4E7L A;  1M90 C;  3E1S A;  4M77 A;  4F7U F;  3GLX A;  1QP2 A;  4PNO A;  2XU8 A;  4EDU A;  3M4Y A;  4QVC A;  2PVG B;  4J6Y A;  1N8R C;  4QQ6 A;  4FM4 B;  2QQB A;  1G3Y A;  3C12 A;  4A53 A;  2DPP B;  2EIF A;  3HFO A;  4LDW A;  4M77 B;  3CCM T;  4C8Q A;  4JRQ A;  3P8D A;  3RMQ A;  1S72 A;  1VQP T;  4JRK A;  1D3B B;  1UGS B;  3QZ9 B;  2GF7 A;  5LJ3 d;  1K9M U;  4EMH A;  4M75 E;  4M7D A;  4RG8 A;  1PSE A;  2KSS A;  2XI9 A;  2YRV A;  2QXF A;  1YI2 A;  1UB4 A;  3SDZ A;  3QXE B;  1WQ7 A;  3JCM c;  4C0F A;  2EJF A;  2EQM A;  4OVA A;  5LJ5 h;  1X01 A;  1OYX A;  2VC8 A;  3BW1 A;  4ZN3 A;  2YLC A;  4M78 D;  5FU6 C;  3OYE A;  3HPW A;  1JBM A;  2FVU A;  4DQ2 A;  2CZ6 B;  2QEX A;  2DEQ A;  3CC2 A;  2F69 A;  3JB9 H;  2XIC A;  2K3X A;  2RJC A;  3OQ5 A;  5GAN f;  3SB2 A;  5HKC A;  1VQL T;  2GQV A;  2WSF E;  2RHY A;  3JCM h;  1KHC A;  2E70 A;  3FB9 A;  3M5A A;  3X28 B;  3L2Q A;  4XTW A;  2EKO A;  3FRN A;  4FIB A;  4IUQ A;  4ZTJ A;  2DVE A;  4M7A G;  3CBO A;  2M1H A;  3CD6 T;  3UDC A;  4FT4 A;  3LWI A;  4OB3 B;  3HKS A;  3GF5 A;  3G6E T;  1QVF A;  5GAN 3;  1SSF A;  4C92 B;  4M75 B;  2OTJ T;  3OW2 S;  5GMK m;  2K3Y A;  2G3R A;  3V8L A;  1VQ7 A;  2YLB A;  1R8O B;  1OZ2 A;  3RIR A;  1YBY A;  2MWP A;  3EAE A;  2R5A A;  1Y96 A;  2R57 A;  2O4X A;  3G4S A;  2RI3 A;  4RKU E;  4OP0 A;  3J80 E;  1W2B S;  1M9S A;  1VQ5 A;  5GAM e;  5GAM h;  2DIG A;  2LC4 A;  4C8Q G;  1WJS A;  5GMK j;  4E7K A;  1EIF A;  1KD1 U;  4B9W A;  5FLX E;  3OYD A;  3OSS C;  4P5N A;  2P0Q A;  2KK4 A;  3QO3 A;  5C0M A;  3PGG A;  2RM4 A;  5GAO p;  1NE8 A;  3CCL T;  4BDY A;  1K8A U;  3HFN A;  3PMT A;  4FU6 A;  3FDR A;  2H3J A;  5KCH A;  2ZZD A;  2VXF A;  5FRO A;  4BAC A;  2VYT A;  4BI4 A;  1KC8 C;  1NJI U;  3AHU A;  3QSU A;  4PJO D;  5GAO r;  4C5G A;  5I21 A;  1M1G A;  2V8J A;  3MP6 A;  2JZ2 A;  3OMC A;  3CBM A;  3LW5 E;  4BE1 A;  2QTX A;  3M57 A;  1QVG S;  4HCC A;  1VQM A;  4FSX A;  3BY7 A;  1Q81 U;  5A0G A;  4NS5 A;  4BB7 A;  1I5L A;  3M9Q A;  3CCR A;  2KVQ G;  1KD1 C;  3PMI A;  3JB9 G;  1B34 A;  1U1S A;  3QYG B;  3RKY A;  4EMK B;  1KQ1 A;  2Y4X A;  3E19 A;  2CKK A;  3MEA A;  4XTY A;  4M75 D;  4CRI A;  1NPP A;  2P0K A;  1K8A C;  1VQ6 A;  2QI2 A;  3GNG A;  4BDZ A;  1YIT T;  3CMA T;  5AYF A;  2PQW A;  2QDY B;  3PT9 A;  5HY6 A;  3CC7 T;  4M7A E;  3NTK A;  1NJI C;  4KUD K;  3ZEH A;  4GY5 A;  4B9X A;  4BUG A;  3E9F A;  2JNG A;  3GP8 A;  5LJ5 j;  5J3B A;  3R6O A;  4PJO F;  1G3S A;  4M7D G;  1YCY A;  3M54 A;  1DJ7 B;  3ME9 A;  4Q5W A;  2DAQ A;  2YHT A;  4M77 E;  3OYM A;  3MCA B;  3QHS A;  3ER0 A;  4DOW A;  4CI0 C;  3HSB A;  4IUT A;  1Q81 C;  4RCB A;  3M56 A;  3TEE A;  4LDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...