3VKIA

Monoclinic crystal structure of salmonella flga in closed form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
198
structure length
198
Chain Sequence
b'QDINAQLTTWFSQRLAGFSDEVVVTLRSSPNLLPSCEQPAFSMTGSAKLWGNVNVVARCANEKRYLQVNVQATGNYVAVAAPIARGGKLTPANVTLKRGRLDQLPPRTVLDIRQIQDAVSLRDLAPGQPVQLTMIRQAWRVKAGQRVQVIANGEGFSVNAEGQAMNNAAVAQNARVRMTSGQIVSGTVDSDGNILINL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagella basal body P-ring formation protein flgA
publication title Structural flexibility of the periplasmic protein, FlgA, regulates flagellar P-ring assembly in Salmonella enterica
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Chaperone
total genus 41
structure length 198
sequence length 198
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2011-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08666 SAF SAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.760 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3vkiA02
3TEEA 3VKIA 3VJPA 3FRNA
chains in the Genus database with same CATH superfamily
1PRLC 5GAN2 1U06A 5GAN8 3C12A 3I56Q 3EAEA 5GAOq 1GFCA 1GL5A 2OI3A 5GAOp 5A0LA 2EKOA 3QIIA 1TTHB 4HCKA 2HKNA 1IHWA 2O2OA 1D1BA 1VQ4T 2HMAA 4RTZA 1YJNA 1PSFA 4R56A 2L3SA 3JB9H 2HBWA 4C92G 4E7ZA 1ABQA 2W10A 1YJ9Q 3H41A 2KSSA 2BTTA 4KT0E 1OYXA 2LT4A 4GY5A 3G4SQ 1K73U 3JCMg 1C6VX 1WZOA 3JCMb 2I2LA 2E41A 2V1RA 3GLXA 2CDTA 3X26B 5CKDA 4OMNA 1OI1A 1NJIC 2QGFB 3JCMh 3CC7T 5L8RE 2J6OA 4M7AF 3CCJQ 2YXYA 3S3MA 4N4HA 1PCXA 1ACMB 1KQ2A 1RI9A 4J7IA 2ROLA 2DA9A 4KRTA 5GAOn 3C0CA 1WHGA 2E65A 2K3BA 2RHZA 3THKA 3VS5A 4E47A 3QWYA 1RAHB 1VA7A 1ZA1B 2K7AA 4LUEA 1VYTA 2H3EB 2LX9A 5EG2A 4PJNA 1X6BA 2XIDA 1N5ZA 4K11A 3A8GB 3JAME 2CZ6B 4HT8A 3CCMA 1RAEB 3U23A 4ZGDB 2HQHA 4OGEA 1S72A 3OYIA 4C5EA 1ZQ1A 5KYNA 1M1KU 2E3HA 4CC7A 4ZN1A 3VS3A 2RK2A 4HA8A 2EGCA 1N8RC 3L2RA 3LX7A 2DETA 2RB6A 1BI0A 1Q7YC 2YDLA 1Y7XA 3M0RA 2JJ9A 3QPHA 5GANf 4M78B 3SD4A 4WCIA 2WACA 1W4SA 2M1HA 3UA7A 2KRSA 1IREB 4MMLA 4DBFA 3INZA 1VQ6Q 2CSIA 3ULRB 2D9TA 3OS2A 3RIRA 4WTOB 1VQMT 5I2SA 2XI9A 1QKXA 4RCCA 2QQBA 1CKBA 1X43A 3A1PA 3C95A 1MMGA 3M54A 1GRIA 3RKXA 5LJ3g 3HFOA 4JS4A 1SG5A 2RHXA 2HKQB 2LJ3A 5KYXB 1KHIA 3BE3A 2RQTA 2C06A 3L2QA 4PNOA 3MJXA 2XG8D 2OTJA 2P0PA 4JZ4A 2JVVA 1W2BS 1KQSP 3ZFJA 4OP0A 1JEGA 2F69A 1UDLA 2L0AA 5LJ5g 3UPUA 3NHNA 3QUIA 1NEBA 4BY6B 1FMKA 1VQKQ 4EIKA 4D8KA 3OA6A 1UFFA 4FYXB 5IAYA 4O6JA 3ZBDA 2E5KA 4F7UA 5D7UA 1E6HA 3PE0A 1MGQA 4FL6A 1TU0B 2QQ9A 1WHLA 2BUDA 2X4WA 2LNHB 4MDXA 2KROA 3CMAT 4XU2A 4LNPA 1X2QA 4A53A 2O88A 1WHHA 4LD6A 1T3LA 2JM9A 3UA6A 2EQUA 3I56A 2JXBA 4C8QB 3NMZC 2DD4A 4B6MA 4JRIA 2L89A 5I2MA 1QVGP 2DLPA 2QAZA 2DD5A 3JV3A 2LCCA 3BW1A 1PKTA 3JCMV 1HYOA 3CD6T 3FDRA 3JSCA 4WF2A 1VQOT 2K2MA 1YJ9A 3META 1JRIA 3TSWA 1NPPA 1UGVA 3TU4K 1W2BA 1TUGB 1FWZA 1OU9A 3PNWC 2G6FX 2PZ1A 1UHFA 2ZPHB 2HQXA 1K73C 2R5AA 4ANJA 1JJ2P 5GMKh 4F7UE 5IN1A 2J7IA 2VC8A 3MEVA 1M1GA 1OZ2A 2RI2A 1VQ5Q 1IGQA 3L1AA 4X34A 2K6DA 3HHTB 1VQ8T 5KCHA 1RABB 2QGGA 2J05A 3OS5A 4HVWA 3CCUA 2JW4A 1ABOA 1ZSZB 5LJ5j 1VQPQ 2VVKA 1UJYA 2J06A 1M90U 4X1VA 4Z88A 3G6EA 4XAXB 2CZ0B 1AHJB 1UJ0A 5HY6A 3OYBA 3JRZA 4NOYA 3LGLA 3M58A 2QEXA 2E1HA 2LQKA 2NUTA 3IQLA 3CCQQ 3CCJT 1Y07A 3HFNA 2X3WD 1YHQT 4DA4A 3EG9A 5I21A 2WSEE 4LDWA 4PLLA 1K0XA 5CQYA 1PNJA 2M51A 4EPCA 1M1KC 4M7DC 2C0TA 2DIGA 1GXIE 2HSPA 4B9XA 1RL2A 4M7DD 3S3NA 2K2VA 2OTLA 1G8XA 2HEQA 2X4JA 4J9FA 2RNAA 4M7DA 4MZTA 5AT1B 1G3YA 1OOTA 3REBB 2DVJA 2DTOA 2K5FA 3D7SB 5FWBA 1SRMA 1M3AA 1M5Q1 2EYQA 4J9CA 2QK0A 2XDDA 4M77F 2DX1A 1W1FA 2WSCE 1Y96A 2AKLA 2MMPA 2NYSA 1K9MR 4BDYA 1VQ6A 1VIFA 1VQNA 1Z9ZA 2COWA 3J81E 2CP0A 2DBKA 3T9NA 1GFDA 1Q95G 4MDWA 2C0IA 3RKYA 2L3RA 3H6ZA 1T0JA 3TSZA 4F16A 2FEIA 2VUBA 4PJOF 2BZ8A 3JCMQ 2EYWA 3OW2S 5HCKA 3ASKA 4JS5A 1VQ9T 1MMAA 3O8VA 1VIEA 2GF7A 3CC7Q 1M9SA 3E1SA 4JLGA 2DPPB 2XK0A 1JXOA 2W0ZA 1V76A 1AZGB 4M7AD 3OYJA 2KBTA 4C5HA 4M7DE 5GJWB 4PLIA 4M7AA 4CC4B 4OB2B 1YJWA 3NGPA 1LCKA 1PRMC 2IIMA 2J6FA 1VUBA 1UTIA 1XTDA 4Z8AA 4BI4A 2LCLA 1LOJA 3ER0A 3L2WA 4C0GA 4AFSC 2K5LA 2QI2A 3EHQA 4BB7A 4LUDA 3G1JA 1M8VA 2KYMA 3OYCA 2MPXC 2XDBA 1UG1A 1I5LA 3VV0A 2CP3A 4M78C 4R0KA 2DEUA 3EFRA 4LE9A 5L23A 1VQKT 1RI0A 4C5IA 1CKAA 3OW2A 4OVAA 2DM1A 3M59A 4EMHA 4F7UB 1PD0A 2WSFE 3RMSA 1TH7A 1WIEA 1QP2A 4A4FA 1OV3A 3NPFA 4RTTA 1U1SA 2HL5C 1ZBXA 1RLPC 1W6XA 2DMOA 4ELYC 2LT1A 4M7AE 2DRKA 3TQ7P 3VS2A 2X51A 1VQMQ 1H641 3EH1A 4RTUA 3OYYA 5GAN3 2DIQA 5KYWB 3LH0A 1I4K1 4RCBA 2BZYA 2VASA 3FRNA 2LP5A 2YLCA 2VXEA 1VQ5A 4IUTA 1SF9A 4M75B 3UF4A 4KUIA 4QT7A 1M2OA 2EIFA 1WNLA 3HL8A 1RAGB 4BI3A 1R77A 2DEQA 3QDRB 2DF6A 5CO7A 1WHMA 4BY6C 4QVDA 1VQPA 1X2KA 3L2UA 3A98A 3OBYA 3M4YA 1WGSA 3EGXB 1M90C 4XTZA 1UHCA 2JTFA 4XTVA 1Y0MA 2RD1A 1QCNA 4QKUA 4ZTFA 1QVFS 4J9IA 4JPBW 5FU7B 3QXEB 2OJ2A 4E7LA 2IG0A 3JCMW 3LW5E 4QW2A 5KE3A 4FYYB 3CMAQ 4LDXA 1EFNA 4C8QC 2NUPA 4C8QD 3NTIA 1FXXA 2Z0WA 1K0SA 4FU6A 3X20B 5D6XA 1MNEA 3HPWA 4C8QA 2E6NA 2ZAEA 5GAN4 3CCLT 4C0DB 2EBPA 1WQWA 3DB4A 2NUTB 1W70A 1VQ4A 5I22A 3FEOA 3CCQT 1NEGA 1D0ZA 1XQHA 3EG9B 4Z89A 3MP6A 2EGAA 3CD6Q 1YI2Q 2HCKA 1VQ7T 1HJDA 3FIFA 3M0TA 3TREA 2KEAA 3OQ5A 2A3LA 3TCJA 3NTKA 2GGRA 2M16A 2LNVA 3CC4T 1JO8A 4M7DB 2ESWA 4X9DA 2SEMA 4HT9A 4ORZA 3MKDA 3EG1A 2ZPBB 2GCXA 3CC2T 1WI7A 4R55A 3OS0A 1D09B 1QVFA 1NG2A 4AFZC 3CC7A 1N27A 1SSFA 1ZSZC 2OAUA 1YCSB 3CMEQ 3FC3A 2O9SA 4DBQA 4JUVA 1Y96B 5FU6B 3VUBA 1VQ8Q 3LWIA 2J6KA 5GANg 2KQWA 4DBHA 4ATOA 4JJBA 1ZSZA 1LNXA 1M2VB 4E7SA 5A0GA 4C8QE 1NM7A 2LDMA 5GMKm 4B9WA 1Q86R 1PM3A 2E3IA 3M9QA 5ECAA 1WHJA 2FPEA 3KBGA 2D8HA 2KRMA 4C92F 4OF1A 4RG2A 4RMOA 1R8OB 3OYLA 1WHKA 3DKMA 2ECZA 1D0XA 1IO6A 4FW1A 1VYVA 1QP3A 2MF2A 2RJFA 1YHQQ 3QYHB 1PWTA 2BE7D 1OX9A 1NPRA 1T3SA 1KD1R 4XK8E 1TUCA 4AFQC 3RMQA 3CCRQ 1AWXA 4M7AB 2PVDB 4FSXA 3SEMA 4LXCA 3H9NA 3OYAA 5J26A 4LDYA 2KYBA 2HDAA 2B86A 1XOVA 1IB8A 4IIMA 4A4GA 2ZCFB 3I35A 2DTHA 1AWOA 2ZPGB 2XHCA 2P4TA 2CP7A 3L2ZA 1VOMA 1OPKA 2ZZDA 1TWBA 2JMCA 1KJWA 3M56A 3X28B 2JMAA 1KG1A 4M78G 1Q81U 4ZN3A 2KDSA 4KBMB 2BE9B 2XMFA 3KXTA 4M77D 1SKUB 1VQMA 2CZ7B 2V8JA 3OYFA 4M77A 1VQ9Q 3I55A 4J9HA 1YP5A 2CT3A 4E7HA 1RLQC 4PJOD 2RQRA 3BY7A 3M53A 5GANj 1IGUA 5GAMd 4JJDA 4PJOA 1X6OA 1BI1A 1YITQ 4AG1C 2RJDA 2XDPA 9ATCB 2LC4A 3X25B 1O9SA 3I9QA 3TEEA 3CCMT 2VKNA 3CCET 5FLXE 2E70A 3CBOA 1M4ZA 1UGSB 3CXCP 4NS5A 4HKEA 1YIJA 1X69A 2CGHA 1NYFA 1UECA 2MK5A 3PIOA 3X24B 3HRTA 5KYUA 3MHXA 2KAFA 4IURA 1FX7A 1P92A 1X27A 5LJ3h 1ZBJA 2OX7A 4J7FA 3PMTA 5FWCA 1NJIR 4GLKA 1UE9A 3RR6A 3CMAA 2NLUA 2ZPFB 2KY9A 2LQNA 1KC8C 1QWEA 1H8KA 2QA4Q 5AYFA 5GMKl 1YBYA 4V2SA 2RF0A 1ZA2B 2L2PA 2HD0A 5GAN6 2ZGWA 5LJ5h 3JCMd 3R6OA 3JB9D 2LJ1A 1A0NB 2DKGA 1WA7A 2M02A 4C8QG 3CQTA 2L8DA 1B34B 4FYWB 4J9BA 4ZGJB 3G71T 6AT1B 1B7TA 3OS1A 2X4XA 1JJ2S 1VQOA 2OAWA 2K3YA 2YLBA 5J39A 5GAOm 2NUPB 4AG2C 1K1ZA 1X01A 4LN2A 3FJPA 2RI5A 1KQ1A 1N9RA 1RACB 4FCYA 2F2WA 1WXUA 3J7AF 5KYWA 4M75C 1WXBA 4DBRA 1LVKA 4M75D 5D6WA 2DERA 3A5ZB 3C4SA 4BUGA 3OBWA 2DFUA 1BI2A 4M75A 1YI2T 3EHRA 2GBQA 1AVZC 1NLOC 4OMLA 1SHFA 1HK9A 3JCMX 2YRDA 1VQ8A 3P8HA 2FO0A 3MEWA 1WYXA 4J6WA 2QTXA 4AFUC 2EW3A 2DBMA 2I0NA 3G4SA 2LVMA 3H8ZA 3EGXA 2FPDA 4JJCA 4Q5WA 4J6XA 5FU7C 4CC2A 3E9FA 1OX8A 3HSBA 2O01E 5CIUA 1WPYA 3CMET 4PJJA 4FW2A 3CCJA 2HL3A 1YHQA 1U8RA 5FRNA 1JJ2A 2QG9B 3SWNB 5GANe 3M0UA 3R6NA 5A2QE 1Q86U 2EGEA 4C0DC 1WJQA 2EPDA 5I11A 1H92A 3OB9A 2MOXA 3CCLQ 4FM4B 3VU3C 4M75E 2G3RA 2CT4A 3CCSQ 2F5KA 3CPWP 4QQDA 1BU1A 4OB1B 2DO3A 3M57A 3QYGB 1VQ7Q 2EQJA 5LJ3d 4NL2A 1R0BG 2FZGB 4Y28E 2EAYA 3CCRT 1GBQA 4KGZB 1Q81C 3SFMA 4ELZC 4BDZA 5IXFA 1K8AR 3CC4Q 2O9VA 1HD3A 3PFSA 2P84A 2LZ6B 2PVGB 1QMCA 3OYKA 3CC2Q 3CEYA 1VQ9A 1HXDA 5FU6C 4BACA 5LJ5d 2FYKA 3VKIA 3PGGA 2LQWA 2AZSA 4FSSA 2GTJA 2BZXA 2ABLA 1Q82R 1UGPB 3QKJA 1Y57A 3WXMB 1M2VA 5CKEA 2E5QA 4QQ6A 1BYMA 1X75C 4XU1A 2R57A 5GAOl 2JT4A 4M77B 3DLLA 5GMKj 1B07A 2CYZB 2ED1A 3MP1A 2KRNA 3RBBB 4DEYA 3M4GA 3LLRA 4QVCA 2JM8A 2CZ1B 2QASA 2V8KA 4QVZA 2DZCA 4PJOB 1YCYA 5CAIA 1K73R 3SHWA 1QCOA 1YITT 4M7AC 4HVVA 1TXQA 3ZEHA 2YRCA 3OSSC 1ZUUA 4EMKB 1EX4A 1YJNQ 4J6YA 2LQ8A 1I8FA 1AD5A 2JS0A 2CP2A 3OYHA 3DB3A 1MV3A 4HCZA 4PK4A 2NWMA 1NBEB 2K57A 3CBMA 1ZSGA 1VQKA 2GNCA 1Z9QA 1B3QA 5KYUB 4CRIA 2KT1A 3GNFB 2HSEB 2O4XA 2CH4W 4D6WA 2AT1B 3NFCA 4N0AA 2MCNA 4KGVB 1KHCA 3CCVT 4E6RA 4NL3A 2RHYA 5KE2A 4F7UG 4J9GA 2ED0A 3LH5A 2EYZA 3JB9G 5GAN5 5M9OA 2QA4T 4XTYA 5DLOA 1BKBA 3RDVA 3OW2P 2RM4A 1N6AA 1WFWA 3EGDA 3UT1A 3H0IA 2RJEA 2RPNA 2H8HA 4XQ3A 3QZ5B 4F7UF 2D1XA 3Q1JA 4OMPA 3H0HA 1KK7A 4JRKA 2GTOA 1FMWA 2YUOA 1WJRA 3M0SA 4M75G 3CCMQ 3CCEQ 2KE9A 1D1CA 4A4KA 1MMNA 3QDFA 4FYVB 1I81A 4BD3A 2DJZA 2F2XA 2PUKB 3BFMA 5CK9A 2LTOA 2JZ2A 2CP6A 1G5VA 3VS6A 3QBYA 3QHSA 2RQWA 2V26A 2DXUA 3CBPA 4CC3A 4HVUA 4L59A 3EG0A 2JN0A 3EG3A 2JTMA 3JB9I 5CVIA 1VQLT 3RNJA 2A0FB 2BIVA 1Q86C 3V8JA 1BBZA 2A08A 2Y4YA 2F5TX 5IH2A 3HRUA 3CCLA 2L3PA 5IXBA 5GMKe 3OYEA 2V1QA 5IHKA 5IHIA 3JB9J 3CCQA 1PSEA 3V7CA 3G71Q 4QQGA 1B34A 1QLYA 2RK1A 3M0QA 5KH6A 1VQ7A 3P8DA 2RHUA 2QXFA 1NYGA 1E6GA 1ZX6A 3E19A 4EMGA 2ZPEB 1G3WA 1OQKA 5IT9E 2X35A 3VS0A 1HSQA 4J9EA 2OTJQ 3FB9A 1D3BB 3CC4A 2DL4A 4KULA 3VYHB 4BE2A 3CCST 1NE8A 5J3BA 2KNBB 4JRPA 3EFSA 2K4YA 3QWXX 3VS1A 3CC2A 2PNIA 4RTYA 4M7DG 2RI3A 4LDUA 3KFVA 4M4ZA 5CCAA 1QCFA 2DL5A 3EG2A 2KR3A 4VUBA 2KI7A 3UATA 2ROTA 1K8AU 2FVUA 4ZTJA 2D0QB 3BDLA 3JCMP 1YFNA 4M7DF 2VGNA 4KUDK 2QYZA 2E10A 1QVFP 1XJWB 4PFPA 4J83A 1U3OA 4E2FB 4BE0A 4Y91A 3SWNC 2LX7A 2VWFA 1GCQA 4HCBA 2A7YA 2SRCA 3RERA 1Q82U 1K9MU 4UC4A 4A63B 3OYNA 3G7ZA 3FLGA 4FT2A 3SWNA 2X9HA 1KFZA 2B8AA 2AHJB 5DM7R 4EDUA 2K79A 1MNDA 5GANh 3UDCA 1JB0E 1GCPA 3H0FA 5HK3A 1D1AA 2MYSA 4OMOA 3VRZA 5C0MA 3GBQA 3MEAA 4M7AG 1F1BB 4XU0A 2X3XD 3M0PA 2KXCA 3WVEB 2HNIA 4LD9K 3JCMc 1J3TA 1M1FA 1M90R 3A8HB 2FL7A 3VYGA 4C92B 1WJSA 2E64A 4DEXA 1YJNT 2DVEA 3SDZA 2O31A 4A4HA 1RAAB 2Y4XA 3LYIA 2F2VA 3RESA 7AT1B 1OEBA 2XKOC 3CCUQ 2EVRA 5GAMf 1QVPA 4TVRA 4ZNXA 2FZCB 1BI3A 3GOXA 2O4XB 5GAMj 3G6EQ 4MMKA 2K9GA 2LRQA 2RQUA 1OULA 1SEMA 1PHTA 3CXCS 2CUDA 3OMCA 4L5GA 1LJOA 4M77C 2YRVA 2DXBA 4XTWA 5GMKi 3OYMA 2R5MA 2QEXQ 1OU8A 3CCEA 1M8MA 1MHNA 1X6GA 1I1JA 3HRSA 3MCAB 4OB3B 3EGDB 4PJOC 2EKHA 4YTLA 1KQSS 5GAOr 5A0DA 4M78F 1I07A 4DQ2A 3M55A 4IUPA 2OTLQ 1GBRA 2FRYA 4PJMA 4XU3A 4EMKC 1SRLA 2FB7A 2PUOB 2JUFA 1JBMA 2RMOA 1T0HA 4F04B 2KK4A 5CQXA 2DXTA 4OMQA 5FROA 1SPKA 1M27C 3PTAA 4EMKA 4RG8A 2QTVA 2YWWA 3AHUA 2MIOA 1S72T 2D0NA 4OGCA 3JCMf 4DOVA 2DAQA 1Y71A 1WLPB 3PVQA 1RUWA 1VQNQ 4AMCA 2DJQA 3URGA 4IUQA 2DL8A 2V8IA 2FPFA 2VB6A 4PFOA 2RH2A 1D0YA 2JNGA 3VS7A 3CCVQ 3GF5A 3CXCA 3G71A 3I55T 1AWWA 2X4YA 1WQ7A 4M77E 1H3HA 4RKUE 1QVGS 5FRMA 2YUQA 2PVOB 1YWPA 2LJ0A 2QDLA 5EC7A 5GANd 3V7RA 3A8MB 4KH0B 1FYNA 5CKBA 4PJOE 4PFZA 2CUBA 1KQSA 4FT4A 2QQRA 4JLIA 1H3ZA 4L6V5 4OMFB 1YJWQ 1MUZA 1YIJT 2M0YA 4XTXA 5D6YA 2RQVA 3CD6A 1YN8A 1YI2A 3I5RA 2ATCB 3QO3A 3PVLA 2DL3A 4Y92A 4RUGA 4A54A 3OMGA 4D8DA 1V1CA 1ZUKA 1DJ7B 1K8AC 2E6ZA 2OTJT 1C0MA 3V7SA 4C8QF 1BCOA 2IVWA 3DLMA 3EFOB 4IUVA 4RTWA 1N8RR 4P5NA 2H3JA 1PG5B 8ATCB 2L3QA 4JRQA 3KUFA 2XICA 2HAXA 1OPLA 2KXDA 4J8OA 2D8JA 5CKFA 1Q7YR 3CMEA 2DZ9A 1N9SA 1PKSA 1Q82C 2VV5A 3N5BB 1W2BP 1K9MC 5GAMe 2CKKA 3OYGA 1VYUA 1QVGA 3CPWS 1VQLQ 4II1A 2CSQA 4PKCC 1BK2A 3A8LB 1PC0A 1UB4A 2ZPIB 3EH2A 2DNUA 4CI0C 5LJ3f 1BCMA 3I56T 1WX6A 1MMDA 2EJGA 2DYIA 5LJ3j 2RA2A 2DE0X 3SB2A 2CREA 3QJ6A 1UGRB 3L2VA 1R0CB 2EQKA 5KYYA 3CCRA 1ARKA 3S6WA 2VYTA 2YUNA 1ZUYA 4E7IA 3O5ZA 1PD1A 5LJ5f 2NUZA 4MZMA 4JDSA 4BI8B 1D3BA 1YJ9T 2E4HA 2BKDN 1QWFA 2KT8A 3E2UA 1SHGA 3A8OB 2DK3A 2YUPA 2LCSA 1QKWA 3G4ST 2R58A 1AOJA 3QSUA 1M30A 1ZHIA 1KC8R 4ME7A 3JCMe 3I5SA 1KD1U 1E7OA 1RADB 4GBQA 4BE1A 1JQQA 3MEUA 3CPFA 1TS9A 2DILA 2XU8A 1KSWA 2K3XA 4E7JA 4IUUA 3ME9A 2M9UA 2AZVA 3CPWA 4N4GA 1M3CA 3CCUT 3JCMJ 1QQJA 2MWPA 2GQIA 2DL7A 4E7KA 3OSVA 4HCCA 4M77G 3G6ET 2A28A 2HZYA 4O5VA 1LPLA 2C0OA 1YITA 3OYDA 2EFIA 4AT1B 4XTUA 4RTXA 3L42A 2QEXT 1VQ4Q 3J80E 4PJOG 3PIPA 4JZ3A 3GPLA 2M0OA 3OY9A 1IZ6A 1O75A 5HKCA 4ESRA 4J5YA 1MV0B 4C92C 2MAMA 2OTLT 2IPOB 2MWOA 4C92D 2JS2A 3AT1B 2AK5A 2JOYA 4OB0B 2QQSA 2COZA 2Y90A 4C92A 3CCVA 2JTEA 2RJCA 1RAFB 1U1TA 1XNIA 2RHIA 2EYXA 1S1NA 1TUDA 4GLMA 1TOVA 2EQMA 2GFUA 1KIKA 2QA4A 3E9GA 1I0CA 5IHNA 3QJYA 4N0AC 1G3TA 1EIFA 2CP5A 1VQ6T 1VQNT 4HXJA 3ZL7C 1C1AA 3NTHA 3M5AA 2D6FA 4C0FA 3PMIA 4X9CA 4ZGEB 1NJIU 2AKKA 2VXFA 2DYBA 3S3OA 2EQIA 2K5IA 1RAIB 5LJ3e 1AZEA 1NZ9A 3VRYA 2XD0A 5C6SA 2P0QA 4F17A 2L5QA 1QW1A 4PL6A 2P4RA 4J9DA 2MI6A 1TG0A 1M1KR 2DXCA 5CKHA 1Q81R 2VGMA 4C92E 1YJWT 1BIBA 1M3BA 3VUZA 3JB9F 1OZ3A 4RTVA 5LJ5e 4N4IA 4KGXB 4M78D 2COYA 1WDXA 4LDVA 5DY9A 2EJ9A 1G2BA 1JU5C 4MZPA 2P0KA 4M78A 1S72Q 3F70A 3GIBA 2RO0A 3MO8A 3HKSA 3RKWA 1V29B 2CH4A 1VQLA 2FG0A 1JXMA 5CR2A 4A4EA 5FW9A 2DTIA 2A37A 2PQWA 1AEYA 1N8RU 2GFAA 5DLQE 8AT1B 3HTRA 2KGTA 3TVTA 1YNZA 3RUXA 2PTKA 1Q7YU 2LMJA 4M75F 2KVQG 3I55Q 1I5OB 1K9AA 1UGQB 1UUEA 1AT1B 2GQVA 4IIOA 1NLPC 5KYXA 4Z02A 2F1LA 1SSHA 3GNGA 3QZ9B 1CSKA 2CS7A 4FIBA 2FHDA 2YSQA 3CCSA 2RN8A 2FRWA 4C0ZA 2YT6A 3HP9A 1YIJQ 2KMTA 1K76A 2A36A 5LL6S 4M78E 1G3SA 2DRMA 1IRXA 1IXDA 1KD1C 2HQEA 2PU9B 5KYYB 4C5GA 1AWJA 5HK0A 1K4US 3V8KA 1VQ5T 1BB9A 3PT9A 3LGFA 4IKFA 2EJFA 2QQAA 3FJ5A 3REAB 3MP8A 3GP8A 2YHTA 3P8BB 1BIAA 1VQPT 2AIRB 3EFOA 3MPUB 1EZZB 1ZLMA 1KC8U 2HBPA 4KH1B 1U5SA 3QG1A 3LWHA 5GAN7 3WVDB 1UEBA 1WXTA 1TSFA 5GAMg 3C94A 3EGUA 5GJVB 5KCOA 3V8LA 2FZKB 2ENMA 3VJPA 4JJNK 2E12A 2EWNA 1IHVA 1YWOA 4F14A 3UWNA 3VS4A 5GAMh 4OMMA 1FMVA 4DOWA 2EYYA 2QDYB 1G83A 1GCQC 1VQOQ 3BDUA 4PJLA
chains in the Genus database with same CATH topology
1M8VA 3OYCA 3OB9A 5GAN2 2XDBA 1I5LA 3VV0A 4M78C 3C12A 5GAN8 3EAEA 3EFRA 5GAOq 4FM4B 3URGA 1VQKT 1RI0A 3VU3C 4M75E 4C5IA 5GAOp 2G3RA 4IUQA 5A0LA 2EKOA 2V8IA 2F5KA 3QIIA 4OVAA 3OW2A 2RH2A 3M59A 4QQDA 2JNGA 4EMHA 4F7UB 2WSFE 3GF5A 3RMSA 1TH7A 4OB1B 2DO3A 3CXCA 3G71A 1QP2A 3M57A 3I55T 1VQ4T 3QYGB 4A4FA 2EQJA 2X4YA 5LJ3d 1U1SA 4NL2A 1YJNA 1PSFA 1WQ7A 4R56A 4M77E 4RKUE 1ZBXA 1QVGS 4Y28E 2EAYA 3JB9H 4ELYC 3CCRT 5FRMA 2LT1A 4C92G 4M7AE 1Q81C 2PVOB 3SFMA 4ELZC 4BDZA 5GANd 2KSSA 3V7RA 4KT0E 1H641 1OYXA 2LT4A 3A8MB 3PFSA 4GY5A 5CKBA 4PJOE 1K73U 3JCMg 2PVGB 3OYYA 3JCMb 5GAN3 3OYKA 2I2LA 2DIQA 1KQSA 4FT4A 2QQRA 4JLIA 1H3ZA 3LH0A 1I4K1 3CEYA 4L6V5 4RCBA 1HXDA 5FU6C 4BACA 2E41A 4OMFB 3GLXA 1VQ9A 5LJ5d 2FYKA 3X26B 3FRNA 3VKIA 3PGGA 5CKDA 1YIJT 4XTXA 5D6YA 1OI1A 1NJIC 3CD6A 1YI2A 2YLCA 3QO3A 2VXEA 3JCMh 3CC7T 5L8RE 1VQ5A 4IUTA 4M75B 4KUIA 4M7AF 4ZTJA 2EIFA 4A54A 1WNLA 1UGPB 3QKJA 3OMGA 3WXMB 4N4HA 3S3MA 5CKEA 3HL8A 2E5QA 4QQ6A 1KQ2A 4J7IA 1DJ7B 4BI3A 3QDRB 2DEQA 5CO7A 4BY6C 1K8AC 2E6ZA 1X75C 4XU1A 5GAOn 2OTJT 2E65A 2R57A 2RHZA 5GAOl 4E47A 4QVDA 1VQPA 4M77B 3L2UA 3V7SA 4C8QF 3DLLA 5GMKj 3OBYA 3M4YA 1WGSA 1M90C 2IVWA 3DLMA 4XTZA 2CYZB 4IUVA 4P5NA 3MP1A 2H3JA 2JTFA 3M4GA 3LLRA 4XTVA 2LX9A 4QVCA 2RD1A 5EG2A 2CZ1B 3KUFA 2V8KA 2XICA 4JRQA 2XIDA 4J8OA 4QVZA 5CKFA 2HAXA 4ZTFA 1QVFS 3CMEA 2DZCA 4PJOB 1YCYA 5FU7B 5CAIA 3A8GB 2DZ9A 3QXEB 1YITT 4M7AC 1N9SA 3JAME 1Q82C 1K9MC 2VV5A 3N5BB 2CZ6B 5GAMe 4E7LA 3ZEHA 2CKKA 3OYGA 4HT8A 3CCMA 2IG0A 3OSSC 4ZGDB 3JCMW 3LW5E 4OGEA 1S72A 4QW2A 5KE3A 3CPWS 1QVGA 4EMKB 4C5EA 3OYIA 4II1A 4J6YA 2LQ8A 4LDXA 1I8FA 1ZQ1A 4C8QC 3OYHA 1M1KU 3DB3A 4HCZA 4PKCC 3A8LB 4ZN1A 2K57A 4C8QD 3NTIA 1UB4A 1FXXA 2RK2A 2ZPIB 3CBMA 4HA8A 1N8RC 3L2RA 3LX7A 4FU6A 3X20B 1VQKA 4CI0C 5LJ3f 5D6XA 3HPWA 4C8QA 2RB6A 1BI0A 2E6NA 5GAN4 3I56T 3CCLT 4C0DB 1Q7YC 4CRIA 2EJGA 1Y7XA 3GNFB 1WQWA 5LJ3j 3DB4A 2O4XA 2RA2A 3QPHA 3SB2A 4D6WA 1VQ4A 3FEOA 5GANf 3NFCA 1UGRB 3QJ6A 4M78B 4N0AA 3SD4A 1KHCA 3CCQT 1XQHA 3CCVT 2WACA 4NL3A 1W4SA 3L2VA 2EQKA 3MP6A 2RHYA 5KE2A 2M1HA 4F7UG 1VQ7T 3FIFA 3TREA 3CCRA 3S6WA 1IREB 4MMLA 2VYTA 3OQ5A 3INZA 2A3LA 4E7IA 3TCJA 3JB9G 3NTKA 5LJ5f 4MZMA 5GAN5 4JDSA 5M9OA 2QA4T 4XTYA 4BI8B 1D3BA 5DLOA 1BKBA 2D9TA 1YJ9T 3OS2A 2BKDN 3RIRA 2M16A 2LNVA 2RM4A 3A8OB 5I2SA 1VQMT 2DK3A 1N6AA 3CC4T 2XI9A 4X9DA 3UT1A 4M7DB 3G4ST 2RJEA 4RCCA 2QQBA 4HT9A 2R58A 3QSUA 1ZHIA 3C95A 2ZPBB 4ME7A 4XQ3A 2GCXA 3QZ5B 3CC2T 3OS0A 4R55A 3JCMe 4F7UF 3M54A 3RKXA 5LJ3g 1KD1U 1QVFA 3HFOA 3CC7A 3Q1JA 1N27A 4JS4A 4BE1A 2RHXA 1SSFA 2OAUA 3MEUA 3CPFA 2XU8A 3FC3A 4JUVA 4JRKA 2K3XA 1Y96B 5FU6B 4IUUA 3ME9A 1KHIA 3VUBA 4E7JA 3JB9J 3LWIA 2M9UA 2C06A 1WJRA 2KQWA 5GANg 3L2QA 4PNOA 3CPWA 4ATOA 4M75G 4N4GA 2XG8D 1LNXA 2OTJA 2P0PA 4A4KA 5A0GA 3CCUT 4C8QE 3JCMJ 2LDMA 2MWPA 2JVVA 1W2BS 5GMKm 1I81A 4B9WA 4BD3A 2DJZA 4E7KA 3M9QA 3OSVA 3ZFJA 4OP0A 2PUKB 2F69A 5LJ5g 4HCCA 3UPUA 3BFMA 5CK9A 3QUIA 2LTOA 4M77G 3KBGA 3G6ET 4BY6B 4C92F 4OF1A 2JZ2A 4RG2A 4RMOA 1R8OB 1G5VA 3OYLA 3OA6A 3DKMA 3QBYA 3QHSA 4O5VA 1QP3A 5IAYA 2MF2A 1YITA 3OYDA 2EFIA 2RJFA 4O6JA 3ZBDA 3QYHB 2DXUA 3CBPA 4XTUA 4F7UA 3L42A 2QEXT 4L59A 3J80E 4PJOG 1MGQA 1NPRA 4FL6A 2JN0A 3PIPA 2QQ9A 3GPLA 2M0OA 2JTMA 3OY9A 1IZ6A 2BUDA 2X4WA 4XK8E 5CVIA 3JB9I 3RMQA 1VQLT 4M7AB 4MDXA 2PVDB 2BIVA 4FSXA 3CMAT 1O75A 4XU2A 3V8JA 1Q86C 4A53A 5HKCA 3OYAA 2Y4YA 4LD6A 5J26A 4LDYA 4J5YA 1XOVA 2F5TX 4C92C 2EQUA 3HRUA 4A4GA 3I56A 3CCLA 2ZCFB 2MAMA 2OTLT 2MWOA 4C8QB 4C92D 5GMKe 3OYEA 2JOYA 2DD4A 4OB0B 2DTHA 4JRIA 2QQSA 3CCQA 2L89A 1PSEA 2Y90A 2ZPGB 5I2MA 3V7CA 4C92A 4QQGA 3CCVA 1B34A 2XHCA 2RK1A 2DD5A 2P4TA 3L2ZA 5KH6A 2RJCA 1VQ7A 3P8DA 1U1TA 1XNIA 2RHUA 2LCCA 2QXFA 2ZZDA 2RHIA 3BW1A 3M56A 3JCMV 3X28B 3E19A 1KG1A 3CD6T 3FDRA 4M78G 1Q81U 3JSCA 4WF2A 4EMGA 4ZN3A 1VQOT 2EQMA 2ZPEB 1G3WA 2KDSA 4KBMB 2GFUA 2QA4A 3E9GA 5IT9E 3META 3KXTA 1YJ9A 2X35A 4M77D 1JRIA 3QJYA 4N0AC 1G3TA 1EIFA 1NPPA 3TU4K 1W2BA 1VQ6T 1VQNT 3FB9A 1D3BB 2CZ7B 1VQMA 3CC4A 1FWZA 3PNWC 2V8JA 3OYFA 3NTHA 2ZPHB 4KULA 4M77A 3M5AA 1NE8A 3VYHB 3CCST 5J3BA 2HQXA 4BE2A 1K73C 2D6FA 4C0FA 2R5AA 4JRPA 3I55A 5GMKh 3PMIA 3EFSA 2K4YA 4X9CA 4ZGEB 3CC2A 4F7UE 5IN1A 4E7HA 4PJOD 4M7DG 2RI3A 2VC8A 1NJIU 4LDUA 3MEVA 1M1GA 1OZ2A 2RI2A 2VXFA 3BY7A 3M53A 5CCAA 3L1AA 5GANj 5GAMd 3S3OA 4PJOA 4X34A 1X6OA 4VUBA 2K5IA 1BI1A 3HHTB 2RJDA 5LJ3e 2XDPA 1VQ8T 1NZ9A 2LC4A 5KCHA 1K8AU 2XD0A 3X25B 3OS5A 1O9SA 2FVUA 5C6SA 2P0QA 3CCUA 5LJ5j 2L5QA 3TEEA 1QW1A 2D0QB 4PL6A 5FLXE 3CCMT 2E70A 3BDLA 3CBOA 3CCET 2MI6A 1M90U 1M4ZA 1UGSB 3JCMP 2DXCA 4M7DF 4NS5A 2VGNA 4HKEA 5CKHA 1YIJA 2CGHA 4KUDK 2VGMA 3G6EA 2E10A 4XAXB 4C92E 1YJWT 1BIBA 4J83A 3VUZA 4BE0A 2CZ0B 1AHJB 3PIOA 4Y91A 3SWNC 5HY6A 3OYBA 1OZ3A 5LJ5e 3JB9F 3JRZA 4NOYA 3X24B 3HRTA 4N4IA 2A7YA 3LGLA 2KAFA 3MHXA 4M78D 4HCBA 3RERA 3M58A 4IURA 1Q82U 1K9MU 1FX7A 1P92A 4LDVA 4UC4A 3OYNA 5DY9A 2QEXA 2E1HA 2EJ9A 2LQKA 3FLGA 3G7ZA 4FT2A 4MZPA 5LJ3h 3CCJT 1Y07A 3HFNA 2P0KA 4M78A 1YHQT 3SWNA 4DA4A 5I21A 4J7FA 3PMTA 3F70A 3GIBA 2RO0A 3MO8A 2WSEE 2B8AA 2AHJB 3HKSA 1V29B 4LDWA 4PLLA 3RKWA 5CQYA 5DM7R 1VQLA 4EDUA 5CR2A 4A4EA 4GLKA 3CMAA 2NLUA 2DTIA 5GANh 2PQWA 2ZPFB 4EPCA 1M1KC 2KY9A 3UDCA 4M7DC 1KC8C 1JB0E 1N8RU 5HK3A 2DIGA 1GXIE 4B9XA 1RL2A 2GFAA 5DLQE 5C0MA 3S3NA 4M7DD 5AYFA 2K2VA 3MEAA 4M7AG 5GMKl 1YBYA 2OTLA 4XU0A 4V2SA 2X4JA 3RUXA 1Q7YU 2HD0A 5GAN6 2ZGWA 4M7DA 3WVEB 4M75F 2HNIA 2KVQG 3JCMc 5LJ5h 3R6OA 1M1FA 4MZTA 3JCMd 3JB9D 4LD9K 1G3YA 2DKGA 3A8HB 2FL7A 4C8QG 3VYGA 4C92B 2L8DA 1B34B 2DTOA 3G71T 4ZGJB 3OS1A 1UGQB 1WJSA 2K5FA 2X4XA 1JJ2S 2GQVA 2E64A 1YJNT 1M5Q1 2EYQA 1VQOA 2K3YA 2YLBA 4M77F 2DVEA 3SDZA 5J39A 2XDDA 2WSCE 1Y96A 2MMPA 4A4HA 5GAOm 4Z02A 2Y4XA 3LYIA 4BDYA 1X01A 3RESA 3GNGA 3FJPA 1VIFA 1VQ6A 2RI5A 1KQ1A 1N9RA 3QZ9B 3J81E 2CS7A 1VQNA 3T9NA 2XKOC 4MDWA 4FIBA 2FHDA 3RKYA 3CCSA 5GAMf 2L3RA 3H6ZA 3J7AF 1QVPA 4TVRA 2VUBA 4PJOF 4M75C 4C0ZA 3JCMQ 1BI3A 3GOXA 3OW2S 2O4XB 3HP9A 4M75D 1BYMA 2KMTA 3ASKA 5D6WA 5GAMj 4JS5A 5LL6S 3O8VA 4MMKA 1VQ9T 2LRQA 3A5ZB 1G3SA 1VIEA 3C4SA 4M78E 2GF7A 4BUGA 3OBWA 3CXCS 1M9SA 1BI2A 2HQEA 1KD1C 4M75A 2PU9B 3OMCA 3E1SA 4JLGA 4L5GA 1YI2T 4C5GA 5HK0A 1LJOA 3V8KA 2DPPB 1VQ5T 2XK0A 2YRVA 2DXBA 4M77C 3PT9A 4XTWA 3LGFA 1HK9A 5GMKi 3OYMA 3JCMX 2R5MA 1VQ8A 4IKFA 3P8HA 2EJFA 2QQAA 3MEWA 4M7AD 3CCEA 4J6WA 2QTXA 1MHNA 3G4SA 3MP8A 3HRSA 3OYJA 3GP8A 2LVMA 2YHTA 3H8ZA 3P8BB 4C5HA 3MCAB 4OB3B 4M7DE 1WJQA 1BIAA 4PLIA 1VQPT 4M7AA 4Q5WA 4PJOC 4J6XA 4YTLA 5FU7C 4OB2B 1YJWA 1KC8U 1KQSS 2HBPA 5GAOr 5A0DA 3QG1A 4M78F 1VUBA 3E9FA 4DQ2A 3M55A 4IUPA 3WVDB 1UEBA 5GAN7 3LWHA 5GAMg 3HSBA 4XU3A 2O01E 4EMKC 1XTDA 5CIUA 2FB7A 3C94A 1WPYA 2PUOB 2JUFA 1JBMA 4BI4A 3CMET 5KCOA 3V8LA 2KK4A 1LOJA 2LCLA 5CQXA 3CCJA 2DXTA 3ER0A 3VJPA 4JJNK 2E12A 1YHQA 5FROA 3L2WA 2EWNA 1U8RA 5FRNA 4C0GA 1JJ2A 3PTAA 4EMKA 3UWNA 4RG8A 3SWNB 2K5LA 2QI2A 5GAMh 3AHUA 5GANe 1S72T 4BB7A 4DOWA 4OGCA 5A2QE 3JCMf 2QDYB 1Q86U 4C0DC 4DOVA 3BDUA 2DAQA 1Y71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TEE A;  3VKI A;  3VJP A;  3FRN A; 
#chains in the Genus database with same CATH topology
 1PRL C;  5GAN 2;  1U06 A;  5GAN 8;  3C12 A;  3I56 Q;  3EAE A;  5GAO q;  1GFC A;  1GL5 A;  2OI3 A;  5GAO p;  5A0L A;  2EKO A;  3QII A;  1TTH B;  4HCK A;  2HKN A;  1IHW A;  2O2O A;  1D1B A;  1VQ4 T;  2HMA A;  4RTZ A;  1YJN A;  1PSF A;  4R56 A;  2L3S A;  3JB9 H;  2HBW A;  4C92 G;  4E7Z A;  1ABQ A;  2W10 A;  1YJ9 Q;  3H41 A;  2KSS A;  2BTT A;  4KT0 E;  1OYX A;  2LT4 A;  4GY5 A;  3G4S Q;  1K73 U;  3JCM g;  1C6V X;  1WZO A;  3JCM b;  2I2L A;  2E41 A;  2V1R A;  3GLX A;  2CDT A;  3X26 B;  5CKD A;  4OMN A;  1OI1 A;  1NJI C;  2QGF B;  3JCM h;  3CC7 T;  5L8R E;  2J6O A;  4M7A F;  3CCJ Q;  2YXY A;  3S3M A;  4N4H A;  1PCX A;  1ACM B;  1KQ2 A;  1RI9 A;  4J7I A;  2ROL A;  2DA9 A;  4KRT A;  5GAO n;  3C0C A;  1WHG A;  2E65 A;  2K3B A;  2RHZ A;  3THK A;  3VS5 A;  4E47 A;  3QWY A;  1RAH B;  1VA7 A;  1ZA1 B;  2K7A A;  4LUE A;  1VYT A;  2H3E B;  2LX9 A;  5EG2 A;  4PJN A;  1X6B A;  2XID A;  1N5Z A;  4K11 A;  3A8G B;  3JAM E;  2CZ6 B;  4HT8 A;  3CCM A;  1RAE B;  3U23 A;  4ZGD B;  2HQH A;  4OGE A;  1S72 A;  3OYI A;  4C5E A;  1ZQ1 A;  5KYN A;  1M1K U;  2E3H A;  4CC7 A;  4ZN1 A;  3VS3 A;  2RK2 A;  4HA8 A;  2EGC A;  1N8R C;  3L2R A;  3LX7 A;  2DET A;  2RB6 A;  1BI0 A;  1Q7Y C;  2YDL A;  1Y7X A;  3M0R A;  2JJ9 A;  3QPH A;  5GAN f;  4M78 B;  3SD4 A;  4WCI A;  2WAC A;  1W4S A;  2M1H A;  3UA7 A;  2KRS A;  1IRE B;  4MML A;  4DBF A;  3INZ A;  1VQ6 Q;  2CSI A;  3ULR B;  2D9T A;  3OS2 A;  3RIR A;  4WTO B;  1VQM T;  5I2S A;  2XI9 A;  1QKX A;  4RCC A;  2QQB A;  1CKB A;  1X43 A;  3A1P A;  3C95 A;  1MMG A;  3M54 A;  1GRI A;  3RKX A;  5LJ3 g;  3HFO A;  4JS4 A;  1SG5 A;  2RHX A;  2HKQ B;  2LJ3 A;  5KYX B;  1KHI A;  3BE3 A;  2RQT A;  2C06 A;  3L2Q A;  4PNO A;  3MJX A;  2XG8 D;  2OTJ A;  2P0P A;  4JZ4 A;  2JVV A;  1W2B S;  1KQS P;  3ZFJ A;  4OP0 A;  1JEG A;  2F69 A;  1UDL A;  2L0A A;  5LJ5 g;  3UPU A;  3NHN A;  3QUI A;  1NEB A;  4BY6 B;  1FMK A;  1VQK Q;  4EIK A;  4D8K A;  3OA6 A;  1UFF A;  4FYX B;  5IAY A;  4O6J A;  3ZBD A;  2E5K A;  4F7U A;  5D7U A;  1E6H A;  3PE0 A;  1MGQ A;  4FL6 A;  1TU0 B;  2QQ9 A;  1WHL A;  2BUD A;  2X4W A;  2LNH B;  4MDX A;  2KRO A;  3CMA T;  4XU2 A;  4LNP A;  1X2Q A;  4A53 A;  2O88 A;  1WHH A;  4LD6 A;  1T3L A;  2JM9 A;  3UA6 A;  2EQU A;  3I56 A;  2JXB A;  4C8Q B;  3NMZ C;  2DD4 A;  4B6M A;  4JRI A;  2L89 A;  5I2M A;  1QVG P;  2DLP A;  2QAZ A;  2DD5 A;  3JV3 A;  2LCC A;  3BW1 A;  1PKT A;  3JCM V;  1HYO A;  3CD6 T;  3FDR A;  3JSC A;  4WF2 A;  1VQO T;  2K2M A;  1YJ9 A;  3MET A;  1JRI A;  3TSW A;  1NPP A;  1UGV A;  3TU4 K;  1W2B A;  1TUG B;  1FWZ A;  1OU9 A;  3PNW C;  2G6F X;  2PZ1 A;  1UHF A;  2ZPH B;  2HQX A;  1K73 C;  2R5A A;  4ANJ A;  1JJ2 P;  5GMK h;  4F7U E;  5IN1 A;  2J7I A;  2VC8 A;  3MEV A;  1M1G A;  1OZ2 A;  2RI2 A;  1VQ5 Q;  1IGQ A;  3L1A A;  4X34 A;  2K6D A;  3HHT B;  1VQ8 T;  5KCH A;  1RAB B;  2QGG A;  2J05 A;  3OS5 A;  4HVW A;  3CCU A;  2JW4 A;  1ABO A;  1ZSZ B;  5LJ5 j;  1VQP Q;  2VVK A;  1UJY A;  2J06 A;  1M90 U;  4X1V A;  4Z88 A;  3G6E A;  4XAX B;  2CZ0 B;  1AHJ B;  1UJ0 A;  5HY6 A;  3OYB A;  3JRZ A;  4NOY A;  3LGL A;  3M58 A;  2QEX A;  2E1H A;  2LQK A;  2NUT A;  3IQL A;  3CCQ Q;  3CCJ T;  1Y07 A;  3HFN A;  2X3W D;  1YHQ T;  4DA4 A;  3EG9 A;  5I21 A;  2WSE E;  4LDW A;  4PLL A;  1K0X A;  5CQY A;  1PNJ A;  2M51 A;  4EPC A;  1M1K C;  4M7D C;  2C0T A;  2DIG A;  1GXI E;  2HSP A;  4B9X A;  1RL2 A;  4M7D D;  3S3N A;  2K2V A;  2OTL A;  1G8X A;  2HEQ A;  2X4J A;  4J9F A;  2RNA A;  4M7D A;  4MZT A;  5AT1 B;  1G3Y A;  1OOT A;  3REB B;  2DVJ A;  2DTO A;  2K5F A;  3D7S B;  5FWB A;  1SRM A;  1M3A A;  1M5Q 1;  2EYQ A;  4J9C A;  2QK0 A;  2XDD A;  4M77 F;  2DX1 A;  1W1F A;  2WSC E;  1Y96 A;  2AKL A;  2MMP A;  2NYS A;  1K9M R;  4BDY A;  1VQ6 A;  1VIF A;  1VQN A;  1Z9Z A;  2COW A;  3J81 E;  2CP0 A;  2DBK A;  3T9N A;  1GFD A;  1Q95 G;  4MDW A;  2C0I A;  3RKY A;  2L3R A;  3H6Z A;  1T0J A;  3TSZ A;  4F16 A;  2FEI A;  2VUB A;  4PJO F;  2BZ8 A;  3JCM Q;  2EYW A;  3OW2 S;  5HCK A;  3ASK A;  4JS5 A;  1VQ9 T;  1MMA A;  3O8V A;  1VIE A;  2GF7 A;  3CC7 Q;  1M9S A;  3E1S A;  4JLG A;  2DPP B;  2XK0 A;  1JXO A;  2W0Z A;  1V76 A;  1AZG B;  4M7A D;  3OYJ A;  2KBT A;  4C5H A;  4M7D E;  5GJW B;  4PLI A;  4M7A A;  4CC4 B;  4OB2 B;  1YJW A;  3NGP A;  1LCK A;  1PRM C;  2IIM A;  2J6F A;  1VUB A;  1UTI A;  1XTD A;  4Z8A A;  4BI4 A;  2LCL A;  1LOJ A;  3ER0 A;  3L2W A;  4C0G A;  4AFS C;  2K5L A;  2QI2 A;  3EHQ A;  4BB7 A;  4LUD A;  3G1J A;  1M8V A;  2KYM A;  3OYC A;  2MPX C;  2XDB A;  1UG1 A;  1I5L A;  3VV0 A;  2CP3 A;  4M78 C;  4R0K A;  2DEU A;  3EFR A;  4LE9 A;  5L23 A;  1VQK T;  1RI0 A;  4C5I A;  1CKA A;  3OW2 A;  4OVA A;  2DM1 A;  3M59 A;  4EMH A;  4F7U B;  1PD0 A;  2WSF E;  3RMS A;  1TH7 A;  1WIE A;  1QP2 A;  4A4F A;  1OV3 A;  3NPF A;  4RTT A;  1U1S A;  2HL5 C;  1ZBX A;  1RLP C;  1W6X A;  2DMO A;  4ELY C;  2LT1 A;  4M7A E;  2DRK A;  3TQ7 P;  3VS2 A;  2X51 A;  1VQM Q;  1H64 1;  3EH1 A;  4RTU A;  3OYY A;  5GAN 3;  2DIQ A;  5KYW B;  3LH0 A;  1I4K 1;  4RCB A;  2BZY A;  2VAS A;  3FRN A;  2LP5 A;  2YLC A;  2VXE A;  1VQ5 A;  4IUT A;  1SF9 A;  4M75 B;  3UF4 A;  4KUI A;  4QT7 A;  1M2O A;  2EIF A;  1WNL A;  3HL8 A;  1RAG B;  4BI3 A;  1R77 A;  2DEQ A;  3QDR B;  2DF6 A;  5CO7 A;  1WHM A;  4BY6 C;  4QVD A;  1VQP A;  1X2K A;  3L2U A;  3A98 A;  3OBY A;  3M4Y A;  1WGS A;  3EGX B;  1M90 C;  4XTZ A;  1UHC A;  2JTF A;  4XTV A;  1Y0M A;  2RD1 A;  1QCN A;  4QKU A;  4ZTF A;  1QVF S;  4J9I A;  4JPB W;  5FU7 B;  3QXE B;  2OJ2 A;  4E7L A;  2IG0 A;  3JCM W;  3LW5 E;  4QW2 A;  5KE3 A;  4FYY B;  3CMA Q;  4LDX A;  1EFN A;  4C8Q C;  2NUP A;  4C8Q D;  3NTI A;  1FXX A;  2Z0W A;  1K0S A;  4FU6 A;  3X20 B;  5D6X A;  1MNE A;  3HPW A;  4C8Q A;  2E6N A;  2ZAE A;  5GAN 4;  3CCL T;  4C0D B;  2EBP A;  1WQW A;  3DB4 A;  2NUT B;  1W70 A;  1VQ4 A;  5I22 A;  3FEO A;  3CCQ T;  1NEG A;  1D0Z A;  1XQH A;  3EG9 B;  4Z89 A;  3MP6 A;  2EGA A;  3CD6 Q;  1YI2 Q;  2HCK A;  1VQ7 T;  1HJD A;  3FIF A;  3M0T A;  3TRE A;  2KEA A;  3OQ5 A;  2A3L A;  3TCJ A;  3NTK A;  2GGR A;  2M16 A;  2LNV A;  3CC4 T;  1JO8 A;  4M7D B;  2ESW A;  4X9D A;  2SEM A;  4HT9 A;  4ORZ A;  3MKD A;  3EG1 A;  2ZPB B;  2GCX A;  3CC2 T;  1WI7 A;  4R55 A;  3OS0 A;  1D09 B;  1QVF A;  1NG2 A;  4AFZ C;  3CC7 A;  1N27 A;  1SSF A;  1ZSZ C;  2OAU A;  1YCS B;  3CME Q;  3FC3 A;  2O9S A;  4DBQ A;  4JUV A;  1Y96 B;  5FU6 B;  3VUB A;  1VQ8 Q;  3LWI A;  2J6K A;  5GAN g;  2KQW A;  4DBH A;  4ATO A;  4JJB A;  1ZSZ A;  1LNX A;  1M2V B;  4E7S A;  5A0G A;  4C8Q E;  1NM7 A;  2LDM A;  5GMK m;  4B9W A;  1Q86 R;  1PM3 A;  2E3I A;  3M9Q A;  5ECA A;  1WHJ A;  2FPE A;  3KBG A;  2D8H A;  2KRM A;  4C92 F;  4OF1 A;  4RG2 A;  4RMO A;  1R8O B;  3OYL A;  1WHK A;  3DKM A;  2ECZ A;  1D0X A;  1IO6 A;  4FW1 A;  1VYV A;  1QP3 A;  2MF2 A;  2RJF A;  1YHQ Q;  3QYH B;  1PWT A;  2BE7 D;  1OX9 A;  1NPR A;  1T3S A;  1KD1 R;  4XK8 E;  1TUC A;  4AFQ C;  3RMQ A;  3CCR Q;  1AWX A;  4M7A B;  2PVD B;  4FSX A;  3SEM A;  4LXC A;  3H9N A;  3OYA A;  5J26 A;  4LDY A;  2KYB A;  2HDA A;  2B86 A;  1XOV A;  1IB8 A;  4IIM A;  4A4G A;  2ZCF B;  3I35 A;  2DTH A;  1AWO A;  2ZPG B;  2XHC A;  2P4T A;  2CP7 A;  3L2Z A;  1VOM A;  1OPK A;  2ZZD A;  1TWB A;  2JMC A;  1KJW A;  3M56 A;  3X28 B;  2JMA A;  1KG1 A;  4M78 G;  1Q81 U;  4ZN3 A;  2KDS A;  4KBM B;  2BE9 B;  2XMF A;  3KXT A;  4M77 D;  1SKU B;  1VQM A;  2CZ7 B;  2V8J A;  3OYF A;  4M77 A;  1VQ9 Q;  3I55 A;  4J9H A;  1YP5 A;  2CT3 A;  4E7H A;  1RLQ C;  4PJO D;  2RQR A;  3BY7 A;  3M53 A;  5GAN j;  1IGU A;  5GAM d;  4JJD A;  4PJO A;  1X6O A;  1BI1 A;  1YIT Q;  4AG1 C;  2RJD A;  2XDP A;  9ATC B;  2LC4 A;  3X25 B;  1O9S A;  3I9Q A;  3TEE A;  3CCM T;  2VKN A;  3CCE T;  5FLX E;  2E70 A;  3CBO A;  1M4Z A;  1UGS B;  3CXC P;  4NS5 A;  4HKE A;  1YIJ A;  1X69 A;  2CGH A;  1NYF A;  1UEC A;  2MK5 A;  3PIO A;  3X24 B;  3HRT A;  5KYU A;  3MHX A;  2KAF A;  4IUR A;  1FX7 A;  1P92 A;  1X27 A;  5LJ3 h;  1ZBJ A;  2OX7 A;  4J7F A;  3PMT A;  5FWC A;  1NJI R;  4GLK A;  1UE9 A;  3RR6 A;  3CMA A;  2NLU A;  2ZPF B;  2KY9 A;  2LQN A;  1KC8 C;  1QWE A;  1H8K A;  2QA4 Q;  5AYF A;  5GMK l;  1YBY A;  4V2S A;  2RF0 A;  1ZA2 B;  2L2P A;  2HD0 A;  5GAN 6;  2ZGW A;  5LJ5 h;  3JCM d;  3R6O A;  3JB9 D;  2LJ1 A;  1A0N B;  2DKG A;  1WA7 A;  2M02 A;  4C8Q G;  3CQT A;  2L8D A;  1B34 B;  4FYW B;  4J9B A;  4ZGJ B;  3G71 T;  6AT1 B;  1B7T A;  3OS1 A;  2X4X A;  1JJ2 S;  1VQO A;  2OAW A;  2K3Y A;  2YLB A;  5J39 A;  5GAO m;  2NUP B;  4AG2 C;  1K1Z A;  1X01 A;  4LN2 A;  3FJP A;  2RI5 A;  1KQ1 A;  1N9R A;  1RAC B;  4FCY A;  2F2W A;  1WXU A;  3J7A F;  5KYW A;  4M75 C;  1WXB A;  4DBR A;  1LVK A;  4M75 D;  5D6W A;  2DER A;  3A5Z B;  3C4S A;  4BUG A;  3OBW A;  2DFU A;  1BI2 A;  4M75 A;  1YI2 T;  3EHR A;  2GBQ A;  1AVZ C;  1NLO C;  4OML A;  1SHF A;  1HK9 A;  3JCM X;  2YRD A;  1VQ8 A;  3P8H A;  2FO0 A;  3MEW A;  1WYX A;  4J6W A;  2QTX A;  4AFU C;  2EW3 A;  2DBM A;  2I0N A;  3G4S A;  2LVM A;  3H8Z A;  3EGX A;  2FPD A;  4JJC A;  4Q5W A;  4J6X A;  5FU7 C;  4CC2 A;  3E9F A;  1OX8 A;  3HSB A;  2O01 E;  5CIU A;  1WPY A;  3CME T;  4PJJ A;  4FW2 A;  3CCJ A;  2HL3 A;  1YHQ A;  1U8R A;  5FRN A;  1JJ2 A;  2QG9 B;  3SWN B;  5GAN e;  3M0U A;  3R6N A;  5A2Q E;  1Q86 U;  2EGE A;  4C0D C;  1WJQ A;  2EPD A;  5I11 A;  1H92 A;  3OB9 A;  2MOX A;  3CCL Q;  4FM4 B;  3VU3 C;  4M75 E;  2G3R A;  2CT4 A;  3CCS Q;  2F5K A;  3CPW P;  4QQD A;  1BU1 A;  4OB1 B;  2DO3 A;  3M57 A;  3QYG B;  1VQ7 Q;  2EQJ A;  5LJ3 d;  4NL2 A;  1R0B G;  2FZG B;  4Y28 E;  2EAY A;  3CCR T;  1GBQ A;  4KGZ B;  1Q81 C;  3SFM A;  4ELZ C;  4BDZ A;  5IXF A;  1K8A R;  3CC4 Q;  2O9V A;  1HD3 A;  3PFS A;  2P84 A;  2LZ6 B;  2PVG B;  1QMC A;  3OYK A;  3CC2 Q;  3CEY A;  1VQ9 A;  1HXD A;  5FU6 C;  4BAC A;  5LJ5 d;  2FYK A;  3VKI A;  3PGG A;  2LQW A;  2AZS A;  4FSS A;  2GTJ A;  2BZX A;  2ABL A;  1Q82 R;  1UGP B;  3QKJ A;  1Y57 A;  3WXM B;  1M2V A;  5CKE A;  2E5Q A;  4QQ6 A;  1BYM A;  1X75 C;  4XU1 A;  2R57 A;  5GAO l;  2JT4 A;  4M77 B;  3DLL A;  5GMK j;  1B07 A;  2CYZ B;  2ED1 A;  3MP1 A;  2KRN A;  3RBB B;  4DEY A;  3M4G A;  3LLR A;  4QVC A;  2JM8 A;  2CZ1 B;  2QAS A;  2V8K A;  4QVZ A;  2DZC A;  4PJO B;  1YCY A;  5CAI A;  1K73 R;  3SHW A;  1QCO A;  1YIT T;  4M7A C;  4HVV A;  1TXQ A;  3ZEH A;  2YRC A;  3OSS C;  1ZUU A;  4EMK B;  1EX4 A;  1YJN Q;  4J6Y A;  2LQ8 A;  1I8F A;  1AD5 A;  2JS0 A;  2CP2 A;  3OYH A;  3DB3 A;  1MV3 A;  4HCZ A;  4PK4 A;  2NWM A;  1NBE B;  2K57 A;  3CBM A;  1ZSG A;  1VQK A;  2GNC A;  1Z9Q A;  1B3Q A;  5KYU B;  4CRI A;  2KT1 A;  3GNF B;  2HSE B;  2O4X A;  2CH4 W;  4D6W A;  2AT1 B;  3NFC A;  4N0A A;  2MCN A;  4KGV B;  1KHC A;  3CCV T;  4E6R A;  4NL3 A;  2RHY A;  5KE2 A;  4F7U G;  4J9G A;  2ED0 A;  3LH5 A;  2EYZ A;  3JB9 G;  5GAN 5;  5M9O A;  2QA4 T;  4XTY A;  5DLO A;  1BKB A;  3RDV A;  3OW2 P;  2RM4 A;  1N6A A;  1WFW A;  3EGD A;  3UT1 A;  3H0I A;  2RJE A;  2RPN A;  2H8H A;  4XQ3 A;  3QZ5 B;  4F7U F;  2D1X A;  3Q1J A;  4OMP A;  3H0H A;  1KK7 A;  4JRK A;  2GTO A;  1FMW A;  2YUO A;  1WJR A;  3M0S A;  4M75 G;  3CCM Q;  3CCE Q;  2KE9 A;  1D1C A;  4A4K A;  1MMN A;  3QDF A;  4FYV B;  1I81 A;  4BD3 A;  2DJZ A;  2F2X A;  2PUK B;  3BFM A;  5CK9 A;  2LTO A;  2JZ2 A;  2CP6 A;  1G5V A;  3VS6 A;  3QBY A;  3QHS A;  2RQW A;  2V26 A;  2DXU A;  3CBP A;  4CC3 A;  4HVU A;  4L59 A;  3EG0 A;  2JN0 A;  3EG3 A;  2JTM A;  3JB9 I;  5CVI A;  1VQL T;  3RNJ A;  2A0F B;  2BIV A;  1Q86 C;  3V8J A;  1BBZ A;  2A08 A;  2Y4Y A;  2F5T X;  5IH2 A;  3HRU A;  3CCL A;  2L3P A;  5IXB A;  5GMK e;  3OYE A;  2V1Q A;  5IHK A;  5IHI A;  3JB9 J;  3CCQ A;  1PSE A;  3V7C A;  3G71 Q;  4QQG A;  1B34 A;  1QLY A;  2RK1 A;  3M0Q A;  5KH6 A;  1VQ7 A;  3P8D A;  2RHU A;  2QXF A;  1NYG A;  1E6G A;  1ZX6 A;  3E19 A;  4EMG A;  2ZPE B;  1G3W A;  1OQK A;  5IT9 E;  2X35 A;  3VS0 A;  1HSQ A;  4J9E A;  2OTJ Q;  3FB9 A;  1D3B B;  3CC4 A;  2DL4 A;  4KUL A;  3VYH B;  4BE2 A;  3CCS T;  1NE8 A;  5J3B A;  2KNB B;  4JRP A;  3EFS A;  2K4Y A;  3QWX X;  3VS1 A;  3CC2 A;  2PNI A;  4RTY A;  4M7D G;  2RI3 A;  4LDU A;  3KFV A;  4M4Z A;  5CCA A;  1QCF A;  2DL5 A;  3EG2 A;  2KR3 A;  4VUB A;  2KI7 A;  3UAT A;  2ROT A;  1K8A U;  2FVU A;  4ZTJ A;  2D0Q B;  3BDL A;  3JCM P;  1YFN A;  4M7D F;  2VGN A;  4KUD K;  2QYZ A;  2E10 A;  1QVF P;  1XJW B;  4PFP A;  4J83 A;  1U3O A;  4E2F B;  4BE0 A;  4Y91 A;  3SWN C;  2LX7 A;  2VWF A;  1GCQ A;  4HCB A;  2A7Y A;  2SRC A;  3RER A;  1Q82 U;  1K9M U;  4UC4 A;  4A63 B;  3OYN A;  3G7Z A;  3FLG A;  4FT2 A;  3SWN A;  2X9H A;  1KFZ A;  2B8A A;  2AHJ B;  5DM7 R;  4EDU A;  2K79 A;  1MND A;  5GAN h;  3UDC A;  1JB0 E;  1GCP A;  3H0F A;  5HK3 A;  1D1A A;  2MYS A;  4OMO A;  3VRZ A;  5C0M A;  3GBQ A;  3MEA A;  4M7A G;  1F1B B;  4XU0 A;  2X3X D;  3M0P A;  2KXC A;  3WVE B;  2HNI A;  4LD9 K;  3JCM c;  1J3T A;  1M1F A;  1M90 R;  3A8H B;  2FL7 A;  3VYG A;  4C92 B;  1WJS A;  2E64 A;  4DEX A;  1YJN T;  2DVE A;  3SDZ A;  2O31 A;  4A4H A;  1RAA B;  2Y4X A;  3LYI A;  2F2V A;  3RES A;  7AT1 B;  1OEB A;  2XKO C;  3CCU Q;  2EVR A;  5GAM f;  1QVP A;  4TVR A;  4ZNX A;  2FZC B;  1BI3 A;  3GOX A;  2O4X B;  5GAM j;  3G6E Q;  4MMK A;  2K9G A;  2LRQ A;  2RQU A;  1OUL A;  1SEM A;  1PHT A;  3CXC S;  2CUD A;  3OMC A;  4L5G A;  1LJO A;  4M77 C;  2YRV A;  2DXB A;  4XTW A;  5GMK i;  3OYM A;  2R5M A;  2QEX Q;  1OU8 A;  3CCE A;  1M8M A;  1MHN A;  1X6G A;  1I1J A;  3HRS A;  3MCA B;  4OB3 B;  3EGD B;  4PJO C;  2EKH A;  4YTL A;  1KQS S;  5GAO r;  5A0D A;  4M78 F;  1I07 A;  4DQ2 A;  3M55 A;  4IUP A;  2OTL Q;  1GBR A;  2FRY A;  4PJM A;  4XU3 A;  4EMK C;  1SRL A;  2FB7 A;  2PUO B;  2JUF A;  1JBM A;  2RMO A;  1T0H A;  4F04 B;  2KK4 A;  5CQX A;  2DXT A;  4OMQ A;  5FRO A;  1SPK A;  1M27 C;  3PTA A;  4EMK A;  4RG8 A;  2QTV A;  2YWW A;  3AHU A;  2MIO A;  1S72 T;  2D0N A;  4OGC A;  3JCM f;  4DOV A;  2DAQ A;  1Y71 A;  1WLP B;  3PVQ A;  1RUW A;  1VQN Q;  4AMC A;  2DJQ A;  3URG A;  4IUQ A;  2DL8 A;  2V8I A;  2FPF A;  2VB6 A;  4PFO A;  2RH2 A;  1D0Y A;  2JNG A;  3VS7 A;  3CCV Q;  3GF5 A;  3CXC A;  3G71 A;  3I55 T;  1AWW A;  2X4Y A;  1WQ7 A;  4M77 E;  1H3H A;  4RKU E;  1QVG S;  5FRM A;  2YUQ A;  2PVO B;  1YWP A;  2LJ0 A;  2QDL A;  5EC7 A;  5GAN d;  3V7R A;  3A8M B;  4KH0 B;  1FYN A;  5CKB A;  4PJO E;  4PFZ A;  2CUB A;  1KQS A;  4FT4 A;  2QQR A;  4JLI A;  1H3Z A;  4L6V 5;  4OMF B;  1YJW Q;  1MUZ A;  1YIJ T;  2M0Y A;  4XTX A;  5D6Y A;  2RQV A;  3CD6 A;  1YN8 A;  1YI2 A;  3I5R A;  2ATC B;  3QO3 A;  3PVL A;  2DL3 A;  4Y92 A;  4RUG A;  4A54 A;  3OMG A;  4D8D A;  1V1C A;  1ZUK A;  1DJ7 B;  1K8A C;  2E6Z A;  2OTJ T;  1C0M A;  3V7S A;  4C8Q F;  1BCO A;  2IVW A;  3DLM A;  3EFO B;  4IUV A;  4RTW A;  1N8R R;  4P5N A;  2H3J A;  1PG5 B;  8ATC B;  2L3Q A;  4JRQ A;  3KUF A;  2XIC A;  2HAX A;  1OPL A;  2KXD A;  4J8O A;  2D8J A;  5CKF A;  1Q7Y R;  3CME A;  2DZ9 A;  1N9S A;  1PKS A;  1Q82 C;  2VV5 A;  3N5B B;  1W2B P;  1K9M C;  5GAM e;  2CKK A;  3OYG A;  1VYU A;  1QVG A;  3CPW S;  1VQL Q;  4II1 A;  2CSQ A;  4PKC C;  1BK2 A;  3A8L B;  1PC0 A;  1UB4 A;  2ZPI B;  3EH2 A;  2DNU A;  4CI0 C;  5LJ3 f;  1BCM A;  3I56 T;  1WX6 A;  1MMD A;  2EJG A;  2DYI A;  5LJ3 j;  2RA2 A;  2DE0 X;  3SB2 A;  2CRE A;  3QJ6 A;  1UGR B;  3L2V A;  1R0C B;  2EQK A;  5KYY A;  3CCR A;  1ARK A;  3S6W A;  2VYT A;  2YUN A;  1ZUY A;  4E7I A;  3O5Z A;  1PD1 A;  5LJ5 f;  2NUZ A;  4MZM A;  4JDS A;  4BI8 B;  1D3B A;  1YJ9 T;  2E4H A;  2BKD N;  1QWF A;  2KT8 A;  3E2U A;  1SHG A;  3A8O B;  2DK3 A;  2YUP A;  2LCS A;  1QKW A;  3G4S T;  2R58 A;  1AOJ A;  3QSU A;  1M30 A;  1ZHI A;  1KC8 R;  4ME7 A;  3JCM e;  3I5S A;  1KD1 U;  1E7O A;  1RAD B;  4GBQ A;  4BE1 A;  1JQQ A;  3MEU A;  3CPF A;  1TS9 A;  2DIL A;  2XU8 A;  1KSW A;  2K3X A;  4E7J A;  4IUU A;  3ME9 A;  2M9U A;  2AZV A;  3CPW A;  4N4G A;  1M3C A;  3CCU T;  3JCM J;  1QQJ A;  2MWP A;  2GQI A;  2DL7 A;  4E7K A;  3OSV A;  4HCC A;  4M77 G;  3G6E T;  2A28 A;  2HZY A;  4O5V A;  1LPL A;  2C0O A;  1YIT A;  3OYD A;  2EFI A;  4AT1 B;  4XTU A;  4RTX A;  3L42 A;  2QEX T;  1VQ4 Q;  3J80 E;  4PJO G;  3PIP A;  4JZ3 A;  3GPL A;  2M0O A;  3OY9 A;  1IZ6 A;  1O75 A;  5HKC A;  4ESR A;  4J5Y A;  1MV0 B;  4C92 C;  2MAM A;  2OTL T;  2IPO B;  2MWO A;  4C92 D;  2JS2 A;  3AT1 B;  2AK5 A;  2JOY A;  4OB0 B;  2QQS A;  2COZ A;  2Y90 A;  4C92 A;  3CCV A;  2JTE A;  2RJC A;  1RAF B;  1U1T A;  1XNI A;  2RHI A;  2EYX A;  1S1N A;  1TUD A;  4GLM A;  1TOV A;  2EQM A;  2GFU A;  1KIK A;  2QA4 A;  3E9G A;  1I0C A;  5IHN A;  3QJY A;  4N0A C;  1G3T A;  1EIF A;  2CP5 A;  1VQ6 T;  1VQN T;  4HXJ A;  3ZL7 C;  1C1A A;  3NTH A;  3M5A A;  2D6F A;  4C0F A;  3PMI A;  4X9C A;  4ZGE B;  1NJI U;  2AKK A;  2VXF A;  2DYB A;  3S3O A;  2EQI A;  2K5I A;  1RAI B;  5LJ3 e;  1AZE A;  1NZ9 A;  3VRY A;  2XD0 A;  5C6S A;  2P0Q A;  4F17 A;  2L5Q A;  1QW1 A;  4PL6 A;  2P4R A;  4J9D A;  2MI6 A;  1TG0 A;  1M1K R;  2DXC A;  5CKH A;  1Q81 R;  2VGM A;  4C92 E;  1YJW T;  1BIB A;  1M3B A;  3VUZ A;  3JB9 F;  1OZ3 A;  4RTV A;  5LJ5 e;  4N4I A;  4KGX B;  4M78 D;  2COY A;  1WDX A;  4LDV A;  5DY9 A;  2EJ9 A;  1G2B A;  1JU5 C;  4MZP A;  2P0K A;  4M78 A;  1S72 Q;  3F70 A;  3GIB A;  2RO0 A;  3MO8 A;  3HKS A;  3RKW A;  1V29 B;  2CH4 A;  1VQL A;  2FG0 A;  1JXM A;  5CR2 A;  4A4E A;  5FW9 A;  2DTI A;  2A37 A;  2PQW A;  1AEY A;  1N8R U;  2GFA A;  5DLQ E;  8AT1 B;  3HTR A;  2KGT A;  3TVT A;  1YNZ A;  3RUX A;  2PTK A;  1Q7Y U;  2LMJ A;  4M75 F;  2KVQ G;  3I55 Q;  1I5O B;  1K9A A;  1UGQ B;  1UUE A;  1AT1 B;  2GQV A;  4IIO A;  1NLP C;  5KYX A;  4Z02 A;  2F1L A;  1SSH A;  3GNG A;  3QZ9 B;  1CSK A;  2CS7 A;  4FIB A;  2FHD A;  2YSQ A;  3CCS A;  2RN8 A;  2FRW A;  4C0Z A;  2YT6 A;  3HP9 A;  1YIJ Q;  2KMT A;  1K76 A;  2A36 A;  5LL6 S;  4M78 E;  1G3S A;  2DRM A;  1IRX A;  1IXD A;  1KD1 C;  2HQE A;  2PU9 B;  5KYY B;  4C5G A;  1AWJ A;  5HK0 A;  1K4U S;  3V8K A;  1VQ5 T;  1BB9 A;  3PT9 A;  3LGF A;  4IKF A;  2EJF A;  2QQA A;  3FJ5 A;  3REA B;  3MP8 A;  3GP8 A;  2YHT A;  3P8B B;  1BIA A;  1VQP T;  2AIR B;  3EFO A;  3MPU B;  1EZZ B;  1ZLM A;  1KC8 U;  2HBP A;  4KH1 B;  1U5S A;  3QG1 A;  3LWH A;  5GAN 7;  3WVD B;  1UEB A;  1WXT A;  1TSF A;  5GAM g;  3C94 A;  3EGU A;  5GJV B;  5KCO A;  3V8L A;  2FZK B;  2ENM A;  3VJP A;  4JJN K;  2E12 A;  2EWN A;  1IHV A;  1YWO A;  4F14 A;  3UWN A;  3VS4 A;  5GAM h;  4OMM A;  1FMV A;  4DOW A;  2EYY A;  2QDY B;  1G83 A;  1GCQ C;  1VQO Q;  3BDU A;  4PJL A; 
#chains in the Genus database with same CATH homology
 1M8V A;  3OYC A;  3OB9 A;  5GAN 2;  2XDB A;  1I5L A;  3VV0 A;  4M78 C;  3C12 A;  5GAN 8;  3EAE A;  3EFR A;  5GAO q;  4FM4 B;  3URG A;  1VQK T;  1RI0 A;  3VU3 C;  4M75 E;  4C5I A;  5GAO p;  2G3R A;  4IUQ A;  5A0L A;  2EKO A;  2V8I A;  2F5K A;  3QII A;  4OVA A;  3OW2 A;  2RH2 A;  3M59 A;  4QQD A;  2JNG A;  4EMH A;  4F7U B;  2WSF E;  3GF5 A;  3RMS A;  1TH7 A;  4OB1 B;  2DO3 A;  3CXC A;  3G71 A;  1QP2 A;  3M57 A;  3I55 T;  1VQ4 T;  3QYG B;  4A4F A;  2EQJ A;  2X4Y A;  5LJ3 d;  1U1S A;  4NL2 A;  1YJN A;  1PSF A;  1WQ7 A;  4R56 A;  4M77 E;  4RKU E;  1ZBX A;  1QVG S;  4Y28 E;  2EAY A;  3JB9 H;  4ELY C;  3CCR T;  5FRM A;  2LT1 A;  4C92 G;  4M7A E;  1Q81 C;  2PVO B;  3SFM A;  4ELZ C;  4BDZ A;  5GAN d;  2KSS A;  3V7R A;  4KT0 E;  1H64 1;  1OYX A;  2LT4 A;  3A8M B;  3PFS A;  4GY5 A;  5CKB A;  4PJO E;  1K73 U;  3JCM g;  2PVG B;  3OYY A;  3JCM b;  5GAN 3;  3OYK A;  2I2L A;  2DIQ A;  1KQS A;  4FT4 A;  2QQR A;  4JLI A;  1H3Z A;  3LH0 A;  1I4K 1;  3CEY A;  4L6V 5;  4RCB A;  1HXD A;  5FU6 C;  4BAC A;  2E41 A;  4OMF B;  3GLX A;  1VQ9 A;  5LJ5 d;  2FYK A;  3X26 B;  3FRN A;  3VKI A;  3PGG A;  5CKD A;  1YIJ T;  4XTX A;  5D6Y A;  1OI1 A;  1NJI C;  3CD6 A;  1YI2 A;  2YLC A;  3QO3 A;  2VXE A;  3JCM h;  3CC7 T;  5L8R E;  1VQ5 A;  4IUT A;  4M75 B;  4KUI A;  4M7A F;  4ZTJ A;  2EIF A;  4A54 A;  1WNL A;  1UGP B;  3QKJ A;  3OMG A;  3WXM B;  4N4H A;  3S3M A;  5CKE A;  3HL8 A;  2E5Q A;  4QQ6 A;  1KQ2 A;  4J7I A;  1DJ7 B;  4BI3 A;  3QDR B;  2DEQ A;  5CO7 A;  4BY6 C;  1K8A C;  2E6Z A;  1X75 C;  4XU1 A;  5GAO n;  2OTJ T;  2E65 A;  2R57 A;  2RHZ A;  5GAO l;  4E47 A;  4QVD A;  1VQP A;  4M77 B;  3L2U A;  3V7S A;  4C8Q F;  3DLL A;  5GMK j;  3OBY A;  3M4Y A;  1WGS A;  1M90 C;  2IVW A;  3DLM A;  4XTZ A;  2CYZ B;  4IUV A;  4P5N A;  3MP1 A;  2H3J A;  2JTF A;  3M4G A;  3LLR A;  4XTV A;  2LX9 A;  4QVC A;  2RD1 A;  5EG2 A;  2CZ1 B;  3KUF A;  2V8K A;  2XIC A;  4JRQ A;  2XID A;  4J8O A;  4QVZ A;  5CKF A;  2HAX A;  4ZTF A;  1QVF S;  3CME A;  2DZC A;  4PJO B;  1YCY A;  5FU7 B;  5CAI A;  3A8G B;  2DZ9 A;  3QXE B;  1YIT T;  4M7A C;  1N9S A;  3JAM E;  1Q82 C;  1K9M C;  2VV5 A;  3N5B B;  2CZ6 B;  5GAM e;  4E7L A;  3ZEH A;  2CKK A;  3OYG A;  4HT8 A;  3CCM A;  2IG0 A;  3OSS C;  4ZGD B;  3JCM W;  3LW5 E;  4OGE A;  1S72 A;  4QW2 A;  5KE3 A;  3CPW S;  1QVG A;  4EMK B;  4C5E A;  3OYI A;  4II1 A;  4J6Y A;  2LQ8 A;  4LDX A;  1I8F A;  1ZQ1 A;  4C8Q C;  3OYH A;  1M1K U;  3DB3 A;  4HCZ A;  4PKC C;  3A8L B;  4ZN1 A;  2K57 A;  4C8Q D;  3NTI A;  1UB4 A;  1FXX A;  2RK2 A;  2ZPI B;  3CBM A;  4HA8 A;  1N8R C;  3L2R A;  3LX7 A;  4FU6 A;  3X20 B;  1VQK A;  4CI0 C;  5LJ3 f;  5D6X A;  3HPW A;  4C8Q A;  2RB6 A;  1BI0 A;  2E6N A;  5GAN 4;  3I56 T;  3CCL T;  4C0D B;  1Q7Y C;  4CRI A;  2EJG A;  1Y7X A;  3GNF B;  1WQW A;  5LJ3 j;  3DB4 A;  2O4X A;  2RA2 A;  3QPH A;  3SB2 A;  4D6W A;  1VQ4 A;  3FEO A;  5GAN f;  3NFC A;  1UGR B;  3QJ6 A;  4M78 B;  4N0A A;  3SD4 A;  1KHC A;  3CCQ T;  1XQH A;  3CCV T;  2WAC A;  4NL3 A;  1W4S A;  3L2V A;  2EQK A;  3MP6 A;  2RHY A;  5KE2 A;  2M1H A;  4F7U G;  1VQ7 T;  3FIF A;  3TRE A;  3CCR A;  3S6W A;  1IRE B;  4MML A;  2VYT A;  3OQ5 A;  3INZ A;  2A3L A;  4E7I A;  3TCJ A;  3JB9 G;  3NTK A;  5LJ5 f;  4MZM A;  5GAN 5;  4JDS A;  5M9O A;  2QA4 T;  4XTY A;  4BI8 B;  1D3B A;  5DLO A;  1BKB A;  2D9T A;  1YJ9 T;  3OS2 A;  2BKD N;  3RIR A;  2M16 A;  2LNV A;  2RM4 A;  3A8O B;  5I2S A;  1VQM T;  2DK3 A;  1N6A A;  3CC4 T;  2XI9 A;  4X9D A;  3UT1 A;  4M7D B;  3G4S T;  2RJE A;  4RCC A;  2QQB A;  4HT9 A;  2R58 A;  3QSU A;  1ZHI A;  3C95 A;  2ZPB B;  4ME7 A;  4XQ3 A;  2GCX A;  3QZ5 B;  3CC2 T;  3OS0 A;  4R55 A;  3JCM e;  4F7U F;  3M54 A;  3RKX A;  5LJ3 g;  1KD1 U;  1QVF A;  3HFO A;  3CC7 A;  3Q1J A;  1N27 A;  4JS4 A;  4BE1 A;  2RHX A;  1SSF A;  2OAU A;  3MEU A;  3CPF A;  2XU8 A;  3FC3 A;  4JUV A;  4JRK A;  2K3X A;  1Y96 B;  5FU6 B;  4IUU A;  3ME9 A;  1KHI A;  3VUB A;  4E7J A;  3JB9 J;  3LWI A;  2M9U A;  2C06 A;  1WJR A;  2KQW A;  5GAN g;  3L2Q A;  4PNO A;  3CPW A;  4ATO A;  4M75 G;  4N4G A;  2XG8 D;  1LNX A;  2OTJ A;  2P0P A;  4A4K A;  5A0G A;  3CCU T;  4C8Q E;  3JCM J;  2LDM A;  2MWP A;  2JVV A;  1W2B S;  5GMK m;  1I81 A;  4B9W A;  4BD3 A;  2DJZ A;  4E7K A;  3M9Q A;  3OSV A;  3ZFJ A;  4OP0 A;  2PUK B;  2F69 A;  5LJ5 g;  4HCC A;  3UPU A;  3BFM A;  5CK9 A;  3QUI A;  2LTO A;  4M77 G;  3KBG A;  3G6E T;  4BY6 B;  4C92 F;  4OF1 A;  2JZ2 A;  4RG2 A;  4RMO A;  1R8O B;  1G5V A;  3OYL A;  3OA6 A;  3DKM A;  3QBY A;  3QHS A;  4O5V A;  1QP3 A;  5IAY A;  2MF2 A;  1YIT A;  3OYD A;  2EFI A;  2RJF A;  4O6J A;  3ZBD A;  3QYH B;  2DXU A;  3CBP A;  4XTU A;  4F7U A;  3L42 A;  2QEX T;  4L59 A;  3J80 E;  4PJO G;  1MGQ A;  1NPR A;  4FL6 A;  2JN0 A;  3PIP A;  2QQ9 A;  3GPL A;  2M0O A;  2JTM A;  3OY9 A;  1IZ6 A;  2BUD A;  2X4W A;  4XK8 E;  5CVI A;  3JB9 I;  3RMQ A;  1VQL T;  4M7A B;  4MDX A;  2PVD B;  2BIV A;  4FSX A;  3CMA T;  1O75 A;  4XU2 A;  3V8J A;  1Q86 C;  4A53 A;  5HKC A;  3OYA A;  2Y4Y A;  4LD6 A;  5J26 A;  4LDY A;  4J5Y A;  1XOV A;  2F5T X;  4C92 C;  2EQU A;  3HRU A;  4A4G A;  3I56 A;  3CCL A;  2ZCF B;  2MAM A;  2OTL T;  2MWO A;  4C8Q B;  4C92 D;  5GMK e;  3OYE A;  2JOY A;  2DD4 A;  4OB0 B;  2DTH A;  4JRI A;  2QQS A;  3CCQ A;  2L89 A;  1PSE A;  2Y90 A;  2ZPG B;  5I2M A;  3V7C A;  4C92 A;  4QQG A;  3CCV A;  1B34 A;  2XHC A;  2RK1 A;  2DD5 A;  2P4T A;  3L2Z A;  5KH6 A;  2RJC A;  1VQ7 A;  3P8D A;  1U1T A;  1XNI A;  2RHU A;  2LCC A;  2QXF A;  2ZZD A;  2RHI A;  3BW1 A;  3M56 A;  3JCM V;  3X28 B;  3E19 A;  1KG1 A;  3CD6 T;  3FDR A;  4M78 G;  1Q81 U;  3JSC A;  4WF2 A;  4EMG A;  4ZN3 A;  1VQO T;  2EQM A;  2ZPE B;  1G3W A;  2KDS A;  4KBM B;  2GFU A;  2QA4 A;  3E9G A;  5IT9 E;  3MET A;  3KXT A;  1YJ9 A;  2X35 A;  4M77 D;  1JRI A;  3QJY A;  4N0A C;  1G3T A;  1EIF A;  1NPP A;  3TU4 K;  1W2B A;  1VQ6 T;  1VQN T;  3FB9 A;  1D3B B;  2CZ7 B;  1VQM A;  3CC4 A;  1FWZ A;  3PNW C;  2V8J A;  3OYF A;  3NTH A;  2ZPH B;  4KUL A;  4M77 A;  3M5A A;  1NE8 A;  3VYH B;  3CCS T;  5J3B A;  2HQX A;  4BE2 A;  1K73 C;  2D6F A;  4C0F A;  2R5A A;  4JRP A;  3I55 A;  5GMK h;  3PMI A;  3EFS A;  2K4Y A;  4X9C A;  4ZGE B;  3CC2 A;  4F7U E;  5IN1 A;  4E7H A;  4PJO D;  4M7D G;  2RI3 A;  2VC8 A;  1NJI U;  4LDU A;  3MEV A;  1M1G A;  1OZ2 A;  2RI2 A;  2VXF A;  3BY7 A;  3M53 A;  5CCA A;  3L1A A;  5GAN j;  5GAM d;  3S3O A;  4PJO A;  4X34 A;  1X6O A;  4VUB A;  2K5I A;  1BI1 A;  3HHT B;  2RJD A;  5LJ3 e;  2XDP A;  1VQ8 T;  1NZ9 A;  2LC4 A;  5KCH A;  1K8A U;  2XD0 A;  3X25 B;  3OS5 A;  1O9S A;  2FVU A;  5C6S A;  2P0Q A;  3CCU A;  5LJ5 j;  2L5Q A;  3TEE A;  1QW1 A;  2D0Q B;  4PL6 A;  5FLX E;  3CCM T;  2E70 A;  3BDL A;  3CBO A;  3CCE T;  2MI6 A;  1M90 U;  1M4Z A;  1UGS B;  3JCM P;  2DXC A;  4M7D F;  4NS5 A;  2VGN A;  4HKE A;  5CKH A;  1YIJ A;  2CGH A;  4KUD K;  2VGM A;  3G6E A;  2E10 A;  4XAX B;  4C92 E;  1YJW T;  1BIB A;  4J83 A;  3VUZ A;  4BE0 A;  2CZ0 B;  1AHJ B;  3PIO A;  4Y91 A;  3SWN C;  5HY6 A;  3OYB A;  1OZ3 A;  5LJ5 e;  3JB9 F;  3JRZ A;  4NOY A;  3X24 B;  3HRT A;  4N4I A;  2A7Y A;  3LGL A;  2KAF A;  3MHX A;  4M78 D;  4HCB A;  3RER A;  3M58 A;  4IUR A;  1Q82 U;  1K9M U;  1FX7 A;  1P92 A;  4LDV A;  4UC4 A;  3OYN A;  5DY9 A;  2QEX A;  2E1H A;  2EJ9 A;  2LQK A;  3FLG A;  3G7Z A;  4FT2 A;  4MZP A;  5LJ3 h;  3CCJ T;  1Y07 A;  3HFN A;  2P0K A;  4M78 A;  1YHQ T;  3SWN A;  4DA4 A;  5I21 A;  4J7F A;  3PMT A;  3F70 A;  3GIB A;  2RO0 A;  3MO8 A;  2WSE E;  2B8A A;  2AHJ B;  3HKS A;  1V29 B;  4LDW A;  4PLL A;  3RKW A;  5CQY A;  5DM7 R;  1VQL A;  4EDU A;  5CR2 A;  4A4E A;  4GLK A;  3CMA A;  2NLU A;  2DTI A;  5GAN h;  2PQW A;  2ZPF B;  4EPC A;  1M1K C;  2KY9 A;  3UDC A;  4M7D C;  1KC8 C;  1JB0 E;  1N8R U;  5HK3 A;  2DIG A;  1GXI E;  4B9X A;  1RL2 A;  2GFA A;  5DLQ E;  5C0M A;  3S3N A;  4M7D D;  5AYF A;  2K2V A;  3MEA A;  4M7A G;  5GMK l;  1YBY A;  2OTL A;  4XU0 A;  4V2S A;  2X4J A;  3RUX A;  1Q7Y U;  2HD0 A;  5GAN 6;  2ZGW A;  4M7D A;  3WVE B;  4M75 F;  2HNI A;  2KVQ G;  3JCM c;  5LJ5 h;  3R6O A;  1M1F A;  4MZT A;  3JCM d;  3JB9 D;  4LD9 K;  1G3Y A;  2DKG A;  3A8H B;  2FL7 A;  4C8Q G;  3VYG A;  4C92 B;  2L8D A;  1B34 B;  2DTO A;  3G71 T;  4ZGJ B;  3OS1 A;  1UGQ B;  1WJS A;  2K5F A;  2X4X A;  1JJ2 S;  2GQV A;  2E64 A;  1YJN T;  1M5Q 1;  2EYQ A;  1VQO A;  2K3Y A;  2YLB A;  4M77 F;  2DVE A;  3SDZ A;  5J39 A;  2XDD A;  2WSC E;  1Y96 A;  2MMP A;  4A4H A;  5GAO m;  4Z02 A;  2Y4X A;  3LYI A;  4BDY A;  1X01 A;  3RES A;  3GNG A;  3FJP A;  1VIF A;  1VQ6 A;  2RI5 A;  1KQ1 A;  1N9R A;  3QZ9 B;  3J81 E;  2CS7 A;  1VQN A;  3T9N A;  2XKO C;  4MDW A;  4FIB A;  2FHD A;  3RKY A;  3CCS A;  5GAM f;  2L3R A;  3H6Z A;  3J7A F;  1QVP A;  4TVR A;  2VUB A;  4PJO F;  4M75 C;  4C0Z A;  3JCM Q;  1BI3 A;  3GOX A;  3OW2 S;  2O4X B;  3HP9 A;  4M75 D;  1BYM A;  2KMT A;  3ASK A;  5D6W A;  5GAM j;  4JS5 A;  5LL6 S;  3O8V A;  4MMK A;  1VQ9 T;  2LRQ A;  3A5Z B;  1G3S A;  1VIE A;  3C4S A;  4M78 E;  2GF7 A;  4BUG A;  3OBW A;  3CXC S;  1M9S A;  1BI2 A;  2HQE A;  1KD1 C;  4M75 A;  2PU9 B;  3OMC A;  3E1S A;  4JLG A;  4L5G A;  1YI2 T;  4C5G A;  5HK0 A;  1LJO A;  3V8K A;  2DPP B;  1VQ5 T;  2XK0 A;  2YRV A;  2DXB A;  4M77 C;  3PT9 A;  4XTW A;  3LGF A;  1HK9 A;  5GMK i;  3OYM A;  3JCM X;  2R5M A;  1VQ8 A;  4IKF A;  3P8H A;  2EJF A;  2QQA A;  3MEW A;  4M7A D;  3CCE A;  4J6W A;  2QTX A;  1MHN A;  3G4S A;  3MP8 A;  3HRS A;  3OYJ A;  3GP8 A;  2LVM A;  2YHT A;  3H8Z A;  3P8B B;  4C5H A;  3MCA B;  4OB3 B;  4M7D E;  1WJQ A;  1BIA A;  4PLI A;  1VQP T;  4M7A A;  4Q5W A;  4PJO C;  4J6X A;  4YTL A;  5FU7 C;  4OB2 B;  1YJW A;  1KC8 U;  1KQS S;  2HBP A;  5GAO r;  5A0D A;  3QG1 A;  4M78 F;  1VUB A;  3E9F A;  4DQ2 A;  3M55 A;  4IUP A;  3WVD B;  1UEB A;  5GAN 7;  3LWH A;  5GAM g;  3HSB A;  4XU3 A;  2O01 E;  4EMK C;  1XTD A;  5CIU A;  2FB7 A;  3C94 A;  1WPY A;  2PUO B;  2JUF A;  1JBM A;  4BI4 A;  3CME T;  5KCO A;  3V8L A;  2KK4 A;  1LOJ A;  2LCL A;  5CQX A;  3CCJ A;  2DXT A;  3ER0 A;  3VJP A;  4JJN K;  2E12 A;  1YHQ A;  5FRO A;  3L2W A;  2EWN A;  1U8R A;  5FRN A;  4C0G A;  1JJ2 A;  3PTA A;  4EMK A;  3UWN A;  4RG8 A;  3SWN B;  2K5L A;  2QI2 A;  5GAM h;  3AHU A;  5GAN e;  1S72 T;  4BB7 A;  4DOW A;  4OGC A;  5A2Q E;  3JCM f;  2QDY B;  1Q86 U;  4C0D C;  4DOV A;  3BDU A;  2DAQ A;  1Y71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...