3VKLA

Protease-resistant mutant form of human galectin-8 in complex with two lactose molecules
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
289
structure length
289
Chain Sequence
LSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-8
total genus 60
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA02
1SCSA 2R0HA 2W39A 3AZWA 3ASIA 4JCKA 1LCLA 3M3QA 3MPPG 1VLNA 4Q8LA 5T5OA 1N3QA 4YZ5A 4YM3A 2D6KA 3OYWA 4YM1A 2A6YA 2ZKNA 1S1AA 4R9AA 3RMXA 4R9BA 2D6MA 4SLIA 1W6MB 3M2MA 3WDXA 4CZSA 1S0DA 2WSVA 1F5FA 2VXRA 4L8QA 1LHOA 3ZXJA 1IOAA 2DUPA 2DV9A 2P37A 5FRAA 1JYIA 2YMZA 4HANA 4YM0A 1SBDA 4LBOA 4YZ4A 2D3PA 4DFSA 1W0PA 2NM1A 1OQ1A 3AFKA 4YG3A 5JVVA 2ZGTA 3WV6A 3RS6A 4XTPA 2ENRA 1DBNA 1QNYA 4ZKTB 2KM2A 1RIRA 1WLWA 1DGLA 3DUIA 4JC1A 2V5YA 1LESA 1QF3A 2DVGA 3KM5A 4FQ4A 1UAIA 4OZXA 3AP4A 4FPKA 3VUOA 3RQ0A 2VH9A 3DGTA 4Z8BA 2ZGLA 1CPMA 1N1VA 1G9AA 2NMOA 2ZGPA 2A3YA 2EXKA 3INAA 5T50A 3BOPA 4K20A 1GZWB 1OKQA 1PZ9A 1VAVA 1JOJA 3T1LA 4PBPA 3N7LA 1V6LA 4Q1PA 1YXWA 2GDFA 2JECA 1RINA 4XIOA 1SFYA 2DYCA 2ERFA 2ZGRA 4YW3A 3V0BB 1UN1A 1CONA 1WLDA 1G86A 1LOBA 4XE9A 1LODA 4FPJA 3N3HA 1DYPA 4WZFA 1CR7A 1CESA 1MVEA 2E7TA 1ONAA 1WW5A 2PHUA 3KQRA 5T55A 3SLIA 5SV8A 2AREA 1QGLA 4Q1RA 1N1SA 4FVVA 4Y1UA 3UL2A 3WG2A 1JBCA 4U36A 4K21A 4XBLA 5JOXA 1IS4A 3AK0A 4D69A 1A3KA 5HCBA 3O12A 4LBKA 2W52A 5GLUA 1FV2A 1S0FA 2VUAA 1J1TA 3GALA 1N47A 2A70A 4DRRA 5T5JA 4XJ9A 2WSUA 3U4XA 2E53A 4AVVA 2DU0A 2GMMA 1G9BA 4LBLA 1DQ2A 4XHXA 2P3KA 5GZDA 1H9WA 5IK4A 1R1ZA 3OYWB 1MS4A 1IS5A 4P9WA 2NYYA 1FX5A 1DQ0A 3N35A 1MS9A 4ATEA 3LCPA 4Y22A 1CJPA 3ENRA 4XMAA 1C1LA 1OFSA 2R49A 2WQZC 4W65A 5F5QA 1W6OB 5DUUA 4BOWA 4YZ1A 3A4UA 3TAYA 1TEIA 4Y1ZA 4FQZA 1AXZA 4M00A 4YFZA 2C9AA 1V6MA 2ZGSA 1GSLA 2ZGNA 4DQAA 1LU1A 2A6WA 3OY8B 2A71A 3WHUA 1LOAA 5GZGA 3I8TA 3B00A 3FBYA 1URXA 2VW1A 2UU8A 2WT1A 4NOTA 3LSDA 5JOWA 2EXHA 3ZSMA 1I1EA 4TZDA 2AENA 1O4YA 1ENQA 2PHWA 4P9XA 4FPCA 4XBNA 4M3CA 1Q8PA 4M3CE 2AUYA 3WDYA 1UL9A 3ILNA 4AGVA 2PHRA 2XG3A 5EYXA 1HLCA 3B69A 4RL7A 1GBGA 1KDKA 2ZHLA 3IPVA 3QLQA 1GZWA 1SLTA 1S0JA 3M3EA 4K1YA 1HQWA 3FLPA 4XHBA 2ARBA 3ILRA 3ZYRA 4BM8A 2UWCA 4MYEA 1WCSA 1ENRA 4C1XA 2DVDA 3AP6A 1B09A 4FOWA 1X50A 1FV3A 1YRZA 2PHTA 2ZHMA 2EAKA 4YG0A 1KDMA 1LTEA 3V64A 4Q8KA 1S0EA 5CA6A 4UW5A 1IS6A 3L2YA 4WV8A 3AXDA 1FNYA 1AVBA 1NXD1 1WBFA 1V6OA 1SLIA 5E89A 1NLSA 1MS1A 2EALA 5H9PA 1CVNA 3O0XA 3W58A 1BYHA 3M3CA 4YZ2A 5KXBA 2AGSA 3AJYA 1HDKA 3B9CA 4K1ZA 5DUVA 3MW4A 1SACA 1APNA 4XYXA 4M3CB 3O5SA 1UZYA 5GZFA 2P2KA 3AP5A 5EXOA 1Z0HA 3WDUA 1KITA 2CY6A 3NV3A 4FOQA 1ULGA 3BIWE 3HMYA 3OGGA 5GLWA 4AVTA 1FNZA 1KJLA 4FPGA 2CTVA 1QOTA 1Q8SA 4XJUA 3POSA 3N7KA 3NWKA 4DPNA 1AX1A 4Y26A 2W68A 4XMIA 3UJQA 3WDWA 3WG3A 1GYKA 4YW1A 5GLZA 2W08A 2UWBA 1VALA 3ILFA 1D0HA 3RSJA 1LOGA 1MR5A 5IK7A 2OUHA 5GZEA 2SBAA 2A3XA 2A6XA 1VIWB 1LU2A 1LJ7A 5BYNA 4YFWA 1BXHA 3ZYPA 1SLCA 1Z78A 1YIFA 5T5PA 1WW4A 1DQ6A 1BQPA 3WDTA 1LEDA 4CTEA 3MEPA 3WCSA 3D4KA 1QDCA 4FOVA 4FPEA 1AZDA 1ULDA 1S0BA 1QOSA 4BQ1A 1PZ8A 5IUQA 2Q5TA 4FP3A 4WVWA 2D43A 3OY8A 3NV2A 2UURA 3WHTA 5GJ6A 1MZ5A 5JOYA 4LBQA 1JUIA 4YGCA 3RRDA 3IN9A 1JW6A 4Q2FA 5IT6A 1KJRA 2D6NA 2WNEA 4Y1XA 5JLVA 4AGGA 2I2SA 2GN3A 4DRVA 3C2UA 1LGBA 2OW4A 4UW3A 4XJAA 1W6PB 1HQLA 1KQRA 1MS8A 2GNBA 1V6JA 4FP2A 4M3CF 3USUB 1XQNA 2WT2A 5CAZA 2ZABA 5KXDA 2R1DA 2WKKA 3OBRA 1AXKA 3ZXLA 4P14A 2DVFA 1GNHA 3FLTA 3R4SA 4PBOA 5KXEA 3AZVA 3V0BA 1AF9A 3IPVB 2ZZJA 4KBBA 1AJKA 2EXIA 1W6PA 1DHKB 1SBEA 4RA0A 2WLQA 4GALA 4XDQA 3WVJA 5KXCA 2D6LX 2B7YA 3QCWA 1S0CA 2AR6A 4IQPA 3AP7A 4GWMA 1QNWA 5DUXA 3WUCA 1W6OA 1DLLA 1GKBA 1GNZA 4UW6A 4FOYA 4Y24A 5CB7A 5JOZA 1BZWA 1SLAA 3FLRA 3POWA 5DZFA 4LBJA 2EIGA 1UMZA 2A75A 3NV1A 3SH3A 1N3OA 4GWNA 4BLIA 1QKQA 1UZZA 2DTWA 5CNAA 5DG2A 2DWRA 2E51A 2JE7A 1V6IA 2YY1A 1ZM1A 2DTYA 3ATGA 3B01A 3ZPYA 4FPFA 2AH2A 1QU0A 2JE9A 4R9CA 1DQ4A 1CPNA 1Q8VA 1PZ7A 2V73A 3V65A 3ZXFA 5H9SA 2NMNA 4YGEA 2DUOA 2VW2A 3BTAA 3I4IA 5H9QA 3SISA 1D2SA 3TB0A 1BJQA 2VW0A 3MW2A 2YV8A 4ZXKA 1LECA 1LEMA 4BMEA 2CL2A 2CYFA 1WD3A 5F9TA 1CN1A 2HYKA 3AZYA 3AZXA 5HCFA 4FPYA 1A78A 1G9CA 2ZHNA 3AX4A 2LALA 3UK9A 5JMCA 4XBQA 2DVBA 2ZHKA 5EWSA 3R4UA 1W6NB 4PCRA 2ARXA 1LGNA 3AYEA 3ZSLA 1DQ1A 1QMJA 2DURA 1H9PA 2WJSA 3POYA 4JRAA 1WBLA 1WW7A 1KRIA 1AX2A 1FYUA 1W0OA 2EXJA 1JHNA 1LOFC 1Y7BA 4XXAA 3PVEA 5E88A 2FHRA 2GMEA 3BODA 5EYYA 4YZ3A 5DXDA 2P34A 2ZBJA 5T5LA 3OBTA 2H0BA 2R1BA 3APBA 2GN7A 1C57A 2ZGUA 3FFZA 1JYCA 2ZGMA 4YGBA 4LBNA 2C5DA 5T54A 1GZCA 2A3WA 3M1HA 2OUJA 4YW5A 1G9DA 3ZSJA 3H0OA 2D6OX 3IKWA 4LBQD 4YM2A 1CQ9A 3CNAA 4HL0A 4XTMA 1GLHA 1V6NA 1SBFA 5LK5A 1C4RA 2GNTA 2ZMNA 3SITA 2P3JA 4AYUA 2E7QA 1LGCA 2ZMLA 4U2AA 1W6MA 1GV9A 2CNAA 1H30A 1JXNA 5GM0A 2ZGQA 1MZ6A 4GXLA 2D3RA 1BKZA 2GNMA 2FMDA 3WUDA 2R0FA 3OPZA 1AX0A 1LHVA 1S0IA 5GZCA 3WG1A 3FUOA 3T1MA 3N36A 3ZXKA 3PVNA 5HCAA 5GLTA 4M01A 4ISQA 2D44A 3N7MA 2ZAAA 1C1FA 3B3QE 2VU9A 3RG0A 4ISRA 2BQPA 2A7AA 2YZ4A 2ZGKA 3HR9A 5L73A 4BLJA 3AZZA 2JD4A 3WZ1A 3AJZA 3NV4A 2D7FA 5T52A 4I30A 1CIWA 5DZGA 3PMEA 3JUUA 4UW4A 3AYAA 1ZA4A 4YW4A 2GNDA 1F31A 4AWDA 2PELA 1YI7A 1MS5A 1DFQA 1O4ZA 3IMNA 4GKYA 4XILA 1V00A 3A0KA 1MACA 1N1TA 1S0GA 4PQ9A 2JJ6A 4XIKA 4Y20A 1Q8OA 2PHXA 3ZVXA 5CBLA 1UPSA 1DIWA 4BMBA 1RITA 4BPZA 3ZSKA 1Q8QA 4GA9A 1LOFA 3W59A 4YG6A 5AVAA 2A6ZA 4FPHA 4AVSA 1AJOA 4FPLA 4XXPA 3FUQA 1V6KA 1ENSA 3VV1A 1WUVA 1LOCA 2ZA9A 4Y20B 4LBMA 3WNXA 1DQ5A 2OVUA 4YGDA 4YW2A 4NO4A 3PJQA 1A8DA 1EPWA 1WLCA 3O0WA 1QOOA 4ATFA 2TEPA 4ASMB 3IM0A 4ITCA 1W6QA 3O0VA 3R05A 3D5OA 1IKPA 2YXSA 3VKMA 1YO8A 3MW3A 1U0AA 3D6EA 2SLIA 4Y1YA 3UJOA 3SH5A 3M3OA 2DUQA 3WCRA 1G7YA 3WLUA 1LHNA 5E8AA 3WG4A 3V0AB 2ZMKA 2RHPA 4Y1VA 3WOGA 2AYHA 5DG1A 2UWAA 1LOEA 2YROA 1IS3A 4F83A 3SNMA 3V0AA 1SLLA 3N7JA 3AXEA 2VY0A 2EF6A 3AYCA 4Q26A 3VKNA 1G8WA 1SCRA 2P3IA 4XZPA 4Q27A 3T2TA 1JN2P 1LENA 2LTNA 1VAMA 2Z42A 2D6PA 3USUA 5GALA 4XJ8A 1IKQA 5IK8A 1LULA 1GANA 1ULEA 1SLBA 2GALA 4CRQA 1UX6A 4LBQB 5H9RA 4DS0A 4C1WA 1MS0A 1WD4A 2CWMA 3PVOA 1GZ9A 2JDZA 3OJBA 4Y22B 3RMYA 3WDVA 3JU9A 1W6QB 1ULCA 2A5ZA 2JKBA 2PHFA 2XB6C 2DVAA 3GNEA 3A0NA 4XOGA 1ULFA 1MS3A 2ZACA 4WVVA 1GICA 1DYKA 1Q56A 4XJWA 2D3SA 2ZGOA 1LHWA 1W6NA 1QDOA 1MVQA 1N1YA 2A6VA 3AP9A 4H55A 4PF5A 4AGRA 5IK5A 1HKDA 1AXYA 2NZ9A 5GLVA 1F9KA 5DUWA 2NN8A 1I3HA 4YLZA 5DZEA 1LHUA 3Q9OA 5JDBA 2NP0A 3VKLA 1DZQA 2E6VA 1UKGA 4FPOB 4P9YA 4XJZA 4GKXA 3VKOA 5FREA 4R9DA 2ES3A 3SH4A 1N3PA 1FAYA 1YYNA 4TYSA 3VKFC 3ZXEA 2GMPA 3HN1A 2CWSA 3AYDA 1G9FA 2R16A 3LSEA 1FATA 2G4IA 1WW6A 2WT0A 2DU1A
chains in the Genus database with same CATH superfamily
3AZWA 3UESA 4K8FA 4JHZA 2H0VA 1VLNA 4Q8LA 4UF0B 4IEYA 3ZDVA 1CAXA 2RS13 3OYWA 4GMP3 3WF1A 1KS5A 1SQ4A 4CCLA 4R9BA 4OHYA 3FFQA 3ME2A 2ZOEB 1PO21 4PDWC 4Z2WA 5ACA2 3M2MA 3WDXA 1QHDA 1OBNA 2WUHA 3LEKA 3I3QA 1RHI3 4MHRA 4QKNA 4FFIA 3ZXJA 2HWD2 4GH4C 2XH6A 4BQ2A 2ADEA 3AFGA 4NWVA 1T2XA 1UNBA 2P37A 4N53B 5JZGB 4HPKA 4HANA 2IXKA 2TBVA 2ZX4A 4LHKA 1TME1 5A3LA 1QJEA 2NPIA 2HWD3 2WS93 2FZ1A 4LO8A 3VL9A 1A6CA 5JVVA 2VC9A 2HKXA 4R4XA 2GZWA 3WV6A 1BK0A 2ENRA 4QGLA 1QNYA 4FFGA 3VL8A 1RIRA 1WLWA 4NROA 4ORFA 3HNYM 5GM0A 2V5YA 2CV6A 4FQ4A 5IVYA 3O1VA 2XJTA 1WMXA 2DCKA 2HWD1 2VUCA 3LFMA 2YB7A 3LEMA 4LLFA 2Q8CA 1IZ3A 5LCWL 2ZGLA 5FPLA 2E7AA 5C6CA 2Y6GA 4YVWC 2XWBB 3BOPA 3CHXA 4WM8B 1RUE2 2QNKA 2IVIB 1VAVA 1H0BA 1NYWA 5ERLA 3VBFC 1UOBA 3LEGA 4CYDA 2WRAA 1EV13 3IDEA 3VZNA 4NIGA 4JGYA 2CSGA 5FYIA 1NCRA 2GDFA 2WYFA 4WM7C 3UKNA 1AR83 1S55A 2BNNA 5FP8A 2DYCA 2ERFA 3OD0A 1K12A 4ZS3A 4YW3A 3WQ0A 3V0BB 4META 1XYPA 4FAGA 4HN1A 4A2UA 4FPJA 4QKDA 4UXAA 1AHSA 2OXBA 2E7TA 1ONAA 1WW5A 3GHMA 3J8F3 4QKBA 5SV8A 2AREA 3RGBA 1N1SA 4BZ4A 5JOXA 3WG2A 1UY2A 1JBCA 3NKTA 4AAPA 1YI9A 4HG6B 4HK8A 4RYDA 1WMFA 1V0AA 2VOXA 2YDEA 4E9KA 2PTMA 4LBKA 2ZX2A 4QMAA 2VUAA 4DRRA 1AR62 2QJVA 3NRUA 5CZKA 3JZVA 3U11A 1YQ8A 1TNRA 4MOAA 1VBA1 1EAH1 5DPNA 3VDAA 3I2JA 4LBLA 1DQ2A 1YQCA 4XHXA 4G9SB 1R1ZA 3PIJA 1XC6A 5JSRA 3LCPA 2BYVE 3PUSA 4Y22A 1CJPA 3CBNA 2YBKA 3KF5A 4B4QA 5I93A 3PTYA 1OFSA 1F4HA 1ULPA 2CDOA 1F5JA 2W1QA 3GHNA 1WMDA 1UPIA 2HWC3 2MEV3 3A4UA 5DUUA 3TAYA 5BNNB 3DKWA 2XBO1 4Y1ZA 5FK8A 1GWMA 2XJPA 2C9AA 3NJZA 1V6MA 3HWJA 1GSLA 4X6QB 5ABJC 4KBZA 3IDAA 3LDRA 3OY8B 4QDSA 2A71A 4KG0A 1D4M2 2ADDA 2QFEA 3I8TA 5FO7B 2WT1A 3FHQA 3RI9A 1K5MA 2EIDA 3ZSMA 1R083 1YFWA 2BP6A 1SMVA 3AL5A 3VBOB 1ZX5A 3LAGA 1O4YA 4Q0QA 3K2OA 3I3DA 3S0MA 1HN1A 3POBA 3WW3A 1Q8PA 2R062 4OQ8A 5LY1A 3K4DA 1ZVFA 4PF1A 1GOGA 4G4FA 1UL9A 2VQTA 4MGZE 1JODA 1GOFA 1AYM2 1KDKA 5FXZA 1UY1A 2ZHLA 4BQYA 4XHBA 4CCKA 2VTFA 5A3NA 5FZ1A 3ILRA 4BM8A 3B7MA 3H8OA 2PXJA 4OHZA 1RUOA 4NAOA 2R063 3GJAA 3ZYBA 2VZSA 1B09A 5LY2A 1DU3D 1X50A 1YRZA 2PHTA 2VR4A 4XFIA 4MG2A 4YG0A 1H1MA 2YPDA 3N9MA 1ODMA 2XJSA 1IS6A 4WV8A 1W2NA 1AVBA 1YJLA 5T3NA 4DEQA 1V6OA 1H4HA 4H7MA 3FN9A 2HWB2 1MS1A 5HXMA 4XW3A 2OX0A 1BMV1 4YVWA 1CVNA 1J3QA 4GWJA 3VBSB 3MHZA 4EWAA 4RR3B 3O1UA 3N9PA 2DFCA 2JENA 2DFBA 4S2FA 2VG9A 2Y38A 3B9CA 4MGQA 1PK6A 1YC61 4M3CB 3TEXA 1YIPA 1UZYA 2RM21 3GDBA 3OGJA 4XUNA 5GZFA 5A7OA 1Z0HA 5FZIA 2MNGA 3BIWE 1ALYA 1RMU2 2HBTA 4X6RB 2G9GA 1KJLA 2Y6HA 2R042 2YHJA 4E4SA 2VMCA 1QOTA 5A33A 2RS33 4H3WA 4J1WA 1O59A 1ND3B 2BW8A 4XFGA 4DPNA 5AC93 4OYUA 1SZBA 2LUWA 3MV01 4XMIA 3UGFA 2DDUA 1NCQC 3PL0A 2QQWA 1D0HA 3H7JA 2BOJA 2ZXQA 3TYJA 3JCIA 5IK7A 4KWLA 1NCRB 5M0TA 2E63A 4OULA 5FP3A 1VIWB 1D7PM 2O14A 4L9BA 4O61A 1AL22 4CP2A 1BXHA 3WF4A 3ZYPA 3CZJA 1Z78A 5FZDA 3ACHA 1WW4A 1NY72 3AVSA 5FMOL 3WCSA 3D4KA 3RPQA 1ASJ1 3OG2A 4CCJA 1RMU1 2WS91 4E2GA 5CYYA 1OD5A 4BQ1A 2MHFA 4QQPA 4P5YA 1TZOA 4M0NA 5IUQA 1RUD3 5L9RA 2MPFA 4TLGA 1W3VA 3NV2A 1F15A 2UURA 3UV9A 1MZ5A 3G7DA 4ZXEA 1UXXX 5JOYA 3THTA 1Y43B 3RRDA 5BY5A 1JW6A 1K5JA 4QPIA 2D6NA 2WNEA 2XJQA 1JZ5A 4DRVA 2GN3A 2W1SA 3ACFA 4LIVA 1HXS2 1LGBA 1U5XA 3X29B 1VBD3 4A44A 2YG0A 4BXSV 5F7UA 1VP6A 4XFHA 4A7ZA 2RJ2A 1MS8A 2WAOA 1V6JA 3ZFFA 2XLFA 3O7OA 2E32A 2QQOA 1GNYA 2X5IC 2WT2A 4KWJA 4UFHA 5CAZA 1ZREA 2JG8B 2J22A 3ZXLA 4HETA 2JDMA 5LA1A 4IEQA 1FOD2 5BPXA 4AE2A 3B93A 1FI2A 1VBE2 2P3YA 1AF9A 4C0HA 4QU1A 1A34A 1UY4A 2W5FA 5LBCA 2HWC2 5FZ4A 5JWPA 5I8TA 4IEZA 2XWJB 2WLQA 3AMMA 3BPSA 2B42B 1RL3A 3LD8A 2AR6A 2BWCA 2IVJA 5FZ8A 4AR2A 4DXTA 4MGYE 4GH4A 3I7DA 1C8M1 1GWLA 2DCJA 4KU8A 4HFSA 1PMJX 1AR92 1UOGA 3EYPA 5FKCA 3WNNA 4UW6A 4GB32 1C8NA 5IAVA 4LKDA 2JDNA 1BZWA 1BVVA 1SLAA 4LXLA 3FLRA 3HT1A 1X9PA 3POWA 5IVEA 1YNAA 1X33A 1UMZA 3VHPA 1N3OA 4GWNA 2PQSA 2BGPA 1IPJA 1QKQA 1NUKA 4LHNA 5KR7A 2PLV2 4TN7A 5A3TA 2ET1A 3E97A 3W5MA 1OLME 2Q1ZB 2FDIA 4IE5A 5LRRA 4XC9A 4CDQB 1AYM1 1H2MA 3ZPYA 2WFF2 1UZWA 2IXLA 3HN3A 3KGLA 2XJVA 4ZZ8A 3DL3A 5FYYA 1DQ4A 5CADA 2CU5A 4LQRA 2VMEA 1OF4A 1NA1C 5H9SA 2VNGA 2J42A 2Q8OA 4Z92B 3ST7A 1AYN1 1BJQA 2Q8EA 4AG4A 5JR2A 4XUQA 2YC0A 1WWYA 3N4MA 1KGYA 4LK6A 2HWB3 1OXCA 2X5IA 3AZYA 1HRV3 4CDXB 1A78A 1COV2 2CGPA 3UK9A 1CZSA 2A73B 2YU2A 4RGAA 5IAXA 2ZHKA 4WM7A 4PCRA 4YARA 2WDBA 2KXLA 3ZSLA 1U5ZA 3AKSA 3POYA 4JGZA 4AI8A 3HQRA 1WBLA 1WW7A 4HKLA 1LRHA 1JHNA 1LOFC 1Y7BA 3KCYA 2X05A 3S7EA 3PVEA 4COZA 2GMEA 5EYYA 2HWC1 3CEWA 3OBTA 2ZGUA 1PHMA 1B35C 1JYCA 1J3RA 1WA4A 4UFKA 5C71A 5T54A 4OHXA 3VD7A 5FYCA 3IIIA 3WNLA 2OA2A 1OQDA 2OUJA 3M1HA 4K8RB 4B7EA 5FO9B 4LORA 5C70A 4PIYA 5FY9A 5D1IA 4QGMA 1R082 3CNAA 4XTMA 1C8M3 1C4RA 1NOVA 1VB2A 2ZMNA 3E1F1 3URFA 3UGGA 4AI9A 3ZN4A 2E7QA 2VVEA 3PURA 2WABA 2LRPA 5JXHA 1W6MA 2CNAA 3DV8A 1H30A 4ZONA 3T4VA 2Q30A 4GXLA 3ECQA 2R30A 2FMDA 2UYBA 1LHVA 3C7EA 4QHOA 2JDYA 3UKTA 4LHSA 3FHIB 4JKKA 2BV4A 2D44A 4XCBA 4ES8A 4AW7A 4UBHA 5BV6A 1PGL2 3KWVA 2QTWB 2HWE1 3J4UH 4PQQA 5JR7B 3NV4A 1OA3A 1OH4A 2B5HA 2BZDA 3JBG2 3D0JA 5T52A 3SXWA 4BCUA 1CIWA 1J58A 1RUNA 3AYAA 1NCQA 2W94A 1ZA4A 3AKTA 4YW4A 1F31A 2PELA 2V09A 3BYWA 1YI7A 3ZXDA 1DFQA 1FOD3 2JG9A 4AI2A 5I0UA 2EIBA 4I3PA 4N90A 4Y20A 5CBLA 4QX2A 3ITQA 3ZVXA 1NZCA 2DF7A 1UOJA 3KV6A 4XPVA 3P6BA 4K7JA 5IVJA 3VZMA 4OLLA 4BISA 3RZJA 4GA9A 1ZBE1 3MLLA 1HRV2 4NHKA 2DBNA 1WCQA 2E31A 3S6PA 3T2PA 2WL1A 1OVPA 1JYNA 2A6ZA 5F6KA 3O1TA 1QJY3 4FPHA 4CEYA 4UOJA 3MUZ1 3VV1A 3FUQA 1ENSA 1WUVA 1LOCA 4OCTA 2ORZA 3QH7A 4K6BA 4IUGA 3FBMA 4N43C 4NO4A 2G19A 2VTXJ 3ES4A 1WCUA 3DYPA 3O0WA 1QOOA 5FTTC 3WD5A 3A22A 3RYRA 4QPIC 4H7LA 1DYOA 2TUNA 3RFRA 2YXSA 1RUC2 1NCQB 1U0AA 2EAAA 2XJRA 2Y34A 2SLIA 2YBPA 1D4VB 3POFA 3R4DB 4HSLA 3LEIA 5A7WB 2DUQA 5FZ7A 3WCRA 2VNRA 1CAUA 1RUJ2 5FXXA 2WNOA 5I0DA 3ZFFC 2VMIA 3FMGA 3V0AB 2ZX3A 2FZ2A 1R092 5DG1A 3THDA 4CUCA 2IXHA 3V0AA 2VQ0A 2YGLA 4IV3A 4LUKA 3HNMA 2BDRA 2VY0A 2A1XA 2P3IA 4IW3A 4XZPA 4NHXA 2LTNA 5JUVA 4N7UA 2D6PA 1RVF2 3USUA 3RZHA 1PIV3 3OGVA 5C9AC 1MZEA 2K2SA 5CFDA 4MZUA 3BN6A 1SLBA 1XXNA 2P5BA 5FBZA 5JCTA 3VD3A 5FCCA 5C4WA 2CWMA 1WD4A 4LKEA 4B8EA 4AVAA 2OPWA 3MYXA 1OLRA 2HH9A 1OLQA 4Y22B 4BE3A 4CP0A 1NXMA 1CGPA 4NR1A 3JU9A 3CDZB 1ULCA 3JXSA 4S2GA 1DP0A 2DVAA 3I2HA 5D8AB 5F37A 4XUOA 2WWUA 3ACGA 3MIBA 1GICA 1OA2A 3NJXA 5FZEA 3DPRB 1RUJ1 1W6NA 1MVQA 3VZJA 2X8KA 1W90A 2A6VA 2NQYA 2Y0OA 4H55A 4IV3B 3LDKA 3T4HB 4MUVA 1I3HA 1WLTA 4E8DA 2HYXA 1DG6A 1UYPA 2TNFA 5L9BA 5FO8B 4P9YA 1ULOA 4XJZA 3PHMA 2D98A 1EUUA 5KHHA 3W9AA 4LT5A 1UF2C 3NKGA 4R9DA 1FAYA 5B4NA 2XGXA 1TMF2 1ZZCA 2BERA 4CUAA 1W99A 2R16A 4EN0A 3NO8A 2VBPA 1JZ7A 1W0NA 4ZPIA 4B29A 2N7GA 1PX3A 2WT0A 3J7HA 5KC6A 4BK5A 1SCSA 1K5MC 4R4ZA 1HRV1 4I2OA 3MFAA 4NVPA 5T5OA 4YZ5A 5A32A 1XE8A 5IWFA 1ND3C 4QQHA 2A6YA 5JPNB 2ZKNA 2VE1A 4R9AA 3RMXA 2OIIA 3ZN6B 4A3ZA 4OVEA 3VBFB 1ZA7A 5A70A 3H3ZA 5IATA 3U0ZA 5FPUA 5FZKA 4CZSA 2BVVA 5IVFA 1JU4A 1X82A 3ZYFA 1IOAA 4HKWA 5A7WA 2DUPA 2QQKA 5JIUA 1PVC3 3SEPA 1JYIA 1H1AA 4ZHNA 1IQDC 3JBG1 1NG0A 1GP6A 4CEWB 2D3PA 2EICA 1AYM3 1W0PA 2NM1A 4YG3A 3AFKA 1BCXA 3NJYA 2I07B 1XSRA 2AEZA 3RS6A 2FQPA 1ZBA1 5JI7A 1QIQA 4ZKTB 2KM2A 3JB8A 4K3UA 4M4PA 4S2HA 4P02B 1I5PA 3DUIA 4XIOA 1QF3A 5A6YA 2DVGA 5KXEA 2J1AA 4OUMA 2Y6FA 1COV3 4XZUG 5LA9A 3VUOA 3RQ0A 2OT7A 5JZGC 1NAEA 2R071 4JVAA 3WQ1A 1AR72 3ZFGA 1N1VA 2A3YA 4RSUA 1JMUB 4ZS2A 2Y60A 3IAPA 1GZWB 1O5LA 1PZ9A 3M70A 5JPMB 4JGYB 1AR81 1UU5A 4OHVA 3H3LA 3QACA 1EV11 4OI1A 4Z2AA 1YXWA 5A3PA 4A3XA 5FZ0A 4KGQA 3ZR6A 1CONA 1WLDA 2BU9A 4WBBA 1G86A 1LOBA 5LEJA 1PMHX 3SEEA 3IZOA 2GU9A 1DYPA 2VBDA 1ZBA2 3S57A 3PU8A 2ZCWA 3C7HA 3J7LA 1CESA 4QD2A 4QT6A 3MPBA 4UFJA 3TNPB 5J96B 1QGLA 3IBMA 5JAXA 4XBLA 4NRMA 3VLBB 5FZBA 4AF9A 3CU7A 5LRSA 4MO3M 3LKJA 4AFMA 3O12A 2W52A 5FZHA 4K9SA 5GLUA 1FV2A 1XOYA 2K0GA 3JQXA 5CU1A 5T5JA 2WSUA 1UIJA 4AVVA 5FZOB 4UFIA 1VBD2 3O1SA 2WQ8A 3MFCA 4IDZA 1TE1B 2QDNA 3GBGA 1YQ5A 5LW9A 4QXHA 5GZDA 3PJYA 3USSA 5IK4A 1QJU1 1RVF3 4QPGA 4E2QA 2Z2SB 4AZZA 2NYYA 5B2GB 4DY3A 3N35A 4ATEA 4IEPA 1O3TA 4J6GA 4D3WA 4UBGA 5D21A 4I02A 3VDBA 5D8AC 2IXIA 1HV0A 1ASJ3 1W6OB 3PU3A 5FZMA 4BOWA 4YZ1A 3LPGA 1TNFA 4JQTA 2VNVA 1XNKA 2ZGSA 2ZGNA 3CJIA 5FLJA 3EB7A 1LU1A 3DXUA 2ZEZA 4CSWA 3WHUA 1LOAA 5JOWA 4CCOA 4LOSA 2WAAA 1IGOA 1P8JA 2AACA 2WFPA 5FY5A 1I1EA 2V5DA 1OT5A 1W03A 1NY71 2AENA 3CKHA 5BNNA 3DECA 5EIYB 2IC1A 5A6QA 1S4CA 4KQ7A 5J98B 4FPCA 4OFGA 1GMMA 4M3CA 1K42A 1XNTA 1GQHA 5FOJB 4PDWA 4WM7B 1MQTB 3ILNA 3TNQA 3POJA 4AGVA 2PHRA 2XG3A 3B69A 2VJXA 3WDWA 4BJ0A 2QQMA 3IPVA 5IYYA 3GCWA 1S0JA 4CDUC 3WP3A 3FLPA 3LF7A 2ARBA 3B9IA 2E33A 4AI1A 2UWCA 3R6SA 4AEJA 2IZWA 1QJX3 2R073 4NIIA 4URTA 1W3XA 2ZHMA 4BU2A 1KDMA 2FDHA 1COV1 1S0EA 5CKMA 2VOKA 3MIFA 1WKYA 1ZZBA 4FCAA 4R52A 3AXDA 1FNYA 2YBSA 4EV0A 1NZIA 1X7NA 2Y0IA 1SLIA 1VRH2 2J7MA 5JZGA 1PO11 4IXLA 5H9PA 4KI5M 5EP9A 5EHDA 1VBC2 2J1UA 2WNVC 3M3CA 3W58A 1RXGA 2VMDA 1D4M3 3RVHA 4YZ2A 4CEWC 5KXBA 3JBG3 3O1OA 4L2NA 2OQ6A 4X8PA 2RMU2 3ABZA 1PVC1 4N53C 1APNA 2K46A 1OUSA 3O5SA 3ZYHA 4TTGA 4CU9A 5APAA 2P2KA 1H4GA 3PIGA 5FBJA 1HB3A 1MQTA 4QAWA 3WDUA 3NV3A 2LW8A 4AVTA 5DAXA 1OHFA 1Y3TA 1FPN2 1Q8SA 3JD71 2D97A 2VCMA 4IEOA 2RMU3 3NWKA 1JH5A 2Y8KA 5FYVA 3VDDC 4JX0A 1OSGA 4XUPA 4AHZA 5FXVA 3MV11 2Z69A 3NJVA 4QHBA 4QPWA 3UJQA 3W5NA 1O8PA 2GH2A 4YW1A 5FY8A 2W08A 1T6GC 1SG3A 2JEMA 3E6BA 4DB5A 1MR5A 1O91A 2WA4A 3CLPA 4E4HA 4CCDA 2A3XA 3OB8A 3ZX7A 3BU0A 1LJ7A 5BYNA 3ZOIA 1ZNPA 3ZN5A 2QQNA 3O14A 4KH9A 2I74A 1LEDA 1TQ5A 3MEPA 4OMCA 3WP6A 3QD6A 1RUC3 5CFDC 1MZFA 1QDCA 2WNVB 4FPEA 3ZFEA 3ZXAC 1ULDA 4B3NA 1QOSA 4L97A 1DF0A 3PUAA 2OYZA 2PN5A 2ZJCA 1DGRA 2GP3A 4JDMA 4HZFA 5K4LA 2WZPP 4FP3A 5C3PA 5J1XA 5D8AA 2BJSA 3FHAA 4MADA 3VHNA 1EAH3 4CPBD 2JB4A 3P3NA 2R043 1KJRA 1R091 1UXZA 2Q4SA 3AC0A 4EQVA 5JLVA 3S7IA 2PYTA 4MGSA 3DCQA 3C2UA 2OW4A 2VCBA 5L7OA 4J1XA 2IFRA 1W6PB 5FZ3A 3KSCA 4SBVA 4Q4V3 3WW4A 3POGA 3GZAA 2ZABA 3AMQA 2G9ZA 4BQWA 2R1DA 2WKKA 2VMFA 1AXKA 3E6DA 1BMV2 1VMJA 4P14A 2DVFA 1GNHA 1QEXA 4GJYA 3I49A 4KBBA 5KBFA 1XNCA 1ASJ2 3EQEA 4LKFA 4RQPC 4L11A 1RUG3 4Q0PA 3SQOA 3W20A 3WVJA 4LO4B 3PUIA 3QCWA 3LOBA 4Q0VA 1E5IA 1SFNA 3OTFA 1U5YA 3C7FA 4Q5OA 4ZU4A 5HV0A 2VBBA 4P9GA 3U4SA 1QH7A 3LFIA 3M8LA 1WZXA 4Q0SA 3HVDA 3WF0A 4AQSA 1O8SA 4L92A 2HWF1 3I3MA 3LIHA 1HXS1 1PGW2 4QX8A 2RS12 1K3IA 2QQVA 2A75A 3NV1A 2VULA 4XQDA 4N43B 4M0HA 1HW5A 1X8EA 2VCAA 5CNAA 5DG2A 5FOBB 1R64A 2K9ZA 4C91A 4MGTA 1J1LA 2VZ1A 1V6IA 2YY1A 1WA6X 2BPA2 1ZM1A 2DTYA 3ATGA 2RS32 2WINB 2AH2A 4PJYA 4A7YA 4HT1T 1QU0A 2JE9A 4W6WA 3V56A 4DMIA 1Q8VA 1PZ7A 2WN3A 1BHGA 2D40A 5A1AA 4MV2A 3ZMOA 2NMNA 4N43A 2DUOA 4YGEA 5H9QA 3K4AA 4KGGA 3SCFA 4HXCA 1W05A 3MF6A 3TB0A 2VW0A 3BGAA 4ZXKA 4CCMA 3E5XA 3GBWA 1LECA 1ZRRA 4AL9A 3R0RA 5J37A 4AI0A 4EZ4A 4AQ2A 5IFTA 5FFOC 2X29A 5GKAC 5F9TA 1CN1A 2HYKA 4Q4W3 1XE7A 2W0XA 1IG0A 1HRI1 2Y33A 4HVQA 3GBFA 1MPXA 2VOVA 4XBQA 4OI4A 3R4UA 4EE2A 1QXPA 1VMHA 2ARXA 4D6SA 3E5QA 4DNYA 4CU8A 4DUXA 4I0BA 4LOTA 5TSWA 5A80A 2CAUA 1DQ1A 1QMJA 5DMYA 5DABA 1H9PA 5CISA 1D4M1 1EP0A 4JRAA 1KRIA 1AX2A 1PK6B 1OLMA 4RFRB 1SHWB 3PTRB 3OEAA 1QXRA 4QB2A 5E88A 1OKOA 3BODA 3DPRA 1RYYA 2UYAA 4FI9A 5DXDA 5T5LA 4AFCA 2GN7A 3MI8A 2C1FA 2YFZA 1O3RA 1J84A 2OPKA 1W8FA 1VBB2 2A3WA 4LO7A 3AM2A 4E4DX 5EPAA 1LB2A 4H2AA 4BDVB 1GLHA 5LK5A 1SBFA 2HEWF 3SITA 1DGWX 3I2FA 4QHZA 4QX7A 4AYUA 1LGCA 2ZMLA 3C3VA 3WNPA 1BEV3 4U2AA 2R7EB 2ZGQA 5IJRA 1C5HA 2WNUC 4Q4Y1 4NPLA 3NNGA 3TEWA 3VBUC 2BEOA 1SPPA 1S0IA 4V2VA 3M4FA 3Q8FA 4E2SA 5GZCA 3FUOA 5LK7B 1Q43A 4QB6A 4XVHA 5FY0A 3T1MA 3TN92 4AQTA 4BQ4A 5JI9A 4ISQA 4A41A 3N7MA 4RQPA 2WFF1 3ZIXA 3RG0A 2H6CA 5B4XA 4ISRA 2A7AA 1YWKA 4XFAA 4NIAA 4M4RA 3VBOA 1UW8A 3MBWA 1TME2 2PLV1 2BTVC 3RDIA 3DKQA 5JSPA 2VMGA 5LZ6A 5DZGA 3PMEA 5ACA3 3C7OA 5FAXA 3WQBA 4DXZA 5LASA 5JXIA 4LIUA 1MS5A 1O4ZA 5FPBA 3K4ZA 3I3EA 4YPJA 1AYN3 1S0GA 1N1TA 4FAHA 3SCHA 1Q8OA 2ZEYA 4OUEA 4BMBA 4LPLA 4LE4A 5KHGA 4XF0A 3WXPA 5HPOA 4GMP0 4COWA 4RR3C 1CAWB 3NAPA 3ETQA 1AJOA 1PGSA 2GC2A 1V6KA 1RTVA 2BFUL 4Y20B 3W21A 2P6CA 4P9LA 1DQ5A 1NE4A 2XJUA 2Z5WA 3RZLA 4Z07A 1UYZA 5L9VA 3IM0A 3DEMA 2I45A 3VZKA 3IT8A 1QY4A 3R05A 3VKMA 1H8TB 3NVCA 2ZZQA 1AR63 5J09A 3SH5A 5BNNC 2ZEXA 3M3OA 4GB31 4I09A 3WLUA 1HQNA 4QDRA 5E8AA 1E5SA 3RZMA 1VBB1 3WG4A 1VBB3 2B9UA 2WZEA 2XMLA 2ZMKA 5F2WA 3I2DA 3WOGA 1LOEA 2HEYF 4YYOA 4WM8A 2J1VA 3CO2A 2F4PA 3N9NA 5C8CA 2XHKA 3T0DA 3NL1A 5EJ1B 2VO5A 3AYCA 3F2ZA 4B1LA 1W8TA 5LBFA 5I0TA 3VDDA 5I0SA 4CXWA 1LENA 4YW7A 1VAMA 1RUH1 2JX9A 4XJ8A 5C5UA 2W9XA 1IKQA 4P08A 3IDBB 5IK8A 3ZKYA 4TXWA 3VBSA 1W9WA 1UX6A 4LBQB 1VAKA 1UMHA 4QQOA 2WA3A 4INDA 4NWWA 1YLLA 4I0WB 4IERA 4C8DA 3HNBM 3OJBA 1AL23 2RE9A 2W91A 1UYXA 3WEZA 1HRI2 3CIHA 2JKBA 4XOGA 2XB6C 4RD7A 3TRSB 1ULFA 1M4WA 1YFYA 2WNVA 5A6ZA 2XPJA 2ZACA 4IE0A 5CFDB 1C8M2 1ACCA 4DXRA 4CDUB 5L7OC 1KEXA 1POV1 2ZGOA 3MICA 4JHTA 1BVP1 3GCXA 5JIAA 2QZ2A 4CEYC 2WNUA 3ZM8A 4L99A 4ET7A 4FTEA 2VCCA 1IG3A 1HKDA 1AXYA 3CMGA 4YLZA 3TWIA 1R1A3 1K5MB 5DDJ1 1W2TA 4HKOA 3VKLA 3WF3A 2NP0A 3Q8BA 5FPZA 1V9U2 3LB9A 3CQOA 1PMIA 1UD1A 2WFF3 1N3PA 4LA3A 3T08A 3VKFC 1IPSA 4O9EA 2E26A 4NE9A 3AYDA 4K40A 1QQP3 4CCEA 3I2KA 2W47A 3VZOA 4AVBA 1FT9A 4HVOA 1NQDA 5C9AB 3MLJA 2DU1A 2W39A 2R0HA 3OY8A 3ASIA 1XU1A 3M3QA 3MPPG 4E8CA 4XAAA 4XUTA 4YM3A 2D6KA 4D7TA 5ANQA 1MEC1 3E5UA 3T0BA 3SMHA 4AEDB 4I01A 1M06G 1DCSA 2CAVA 4F8AA 2D6MA 4IEWA 3Q8AA 1W6MB 5LEKA 1VBC1 2B46X 5K0UA 1F5FA 2VXRA 1LHOA 4QWNA 4TWTA 2RM23 3EBRA 2XXZA 4QXCA 2R32A 2DV9A 4LUMA 2BFUS 2YMZA 4ZU5A 2BGCA 5FK7A 4ES9A 1W8UA 1SBDA 2C9KA 2GH8A 2RM22 4YZ4A 1BBT2 5I0RA 4DUWA 1OQ1A 2G9FA 1RC6A 4PIXA 2ZGTA 3WP5A 3B5LB 4IETA 4XTPA 1DBNA 4DOUA 5FP7A 1RUF3 1W9TA 1DGLA 1W04A 3MF9A 1UY3A 2WZR2 1DGWA 1UAIA 3KM5A 3OCPA 2YYOA 4JDNA 4FPKA 4L0PA 3ROUA 2P6HA 3ORJA 1GFF2 2C24A 1G9AA 2NMOA 1HIXA 1ZBE2 3INAA 4QXBA 3RI8A 1RB8G 5T50A 4K20A 1HB1A 1OC1A 4QU2A 1VBC3 5FZLA 3WNKA 5LATA 1UKRA 1XNBA 1T6BX 3ZSEA 3P3PA 1HRI3 1LAJA 3M7AA 3UT0A 5BNQA 5FMOS 3K3OA 3FJSA 1KXGA 3N7LA 4IV3C 4PBPA 1V6LA 3O1MA 5DAWA 4Q1PA 1H2LA 4YNIA 1XYOA 4KMQA 1RINA 1H2KA 1JYVA 1SFYA 2ZGRA 3POEA 5F3CA 1H8TC 5J36A 3DYOA 4IGOA 5FUPA 2QUOA 2Q8DA 5C9AA 4QPIB 2V4AA 3CJIB 1VBA2 1V9U1 3KV5A 5F5AA 4BQ5A 1MVEA 4YW6A 3KQRA 5T55A 5DDJ2 4UFLA 5CFCA 2WIIB 3P1IA 4FVVA 4Q1RA 5CVRA 4K21A 3NW4A 2IXCA 3EO6A 1IS4A 2H6BA 2PAMA 2F6BA 1B35A 3AK0A 4HVRA 1A3KA 2WYSA 1SDDB 5HCBA 4JKLA 3UNPA 2X09A 2FDJA 3GALA 3M3IA 4BIOA 1J1TA 3U4XA 4CDQC 1GOHA 5E16A 4XJ9A 1YQ2A 2E53A 2XBO2 4V1PA 1KFUL 2GMMA 3BU7A 5KWRA 2PFWA 2WNUB 1HXS3 3IWZA 1FPN1 3S5QA 2XKPA 1H1IA 3CJXA 5A3WA 3ZXGA 3OYWB 3PUQA 1MS4A 1GUIA 3ZFEB 4CPBA 1FX5A 1MS9A 3TN93 1H6XA 4OI0A 4CP9B 1C1LA 2WQZC 3THCA 4W65A 3LIGA 4QX3A 5BNPA 5JOZA 3T2QA 4O65A 1RUG1 1VBE3 1AXZA 4M00A 4YFZA 4BQXA 2OS2A 4DQAA 4BH9A 1VRH1 2CGOA 5C4WB 4CDWC 3FBYA 2RDRA 1URXA 4NOTA 4AXOA 3J8F1 3LSDA 5K8SA 4GWIA 2EXHA 1SPPB 1XE0A 1HV1A 1VRH3 4TZDA 5FMDA 4XFBA 1ENQA 2PHWA 2FCUA 2W3JA 3OUIA 4GH4B 4P9XA 2WZR3 5FYTA 4XBNA 1US2A 4JGYC 2BWAA 1DDLA 2BBVA 2AUYA 4D6QA 4WM8C 5FYBA 1WGPA 3BOWA 1RUI3 4NJ4A 5EYXA 4GB33 3QLQA 4XFCA 3H8UA 3DF0A 3DPRC 3TN91 4K1YA 5G05L 4ASKA 1HQWA 1ZZ6A 2IXJA 1RUI2 1J59A 4Y4RA 1PVC2 3ZYRA 4MYEA 2FCVA 1XJAA 1VE0A 3J26N 4RHV2 4C1XA 1FPN3 1NQJA 2DVDA 3AP6A 4D7SA 1FV3A 4A6OA 3PMSA 1JZ4A 1XU2A 4DY5A 2EAKA 5CA6A 5FKBA 4Q8KA 5KHKA 2KR2A 4LA2A 3KV4A 2J1SA 3HBKA 4HBNA 3MUY1 3ACIA 3L2YA 1NXD1 1WBFA 4COUA 1S2BA 4BQ3A 4N8MA 1HX6A 1NLSA 2XOMA 1Z7S2 2EALA 5E89A 1OPMA 3KT7A 3O0XA 3OUHA 5F5IA 1TME3 3AJYA 3AMPA 2PHDA 5A3UA 4K1ZA 5DUVA 3MW4A 1SACA 1W8OA 4XYXA 3VBFA 1UWWA 1F2NA 1KITA 2CY6A 4FOQA 3WSOA 1W06A 3OGGA 5GLWA 3VGIA 3KB5A 1RUF2 1FNZA 1AR91 1CAVB 2P1BA 5C7GA 2CTVA 1H8TA 3OSDA 5CG8A 3JD73 4GMP1 4XJUA 5ACA1 5ABJA 2VZOA 1Y9MA 1X8MA 3VDCA 4Y26A 2VZTA 1U5IA 5C3SA 3GJBA 2RR13 3DYMA 3K46A 2ET7A 3WG3A 2ZPXA 5CFCC 1JYXA 1VALA 3ILFA 2BOIA 1GP4A 4RFT0 1EYBA 4Q4X3 1AR71 1NE6A 3FZ3A 1LOGA 2RVAA 2OUHA 5GZEA 2SBAA 5BNPB 3THPA 2A6XA 3WR0A 5K7PA 4QM8A 4MXWA 4LNVA 2LM3A 1SLCA 3KT4A 4QGNA 1YIFA 5T5PA 1BQPA 3WDTA 2BUKA 2D93A 3BIEA 2EIEA 3B02A 5FY4A 4Q4X2 1VPHA 1KFXL 4FOVA 3VBSC 1S0BA 4NPRA 4PLNA 5FUIA 1PIV2 4P9JA 3WT3A 3ZN6A 4QKFA 1AR82 5FP4A 5GJ6A 2L9LA 1BLZA 2W87A 3BCWA 4HLTA 2F4LA 3I59B 4YGCA 3IN9A 4Y33A 4IV1B 4NPMA 3U07A 4Z1VA 1JZ3A 4MLOA 1MEC3 1OI6A 1UQXA 5A7QA 5EJ3A 4ZU7A 4IEUA 4XJAA 4HPKB 4DZGA 1FXZA 4RQPB 1HQLA 1UZ0A 5FLIA 2PMWB 2OKXA 3TBDA 4CEWA 1PGW1 4CA9A 1BEV2 2XQRA 4LKSA 1PVXA 4JAAA 2XVGA 1SDWA 1XQNA 3KVAA 4HSJA 4RS5A 4DXSA 4RN5A 5KXDA 3BTXA 4RHV1 3OBRA 3BTYA 2VL4A 1ZRFA 1GQPA 2VQAA 2ZKLA 4PBOA 3JB4C 2RR11 3T3YA 2EXIA 3VBUB 1W6PA 1QJX2 1NX9A 4WVMB 1BBT3 2X53S 3FL7A 4HMZA 4XDQA 1HB4A 3L9JT 4HN0A 4COVA 2D6LX 1YJKA 4HK9A 5KXCA 1VBD1 1S0CA 3BALA 2YC2A 1C28A 5L19A 4FTBA 3AP7A 3K77A 1QNWA 3IMMA 5DUXA 4AEMA 4MH0E 5A1FA 1W6OA 1Z7S1 1DLLA 1GKBA 3I2IA 5HBAA 4IV1A 1GNZA 4JKMA 1PNGA 5CB7A 3U14A 3O1PA 2C4XA 5FYZA 4LITA 2VGDA 4EYUA 2EIGA 4XABA 3SH3A 2B39A 2VOWA 1OUXA 4B7KA 4QM9A 4HONA 1XBFA 2E51A 2LS6A 2E9QA 3ZR5A 3AKPA 1PK6C 4V2WA 1CWPA 3FE5A 4NIDA 4R9CA 3LPFA 2JG8C 4MXWB 2WR9A 1TVGA 2HJIA 3QH6A 4Q29A 5FUNA 1RUD2 3BTAA 1W9YA 3HIFA 4UF0A 5EZWA 4LE3A 1QJZA 3KD4A 1E57A 2YV8A 1NCRC 1YCIA 3HEIA 5LB6A 3P5BA 4DINB 1W2OA 4NHLA 5AC91 1QJY2 2RG4A 2CYFA 2Q1FA 2CGNA 2RS31 3IDCB 1WD3A 5CIRA 3KCXA 2V72A 5HCFA 3OUJA 1G9CA 1KS4A 2WZR1 5JMCA 5FPAA 2DVBA 1CAVA 3WP4A 5I8SA 2JIGA 5HI0A 1LGNA 2C0ZA 2VZVA 1V70A 4ZZ5A 2VZQA 4UFMA 5BXXA 4BK4A 5A7PA 4QQLA 4YWAA 3ZFFB 2IUWA 3WY6A 4PI0A 1FYUA 1W0OA 2EXJA 2VXJA 2VVDA 4UYBA 1VBE1 4XXAA 3B94A 3KV9A 5F32A 2WO1A 4Z82A 2ARAA 4Y5Z0 3U75A 4CDUA 1G6NA 1OH3A 3NNLA 4BIFA 2HWE2 4MHUA 3FFZA 4YGBA 2ZGMA 2WO2A 3WW1A 2R041 4AOCA 2ARCA 1XNAA 2C5DA 4D0QA 1PGL1 1W39A 1GZCA 2JE8A 2LROA 2OZ6A 1J3PA 1G9DA 5BUVA 2D6OX 3IKWA 4LBQD 2B9VA 3HT2A 1ST8A 5EJZB 2GNTA 3VHRA 4A42A 4R8HA 4QPGB 3GGLA 4X8NA 5E1RA 5ISLA 1J83A 5CKQA 3MGUA 2Y6JA 3RZZA 2PAEA 5DQ0A 1MZ6A 2ZS6B 4XAEA 2D3RA 1BKZA 1BBT1 5A6XA 3PDQA 2R0FA 4GIQA 1AX0A 4N53A 2P17A 2JDHA 3VBRB 3OPTA 3WG1A 1R1A2 4CUBA 4EN9B 1R081 1CJDA 3N36A 3NQHA 4LHLA 3ZXKA 2KD7A 2VNOA 5GLTA 1V9U3 5HCAA 3JQWA 4RHV3 2GC1A 2ZAAA 1O3QA 1OD3A 3CF6E 2YZ4A 3HR9A 4KNCA 1IQAA 3AZZA 5E6HA 3WZ1A 5HXVA 2OQ7A 2VZ3A 2YPJA 3K3NA 5JMOA 4NHMA 3JUUA 4UW4A 2AC1A 2QDRA 2JD9A 2ZAHA 3IB3A 4XETA 5FQ0A 4GKYA 1ND3A 1ZZ8A 2WN2A 1MACA 2JJ6A 4XIKA 1JZ6A 1PM7A 2PHXA 3N9QA 4LR4A 4ARYA 1XPWA 4CVUA 4UI9L 1DIWA 1RITA 1VBA3 4FFHA 1CAWA 3NAPB 5F3EA 2V4VA 2W2IA 5AVAA 5FYSA 2ETEA 5FYHA 5FY7A 1RUF1 1W8ZA 4XXPA 4AHWA 4DEVA 5DN2A 2ZA9A 2RDNA 3G6JB 4LBMA 3VBHC 5EFUA 2OVUA 3S30A 3WNXA 4A45A 5J7MA 1OPOA 1UX7A 1F35A 5FYMA 1A8DA 1EPWA 1Q3EA 4QPYA 4Y3OA 3CL1A 3SC7X 1WLCA 5CG9A 3PNAA 2VZRA 4ATFA 1QJX1 1W9FA 4AQ6A 4B1MA 4ITCA 2DBIA 4FT8A 3D3AA 3D0SA 1IKPA 5F1RA 5FV3A 2Y6KA 2KA3A 3D6EA 4Y1YA 1W2UA 4W4ZA 4FTSA 2XL9A 3BB6A 3LA7A 5FWEA 4RGGA 3PUHA 1MQTC 5FZGA 5FPXA 5F8PA 2RHPA 2AYHA 1PO12 2YROA 3HJRA 4PT6A 4JGZB 3SNMA 5C8WA 2QCSB 5KHIA 1SLLA 2JDAA 4KG8A 4Q26A 3VKNA 4NRPA 4XF4A 3T2TA 3EXUA 3OGRA 4CDWB 1JU3A 4FXKB 3LA3A 3VZLA 5GALA 4BXFA 2VUJA 3H3UA 3UGHA 4AAXA 1JI6A 2BVBA 5HV4A 2PQQA 1SFPA 3LDBA 1GANA 2ZX1A 3ON7A 2VZPA 1H8VA 4DS0A 5I91A 4C1WA 2WQ4A 2RS53 2YC4A 4EROA 2VPVA 2JDZA 3BVCA 1KD7A 3WDVA 2Z4FA 1W6QB 2A5ZA 3KCCA 2O8OA 1ND2B 1ZZ7A 1POV3 3N9OA 1WCKA 4KWKA 2J1TA 1LR5A 1QJU3 3OOXA 3VD9A 3H50A 1Q56A 1RJ7A 1RHI1 2RJKA 4PHZA 3TEZA 2WO7A 4FBFA 1LHWA 3MIEA 1PO23 3LZZA 2QBXA 4IE7A 5K0UB 3ZYIB 2JWPA 4QQ2A 3AP9A 1WCDJ 3EHKA 3ZO0B 1CIYA 1RUI1 3ZKUA 1YHFA 2JDPA 2RS11 2NZ9A 4O7XA 1F9KA 4OUSA 5GLVA 5DUWA 2NN8A 1ND2A 3K51A 4AVCA 2HWF2 5JDBA 3H8RA 2HWE3 2MEV2 1DZQA 1EAH2 1UKGA 1W8NA 2JG8A 4FPOB 2BNOA 3LQCA 1XNDA 2ES3A 4LK7A 3BUCA 1YYNA 3HN1A 3CJIC 1NKGA 4QXKA 1QWRA 3HD8B 1JUHA 3LSEA 1FATA 1CD3G 1OA4A 2G4IA 5ABJB 4A4AA 1GWKA 4QX1A 3ZPOA 5FZAA 2W1WA 4JCKA 3SHRA 1LCLA 1H6YA 4HOOA 4BB3A 1N3QA 2JG9C 4WVMA 4YM1A 3VBRC 1OOPC 3QBQA 1S1AA 1AYN2 3A7QA 3WW2A 4SLIA 1TMF1 1HB2A 3ZIWA 2R072 1S0DA 2WSVA 3WINE 4L8QA 3ZFEC 4DIQA 1FMD3 5F2SA 2DCYA 4EJRA 4FSJA 3AVRA 2CHHA 4XDPA 2PHLA 5LA0A 5K9YA 2WWSA 5FRAA 4EN6B 4YM0A 4LBOA 1FMD2 4Q4Y2 4DFSA 5FQ0B 3VBHA 1RUE1 3BTZA 1Q5OA 4N7IA 1ODNA 1VR3A 1W9SA 3MLKA 2ZEWA 1GP5A 2Q0AA 2B4KA 2P4EA 5A7NA 1JYWA 1JYTA 4JC1A 4OZXA 1LESA 3AP4A 3NNFA 3A21A 5F5CA 2VH9A 2XVKA 3DGTA 3MO4A 1K45A 1CPMA 4Z8BA 4CCCA 2ZGPA 2BNMA 2EXKA 1XRUA 4I3GA 4Q0UA 1U12A 1UIKA 4MVTA 1DZRA 3HQUA 1OKQA 3KT1A 4AK3A 1Z7S3 3J9SA 1US3A 4B4PA 1JOJA 3T1LA 1UMIA 2HWB1 3ELNA 4I0AA 5HCHA 4EWDA 1OOPB 3UETA 2JECA 5FWJA 1JOPA 4P5HA 3ZYGA 1VJ2A 2FDKA 1L7LA 1UN1A 1OMIA 4AFDA 3I3BA 2F17A 4XE9A 2QE3A 1EUTA 4A7KA 1CAUB 1LODA 4C90A 1TG7A 3N3HA 3RWKX 3UYJA 4WZFA 1CR7A 2AEYA 3A23A 4GULA 2UY8A 4YVSC 4MGIE 2PHUA 3KVBA 4QX0A 1EPZA 3SLIA 1I5ZA 1W2AX 4Y1UA 3UL2A 5C4WC 2FDGA 3AKQA 3Q8EA 3KF3A 4U36A 4W8JA 5FJHA 2G1MA 1PO13 4D69A 2VTXA 5JXGA 3RYKA 3D8CA 2JXAA 3RZGA 3VB9A 4OI2A 1S0FA 3DN7A 1N47A 1NT0A 2A70A 5J3UA 2QZ3A 4EWEA 2DU0A 4IEXA 3FWEA 4CEYB 5F3IA 1G9BA 4WVZA 1YEWA 3ZDSA 4MGKE 5FY1A 2P3KA 5DAVA 1H9WA 3IIAA 1IS5A 4P9WA 1DQ0A 1JS9A 1NA1A 3AB0A 5FJKA 4AEDA 3ENRA 4XMAA 4BHPA 2R49A 5F5QA 1TEIA 3BPZA 5FLHA 3EMRA 4FQZA 1REFA 2NLRA 3GF6A 5EV7A 4IGQA 4F3JA 1OVSA 2A6WA 4KWUA 4QX5A 3RWNA 2YUEA 5GZGA 1PIV1 3B00A 2J1EA 2VW1A 2UU8A 4TLFA 1AR73 3ES1A 4Q4X1 3KHBA 3LWCA 4BWOA 1W28A 1YQ6A 2HBUA 2YU1A 4RS5B 5IHRA 2XR4A 4COYA 4M3CE 3WDYA 4XQ4A 1PX4A 4JTOA 1JOBA 4LTAA 3VBOC 4AHXA 1HLCA 1D2QA 4RL7A 1GBGA 3E6CC 1STMA 1AR93 5AC92 1GZWA 1SLTA 1O5UA 3M3EA 5EQUA 1ENXA 3ETPA 5C5TA 2VMHA 5FMBA 5L7OB 3RNSA 4IL7A 1WCSA 4CU7A 1RUD1 1ENRA 1CZVA 4Y4YA 3JD72 4RR3A 2VZUA 4FOWA 1NLRA 2RDQA 5AFEA 4IV1C 3V64A 1LTEA 3AMNA 3KQ4B 1RMU3 4CP1A 4BYYA 1S2KA 4UW5A 4AFAA 1UOFA 1QJY1 4CE8A 3ZFGC 4EZHA 1F8VA 1RUE3 2OZJA 3AKRA 1BYHA 2VECA 4D94A 2FD8A 3WNMA 2AGSA 3TEYA 1ZBE3 1JTZX 1HDKA 1REEA 3U37A 4XFFA 4JQRA 5KHJA 4LLOA 1FMD1 3AP5A 2W1UA 3J7MA 3H1WA 3LE0A 5EXOA 5LBBA 1ULGA 2DCZA 3HMYA 4CDXC 4MX3A 5BNPC 1O3SA 4NRQA 3T09A 4FPGA 2ILMA 5BNOC 3ALQA 4XDOA 1UYYA 4LO5B 3POSA 3VN4A 4LJHA 3N7KA 1AX1A 1I9RA 2W68A 1AR61 2EVXA 4YVSA 1VRBA 1GYKA 3HOBA 1QXJA 5GLZA 2D5FA 1ZRIA 2UWBA 5C33A 3RSJA 1QJU2 5FXWA 4F7ZA 2VUDA 2GC3A 3U78A 2VQUA 5FZCA 1LU2A 1ZYBA 2RJLA 4FXGB 1E5HA 4YFWA 3OBAA 1ZBA3 4Y5TA 1DQ6A 4OHWA 4JGZC 4C0BA 4CTEA 3C8XA 3O1RA 1REDA 3Q8CA 4IEVA 4CUGA 1AZDA 3K75B 2RR12 1PZ8A 1OURA 1CX4A 1HJFA 3FC0A 1LKNA 3I2GA 1C3HA 2Q5TA 1HN0A 2C6SA 2R061 3OF1A 4WVWA 5FMCA 2D43A 5SV5A 4AEDC 3PVBB 3WHTA 2WBKA 4PIZA 1UY0A 2HEVF 3D82A 4LBQA 1JUIA 1RUH2 2BGOA 1YUDA 4Q2FA 4WZCA 5IT6A 1ND2C 5IVCA 4Y1XA 4DUVA 4AGGA 2I2SA 2XLAA 1JZ2A 4JTNA 4UW3A 1W8WA 2RS51 2PLV3 3SKVA 2VOTA 4XEZA 3VDDB 1KQRA 4NHYA 3T2OA 2GNBA 4MXVA 3KLSA 4GZ9A 4NN0A 5FP9A 4FP2A 2ZTNA 4BA6A 1WMEA 4LMFA 4M3CF 3USUB 4P9IA 3LGRA 4PDWB 4PLMA 5C8CC 3VBUA 1EY2A 2XHNA 2VAUA 3FLTA 1GU3A 3R4SA 5FPVA 3V0BA 3AZVA 5A3OA 1IPKA 3IPVB 3HQXA 1ZZ9A 2XUEA 2ZZJA 4LEJA 3VBRA 1DHKB 1SBEA 4RA0A 1DGRN 3ACLA 4Q4Y3 4Y5SA 4GALA 5C8CB 2B7YA 2RMU1 5G04L 1XB9A 3ZYJB 3I54A 2IFWA 5LBEA 4IQPA 4GWMA 3MIDA 4PLOA 5D2AA 1RHI2 3WUCA 4QB1A 1XSQA 1GZTA 1DZTA 4GQ7A 2FMYA 2ID4A 3WX5A 1L3JA 4FOYA 4Y24A 1Y9GA 1X36A 2XL7A 1EV12 4O9GA 2FBEA 2EA7A 3H7YA 3I97A 3TOJA 5DZFA 1ZRCA 4LBJA 3GZUC 1POQA 2VVFA 1D0GA 1RGSA 3C7GA 5DAPA 3POIA 4KL1A 4AEKA 2JDUA 1GR3A 4BLIA 5J48A 1AL0G 1UZZA 2DTWA 3ZLIA 2DWRA 2W92A 5IVVA 2JE7A 1GQGA 3J8F2 5FR3A 3B01A 3RJ2X 1NLQA 1RXFA 2QQLA 4TSVA 4FPFA 3NSTA 3BKZA 3HPNA 1CPNA 2JB8A 2V73A 3V65A 3RYPA 2PAKA 5FYUA 3ZXFA 4CDXA 3H8XA 4XACA 2WS92 2WLPA 3SISA 4B4RA 2VW2A 3I4IA 2HLEA 5FZOA 1D2SA 2JG9B 5A32B 4CXYA 3MW2A 1POV0 4QDQA 4XQWA 4GD4A 3GYDA 3WF2A 2PA7A 4YVSB 4Q4W1 1LEMA 3H9AA 3IAQA 4BMEA 2CL2A 4W50A 5CFCB 3U1XA 3H1YA 1PM4A 5KC5A 3KHCA 3AZXA 3OBZA 1IHMA 2D5HA 4W6YA 4GJZA 4FPYA 4P00B 5AFBA 5C3QA 2ZHNA 3AX4A 1OOPA 2LALA 3AMHA 5LWBA 1X9TA 5EWSA 3H1MA 1O4TA 1W6NB 1QQP1 2XDVA 3AYEA 5A33B 1Y9QA 4MSVA 1JHJA 1S2EA 2DURA 2RV9A 2WJSA 3ZMNA 1UO9A 2IWGB 4UWDA 5FDBA 2GC0A 2B8MA 4CDQA 2GP5A 1R1A1 4LULA 5DDJ3 1UZVA 2XONA 1RUG2 2FHRA 4KU7A 2O8QA 4N9IA 3UKVA 2ORXA 3PLQA 4G3YC 2P34A 2ZBJA 1BK1A 2DCTA 2J1RA 3GM8A 2ZX0A 4YZ3A 2H0BA 2R1BA 2XVLA 3APBA 4YSFA 1C57A 1CX1A 4QPGC 2JDKA 3NNMA 4LBNA 4IE4A 1H2NA 3BI3A 3OGSA 2HWF3 1RVF1 4YW5A 4IGPA 2QQUA 2W95A 3ZSJA 3H0OA 4PI2A 4JZRA 1VMFA 3VHOA 4YM2A 1CQ9A 2UY9A 1FOD1 2Y6LA 4HL0A 1V6NA 4GAZA 2P3JA 2QVSB 3T0AA 2JKXA 5F3GA 1AL21 2QQJA 5BNOB 1ZRDA 1GV9A 1JXNA 1MEC2 1UU4A 2JICA 4CDWA 3S5AA 3NMBA 1QQP2 2GNMA 3WUDA 1OQEA 2Y64A 3OPZA 2W46A 2XLGA 1LNSA 2BBAA 4H14A 2O1QA 4EN7B 1QJFA 1RUH3 3PVNA 4NUBA 4CU6A 4M01A 4S2DA 4YRDA 1C1FA 3B3QE 2VU9A 4OMDA 5BNOA 2BQPA 2X5IB 3T30A 2ZGKA 3EJKA 3KGZA 5L73A 4Q4V1 2YFUA 3VD5A 4ASLA 4BLJA 2JD4A 1UCXA 4D8MA 3AJZA 2D7FA 4I30A 3I59A 4JDOA 2GNDA 3GZTB 2WO3A 4AWDA 1R093 4OZOA 4XILA 3IMNA 1V00A 1VB4A 3A0KA 3L2HA 4ZY9A 4PQ9A 5LA2A 3MDPA 1UPSA 4NIHA 2R6QA 4Q4V2 1A8MA 3ZSKA 1Q8QA 3N9LA 4AI3A 4BPZA 5K0UC 2FDFA 1LOFA 1O7FA 1UU6A 3W59A 4YG6A 4URAA 1RUC1 2WZ8A 3KS7A 4XF3A 3CZUA 3OPWA 4FFFA 4AVSA 4YVWB 1E5RA 1I6XA 5FZ9A 4FPLA 2YGMA 4E4ZA 1QH6A 4W6XA 3MIGA 5AVPA 2XQXA 2VD7A 4OQ9A 4E27A 4YGDA 4YW2A 4ARXA 3HBZA 3MZHA 1L7QA 3PJQA 3F95A 5IFPA 4N9HA 2TEPA 1B35B 1L7RA 4ASMB 1JZ8A 2BRTA 5L36A 2C26A 1W6QA 3O0VA 3D5OA 1DLCA 4JV4A 3HAGA 5C3OA 1YO8A 3SCGA 3MW3A 3SKJE 2X10A 3UJOA 1XYNA 3AL6A 1W8HA 2XUMA 1G7YA 1LHNA 3J7NA 4NAMA 4EN8B 5JSOA 4Y1VA 2XKOA 2UWAA 1Y4WA 2GAUA 1IS3A 4F83A 4XCAA 2AZ5A 2FCTA 3OEBA 3VD4A 4RGKA 3N7JA 3WNOA 3AXEA 2EF6A 3DXTA 1CAXB 4CXXA 4AFBA 1G8WA 1OF3A 1SCRA 2WWJA 5C3RA 1PNFA 1YFXA 4Q27A 1JN2P 3KZ4C 4AHYA 2RS52 5I8YA 3K48A 4J25A 4NMIA 2Z42A 1AUYA 3U10A 4CCNA 4DO0A 4IESA 5IVBA 1RJ8A 2RDSA 1LULA 3RJRA 3ZFGB 4D6RA 5CEHA 1ULEA 2GALA 4CRQA 3KMHA 5FIXA 2WC2A 2XBO3 5H9RA 3FX3A 5A1LA 1MS0A 3I2OA 3PVOA 5JXJA 2MEV1 1GZ9A 1C5IA 1BEV1 1YFUA 5A7SA 2Q1MA 1NA1B 3RMYA 3VBHB 2PHFA 2ATFA 4ONUA 2JIJA 3GNEA 4D7YA 3A0NA 4CP9A 2QQIA 1RUJ3 1MS3A 4XF9A 5ANNA 4XF1A 4WVVA 4FO9A 1DYKA 4Q4W2 5F39A 4XJWA 2D3SA 5CKNA 1TMF3 3NAPC 3GZEA 1QDOA 4A6SA 2Z79A 1N1YA 5F6LB 3WQ7A 4XURA 4LO6B 5DAQA 4AGRA 4PF5A 5FZFA 3QOPA 5IK5A 4RS5C 5DZEA 3RZKA 3MIHA 1LHUA 3Q9OA 4IE6A 2GSYA 2E6VA 3GXUA 1F4AA 2VM9A 3OD4A 2CDPA 4GKXA 3VKOA 5FREA 2QQPA 3SH4A 3NNJA 2O0OA 1HJGA 1CZTA 3LA2A 4TYSA 3ZXEA 1PO22 2GMPA 3LOIA 2CWSA 2QKDA 3H42B 1G9FA 4JRLA 1OFNA 1SEFA 2B45X 5FZ6A 1WW6A 4UT5A 5IW0A 1O6UA 2Y26A 4UAPA 5A3MA 1AJKA
chains in the Genus database with same CATH topology
3AZWA 4K8FA 2H0VA 1VLNA 4Q8LA 4IEYA 1CAXA 2RS13 3OYWA 4GMP3 1KS5A 1SQ4A 4R9BA 4OHYA 3FFQA 3ME2A 2ZOEB 1PO21 4PDWC 4Z2WA 5ACA2 3M2MA 3WDXA 1QHDA 1RHI3 3ZXJA 2HWD2 4GH4C 2XH6A 3AFGA 4NWVA 2P37A 4N53B 5JZGB 4HPKA 4HANA 2IXKA 2TBVA 2ZX4A 4LHKA 1TME1 5A3LA 2NPIA 5L36A 2HWD3 2WS93 2FZ1A 4LO8A 3VL9A 1A6CA 5JVVA 2HKXA 4R4XA 2GZWA 3WV6A 2ENRA 4QGLA 1QNYA 1RIRA 1WLWA 4ORFA 5GM0A 2V5YA 2CV6A 4FQ4A 2XJTA 2DCKA 2HWD1 4LLFA 1IZ3A 2ZGLA 2E7AA 5C6CA 4YVWC 2XWBB 3BOPA 4WM8B 1RUE2 2QNKA 1VAVA 1H0BA 1NYWA 3VBFC 4CYDA 1EV13 3IDEA 3VZNA 4JGYA 3UKNA 1NCRA 2GDFA 4WM7C 1AR83 1S55A 2BNNA 2DYCA 2ERFA 3OD0A 4YW3A 3WQ0A 3V0BB 4META 1XYPA 4FAGA 4HN1A 4A2UA 4FPJA 4UXAA 1AHSA 3GHMA 2E7TA 1ONAA 1WW5A 3J8F3 5SV8A 2AREA 1N1SA 4BZ4A 5JOXA 3WG2A 1JBCA 3NKTA 1YI9A 4HK8A 1WMFA 2YDEA 2VOXA 4E9KA 2PTMA 4LBKA 2ZX2A 4QMAA 2VUAA 4DRRA 1AR62 2QJVA 3JZVA 3U11A 1TNRA 1VBA1 1EAH1 4LBLA 1DQ2A 4XHXA 4G9SB 1R1ZA 5JSRA 3LCPA 2BYVE 4Y22A 1CJPA 5I93A 4B4QA 3PTYA 1OFSA 3GHNA 1F5JA 5DUUA 5BNNB 1WMDA 1UPIA 2HWC3 2MEV3 3A4UA 3TAYA 3DKWA 2XBO1 4Y1ZA 2XJPA 3NJZA 2C9AA 1V6MA 3HWJA 1GSLA 4X6QB 5ABJC 3OY8B 2A71A 4KG0A 1D4M2 2QFEA 3I8TA 5FO7B 2WT1A 3RI9A 1K5MA 3ZSMA 1R083 1YFWA 1SMVA 3VBOB 1ZX5A 3LAGA 1O4YA 4Q0QA 3S0MA 3WW3A 1Q8PA 2R062 1ZVFA 4G4FA 1UL9A 4MGZE 1AYM2 1KDKA 2ZHLA 4XHBA 3ILRA 4BM8A 3B7MA 1RUOA 4OHZA 2R063 1B09A 1DU3D 1X50A 1YRZA 2PHTA 4XFIA 4YG0A 1H1MA 2XJSA 1IS6A 4WV8A 1AVBA 1YJLA 5T3NA 1V6OA 1H4HA 4H7MA 2HWB2 1MS1A 4XW3A 1BMV1 4YVWA 1CVNA 1J3QA 3VBSB 4EWAA 4RR3B 2DFCA 2JENA 2DFBA 4S2FA 2VG9A 2Y38A 3B9CA 1PK6A 4M3CB 1YIPA 1UZYA 2RM21 3OGJA 5GZFA 1Z0HA 2MNGA 3BIWE 1ALYA 1RMU2 4X6RB 2G9GA 1KJLA 4E4SA 2R042 2YHJA 1QOTA 5A33A 2RS33 4H3WA 4J1WA 1ND3B 2BW8A 4XFGA 4DPNA 5AC93 2LUWA 4XMIA 1NCQC 1D0HA 3H7JA 3TYJA 3JCIA 5IK7A 4KWLA 1NCRB 2E63A 4OULA 1VIWB 4L9BA 1AL22 4CP2A 1BXHA 3ZYPA 1Z78A 1WW4A 1NY72 5FMOL 3WCSA 3D4KA 3RPQA 1ASJ1 1RMU1 2WS91 4E2GA 1OD5A 4BQ1A 2MHFA 4QQPA 5IUQA 4M0NA 1RUD3 2MPFA 3NV2A 2UURA 3UV9A 1MZ5A 3G7DA 5JOYA 3THTA 1Y43B 3RRDA 5BY5A 1JW6A 4QPIA 2D6NA 2WNEA 2XJQA 4DRVA 2GN3A 1HXS2 1LGBA 1U5XA 3X29B 1VBD3 1VP6A 4XFHA 4A7ZA 1MS8A 3ZFFA 1V6JA 2XLFA 3O7OA 2X5IC 2WT2A 4KWJA 5CAZA 1ZREA 2JG8B 3ZXLA 4HETA 4IEQA 1FOD2 5BPXA 4AE2A 3B93A 1FI2A 1VBE2 1AF9A 4C0HA 2HWC2 5JWPA 5I8TA 4IEZA 2XWJB 2WLQA 3AMMA 2B42B 1RL3A 2AR6A 2BWCA 4MGYE 4GH4A 3I7DA 1C8M1 4KU8A 2DCJA 4HFSA 1AR92 4UW6A 4GB32 1C8NA 5JOZA 1BZWA 1BVVA 1SLAA 3FLRA 3HT1A 3POWA 1YNAA 1X33A 1UMZA 3VHPA 1N3OA 4GWNA 4LHNA 1IPJA 1QKQA 2PLV2 2ET1A 3E97A 2Q1ZB 5LRRA 4CDQB 1AYM1 1H2MA 3ZPYA 2WFF2 2IXLA 3KGLA 2XJVA 3DL3A 1DQ4A 5CADA 1NA1C 5H9SA 2VNGA 4Z92B 2Q8OA 3ST7A 1AYN1 1BJQA 4AG4A 2YC0A 3N4MA 2HWB3 2X5IA 3AZYA 1HRV3 4CDXB 1A78A 1COV2 2CGPA 3UK9A 2A73B 4RGAA 2ZHKA 4WM7A 4PCRA 4YARA 2KXLA 3ZSLA 1U5ZA 3AKSA 3POYA 4JGZA 4AI8A 1WBLA 1WW7A 4HKLA 1LRHA 1JHNA 1LOFC 1Y7BA 3KCYA 3S7EA 3PVEA 4COZA 2GMEA 5EYYA 2HWC1 3CEWA 3OBTA 2ZGUA 1PHMA 1B35C 1JYCA 1J3RA 1WA4A 5T54A 4OHXA 2OA2A 1OQDA 2OUJA 3M1HA 4B7EA 5FO9B 4PIYA 5D1IA 4QGMA 1R082 3CNAA 4XTMA 1C8M3 1C4RA 1NOVA 1VB2A 2ZMNA 3URFA 3ZN4A 2E7QA 2VVEA 1W6MA 2CNAA 3DV8A 1H30A 2Q30A 4GXLA 3ECQA 2R30A 2FMDA 2UYBA 1LHVA 3UKTA 3FHIB 2D44A 4ES8A 4AW7A 4UBHA 5BV6A 1PGL2 2HWE1 3J4UH 5JR7B 4D7SA 3NV4A 1OA3A 2B5HA 3JBG2 5T52A 3D0JA 3SXWA 4BCUA 1CIWA 1J58A 1RUNA 3AYAA 1NCQA 3AKTA 1ZA4A 4YW4A 1F31A 2PELA 2V09A 1YI7A 3ZXDA 1DFQA 1FOD3 2JG9A 4AI2A 5I0UA 4N90A 4I3PA 4Y20A 5CBLA 3ZVXA 1NZCA 2DF7A 4XPVA 4K7JA 3VZMA 4OLLA 4GA9A 1ZBE1 3MLLA 1HRV2 4NHKA 3S6PA 2WL1A 2A6ZA 5F6KA 1QJY3 4FPHA 4CEYA 3VV1A 3FUQA 1ENSA 1WUVA 1LOCA 3QH7A 4K6BA 3FBMA 4N43C 4NO4A 3ES4A 5FTTC 3O0WA 1QOOA 3WD5A 3RYRA 4QPIC 4H7LA 2TUNA 2YXSA 1RUC2 1NCQB 1U0AA 2EAAA 2XJRA 2SLIA 1D4VB 3R4DB 4HSLA 2DUQA 3WCRA 2VNRA 1CAUA 1RUJ2 3V0AB 3ZFFC 2VMIA 3FMGA 2ZX3A 2FZ2A 1R092 5DG1A 2IXHA 3V0AA 2VQ0A 2YGLA 4IV3A 4LUKA 2VY0A 2P3IA 4XZPA 2LTNA 4N7UA 2D6PA 1RVF2 3USUA 1PIV3 5C9AC 1MZEA 2K2SA 5CFDA 4MZUA 1SLBA 1XXNA 5FBZA 5JCTA 5FCCA 5C4WA 2CWMA 1WD4A 4B8EA 4AVAA 3MYXA 1OLRA 4BE3A 1OLQA 4Y22B 4CP0A 1CGPA 1NXMA 4NR1A 3JU9A 1ULCA 5D8AB 4S2GA 2DVAA 3MIBA 1GICA 1OA2A 3DPRB 1RUJ1 1W6NA 1MVQA 3VZJA 2X8KA 2A6VA 2NQYA 2Y0OA 4H55A 4IV3B 4MUVA 1I3HA 1WLTA 1DG6A 2TNFA 5FO8B 4P9YA 4XJZA 3PHMA 2D98A 5KHHA 3W9AA 4LT5A 1UF2C 3NKGA 4R9DA 1FAYA 2XGXA 1TMF2 1ZZCA 2R16A 4EN0A 3NO8A 4B29A 2N7GA 2WT0A 5KC6A 1SCSA 1K5MC 4R4ZA 1HRV1 4I2OA 3MFAA 4NVPA 5T5OA 4YZ5A 5A32A 1XE8A 1ND3C 4QQHA 2A6YA 5JPNB 2ZKNA 3RMXA 4R9AA 2OIIA 3ZN6B 4OVEA 3VBFB 3H3ZA 3U0ZA 4CZSA 2BVVA 1X82A 1IOAA 4HKWA 2DUPA 5JIUA 1PVC3 1JYIA 1H1AA 3JBG1 1NG0A 4CEWB 2D3PA 1AYM3 1W0PA 2NM1A 4YG3A 3AFKA 1BCXA 3RS6A 2I07B 2FQPA 1ZBA1 5JI7A 4ZKTB 2KM2A 3JB8A 4K3UA 4S2HA 3DUIA 4XIOA 5KXEA 1QF3A 2DVGA 4OUMA 1COV3 3VUOA 3RQ0A 5JZGC 2R071 4JVAA 3WQ1A 3ZFGA 1AR72 1N1VA 2A3YA 4RSUA 1GZWB 1O5LA 1PZ9A 3M70A 5JPMB 4JGYB 1AR81 1UU5A 4OHVA 3QACA 1EV11 4OI1A 1YXWA 4A3XA 4KGQA 1CONA 1WLDA 4WBBA 1G86A 1LOBA 5LEJA 2GU9A 1DYPA 1ZBA2 2ZCWA 4QD2A 1CESA 4QT6A 3MPBA 3TNPB 5J96B 1QGLA 3IBMA 5JAXA 4XBLA 3VLBB 4AF9A 3CU7A 5LRSA 3LKJA 4AFMA 3O12A 2W52A 4K9SA 5GLUA 1FV2A 3JQXA 2K0GA 5CU1A 5T5JA 2WSUA 1UIJA 4AVVA 1VBD2 3MFCA 1TE1B 2QDNA 3GBGA 5GZDA 3PJYA 3USSA 5IK4A 1QJU1 1RVF3 4QPGA 4E2QA 2Z2SB 5B2GB 2NYYA 4DY3A 3N35A 4ATEA 4IEPA 1O3TA 4J6GA 4D3WA 4UBGA 4I02A 5D8AC 2IXIA 1HV0A 1ASJ3 1W6OB 4BOWA 4YZ1A 1TNFA 1XNKA 2ZGSA 2ZGNA 3CJIA 5FLJA 1LU1A 3WHUA 1LOAA 5JOWA 1IGOA 2WFPA 1I1EA 2AENA 1NY71 5BNNA 2IC1A 4KQ7A 5J98B 4FPCA 4OFGA 4M3CA 1GQHA 5FOJB 4PDWA 4WM7B 1MQTB 3ILNA 3TNQA 4AGVA 2PHRA 2XG3A 3B69A 3WDWA 3IPVA 1S0JA 4CDUC 3WP3A 3FLPA 2ARBA 3B9IA 4AI1A 2UWCA 3R6SA 4AEJA 2IZWA 1QJX3 2R073 4URTA 2ZHMA 1KDMA 1COV1 1S0EA 2VOKA 3MIFA 4R52A 1ZZBA 4FCAA 3AXDA 1FNYA 4EV0A 1X7NA 2Y0IA 1SLIA 1VRH2 5JZGA 1PO11 4IXLA 5H9PA 1VBC2 2WNVC 3M3CA 3W58A 1D4M3 4YZ2A 4CEWC 5KXBA 3JBG3 4L2NA 4X8PA 2RMU2 1PVC1 4N53C 1APNA 3O5SA 2P2KA 1H4GA 3WDUA 1MQTA 3NV3A 4AVTA 1OHFA 1Y3TA 1FPN2 1Q8SA 3JD71 2D97A 4IEOA 2RMU3 3NWKA 1JH5A 3VDDC 1OSGA 4AHZA 2Z69A 4QHBA 3UJQA 2GH2A 4YW1A 2W08A 1T6GC 2JEMA 3E6BA 4DB5A 1MR5A 1O91A 2WA4A 3CLPA 2A3XA 3ZX7A 1LJ7A 5BYNA 1ZNPA 3ZN5A 3O14A 4KH9A 2I74A 1LEDA 1TQ5A 3MEPA 3WP6A 3QD6A 1RUC3 5CFDC 1MZFA 1QDCA 2WNVB 4FPEA 3ZFEA 3ZXAC 1ULDA 4B3NA 1QOSA 4L97A 1DF0A 2OYZA 2PN5A 2ZJCA 1DGRA 4JDMA 2WZPP 4HZFA 4FP3A 5D8AA 3VHNA 1EAH3 3P3NA 2R043 1KJRA 1R091 2Q4SA 5JLVA 3S7IA 2PYTA 3C2UA 2OW4A 5L7OA 4J1XA 2IFRA 1W6PB 3KSCA 4SBVA 4Q4V3 3WW4A 3GZAA 2ZABA 3AMQA 2R1DA 2WKKA 3E6DA 1AXKA 1BMV2 4P14A 2DVFA 1GNHA 4KBBA 5KBFA 1XNCA 1ASJ2 3EQEA 4RQPC 4L11A 1RUG3 4Q0PA 3WVJA 4LO4B 3QCWA 3LOBA 4Q0VA 1SFNA 3OTFA 1U5YA 4ZU4A 4P9GA 1QH7A 3M8LA 4Q0SA 4AQSA 4L92A 2HWF1 1HXS1 1PGW2 2RS12 2A75A 3NV1A 2VULA 4XQDA 4N43B 4M0HA 1HW5A 1X8EA 5CNAA 5DG2A 5FOBB 2K9ZA 4C91A 1J1LA 1V6IA 2YY1A 2BPA2 1ZM1A 2DTYA 3ATGA 2RS32 2WINB 2AH2A 4PJYA 4A7YA 4HT1T 1QU0A 2JE9A 4W6WA 3V56A 4DMIA 1Q8VA 1PZ7A 2D40A 4MV2A 3ZMOA 2NMNA 4N43A 2DUOA 4YGEA 5H9QA 3SCFA 4KGGA 3MF6A 3TB0A 2VW0A 4ZXKA 3E5XA 3GBWA 1LECA 1ZRRA 3R0RA 5J37A 4AI0A 4AQ2A 5FFOC 2X29A 5GKAC 5F9TA 1CN1A 2HYKA 4Q4W3 1XE7A 2W0XA 4HVQA 1HRI1 3GBFA 2VOVA 4XBQA 4OI4A 3R4UA 1QXPA 4DNYA 2ARXA 3E5QA 4I0BA 5TSWA 2CAUA 1DQ1A 1QMJA 1H9PA 1D4M1 1EP0A 4JRAA 1KRIA 1AX2A 1PK6B 5E88A 1QXRA 3BODA 3DPRA 5DXDA 2UYAA 5T5LA 4AFCA 2GN7A 3MI8A 2C1FA 1O3RA 2OPKA 1VBB2 2A3WA 4LO7A 3AM2A 4E4DX 1LB2A 1GLHA 5LK5A 1SBFA 2HEWF 3SITA 1DGWX 4AYUA 1LGCA 2ZMLA 3C3VA 1BEV3 4U2AA 2ZGQA 1C5HA 2WNUC 4Q4Y1 3VBUC 2BEOA 1S0IA 3M4FA 5GZCA 4E2SA 5LK7B 3FUOA 1Q43A 3T1MA 4AQTA 3TN92 5JI9A 4ISQA 3N7MA 4RQPA 2WFF1 3ZIXA 3RG0A 2H6CA 4ISRA 2A7AA 1YWKA 4XFAA 3VBOA 1UW8A 1TME2 2PLV1 2BTVC 3RDIA 5JSPA