3VKLA

Protease-resistant mutant form of human galectin-8 in complex with two lactose molecules
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
289
structure length
289
Chain Sequence
LSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 60
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA02
1CONA 4GWMA 1VAMA 3AP5A 1IKQA 3H0OA 2GNBA 4TYSA 3N36A 1GZ9A 4FOQA 5CB7A 1IS6A 1URXA 1FATA 2E7TA 2DV9A 5T55A 1FV3A 1KRIA 2H0BA 3N7JA 4ZXKA 4BM8A 1VIWB 3VKMA 1CN1A 3BOPA 3POYA 3RS6A 2GNMA 1JYCA 4XZPA 2DVAA 1AX1A 3WUCA 4Q26A 5DZFA 4C1WA 1JW6A 1WCSA 2P34A 1MS1A 4W65A 3O0XA 4YLZA 1S0CA 1G9FA 3ZSMA 2WQZC 2D44A 4Y1VA 1AX0A 1SLLA 2A7AA 4YW5A 3T1MA 1C4RA 3R4UA 1JN2P 2ZGNA 2WSUA 1LOFC 4XMIA 1IS4A 1S1AA 2CY6A 1AF9A 3ZYPA 4LBQB 2PHXA 4Y1XA 4DFSA 3M3CA 1LU1A 4Y1UA 4XJ8A 1GICA 1CPMA 1GNZA 1LCLA 1WBFA 2DVGA 1YYNA 2XG3A 3WDVA 4C1XA 3V0BA 2ZHKA 4M00A 2E51A 2EXKA 4YW1A 2I2SA 2WSVA 3OYWA 3HMYA 3WZ1A 3AZWA 4RA0A 4CZSA 3AFKA 1F9KA 3T1LA 2EF6A 5EWSA 5GLUA 3O0VA 1GYKA 2WNEA 1QOSA 4LBKA 1G7YA 1DQ6A 2PHUA 5H9SA 5KXDA 3M1HA 3D4KA 1AXYA 1D0HA 1VLNA 2ENRA 2PHRA 2R49A 4XBNA 3TB0A 3WHUA 1WW7A 2EIGA 1OQ1A 3WDYA 2CL2A 1SBEA 3AP6A 4XMAA 2DUQA 5F9TA 2ZMLA 1QGLA 4YGCA 5L73A 2YV8A 3WUDA 1S0BA 3N35A 3RMYA 1WLWA 3B01A 3R4SA 4WV8A 1I1EA 2YMZA 1N1VA 4YM0A 1V6NA 3A0NA 2VW1A 1UZYA 2ZHMA 2JE7A 4R9DA 3B9CA 2A6WA 3B3QE 1LGBA 2ZGTA 1G9DA 1GZWA 3OGGA 1WLDA 1N3OA 2DUOA 3AJYA 2D6OX 1WW6A 4BPZA 2ZGKA 3RSJA 1RINA 1LESA 2KM2A 4PCRA 4XXPA 2AGSA 1DFQA 1FAYA 1YO8A 2WT0A 5T52A 1KQRA 4M01A 1DBNA 1LJ7A 1CQ9A 5DZEA 1LHNA 2ARXA 2E6VA 2ES3A 2P37A 4YFWA 5T5JA 2NM1A 2JECA 1QNWA 3BTAA 3FLPA 5H9QA 1NLSA 1IOAA 1ULEA 5T5PA 2P3IA 3BIWE 3ATGA 1MS8A 3ILRA 4Y1ZA 5SV8A 5HCAA 1LGNA 2Z42A 2WKKA 1LOGA 2DWRA 1KJRA 4YM3A 2VXRA 4UW5A 1N3PA 2D3RA 2D6MA 1DZQA 1EPWA 1MS5A 3PVEA 1PZ7A 4PBOA 1QDCA 2PHTA 3AYDA 4YGBA 3ZXJA 2DYCA 5JLVA 4LBQD 3V64A 1DQ4A 1B09A 4JRAA 4NOTA 2NP0A 4XXAA 1C1LA 2VUAA 1AX2A 1ENSA 2GNDA 5DZGA 4FPKA 1HQLA 3SH4A 3SNMA 4FPOB 4Y20B 5DG2A 1IKPA 1KDKA 1ENQA 3AX4A 1ULGA 1W6NA 2UWBA 3FFZA 1UAIA 4DS0A 2G4IA 1DYKA 1LOBA 1CR7A 3A0KA 4IQPA 4XIOA 4D69A 5IT6A 3WCRA 3NWKA 4RL7A 4M3CF 4YZ1A 2ZGPA 4P9YA 4WZFA 1JXNA 2WLQA 4M3CE 4P14A 4R9AA 1FYUA 1GBGA 3USUB 3NV2A 4KBBA 1CPNA 4OZXA 2GALA 5IK5A 4AWDA 1W6MA 2FMDA 5GZEA 4R9CA 5IK7A 1LOAA 1MZ6A 4FQ4A 5DUUA 2D43A 2AYHA 1CESA 3O12A 1S0DA 1YXWA 2ZHNA 4PBPA 2SBAA 1VAVA 5E8AA 4AGVA 3M3OA 1F5FA 2ZBJA 2C5DA 5EYXA 3NV3A 2XB6C 1S0FA 4XJUA 2EXHA 3N7LA 3FBYA 2FHRA 5KXEA 3SITA 1DGLA 2P3JA 3AXDA 1G8WA 3MPPG 3MW3A 1SLTA 1LOFA 1OKQA 1G9CA 2WT2A 5DXDA 4YG3A 1LEMA 5GZCA 2EXIA 2W52A 3KQRA 3V0BB 3LSDA 2R0FA 2VW2A 1DYPA 1YI7A 3WCSA 1RITA 2W08A 1DIWA 1ZM1A 1SBFA 4YW3A 1N1SA 2ZKNA 3OYWB 3PVNA 2A71A 3T2TA 1LEDA 4GA9A 2E53A 4AVVA 3JUUA 2LTNA 2DTYA 2YROA 4PQ9A 1V6KA 3AJZA 1ENRA 3ZXKA 1HLCA 4CTEA 1WD4A 4ATFA 5JOYA 4YM1A 2ZABA 2EAKA 3APBA 4XIKA 1JBCA 3HR9A 4DRRA 3WNXA 2ZGOA 3VKNA 3VV1A 3MW4A 1ONAA 4BMBA 3ZXEA 4FPLA 2D3SA 3PJQA 4YM2A 2ERFA 4UW3A 2ZGMA 3WLUA 3IM0A 1Z78A 3WDXA 3ZSKA 4PF5A 4LBJA 1S0GA 4Q8KA 1UZZA 1CJPA 3OJBA 4M3CA 4Q1RA 1AJKA 1DQ0A 1GZWB 1XQNA 2B7YA 1OFSA 1SFYA 2A3WA 1KJLA 1VALA 1KITA 1MACA 2SLIA 4GKYA 1LULA 2DUPA 4F83A 3VKOA 3WVJA 1DHKB 3HN1A 5EXOA 3NV4A 4XHBA 5GZGA 1ULCA 2UURA 2AUYA 4ASMB 2YY1A 4K1ZA 3PMEA 4XTPA 2NYYA 1SLIA 1V6LA 5GLZA 1LENA 1H9PA 1CIWA 1HQWA 5EYYA 2ZA9A 3L2YA 2UWAA 1I3HA 1LGCA 1Q8VA 4JCKA 1MVEA 5GM0A 3I4IA 4ATEA 4K21A 3N7KA 3AZVA 5JOWA 1W0OA 1AXZA 1QOTA 1PZ8A 4YGDA 1W6PA 1GANA 1LTEA 3OY8A 4XYXA 3ZVXA 2ZGUA 4Y26A 4FOWA 2JJ6A 1CVNA 3UJQA 2D6KA 1LU2A 3GALA 2ZHLA 1WW4A 1W6NB 1SLCA 3IMNA 3AZZA 4MYEA 4LBMA 3RRDA 2ZMNA 1G9AA 2TEPA 2ZACA 3FUQA 2W68A 2PHFA 4GWNA 1N47A 2A6YA 4YW4A 3WDWA 4LBOA 1A3KA 1C1FA 1N1TA 2D6PA 2P2KA 3AP9A 4FOVA 4HANA 1SCSA 2CTVA 4XDQA 3C2UA 2RHPA 4ITCA 3QCWA 5JMCA 1LODA 2DURA 1QU0A 4I30A 3POSA 3WG3A 5KXCA 5T50A 1W6MB 2VW0A 4XHXA 1LHWA 1UKGA 1UX6A 4YZ4A 4XOGA 3M3QA 2OUJA 3AYCA 5GLTA 1Y7BA 4AVTA 5GALA 2EXJA 3D6EA 4XBLA 5CA6A 5GLVA 3TAYA 4GKXA 2JDZA 4YFZA 1G86A 4XBQA 4Y1YA 2NMOA 2R16A 3ASIA 4YZ3A 5IK8A 4UW6A 5BYNA 5JOZA 1W6OA 5H9PA 1QKQA 1S0EA 2NZ9A 4NO4A 2PHWA 5LK5A 1JUIA 5KXBA 2ZGSA 3ZYRA 3WV6A 1HKDA 1QOOA 4LBNA 2JE9A 1W6QA 5DG1A 1FX5A 3AYAA 4K1YA 3V65A 1QNYA 2OUHA 4FP3A 3M2MA 4XJ9A 1J1TA 2AH2A 1WW5A 2R1BA 4ISRA 1BZWA 4XE9A 1V6JA 2PELA 4FPYA 1W0PA 2GNTA 4XJZA 2ZGLA 1DQ2A 1BXHA 2GMEA 4FQZA 3LSEA 2A75A 1MS9A 2LALA 4Y20A 2ZMKA 1AXKA 1FNZA 1BJQA 3AZXA 3ENRA 5HCBA 5CBLA 1G9BA 3VKLA 1MVQA 1SLBA 5T5LA 3NV1A 4UW4A 2BQPA 1O4YA 2JKBA 3INAA 5DUVA 4K20A 2C9AA 2VU9A 2GN7A 3D5OA 4Y22A 5T54A 5DUXA 5IK4A 5JOXA 3U4XA 3SH3A 4XTMA 2UU8A 4DRVA 3AZYA 3VUOA 1Q8SA 4FPJA 3W59A 3IPVA 3N7MA 4HL0A 3USUA 4DPNA 1S0JA 3V0AA 2A6XA 4YZ5A 4ZKTB 1V6IA 3FUOA 3IKWA 4M3CB 1MS3A 1DQ5A 2D3PA 1KDMA 4DQAA 1Q8OA 3RQ0A 3SLIA 1LHVA 4YG0A 4Z8BA 2DVFA 3Q9OA 3JU9A 3WDUA 5IUQA 1IS3A 1LHOA 3DGTA 1GKBA 1BYHA 5H9RA 1JYIA 3M3EA 2UWCA 2YXSA 3B00A 2CWSA 1LECA 1SCRA 2AR6A 2GN3A 4Q27A 3WG4A 3OPZA 5CNAA 4ISQA 2WT1A 5FREA 1R1ZA 5AVAA 4SLIA 3AK0A 2DTWA 1GNHA 3AP7A 3WHTA 2R1DA 1MS0A 1Z0HA 2DU0A 3GNEA 4H55A 2R0HA 3LCPA 3DUIA 3POWA 1S0IA 1ZA4A 3I8TA 3R05A 2HYKA 4BOWA 3FLRA 3B69A 1HDKA 2JD4A 2GMMA 4CRQA 1W6PB 2ZGRA 3MEPA 4LBLA 3KM5A 5F5QA 1UL9A 3UL2A 3VKFC 1JOJA 1O4ZA 4WVWA 4XJWA 3N3HA 3OY8B 1RIRA 2ZGQA 2EALA 2W39A 1H30A 2AREA 2WJSA 3ZPYA 3WOGA 1QF3A 4LBQA 1AZDA 1GSLA 3W58A 5JVVA 4FPCA 2V73A 4Q2FA 3ZSLA 2E7QA 3CNAA 3RMXA 4TZDA 2VH9A 4FPHA 2V5YA 2CWMA 4FPFA 1V6OA 2DU1A 5HCFA 4AVSA 1MZ5A 5JDBA 1UPSA 3O0WA 4XJAA 4YGEA 1SACA 2GMPA 1AVBA 1Q8PA 2OW4A 1WUVA 3MW2A 5E88A 1GV9A 1IS5A 2A6ZA 1UMZA 4YZ2A 1GLHA 1BKZA 3O5SA 1YRZA 3ZSJA 1U0AA 4WVVA 3WG2A 4AGGA 4FVVA 3ZXLA 4GALA 4XILA 1A78A 4AYUA 1ULFA 1QDOA 3A4UA 2A3XA 4U2AA 4BMEA 1APNA 1C57A 3WG1A 4P9XA 4AGRA 1N3QA 2GDFA 1SLAA 1WLCA 3ZXFA 1V6MA 4FOYA 1X50A 2ZAAA 3AXEA 4FPGA 1BQPA 1W6OB 4R9BA 5GZDA 3SISA 3OBRA 1DLLA 1D2SA 3RG0A 2DVBA 3PVOA 1FV2A 1GZCA 5CAZA 1N1YA 1W6QB 2CYFA 2AENA 1V00A 2P3KA 2ZZJA 1SBDA 2A3YA 3ILNA 3QLQA 5T5OA 3FLTA 3SH5A 4BLIA 1JHNA 1LHUA 3AYEA 4YW2A 2NMNA 1UN1A 4FP2A 2Q5TA 5DUWA 1LOEA 3UJOA 1ULDA 1WBLA 1QMJA 2A6VA 2D6NA 2DVDA 4Y24A 1F31A 1DQ1A 4YG6A 1PZ9A 1NXD1 4L8QA 2VY0A 1MR5A 2A70A 4BLJA 4BQ1A 3BODA 1TEIA 5FRAA 5GJ6A 4FPEA 4GXLA 3UK9A 1YIFA 5GLWA 3WDTA 2NN8A 1Q56A 4Q8LA 2ARBA 4Y22B 1AJOA 2OVUA 4U36A 1H9WA 1MS4A 3ILFA 2A5ZA 1WD3A 2CNAA 3OBTA 4JC1A 3IN9A 3IPVB 5GZFA 1FNYA 2YZ4A 2D7FA 1A8DA 2D6LX 5E89A 4P9WA 3V0AB 1Q8QA 1LOCA 4Q1PA 3AP4A
chains in the Genus database with same CATH superfamily
4WM7B 2X09A 3I49A 2X29A 4GWMA 5FAXA 1RUJ1 2GNBA 5FZCA 3DYMA 5FMOS 4NHKA 1XYNA 3ZXAC 2DV9A 2YYOA 3LD8A 5IFTA 1FV3A 1KRIA 3CDZB 1CN1A 1PO22 1HRV3 3KQ4B 1H2MA 1NAEA 2DVAA 4QQ2A 4XFBA 3LIGA 4YVWA 1JW6A 4DUVA 5HXVA 1ZZ6A 2P34A 2A1XA 4W65A 3AMHA 1S0CA 1G9FA 2HWB2 4BQWA 4I02A 3U1XA 1ASJ2 4R52A 3C7GA 3LOIA 3CF6E 5A7WB 1C4RA 3J26N 3R4UA 1JN2P 4GH4B 4P5YA 2DFBA 3MF9A 1EV13 4A4AA 2QQJA 5D2AA 2LW8A 5I0TA 1JZ5A 3R4DB 5L36A 2ZCWA 5FPUA 1E5SA 2W94A 2Y64A 4LBQB 1FOD2 3Q8CA 1LU1A 4HKWA 4GJZA 1GICA 5F6KA 1UY4A 2ZHKA 4M00A 2WFF3 3PLQA 2ID4A 5FYTA 1HW5A 4CEYC 5C3OA 2IZWA 2I2SA 3MLJA 4W8JA 1L7RA 1F9KA 3T1LA 3VDBA 4M4RA 4AF9A 2WWSA 4CUAA 3H50A 1OUXA 4Y5SA 3DEMA 3WF3A 3M1HA 2LUWA 4A7KA 4COVA 3I2JA 2ENRA 2HWC3 3B5LB 1ZA7A 1OQ1A 1R081 1NCRA 1QJU3 4Q4X2 3AP6A 4XFCA 5FQ0B 5BNOB 5C9AC 4AQTA 4AEKA 3N9NA 3O1VA 1AR73 2E26A 3UESA 1S0BA 3N35A 5FMCA 3I3BA 4IEWA 3SCHA 4BWOA 3MFCA 4XFAA 1N1VA 1FT9A 4YM0A 5FP3A 1V6NA 1W8ZA 4RHV1 3JQWA 3I59A 1IPSA 4IEVA 2ZHMA 4RD7A 4R9DA 3B9CA 4FFGA 1JZ3A 2ZX4A 1OA2A 2PAMA 2ZGTA 3T2OA 5F1RA 4W6XA 4BQ2A 1F2NA 1REDA 3M7AA 1E57A 2RS33 3OGGA 2XWJB 1WLDA 1XNKA 2B39A 2DUOA 4Q4V1 5FJKA 1Y9QA 3OD4A 4OHVA 2D6OX 1NKGA 3KMHA 4UBHA 1W39A 1YQ2A 3H7JA 4I01A 5KC5A 1LESA 2KM2A 1CD3G 4XXPA 4EN9B 2AGSA 1DFQA 1YO8A 3NKGA 5F2WA 2JEMA 1GP4A 1KQRA 5T52A 4M01A 2C6SA 4CXWA 4EWAA 4WM8C 4JRLA 2ES3A 2R072 4BIFA 5T5JA 2JECA 5T5PA 4AI2A 2JB4A 5FZ7A 2ET1A 1VBA2 3ATGA 5ACA3 3ZIWA 1ZZ7A 2F4PA 1CAXA 4YM3A 5J1XA 3W5MA 4B7KA 1XSRA 1AL0G 4DXRA 4QXHA 1DZQA 1PGL1 3ZXJA 3B02A 3PVEA 4PBOA 1QDCA 2PHTA 3AMNA 2DYCA 2EA7A 4CCCA 3LA3A 3HQXA 1OPMA 3K4DA 1S2EA 5EZWA 3OTFA 1DQ4A 4MUVA 1UIJA 4ASLA 4XXAA 2BBAA 1AX2A 3SH4A 2GNDA 2HJIA 1H2NA 3SNMA 3VBSB 1KDKA 1OA4A 1ENQA 4N53C 3LF7A 1WMXA 4H7LA 2K0GA 1W8UA 1TNFA 2Z5WA 2G4IA 1DYKA 4A6OA 1OQEA 4IQPA 3IDAA 3NNFA 2E9QA 3VZOA 5IT6A 5A3TA 2BUKA 3FJSA 4XDOA 3TNQA 5LZ6A 3CQOA 2CU5A 4P9YA 1JXNA 3E97A 1VBD3 1BHGA 1VMFA 2GH8A 4JHZA 4EYUA 1XNTA 5F5CA 4FTSA 4YRDA 5FR3A 3NV2A 4HG6B 5IVYA 2R32A 4OZXA 4YVWB 3ZR5A 1QJU1 2WIIB 4HZFA 2N7GA 4AWDA 5LEKA 2V72A 2VR4A 4I3PA 4LHKA 1M4WA 1JYNA 4B4PA 5DUUA 1W2OA 1S0DA 1YXWA 2EICA 1PO23 2ZHNA 3FBMA 3L9JT 3UETA 1W2AX 3D0JA 3PU3A 4AQ6A 4B4QA 4AGVA 2RV9A 2C5DA 2W1UA 4PLNA 2XB6C 3WXPA 2Y6KA 3ETPA 1XNBA 1PGSA 1RGSA 5A3MA 2YU2A 3KHCA 2VQTA 1G9CA 2HWB3 5F8PA 4NIAA 5IW0A 4CUBA 1LEMA 4E4SA 2QQLA 2B9UA 2YC0A 2EXIA 1ASJ3 5FYIA 3H7YA 1C28A 3KQRA 5CKQA 1HIXA 2J1RA 2R0FA 3LSDA 3WCSA 4C0BA 1D7PM 4CEYA 4YW3A 1P8JA 4GB31 1N1SA 3C7EA 2OA2A 2A71A 2ETEA 4NVPA 3C8XA 3KCYA 1PIV1 2XQRA 1I9RA 1FOD3 3OSDA 4QHBA 1DGWA 4AVVA 2YROA 2RS12 4IEUA 4JAAA 3AJZA 4QQOA 3J8F1 4X6RB 1CZTA 5J48A 5FUIA 2ADEA 2BFUS 4ATFA 2VZSA 4AI3A 4LK6A 3WSOA 1NCRB 1JBCA 2V09A 1OMIA 5L9RA 3FHIB 5C9AA 2ZGOA 4QXCA 3VKNA 3TNPB 3ZXEA 4FPLA 1E5HA 3CZUA 4OVEA 3WLUA 1OLMA 1ZZ9A 3BU7A 3IM0A 5FUNA 3H9AA 3WDXA 2YGLA 2HH9A 2LRPA 4PF5A 1ND3C 3I59B 4RGAA 4Q4X3 2I07B 1S0GA 4IV1C 1YLLA 1CJPA 2HYXA 4M3CA 4QM9A 5JWPA 2ORZA 2JG8A 1AJKA 4UWDA 2Z69A 1SFYA 2A3WA 4CUGA 4IERA 4XACA 4MGQA 1KITA 1MACA 2SLIA 4GKYA 4BA6A 4ET7A 3O1UA 3GBFA 2BW8A 3VKOA 3WVJA 1Q43A 1RVF2 3NV4A 3MZHA 3GJBA 1W06A 5J36A 5F3CA 1OSGA 3HN3A 2AUYA 3RJRA 2YY1A 4K1ZA 4O61A 4XTPA 1LENA 1UMIA 1CAXB 1CIWA 1HQWA 2CV6A 5EYYA 3TYJA 4CSWA 5EV7A 4AI0A 3VBFA 1I3HA 2Z2SB 5GM0A 3POEA 4ATEA 2R073 2PFWA 3AZVA 4MO3M 1K5MC 2BVBA 1W6PA 3AKRA 3UGFA 3RNSA 4V2VA 1K45A 1VBA3 1VMHA 1YHFA 2YUEA 4KH9A 4XYXA 1QJX1 4AXOA 3JB4C 1NZCA 3POBA 4NHLA 4FOWA 4AFCA 1CVNA 1HV0A 2VVFA 4LTAA 3GALA 5L9BA 4N53A 4MGIE 1PGW2 3AZZA 4LBMA 4CXXA 2ZMNA 2QDRA 1DYOA 2EIDA 4JZRA 2QQIA 3P3PA 4OHWA 5JR7B 5APAA 2XKPA 3KVAA 3X29B 2ZS6B 2XVLA 4GWNA 5FBZA 2A6YA 4S2DA 4YW4A 1B35C 3IB3A 3QD6A 1AL22 2CTVA 4QWNA 1IPKA 5FY8A 3PNAA 1QQP2 3HWJA 4LHLA 2RMU2 2JDHA 4PLMA 3ZN4A 4IGOA 4ZU5A 5FZ6A 5HV0A 2D93A 2LM3A 5FYBA 2VW0A 1OLME 4XHXA 5FZ3A 2ZTNA 5FY1A 1QJY1 4EWEA 5GLTA 2OUJA 5GALA 4PI2A 5KHGA 4XBLA 5CA6A 5KHHA 5DMYA 5GLVA 3TAYA 1O6UA 1G86A 1RL3A 3O1MA 4XBQA 2NMOA 4YZ3A 1UY1A 4HLTA 2QUOA 3LOBA 1ZVFA 5JOZA 1HRI1 3E1F1 1FXZA 5H9PA 4QHOA 3RYPA 3QH7A 4MXWA 1VE0A 2NZ9A 5KXBA 2BDRA 1QIQA 3VHRA 1HKDA 3SMHA 1VRBA 3B9IA 2JE9A 1W6QA 5DG1A 1FX5A 4W6YA 5F39A 4UFIA 1DP0A 1IHMA 3B93A 3V65A 5HPOA 4CEYB 3LEIA 1WW5A 2R1BA 4ISRA 3IZOA 1RUG2 2PELA 4UT5A 4UFMA 2ZGLA 4LKFA 3OBZA 1PO11 2XL9A 4DOUA 3Q8AA 3I54A 4Y20A 1NG0A 3VBOC 5HCBA 1BJQA 2QZ3A 3ENRA 5FZHA 3A22A 4EN6B 3VKLA 3CMGA 3NNLA 3NV1A 5T5LA 3WP4A 4UW4A 2K46A 5C9AB 5JXIA 5DUVA 2VU9A 5DAPA 3LAGA 2RR12 4QX2A 3ACHA 4K7JA 4MGZE 2RS13 3GHMA 4AHXA 1H8TC 4LE3A 5DDJ1 4LA3A 3CL1A 3VUOA 1O5LA 1AYM1 3I2HA 4UXAA 4RGGA 2DCZA 3KV4A 4Z07A 3GCXA 5LRRA 4CU7A 1ND3A 3USUA 2XJVA 1S0JA 4IV1A 4K9SA 4YZ5A 4XAEA 4M3CB 3WNPA 1MS3A 3RYRA 4UAPA 2FCVA 4ES9A 1IG0A 1Q8OA 4OUMA 3RQ0A 3SLIA 4LT5A 4CP0A 5FP7A 3P3NA 3C3VA 5B2GB 1OPOA 2RG4A 2RVAA 2XONA 4N43C 5H9RA 4LHSA 4A3ZA 4COYA 5JUVA 4D6RA 5FZOA 4YVSA 2XQXA 3JZVA 4QGNA 3FL7A 2VPVA 5CNAA 2WN3A 4DY5A 2QQNA 1VBC2 1VRH1 4ZZ8A 5I93A 3WEZA 1Z0HA 2VOXA 4Y4RA 4H55A 5DAWA 1SMVA 4DEVA 4OI0A 1H6XA 3MV11 1RVF3 1S0IA 2Q1FA 3I8TA 4FSJA 1A6CA 5E6HA 5D1IA 3M4FA 5G04L 4BH9A 3B69A 3H8OA 1W6PB 3ZYRA 1UL9A 5KWRA 4Q29A 3KT1A 4XJWA 4META 3T3YA 1HQNA 1R1A2 2ZGQA 2EALA 3KT4A 4X8PA 3ZPYA 3WOGA 1RUI1 3THPA 4N53B 1WLTA 5GKAC 3WF4A 2V73A 4Q2FA 4H2AA 4UF0A 4XUQA 4RFRB 2JDNA 3RMXA 3PUHA 4CDUC 4TZDA 3AVSA 3N9OA 3PTYA 4AZZA 5FYZA 4HSJA 1B35A 4FPFA 5A32A 1J1LA 3OUJA 3JXSA 2DCKA 4XJAA 1OF4A 3VL8A 5IVCA 1AVBA 1SPPA 5IVBA 3LFMA 4M0NA 1F4HA 4LR4A 1O8SA 1IS5A 2IXJA 5FXVA 1UW8A 3I97A 3PJYA 4AYUA 4AGGA 2VUJA 4XDPA 1A78A 4J25A 4A45A 1AL23 2HBTA 5IYYA 4IE5A 2RS11 5CG9A 2A3XA 5FCCA 4U2AA 2KA3A 1AR62 3PUAA 1QQP3 4UFHA 2JIGA 4P9XA 4PJYA 2RMU3 2YG0A 4AHYA 2X5IC 1BQPA 3H3LA 4R9BA 3AMPA 4AHWA 2J1VA 1DLLA 2W92A 4MXWB 4OI4A 3RG0A 4N9HA 2WYFA 2E32A 2PA7A 2RDRA 3PVOA 3DCQA 4LKSA 1FV2A 2PN5A 4TN7A 1N1YA 1W6QB 4MG2A 4BXSV 2CYFA 5FP8A 3WP3A 1NA1C 1SBDA 2A3YA 4OCTA 3FLTA 1RUH1 5I0RA 1LHUA 3AYEA 2NMNA 4Y4YA 5FZ9A 4QQLA 5BNQA 3QBQA 4OMCA 4EZ4A 1K3IA 2FQPA 2Q5TA 2OT7A 1X82A 5DUWA 4YW6A 5BPXA 3T0BA 1LOEA 2XLGA 3OEAA 3KVBA 3H8XA 2XJQA 3LA2A 1WBLA 2A6VA 4Y24A 2D6NA 3U14A 1F31A 3UT0A 3THTA 1QH6A 4NRMA 3O1SA 4L8QA 5FMDA 4IGPA 4BLJA 1STMA 3BODA 5FO9B 1SG3A 5FBJA 5FLIA 1H2LA 5GJ6A 2D98A 2LROA 1KS5A 4GXLA 1RUG3 4MH0E 3HPNA 4LUMA 4LE4A 1C8M2 5LA2A 1H2KA 2ARBA 2VOKA 2IFRA 4CU9A 2VUDA 5C4WA 3FWEA 3RZLA 1O7FA 1POV3 2J1SA 2A5ZA 1H0BA 3DECA 4A3XA 1ND3B 2I74A 2YZ4A 4JQTA 1GZTA 2D6LX 1O5UA 4IV1B 1Q8QA 3BPZA 1NE4A 2QQUA 4Q1PA 4QDSA 4QGLA 1CONA 2RR13 3RZMA 5A7OA 1VAMA 3AP5A 3MIBA 3H0OA 3N36A 4FOQA 1COV2 4P9JA 1BK0A 2VNGA 3D82A 4N43A 1TME2 1Z7S1 3BOPA 3O14A 1LAJA 1MPXA 2VNOA 4YVSB 5FZOB 1NUKA 5C33A 4XUTA 3M70A 4Q26A 1AR91 5JSRA 4P9IA 5ERLA 3RI9A 5CADA 3KZ4C 3UGHA 4I0AA 3GCWA 1AL21 3O0XA 2OKXA 4MLOA 4YW7A 4FBFA 3QOPA 4DMIA 4A2UA 3IBMA 2D44A 1RUD2 3WY6A 1HB4A 4Y1VA 1AX0A 3DXUA 4GJYA 3LEGA 4YW5A 3BKZA 1JMUB 4I0WB 1VBC3 3DYPA 1OT5A 2WSUA 3ZLIA 4NHXA 3T0AA 2WAAA 1W8WA 4XMIA 1X33A 1IS4A 4AI8A 5DQ0A 4H7MA 2QCSB 4JX0A 3ZYPA 1C5HA 2AC1A 1XBFA 2AZ5A 4Y1XA 3ZDSA 3ZM8A 4DFSA 1YFWA 1GNZA 1LCLA 2DVGA 4UF0B 1YYNA 3JD71 1UYXA 3U78A 3V0BA 4CDUA 4OI2A 2Y34A 4CP1A 1R1A3 4NWVA 1B35B 5JIUA 5A32B 4RA0A 1HB3A 3B7MA 2DCTA 3E5QA 5FYVA 5GLUA 1BBT1 1JZ4A 3K48A 4PI0A 1L7QA 2VBPA 1SHWB 2TNFA 1W8FA 1DQ6A 1K12A 3KT7A 1PNGA 1XU1A 3D4KA 1OKOA 1GUIA 1UYYA 1AXYA 2K2SA 1CIYA 3N9LA 2UYBA 1WW7A 2EIGA 3AL5A 3U0ZA 4R4XA 3IDBB 2CL2A 1SBEA 2X8KA 2DUQA 2YFUA 4N7UA 5F9TA 2JD9A 4YGCA 5L73A 2DCYA 5HV4A 2Q30A 2PLV1 1KFXL 1W99A 4WV8A 5L19A 4LHNA 2X5IA 2IVIB 3A0NA 4BQXA 2Y60A 5FOBB 2VW1A 4JDMA 5A1LA 3RWKX 4EZHA 2A6WA 3DXTA 1G9DA 4Y5TA 3ZIXA 1AR63 1GZWA 4XEZA 1NA1A 2QE3A 3ZFGC 2HEVF 2Z4FA 2XDVA 5KBFA 5JXJA 2GC0A 1DGRN 2ZGKA 3GBWA 3P5BA 1TMF1 2WT0A 1XNAA 3PHMA 3LZZA 4PIXA 2UYAA 3FLPA 1NLSA 2A73B 1ULEA 2VECA 2X05A 1QXRA 1LOGA 2FMYA 1KJRA 3GZTB 2H6BA 2ZJCA 1AR82 2D3RA 2D6MA 4MOAA 1EPWA 1MS5A 3RWNA 3GXUA 4L0PA 4QB6A 3OGSA 5JLVA 5C4WB 3NQHA 5C7GA 1ND2A 1WZXA 5A7QA 3V64A 1WKYA 1RUC2 4DNYA 4NOTA 2NP0A 1C1LA 2VUAA 1UNBA 3TWIA 2NLRA 4UFKA 1O3QA 1IKPA 3TEZA 1C8M3 3FFZA 4IXLA 4DS0A 3M8LA 4XIOA 4A44A 1D0GA 2WS92 4QPGA 3WCRA 4DO0A 3NWKA 4YZ1A 2QFEA 3FZ3A 4N43B 1MZEA 4WZFA 4QT6A 1UXXX 3UKNA 2C24A 4PIYA 5JAXA 3DKWA 4MGKE 1H1AA 1WA4A 3VHNA 1CZSA 4E2GA 1COV3 1V70A 5C8CC 1MZ6A 1TME3 2UY8A 2D43A 2XLAA 4AG4A 4PBPA 4XVHA 2SBAA 3K4ZA 1W2TA 4JQRA 4QX8A 3EQEA 5E8AA 5LATA 2ZBJA 5FLHA 2JDYA 3NV3A 4FTBA 1S0FA 5FJHA 2EXHA 3WF2A 2VOWA 3FBYA 5FPAA 3EMRA 2BVVA 3ES4A 3SITA 1DGLA 3AXDA 4COUA 2BNOA 3MPPG 5KXEA 1SLTA 3T30A 3TBDA 5CG8A 4QD2A 1S4CA 1AR61 4XABA 1KGYA 1RUD3 4R8HA 1JZ7A 2XBO2 2W52A 3AKQA 1JTZX 1R091 2ZAHA 5K4LA 5K0UA 1FPN1 2AEYA 4CCLA 5LA1A 2VW2A 5DPNA 4CDUB 3VD9A 1DYPA 3NJYA 4EWDA 3V0BB 1RITA 2W08A 1DIWA 2XVGA 1OUSA 3PVNA 1J59A 1OXCA 3T2TA 1RHI2 4XCAA 5D8AA 5FKCA 4C91A 2GP3A 3S6PA 4GA9A 2WQ4A 4JTNA 3AMQA 4RSUA 4LLFA 5J37A 3J7LA 3VBHC 3CO2A 1V6KA 3PTRB 3ZKUA 1ENRA 1KD7A 2JG9C 1PK6C 3WQBA 3BPSA 4CTEA 5SV5A 5FY5A 3PU8A 1FMD1 2WZEA 2ZABA 5F3IA 4D7TA 4XQDA 5JXGA 4BJ0A 1JYXA 4XIKA 1UY0A 5JZGC 3ZKYA 3ALQA 1OF3A 4LO7A 4IEQA 3IAPA 1ONAA 2RM22 1TG7A 1NQJA 3MIHA 4G9SB 1KEXA 4UBGA 1EAH2 3PJQA 3ZYJB 4GWJA 2XMLA 5ANNA 2X5IB 5IFPA 3MIEA 4FTEA 3FHQA 4GMP3 4PF1A 5C3QA 4LBJA 3SHRA 3GZAA 5M0TA 5A1AA 4NIGA 1O3RA 5DN2A 2IWGB 4LEJA 4Q1RA 1GZWB 1NA1B 3HAGA 4RQPA 3ZFGA 4CEWC 1VALA 3MUY1 3O7OA 1U5IA 3RZHA 2DUPA 4LLOA 1ZRRA 3MV01 3KGZA 1DHKB 1CZVA 4XZUG 1W9TA 5GZGA 5KR7A 2W5FA 3HT1A 2UURA 1Y3TA 1IQDC 1COV1 2KR2A 5FP4A 3THCA 5CISA 1VP6A 3EXUA 3SXWA 3PMEA 5AC92 2JG8C 4P9GA 4WBBA 1SLIA 5GLZA 3ZR6A 1PVC2 4B29A 1W9WA 3KCCA 3L2YA 4AVAA 1OVSA 2Y38A 3EYPA 3ZSEA 3ON7A 1YJLA 2HWD2 3AKTA 4IEZA 1XE7A 1WGPA 4K21A 3N7KA 1MEC2 1HRV1 1NYWA 2JIJA 2WWJA 1W0OA 1AXZA 2J1TA 4HN1A 5C3RA 1ND2B 1JZ6A 4HPKA 5FKBA 2BBVA 4Y26A 2C1FA 5FYHA 5EHDA 4JVAA 2XXZA 4AFAA 1AR83 1DGWX 4MHUA 2ZHLA 1WW4A 4UYBA 5B4NA 1SLCA 2GC1A 2PQSA 3AFGA 3IMNA 4MYEA 4G4FA 1JODA 4DXSA 3LIHA 3VBFC 2LS6A 3FUQA 1RUC3 2VUCA 4J1WA 2FZ2A 1EV11 5IVFA 1A3KA 3CEWA 1N1TA 1RMU2 2XJUA 3AP9A 4XDQA 1POV0 3C2UA 4AK3A 2WR9A 3S0MA 2WC2A 5J7MA 1LODA 3POSA 3WG3A 1XPWA 2WS93 5C8CA 4CP2A 2RDSA 2PTMA 4HT1T 2WFF1 2ARCA 1LHWA 4TLFA 5JI7A 1K42A 4ZONA 3WNLA 3AYCA 1ODNA 1AYN2 1RUE2 2EXJA 4XAAA 2B46X 5AVPA 3OPWA 4FT8A 3HVDA 4GKXA 1IGOA 3I3EA 4QX7A 4L99A 4HOOA 2R16A 1ZNPA 2HWC1 4Q0QA 1TZOA 1WWYA 1S0EA 1ULOA 4URAA 4NO4A 4RN5A 1GQPA 4KG0A 3WV6A 3AB0A 2QQVA 3ES1A 4LBNA 4B8EA 5FO8B 1NX9A 1AR71 4QDRA 5K0UB 3AYAA 3CJIC 3TEXA 1GQHA 3KGLA 3RI8A 3HNYM 3MYXA 1WA6X 4FP3A 4XJ9A 1W3XA 3L2HA 3JCIA 3MICA 5D8AB 4XE9A 2XHNA 2QZ2A 1BMV2 3I2GA 4YPJA 4FPYA 2WZPP 4XJZA 3VBHA 1EUTA 2XBO3 4XETA 1HXS2 4MGTA 2E31A 4FQZA 1X7NA 3JBG2 1ULPA 2JG9A 1PK6A 2A75A 2RS31 1UYPA 2FDKA 2ZMKA 1AXKA 4HFSA 3BALA 3S7IA 3VBUA 4MVTA 3SKJE 4CDWA 5CBLA 1G9BA 1VBB2 5JZGA 1RHI3 2QQWA 2VMHA 1W03A 2VZPA 4AQSA 2IXIA 1OLRA 2RS52 3A23A 2CAVA 2JKBA 3INAA 3J7NA 4WVZA 3ZYGA 3IDCB 4Y22A 5DUXA 4XTMA 2UU8A 4BCUA 4DRVA 1PMJX 3AZYA 4NIHA 1ACCA 4DINB 3N7MA 4NWWA 4HL0A 3U10A 5ACA1 5I8SA 2D5FA 1YJKA 5FZIA 2FCUA 4A7ZA 1V6IA 1WMFA 4NIIA 3H42B 1DQ5A 2D3PA 5JPMB 2RM23 1KDMA 2YBKA 4TSVA 1D4M2 3VHOA 1EAH3 2F6BA 1UPIA 2VM9A 4CEWA 3ZFGB 5A33A 1RYYA 3MIFA 3KV6A 1IS3A 4XFFA 3DGTA 4CCMA 3LDKA 2C26A 2J22A 4HN0A 2UWCA 3G6JB 1GWMA 2O1QA 2P6HA 4XF1A 3HT2A 1LECA 1SDWA 2AR6A 2QKDA 2VZTA 4Q27A 3WG4A 5HI0A 2WO3A 4FFIA 4MGYE 2WT1A 1R1ZA 1C5IA 2WNOA 3M3IA 2DTWA 3WHTA 3AP7A 2VG9A 2R1DA 3SC7X 4MSVA 3Q8FA 2R0HA 3DUIA 1VBD1 2V5DA 2BERA 3R05A 4C90A 3FLRA 1CX1A 1WCDJ 1HDKA 3HNBM 1HJFA 1REEA 3BTYA 4CRQA 3MEPA 5FZFA 3MF6A 4L97A 4YVSC 1JOJA 2EVXA 2WZ8A 3VKFC 4HPKB 4BQ5A 5AC93 5E1RA 1PVC3 1XSQA 4LOSA 5FZ0A 1H30A 2WJSA 3WD5A 4ARYA 1H6YA 1QF3A 2HWD3 3MUZ1 3PDQA 1AZDA 1GSLA 3I3MA 3ZN6A 1PO21 2BPA2 1MEC3 4X8NA 3ZSLA 2YU1A 4JV4A 3LA7A 4JDOA 2QBXA 5BNNC 1BLZA 2DDUA 2VH9A 4QKNA 1ZBA2 5K9YA 1V6OA 5FZ4A 2HWB1 4YARA 3CLPA 2GMPA 3RGBA 2OW4A 3WF1A 2YB7A 1ASJ1 2A6ZA 1UMZA 1W9SA 1NLQA 3O5SA 4QB2A 4YZ2A 5C8CB 2PHLA 5A1FA 5FY4A 4D6QA 2GZWA 1PM4A 4Q4W2 2XR4A 1RMU3 2WO1A 5FZKA 1ULFA 3A4UA 4K40A 3LFIA 4ASKA 3S57A 1FOD1 3WP5A 1APNA 1C57A 2ZKLA 5FXZA 3WG1A 4AI1A 4KG8A 3KD4A 4AR2A 4W4ZA 3T2PA 3ZXFA 2WN2A 3TN92 3AXEA 4N7IA 4JKKA 5GZDA 3RZJA 3ME2A 5F3EA 2CGPA 2VZQA 3OBRA 2RM21 3VDCA 4E2SA 2V4AA 3WNNA 3K46A 1AYN3 4E2QA 1GZCA 1RUE3 1TQ5A 3BYWA 1W04A 2P3KA 2AENA 2WBKA 2ZZJA 3CJIA 3ILNA 5T5OA 3SH5A 1W9YA 2XUMA 1JHNA 5I0SA 4K6BA 4YW2A 5A7SA 3VLBB 5A3UA 1W3VA 1DDLA 4AFBA 5IWFA 3FHAA 4F3JA 1VMJA 4Q5OA 5B4XA 4Q4X1 4IL7A 4IEYA 1UOJA 3AKSA 1OBNA 3DPRC 3VBHB 3DKQA 3S7EA 3DF0A 1PZ9A 2JG9B 1EUUA 1PK6B 1RUF2 1UF2C 2VY0A 1MR5A 2A70A 2JWPA 4D6SA 5A70A 5J09A 2R062 5FRAA 1OD5A 3VBUB 4FPEA 4CDWB 5FPLA 5JZGB 4COWA 3T08A 1UKRA 3UK9A 1Q56A 2ZPXA 4XCBA 4Y22B 4CA9A 2OVUA 3OD0A 1HXS3 5A6YA 4U36A 5AC91 5LBCA 1H9WA 2VZRA 3JBG3 2XUEA 3ILFA 4NRQA 3VZKA 1WD3A 2P4EA 3WQ1A 5GZFA 3NNMA 1TE1B 1U5ZA 1VBB3 5E89A 1Y9GA 4P9WA 4OHZA 2BGPA 3CJXA 2RS53 4Z1VA 1E5IA 2YBPA 4D7YA 2ZEYA 1YC61 2P3YA 2WLPA 3G7DA 1IKQA 4TYSA 5J3UA 3BU0A 2R071 3HIFA 4CEWB 1GZ9A 1ZZCA 5A33B 5CB7A 1NZIA 1URXA 1VBA1 2C9KA 2HWF2 5C4WC 4P02B 3N7JA 4ZXKA 2HLEA 4BM8A 1US3A 3POYA 2AEZA 3KWVA 1JYCA 4XZPA 1EP0A 4AFDA 1AX1A 1D4M3 1T2XA 4GMP0 4HKOA 3RZZA 3WUCA 4ES8A 4C1WA 5LWBA 2YPJA 1WCSA 1WCUA 2JG8B 3ZSMA 5FP9A 3GF6A 2WQZC 5ANQA 2W1WA 5FY9A 4NE9A 1ZREA 2ILMA 2VNRA 2YDEA 4OQ8A 3LKJA 4E8DA 5A6ZA 5LBFA 1SLLA 2A7AA 3T1MA 2BOIA 4GAZA 2IXHA 1L3JA 3IIAA 5LY1A 1LOFC 3NNGA 3WQ0A 2CDPA 4TTGA 1RJ7A 5G05L 2PHXA 1NY72 1J3QA 3M3CA 1W8TA 2VZUA 4RR3C 3ZN6B 4XJ8A 1UOGA 4Q0SA 2XG3A 5CYYA 4C1XA 1WBFA 4Q4Y2 1GU3A 5EJ1B 3VBFB 5BNNA 2XH6A 2EXKA 1HV1A 4BK4A 4YW1A 1OOPC 2WSVA 2Y0OA 3HMYA 3WZ1A 3AZWA 4AFMA 1W2NA 1XU2A 3AFKA 4CZSA 4D0QA 4FXGB 2EF6A 1UCXA 4KU7A 4AOCA 3CKHA 3U11A 4F8AA 2WNEA 1QOSA 4LBKA 4EE2A 5H9SA 5HXMA 5KXDA 3HD8B 4LORA 4L11A 4HMZA 4QQPA 1D0HA 2PHRA 1VLNA 3TB0A 2R49A 2ZOEB 3A21A 3SCGA 4AI9A 1IZ3A 4JGYC 4P9LA 1ZBA3 4XMAA 1TNRA 1YQCA 2ZMLA 4IUGA 1QGLA 2GSYA 4IV3A 4YNIA 4V2WA 4P08A 2VMEA 3C7FA 4MHRA 3WUDA 3RMYA 1WLWA 1WMDA 3TEWA 3UKVA 3R4SA 2PMWB 4AEJA 1GWKA 1GWLA 4CCDA 2YMZA 2VBDA 3DN7A 5K8SA 1JYWA 4Q4W3 2VE1A 2Y6JA 1RTVA 4BISA 3B3QE 1LGBA 5A7PA 4MXVA 3EO6A 3CJIB 1NCQC 2Q0AA 3AJYA 1JYTA 1VBE2 2CGNA 2ADDA 4BPZA 3TN93 2VNVA 3RSJA 4XF9A 3WX5A 2JDPA 5I0DA 3PUSA 3RDIA 4QKFA 1FAYA 2WO2A 4KI5M 4OUSA 5ABJC 2JXAA 1LJ7A 1BCXA 1CQ9A 1RUJ2 3EBRA 1LHNA 2E6VA 3DPRA 3ETQA 4OYUA 4YFWA 5DZEA 5L7OC 1QNWA 2JDAA 4URTA 1IOAA 1ZZ8A 3I2IA 4ZPIA 3W20A 3ILRA 1MS8A 2XLFA 5HCAA 2Z42A 4FCAA 2WFPA 2VXRA 2X53S 3O1TA 3VB9A 1N3PA 4DUWA 1MQTC 1VB4A 2BGOA 5FO7B 5TSWA 4YGBA 4BDVB 5KHJA 2VXJA 4H14A 5KHKA 3H1YA 1JZ2A 4E4DX 2VTXA 1RUF3 4OLLA 5F32A 1B09A 1J58A 2VCMA 2VZOA 1YFYA 2R063 3CHXA 5C3SA 1J3RA 4G3YC 4FPKA 1HQLA 1AHSA 5FK8A 2Y26A 4LQRA 5FYCA 1DG6A 3N9QA 4Y20B 5DG2A 1J83A 1W6NA 1RVF1 1D2QA 2R042 5ISLA 2R6QA 1GNYA 2W91A 4LO5B 4B7EA 1LOBA 4D69A 4UFLA 4ARXA 1SDDB 1X36A 1UY2A 4DUXA 4GULA 5LK7B 4CCOA 4RL7A 2ZGPA 1ZRCA 4QAWA 4KBZA 1I5ZA 1ND2C 4K8RB 5FZGA 3HBZA 3U07A 1RXFA 5DAVA 1FYUA 1GBGA 3VDAA 3USUB 1NT0A 4S2FA 3AL6A 4UOJA 2GALA 4O65A 5F5IA 5FWEA 3VGIA 5BUVA 5IK5A 2G9FA 2JDMA 5LBBA 5CIRA 1W6MA 2HWF3 2I45A 1LOAA 1UMHA 2AYHA 3OG2A 1YUDA 4QPGC 2OIIA 5FPVA 1VAVA 3EJKA 5F6LB 3OGRA 5DABA 1PGW1 4XUPA 1JYVA 4PIZA 3N7LA 4X6QB 1R082 1NXMA 3F2ZA 3H3ZA 4IEOA 2P3JA 3MW3A 1G8WA 3UKTA 5ABJA 1LOFA 1O8PA 1OKQA 2BJSA 5LBEA 2WT2A 3ZMNA 2YC4A 5DXDA 1IQAA 2G9ZA 2B4KA 2VBBA 4RR3A 1H4HA 2P6CA 1ZBE2 1UXZA 2CHHA 1PVXA 3OUIA 5BNNB 1QQP1 4RHV2 2JDKA 1YI7A 4I0BA 4EV0A 2RMU1 1OOPA 1SBFA 3CZJA 3LWCA 5IVVA 2CGOA 1PX3A 3ZFEC 2OS2A 2FZ1A 1PMIA 2LTNA 2DTYA 4PQ9A 4Q4V2 5JIAA 3VHPA 4COZA 4Q4Y3 3TEYA 3E6CC 2R30A 1WD4A 2W95A 4RFT0 5EPAA 2XVKA 5IHRA 5JOYA 3BGAA 3J4UH 1JHJA 3APBA 4JGYA 4TLGA 5K0UC 2VL4A 3NJXA 3WNXA 3MW4A 4IV3B 4BMBA 5D8AC 2D3SA 3KLSA 4YM2A 2R061 3NMBA 3TRSB 1Z78A 2VVDA 1SPPB 3ZSKA 5EJZB 1W8NA 3TOJA 1PGL2 3SKVA 1I5PA 1U5XA 1UZZA 3C7OA 4XQWA 4CP9A 4AEMA 1RUG1 4LIUA 3MPBA 2E33A 1ALYA 1DQ0A 1O91A 1XQNA 2QTWB 5FOJB 2OZ6A 5KHIA 1NCQA 4BIOA 4E8CA 4CDXC 1LULA 2GC3A 4TXWA 1POV1 1RUNA 4BU2A 4OFGA 3AVRA 3MFAA 2F17A 1UU5A 5FDBA 3HN1A 1I6XA 2KD7A 4HSLA 4JGZA 4QDQA 2IC1A 4ZU4A 2Y33A 4XHBA 2QQOA 1H4GA 1V9U2 3DPRB 5L7OA 1ULCA 4QGMA 3LGRA 2RR11 5EIYB 4ASMB 1VBE3 2C4XA 3POFA 2NYYA 2TBVA 1H9PA 5I0UA 2ZA9A 4RQPC 2G9GA 2ARAA 3LDBA 1MQTA 3IMMA 1Q8VA 1MVEA 1RUJ3 3I4IA 3KV5A 5JOWA 1RB8G 4OUEA 1PZ8A 2DFCA 4YGDA 4LO8A 1GANA 3ST7A 1LTEA 1BEV2 1ZYBA 2W87A 2WNUC 4QX3A 2ZGUA 4ZY9A 3VN4A 2WRAA 5A6QA 2WA4A 4ZU7A 3UJQA 4Z82A 2D6KA 3ZX7A 1NOVA 1W6NB 2JX9A 3USSA 2XWBB 5BNPC 3BUCA 3GBGA 2TEPA 4OHYA 2IXLA 1VBC1 2PHFA 4E4ZA 1N47A 5FLJA 3WDWA 2J1UA 5FXXA 2E7AA 4R4ZA 4FOVA 2D6PA 4HANA 5JCTA 2QQPA 1HN1A 4N9IA 4XF4A 2RHPA 2R043 2GC2A 3QCWA 5JMCA 5C5UA 5HCHA 3W21A 3FX3A 2WAOA 1QU0A 4I30A 4QPIA 3UNPA 1LNSA 4GB32 5F7UA 5KXCA 5T50A 5IATA 1W6MB 1PIV2 2JB8A 3FMGA 1R1A1 1QXPA 4XOGA 3M3QA 1Y7BA 1GQGA 4AVTA 1F15A 3D6EA 3J8F2 3WNKA 4LXLA 3POIA 2JDZA 4K8FA 2CDOA 3AMMA 4JKLA 4O9EA 3VDDC 4JHTA 5JI9A 4IE0A 4UW6A 1REFA 1J3PA 4P5HA 1QKQA 3PVBB 4AAXA 1DF0A 4Y33A 4BHPA 2PHWA 5BY5A 4IETA 3VD5A 1JUIA 1UU4A 2ZGSA 4EN8B 1XE8A 4RR3B 1QOOA 2C0ZA 4BXFA 4CXYA 1DLCA 5A80A 2ZEXA 4QX0A 2XGXA 5FYMA 2DBNA 5AFEA 2OYZA 1QNYA 1R083 2OUHA 3W9AA 1OOPB 3M2MA 1JU4A 1J1TA 2W1SA 1LB2A 3ECQA 3ZFEA 2JE8A 3FN9A 1W0PA 2GNTA 2W2IA 2HKXA 1DQ2A 1BXHA 1VBE1 2GMEA 1UX7A 1ZBE3 2WINB 1PMHX 1JS9A 1MS9A 4OZOA 4RHV3 2RDQA 3U4SA 2KXLA 4IGQA 4JGYB 1MVQA 1SLBA 4EQVA 5FWJA 1F5JA 1VR3A 3D5OA 3K4AA 4Q4V3 5IK4A 5JOXA 3U4XA 3ZPOA 1QJFA 2VMDA 1UOFA 1R64A 3SEEA 1SQ4A 1Q8SA 1XC6A 1PNFA 4FPJA 1HN0A 2WWUA 4NPMA 1UD1A 4C0HA 2VZVA 3HJRA 3V0AA 1JUHA 3ZFFA 4CP9B 3FUOA 4UI9L 2ZEWA 3ACGA 3VBUC 1E5RA 4CDWC 4V1PA 4QXKA 4DQAA 3RZKA 1LHVA 1NCQB 1SZBA 3NRUA 4YG0A 1QJX2 4CDXA 1QJZA 1XB9A 4DB5A 1X8MA 1DGRA 1LHOA 1GKBA 1JYIA 1NE6A 1X9TA 3HNMA 5JSOA 2R041 5ABJB 4JGZB 4WVMA 2WNVC 3O1PA 4OULA 4QHZA 1XOYA 2CWSA 4XUOA 5L7OB 4INDA 1C8M1 5FREA 1KXGA 4SLIA 3AK0A 2OQ7A 3ZOIA 1O3SA 4E27A 1HB2A 1OQDA 4KNCA 4NHMA 2GP5A 4LK7A 3GJAA 3HQRA 3V56A 4AAPA 3D3AA 1MQTB 1HX6A 4E9KA 4OQ9A 5A3NA 5LA0A 4BOWA 1V9U3 4LA2A 3I2OA 4BQ3A 2ZGRA 4LBLA 2K9ZA 3UL2A 5F5QA 1O4ZA 4WVWA 3N3HA 1NQDA 2WNUA 3NVCA 1QJY2 3K75B 2W39A 1VAKA 2YC2A 4QB1A 2ZX1A 2AREA 2WZR2 3WW2A 1TME1 5LCWL 4OHXA 5BNPA 3W58A 5JVVA 4FPCA 1H8VA 2OX0A 3CNAA 3OF1A 1HRI2 3NAPA 5IAXA 1BEV3 4FAGA 2V5YA 4CUCA 2W47A 2DU1A 1UYZA 1QWRA 4AVSA 3OGJA 1Q5OA 3WP6A 5JDBA 1ZBE1 1CAUA 4LITA 1SACA 3AM2A 1HB1A 1RUD1 1WUVA 3NKTA 4CU8A 4KGQA 4GZ9A 4QPIB 2PAKA 1BKZA 5LY2A 3ZSJA 2VMIA 1U0AA 4WVVA 4KMQA 3WG2A 3WNOA 4GALA 4XILA 2CSGA 3ELNA 3ZDVA 4HETA 5LB6A 4QPGB 1QEXA 2VCCA 1QDOA 3A7QA 1PO12 2W9XA 4B1LA 4H3WA 4BMEA 2XKOA 1POQA 4QU2A 4AEDC 1SLAA 3VDDA 1WLCA 4GB33 4FOYA 5IVJA 4FPGA 3SISA 1DZTA 1PIV3 5AFBA 1CJDA 2P1BA 2HEWF 3FFQA 4QX5A 1BVP1 4KWLA 1JH5A 1OLQA 5DDJ2 3J8F3 2IXKA 1AYM2 4KGGA 5FK7A 4HVRA 4BLIA 5FZ8A 1BVVA 3KSCA 1S2BA 4FFHA 2W0XA 4FP2A 3LE0A 3WR0A 3OCPA 4GMP1 3AC0A 3UJOA 3ZFEB 2DCJA 4MX3A 2XHKA 4LO4B 2BU9A 3FE5A 4IEXA 1ULDA 1QMJA 2XJRA 1UY3A 4YG6A 4B4RA 5KC6A 2B9VA 1NXD1 2Q8EA 4NHYA 1JOBA 1CX4A 4CDQC 2IXCA 4EN0A 4LULA 4GWIA 1V9U1 2VULA 3O1OA 4DEQA 4E4HA 1XYOA 3WDTA 4Q8LA 2QVSB 1VRH2 3P1IA 2WL1A 5HBAA 3PL0A 5JSPA 3OBTA 4JC1A 3ZXGA 3IN9A 4BQ4A 1A8DA 5CKMA 2ZX2A 3IAQA 4C8DA 1LOCA 3ZFFB 3V0AB 5EFUA 5A3PA 5BV6A 1O59A 1H1IA 4IW3A 4CYDA 5FPBA 3S5AA 2ZX0A 1W9FA 1BEV1 2VO5A 3E6BA 4Q0UA 3QACA 2IUWA 3MI8A 1IS6A 3B94A 4CDXB 1FATA 2E7TA 3VD4A 5T55A 1C8NA 1OC1A 1RUI2 2E63A 2H0BA 3NNJA 1QH7A 2VJXA 1VIWB 3ACLA 2WNVA 3LB9A 3MIGA 4WVMB 3RS6A 3VKMA 1GFF2 2GNMA 4CU6A 4O9GA 1AR81 3NW4A 5DZFA 3THDA 3UGGA 5FYUA 4ZHNA 1ENXA 2BGCA 1QJX3 2BWCA 4PDWC 1MS1A 4YLZA 1OFNA 1RUC1 3ABZA 4RQPB 5FZLA 2XPJA 5LRSA 2FBEA 5FZ1A 2GAUA 4PHZA 5FYSA 1OH3A 4SBVA 5FZAA 4UFJA 1IPJA 1A34A 2WUHA 1ST8A 2FDHA 2EIEA 2ZGNA 4DXZA 4Z2WA 5FY7A 2WNUB 5FUPA 3T4VA 5L9VA 2WS91 5IVEA 2VMFA 4XURA 2PHDA 3MBWA 3LPFA 3O1RA 1S1AA 1W8OA 2CY6A 1AF9A 4J6GA 5BNPB 4Y1UA 4MV2A 1CPMA 3POGA 3WDVA 1CAWA 5CFDC 1T6BX 1XNDA 3NAPB 4CCNA 2E51A 2QDNA 3I2FA 5FV3A 3E5UA 2PXJA 4AE2A 1RJ8A 1QJY3 3OYWA 2B8MA 3EB7A 2D97A 1ZRIA 5EWSA 2WZR3 3O0VA 1GOHA 1YNAA 1CAUB 1JI6A 1GYKA 1K5JA 1RUH2 1G7YA 2PHUA 2VGDA 4YYOA 3ZN5A 1HRI3 4XBNA 4Y3OA 5EP9A 1UO9A 5EQUA 4IEPA 3WHUA 4CPBD 4QXBA 1OURA 2W46A 3GDBA 3WDYA 4NPLA 2VZ3A 2RDNA 3ZYHA 3WNMA 5FTTC 4FXKB 4BB3A 2YV8A 3I2KA 1PX4A 4JDNA 4HKLA 3N9PA 3OOXA 3B01A 2XBO1 1YQ5A 4AEDA 5FY0A 4GD4A 3VDDB 1I1EA 3PIGA 3EHKA 1EY2A 1A8MA 4WM8A 1WMEA 3BVCA 1UZYA 5FZMA 2VAUA 3RFRA 3ZO0B 2JE7A 1RHI1 3D8CA 1JU3A 3N4MA 1PO13 4NR1A 4XFHA 2BRTA 2VOVA 2VQAA 1OHFA 4RGKA 1Y4WA 1N3OA 4XF0A 4IV3C 2XOMA 1WW6A 1XYPA 4QU1A 2JKXA 3DV8A 1RINA 2MNGA 3GZEA 4PCRA 4PT6A 4XFGA 3WW1A 4EJRA 1WCKA 2XJPA 1YI9A 2ZZQA 1DBNA 4L2NA 4YSFA 2ARXA 2P37A 5DDJ3 5I8YA 2NM1A 2WQ8A 3BTAA 4NJ4A 1QHDA 5H9QA 3ZYBA 1AYM3 3ZYIB 1UZ0A 4ONUA 1EAH1 2P3IA 2VTXJ 2QNKA 3BIWE 3KV9A 4Y1ZA 3BN6A 5SV8A 4CDQA 2Q4SA 1LGNA 4IE6A 2VQUA 3T2QA 5JR2A 2WKKA 2DWRA 3D0SA 4YWAA 3VBRC 1Z7S2 3Q8BA 5A6XA 3K2OA 3BTXA 2FDFA 4UW5A 2FDIA 2X10A 4Y5Z0 1PHMA 3QH6A 4Z2AA 1PZ7A 1AR92 2BNNA 3AYDA 4AVCA 2JICA 2F4LA 4AW7A 4LBQD 3AKPA 3T09A 1RC6A 4JRAA 2BOJA 1ENSA 3HQUA 4I09A 5DZGA 1RXGA 3GHNA 2VC9A 4FPOB 4I3GA 3AX4A 5FMBA 1ULGA 3WT3A 1U5YA 1GP5A 1YQ6A 2UY9A 3NJVA 1SFPA 2UWBA 1Q3EA 3NJZA 1UAIA 1VRH3 2AACA 3R0RA 4ZS2A 1CR7A 3A0KA 4NIDA 3JQXA 4D7SA 4KWJA 5J96B 4BQYA 4M3CF 5A3WA 2VQ0A 2WZR1 2WLQA 4M3CE 4P14A 1PVC1 3NL1A 2WNVB 5IAVA 3BTZA 3I7DA 4R9AA 1X8EA 3JD72 3K3NA 2HWD1 1D4VB 4EN7B 4KBBA 1CPNA 2B5HA 2OZJA 4AL9A 1MEC1 2OPKA 1ZZBA 4LOTA 4PDWA 4L92A 2FMDA 4RS5C 5GZEA 4R9CA 2Q8DA 4LO6B 2QQMA 4BYYA 5IK7A 2PAEA 1BBT2 1RUI3 1JOPA 3JB8A 4FQ4A 5D21A 1CESA 3O12A 2ATFA 4JKMA 1LKNA 2Q8OA 1ZRDA 3LQCA 1F5FA 3M3OA 2YHJA 3H1WA 4NRPA 4Q0PA 2H6CA 5EYXA 5FZEA 4A41A 2PQQA 5FZDA 4XJUA 3DYOA 3GGLA 3K51A 2FHRA 2OXBA 5F3GA 3UV9A 1F4AA 4FFFA 3VD3A 4EROA 5CVRA 2O8OA 1XXNA 3I3DA 4S2HA 3ACIA 2XJTA 4YG3A 3ZMOA 4D94A 5JMOA 5GZCA 1RMU1 2PLV2 2ORXA 2MHFA 5I91A 1YFXA 4HBNA 4WZCA 1BK1A 3H8UA 4O7XA 2BEOA 4Z92B 1CAWB 2NQYA 4KL1A 5CFDA 3BCWA 1ZM1A 1UQXA 2ZKNA 3OYWB 5E16A 1LEDA 1UZWA 2Y0IA 1H1MA 2BTVC 2W3JA 2E53A 1OVPA 3JUUA 3S30A 3VD7A 1AYN1 1RUE1 3ZXKA 1HLCA 3ITQA 4YM1A 1VPHA 2RE9A 2EAKA 1W28A 1TMF2 3KHBA 1EYBA 2FDJA 3FC0A 5F2SA 3HR9A 4DRRA 3J7HA 1J84A 3VV1A 1U12A 1XE0A 5FZBA 4F7ZA 3RPQA 1L7LA 2MEV2 1RUH3 2ET7A 5CU1A 4HK8A 5A3OA 2ERFA 4UW3A 2ZGMA 3PIJA 2XJSA 4AEDB 3I3QA 4W6WA 2VVEA 4ZXEA 1CGPA 2GH2A 5CFCC 4TWTA 4WM8B 3H8RA 1SFNA 4NAMA 3KS7A 4Q8KA 2G1MA 3OJBA 3C7HA 1BMV1 4WM7C 4Q0VA 4XFIA 4DIQA 5LASA 2B7YA 1OFSA 2WA3A 3BOWA 1KJLA 2O0OA 3SEPA 1YCIA 1HXS1 2WDBA 4M0HA 5CZKA 4PLOA 4CE8A 3JBG1 2OPWA 4F83A 3OBAA 2B42B 4MZUA 1K5MA 5EXOA 1VBB1 3VL9A 2J42A 3RVHA 2RS51 3WINE 3MLKA 1GP6A 2D40A 4LKEA 1O3TA 2HWE2 5JXHA 1F8VA 4ZS3A 4IE7A 2EIBA 4BE3A 3RZGA 1VJ2A 2VZ1A 3OGVA 4GQ7A 4CDQB 1V6LA 3P6BA 3VBRA 3GZUC 1GMMA 3KCXA 2UWAA 2WO7A 4LJHA 3ZXDA 2G19A 1YIPA 1LGCA 4JCKA 4BZ4A 3ACFA 5F5AA 4B1MA 5CEHA 1XNCA 3KF3A 5C5TA 1QOTA 5FYYA 4JGZC 1D4M1 3OEBA 3OUHA 3VZLA 4GH4C 3OY8A 3ZVXA 5FMOL 2FCTA 1Z7S3 4MADA 2JDUA 2JJ6A 3ROUA 1XRUA 2J1EA 1LU2A 5C3PA 1QJEA 1AR93 4GIQA 1KFUL 2Y6FA 3RRDA 1G9AA 4NMIA 1YEWA 2Q1MA 2ZACA 4A6SA 2W68A 4XW3A 2VCAA 4JTOA 4FAHA 4NAOA 1W8HA 2H0VA 3KB5A 3HBKA 4LBOA 4I2OA 1C1FA 4CCJA 2P2KA 3J9SA 1SCSA 2Y6GA 4P00B 1HJGA 1R092 2Y8KA 3IIIA 4ITCA 4A7YA 4CCKA 1FPN2 2VOTA 4DZGA 3S5QA 4HVOA 2DURA 4KWUA 1YFUA 1GOGA 1EPZA 4PQQA 4PDWB 2BWAA 4RS5A 1DU3D 2WYSA 2CAUA 1UKGA 1UX6A 3U75A 2P17A 1ZX5A 3PUIA 4YZ4A 4IE4A 2NPIA 5BNOC 1O4TA 3JD73 4L9BA 1W0NA 4HK9A 4HONA 1T6GC 4XF3A 4AQ2A 4YFZA 1FMD2 1G6NA 4Y1YA 3ASIA 5IK8A 1GOFA 5BYNA 1W6OA 3IT8A 1BBT3 2VCBA 4QPIC 2FDGA 3MLLA 3R6SA 1ZBA1 5LK5A 3ORJA 3VBOA 1QY4A 2V4VA 3OPTA 4KQ7A 3OB8A 1OI6A 2Q1ZB 4DY3A 5CFDB 4K1YA 5J98B 3PMSA 4QPYA 4LPLA 4QMAA 2AH2A 3CBNA 1VB2A 3Q8EA 4XUNA 4N8MA 1H8TA 1BZWA 4NPRA 4XQ4A 2O8QA 1V6JA 4QQHA 4Q4W1 2PLV3 3GM8A 1W05A 2FD8A 1NLRA 2B45X 3H1MA 4NUBA 1W90A 3LSEA 2LALA 1FNZA 2P5BA 3AZXA 5DAXA 2W1QA 3TN91 3KF5A 1CAVA 3LEMA 3MGUA 2BQPA 1O4YA 1TVGA 3MIDA 4OMDA 4AHZA 4K20A 2C9AA 3CU7A 2GN7A 5T54A 4CPBA 5IJRA 4KWKA 2R7EB 3SH3A 3MDPA 3CIHA 4QX1A 2YBSA 3WW3A 5CFCA 3HOBA 3W59A 1TMF3 3IPVA 4DPNA 2JENA 3RJ2X 3VBSC 2A6XA 4ZKTB 1US2A 3IKWA 1HRV2 2Y6LA 4WM7A 3J7MA 2MEV3 4RYDA 3E6DA 1MZFA 2DVFA 3Q9OA 2YFZA 4Z8BA 5C71A 1UOBA 1OD3A 3JU9A 5IUQA 3WDUA 5CKNA 1RUF1 2VMGA 5FXWA 1YWKA 1BYHA 3VZJA 3M3EA 3F95A 1K5MB 2YXSA 3WQ7A 4A42A 4ORFA 3B00A 5DAQA 5A7NA 1SCRA 2GN3A 5FIXA 3OPZA 1IG3A 4ISQA 1YQ8A 5AVAA 4YVWC 3ZFFC 1F35A 1GNHA 2VTFA 4J1XA 1EV12 3ZYFA 1MS0A 5JPNB 3VBRB 2DU0A 4B3NA 3GNEA 2HEYF 1C3HA 3LCPA 3N9MA 3K77A 3POWA 4IESA 2XL7A 3WF0A 1DCSA 1ZA4A 1OH4A 1ODMA 4CCEA 2HYKA 2JD4A 2BZDA 2GMMA 3W5NA 3BIEA 5A7WA 4DXTA 2HWE3 1AUYA 3RYKA 2J7MA 2WFF2 3KM5A 4GH4A 3GYDA 5T3NA 4D3WA 3OY8B 1RIRA 2D5HA 2HWF1 4QKDA 2EAAA 1V0AA 4LBQA 2QJVA 4QKBA 3T4HB 2E7QA 4CVUA 3PURA 2HWC2 1QXJA 3VZMA 2IFWA 3SQOA 2Y6HA 4FPHA 1QJU2 2CWMA 2ZEZA 5EJ3A 2PYTA 1UU6A 2VMCA 3NO8A 3BB6A 4LNVA 2ZX3A 1MZ5A 1WCQA 2J1AA 2WABA 5HCFA 2Q8CA 3VZNA 1UPSA 3O0WA 4K3UA 1AR72 4YGEA 1Q8PA 2RJ2A 4LKDA 5C6CA 1S55A 2L9LA 4IDZA 1S2KA 1DZRA 3MW2A 1GV9A 5E88A 3UYJA 5K7PA 3NSTA 1GLHA 4QPWA 1YRZA 4RS5B 3BI3A 3URFA 1NCRC 4FVVA 4LMFA 3ZXLA 1SEFA 1KS4A 3WW4A 3NAPC 5BNOA 5FQ0A 5BXXA 3LPGA 1R093 4MGSA 1FI2A 5LW9A 1FPN3 3HEIA 1OA3A 1UIKA 1CWPA 1NY71 2RS32 1X9PA 3I2DA 3MHZA 1XJAA 1N3QA 2GDFA 1W2UA 4AGRA 1ZRFA 1V6MA 2HBUA 4Q4Y1 5LEJA 4AVBA 1GR3A 1X50A 2ZAAA 4S2GA 4XC9A 1W6OB 4NROA 5A3LA 2BNMA 1D2SA 2DF7A 3IDEA 2DVBA 2MEV1 4LIVA 5FFOC 3VBOB 4M4PA 3DL3A 5CAZA 4D8MA 1V00A 3QLQA 2MPFA 1FMD3 2RJLA 2ZXQA 2BYVE 5ACA2 3POJA 1JZ8A 1UN1A 2BFUL 1H8TB 2IVJA 2QQKA 5LA9A 2Z79A 3LDRA 4HVQA 4FI9A 2VD7A 4LUKA 2DVDA 4HXCA 1DQ1A 4QM8A 1Y9MA 3LEKA 4N90A 4BQ1A 4BK5A 1TEIA 4W50A 1Y43B 2BV4A 2DBIA 4ZZ5A 3H3UA 3E5XA 2BP6A 1CAVB 1LRHA 2YPDA 4KU8A 3PUQA 5I8TA 1YIFA 2TUNA 2YGMA 5GLWA 2NN8A 3K3OA 2HWE1 1AJOA 2GU9A 1M06G 3U37A 5FPZA 1PM7A 5F37A 1MS4A 5C8WA 2CNAA 1UZVA 3T0DA 1UWWA 5CFCB 3IPVB 3SCFA 1FNYA 5FPXA 5C70A 2D7FA 1LR5A 1VBD2 3IWZA 2O14A 3MO4A 2RJKA 4NN0A 3VBSA 1RUOA 4XPVA 2OQ6A 4OI1A 4FO9A 3AP4A
chains in the Genus database with same CATH topology
4WM7B 2X29A 4GWMA 5FAXA 1RUJ1 2GNBA 5FMOS 4NHKA 1XYNA 3ZXAC 2DV9A 2YYOA 1FV3A 1KRIA 1CN1A 1PO22 1HRV3 1H2MA 2DVAA 4QQ2A 4XFBA 4YVWA 1JW6A 5HXVA 1ZZ6A 2P34A 4W65A 3AMHA 1S0CA 1G9FA 2HWB2 4I02A 1ASJ2 4R52A 3LOIA 3CF6E 1C4RA 3J26N 3R4UA 1JN2P 4GH4B 2DFBA 3MF9A 1EV13 5I0TA 3R4DB 5L36A 2ZCWA 4LBQB 1FOD2 1LU1A 4HKWA 1GICA 5F6KA 2ZHKA 4M00A 2WFF3 3PLQA 1HW5A 4CEYC 2IZWA 2I2SA 3MLJA 1F9KA 3T1LA 4AF9A 2WWSA 3H50A 3M1HA 2LUWA 4A7KA 4COVA 2ENRA 2HWC3 3B5LB 1OQ1A 1R081 1NCRA 1QJU3 4Q4X2 3AP6A 4XFCA 5FQ0B 5BNOB 5C9AC 4AQTA 4AEKA 1AR73 1S0BA 3N35A 4IEWA 3SCHA 4BWOA 3MFCA 4XFAA 1N1VA 1FT9A 4YM0A 1V6NA 4RHV1 3JQWA 3I59A 4IEVA 2ZHMA 4RD7A 4R9DA 3B9CA 2ZX4A 1OA2A 2PAMA 2ZGTA 5F1RA 4W6XA 1F2NA 1REDA 3M7AA 1E57A 2RS33 3OGGA 2XWJB 1WLDA 1XNKA 2B39A 2DUOA 4Q4V1 1Y9QA 3OD4A 4OHVA 2D6OX 3KMHA 4UBHA 5KC5A 1W39A 3H7JA 4I01A 1LESA 2KM2A 1CD3G 4XXPA 4EN9B 2AGSA 1DFQA 1YO8A 3NKGA 2JEMA 1KQRA 5T52A 4EWAA 4M01A 4WM8C 4JRLA 2ES3A 2R072 4BIFA 5T5JA 2JECA 5T5PA 4AI2A 2ET1A 1VBA2 3ATGA 5ACA3 3ZIWA 1ZZ7A 2F4PA 1CAXA 4YM3A 4B7KA 1AL0G 1DZQA 1PGL1 3ZXJA 3B02A 3PVEA 4PBOA 1QDCA 2PHTA 3AMNA 2DYCA 2EA7A 3LA3A 3HQXA 1OPMA 5EZWA 3OTFA 1DQ4A 4MUVA 1UIJA 4ASLA 4XXAA 1AX2A 3SH4A 2GNDA 2HJIA 1H2NA 3SNMA 3VBSB 1KDKA 1OA4A 1ENQA 4N53C 4H7LA 2K0GA 2Z5WA 1TNFA 2G4IA 1DYKA 1OQEA 4IQPA 2E9QA 3VZOA 5IT6A 2BUKA 3FJSA 3TNQA 4P9YA 1JXNA 3E97A 1VBD3 2GH8A 4FTSA 4YRDA 3NV2A 2R32A 4OZXA 4YVWB 1QJU1 2WIIB 4HZFA 2N7GA 4AWDA 5LEKA 4I3PA 4LHKA 1M4WA 4B4PA 5DUUA 1S0DA 1YXWA 2ZHNA 1PO23 3L9JT 3FBMA 3D0JA 4AQ6A 4B4QA 4AGVA 2C5DA 4PLNA 2XB6C 3WXPA 1XNBA 1PGSA 1RGSA 5A3MA 1G9CA 2HWB3 1LEMA 4E4SA 2B9UA 2YC0A 2EXIA 1ASJ3 3H7YA 1C28A 3KQRA 1HIXA 3LSDA 2R0FA 3WCSA 4C0BA 4CEYA 4YW3A 4GB31 1N1SA 2OA2A 2A71A 2ETEA 4NVPA 3KCYA 1PIV1 1I9RA 1FOD3 4QHBA 1DGWA 4AVVA 2YROA 2RS12 4IEUA 4JAAA 3AJZA 4QQOA 3J8F1 4X6RB 2BFUS 4ATFA 4AI3A 1NCRB 1JBCA 2V09A 1OMIA 3FHIB 5C9AA 2ZGOA 3VKNA 3TNPB 3ZXEA 4FPLA 4OVEA 3WLUA 1ZZ9A 3BU7A 3IM0A 3H9AA 3WDXA 2YGLA 4PF5A 1ND3C 3I59B 4RGAA 4Q4X3 2I07B 1S0GA 4IV1C 1YLLA 1CJPA 4M3CA 4QM9A 5JWPA 2JG8A 1AJKA 2Z69A 1SFYA 2A3WA 4IERA 1KITA 1MACA 2SLIA 4GKYA 4BA6A 3GBFA 2BW8A 3VKOA 3WVJA 1Q43A 1RVF2 3NV4A 3MZHA 5J36A 1OSGA 2AUYA 3RJRA 2YY1A 4K1ZA 4XTPA 1LENA 2CV6A 1CAXB 1CIWA 1HQWA 5EYYA 3TYJA 5EV7A 4AI0A 3VBFA 1I3HA 2Z2SB 5GM0A 4ATEA 2R073 2PFWA 3AZVA 1K5MC 2BVBA 1W6PA 3AKRA 3RNSA 1VBA3 2YUEA 1YHFA 4KH9A 4XYXA 1QJX1 4AXOA 3JB4C 1NZCA 4NHLA 4FOWA 4AFCA 1CVNA 1HV0A 2VVFA 4LTAA 3GALA 4N53A 4MGIE 1PGW2 3AZZA 4LBMA 2ZMNA 2QDRA 3P3PA 4OHWA 5JR7B 2XKPA 3X29B 2ZS6B 2XVLA 4GWNA 5FBZA 2A6YA 4S2DA 4YW4A 1B35C 3QD6A 1AL22 2CTVA 1IPKA 3PNAA 1QQP2 3HWJA 4LHLA 2RMU2 4PLMA 3ZN4A 4ZU5A 2D93A 2LM3A 2VW0A 4XHXA 2ZTNA 1QJY1 4EWEA 5GLTA 2OUJA 5GALA 5KHGA 4XBLA 5CA6A 5KHHA 5GLVA 3TAYA 1G86A 1RL3A 4XBQA 2NMOA 4YZ3A 4HLTA 2QUOA 3LOBA 1ZVFA 5JOZA 1HRI1 1FXZA 5H9PA 3RYPA 3QH7A 4MXWA 2NZ9A 5KXBA 3VHRA 1HKDA 3SMHA 3B9IA 2JE9A 1W6QA 5DG1A 1FX5A 4W6YA 1IHMA 3B93A 3V65A 4CEYB 1WW5A 2R1BA 4ISRA 1RUG2 2PELA 2ZGLA 1PO11 2XL9A 4DOUA 3I54A 4Y20A 1NG0A 3VBOC 5HCBA 1BJQA 2QZ3A 3ENRA 4EN6B 3VKLA 3WP4A 5T5LA 3NV1A 4UW4A 5C9AB 5DUVA 2VU9A 3LAGA 2RR12 4AHXA 4K7JA 4MGZE 2RS13 3GHMA 1H8TC 4LE3A 5DDJ1 4LA3A 3CL1A 3VUOA 1O5LA 1AYM1 4UXAA 4RGGA 2DCZA 4Z07A 5LRRA 1ND3A 3USUA 2XJVA 1S0JA 4IV1A 4K9SA 4YZ5A 4M3CB 1MS3A 3RYRA 4ES9A 1Q8OA 4OUMA 3RQ0A 3SLIA 4LT5A 4CP0A 3P3NA 3C3VA 5B2GB 1OPOA 5H9RA 4N43C 4COYA 4YVSA 3JZVA 4QGNA 2VPVA 5CNAA 4DY5A 1VBC2 1VRH1 5I93A 1Z0HA 2VOXA 4H55A 1SMVA 4OI0A 1RVF3 1S0IA 3I8TA 4FSJA 1A6CA 5D1IA 3M4FA 4BH9A 3B69A 1W6PB 3ZYRA 1UL9A 5KWRA 4Q29A 3KT1A 4XJWA 4META 1HQNA 1R1A2 2ZGQA 2EALA 3KT4A 4X8PA 3ZPYA 3WOGA 1RUI1 3THPA 4N53B 1WLTA 5GKAC 2V73A 4Q2FA 3RMXA 4CDUC 4TZDA 3PTYA 4HSJA 1B35A 4FPFA 5A32A 1J1LA 2DCKA 4XJAA 3VL8A 1AVBA 4M0NA 4LR4A 1IS5A 2IXJA 1UW8A 3PJYA 4AYUA 4AGGA 2VUJA 1A78A 1AL23 2RS11 5CG9A 2A3XA 5FCCA 4U2AA 2KA3A 1AR62 1QQP3 4P9XA 4PJYA 2RMU3 4AHYA 2X5IC 1BQPA 4R9BA 3AMPA 4AHWA 1DLLA 4MXWB 4OI4A 3RG0A 4N9HA 3PVOA 2PA7A 1FV2A 2PN5A 1N1YA 1W6QB 2CYFA 3WP3A 1NA1C 1SBDA 2A3YA 3FLTA 1RUH1 5I0RA 1LHUA 3AYEA 2NMNA 4Y4YA 4QQLA 5BNQA 3QBQA 2FQPA 2Q5TA 5BPXA 1X82A 5DUWA 1LOEA 2XLGA 2XJQA 3LA2A 1WBLA 2A6VA 4Y24A 2D6NA 1F31A 3THTA 1QH6A 4L8QA 4BLJA 3BODA 5FO9B 5FLIA 5GJ6A 1H2LA 2D98A 1KS5A 4GXLA 1RUG3 4MH0E 4LUMA 4LE4A 1C8M2 2VOKA 1H2KA 2ARBA 2IFRA 5C4WA 3FWEA 1O7FA 1POV3 2A5ZA 1H0BA 4A3XA 1ND3B 2I74A 2YZ4A 2D6LX 1O5UA 4IV1B 1Q8QA 3BPZA 1NE4A 4Q1PA 4QGLA 1CONA 2RR13 1VAMA 3AP5A 3MIBA 3H0OA 3N36A 4FOQA 1COV2 4P9JA 2VNGA 3D82A 4N43A 1TME2 1Z7S1 3BOPA 3O14A 2VNOA 4YVSB 5C33A 3M70A 4Q26A 1AR91 5JSRA 4P9IA 3RI9A 5CADA 3KZ4C 4I0AA 1AL21 3O0XA 4MLOA 4FBFA 3QOPA 4DMIA 4A2UA 3IBMA 2D44A 1RUD2 3WY6A 4Y1VA 1AX0A 4YW5A 4I0WB 1VBC3 2WSUA 4XMIA 1X33A 1IS4A 4AI8A 4H7MA 2QCSB 3ZYPA 1C5HA 4Y1XA 3ZDSA 2AZ5A 4DFSA 1YFWA 1GNZA 1LCLA 2DVGA 1YYNA 3JD71 3V0BA 4CDUA 4OI2A 4CP1A 1R1A3 4NWVA 1B35B 5JIUA 5A32B 4RA0A 3B7MA 2DCTA 3E5QA 5GLUA 1BBT1 3K48A 2TNFA 1DQ6A 3KT7A 1PNGA 1XU1A 3D4KA 2K2SA 1AXYA 2UYBA 1WW7A 2EIGA 3U0ZA 4R4XA 3IDBB 2CL2A 1SBEA 2X8KA 2DUQA 5F9TA 4N7UA 4YGCA 5L73A 2DCYA 2Q30A 2PLV1 1KFXL 4WV8A 4LHNA 2X5IA 3A0NA 5FOBB 2VW1A 4JDMA 2A6WA 1G9DA 3ZIXA 1AR63 1GZWA 4XEZA 1NA1A 2QE3A 3ZFGC 2HEVF 5KBFA 2GC0A 1DGRN 2ZGKA 3GBWA 1TMF1 2WT0A 3PHMA 3LZZA 4PIXA 2UYAA 3FLPA 1NLSA 2A73B 1ULEA 2VECA 1QXRA 1LOGA 2FMYA 1KJRA 3GZTB 2H6BA 2ZJCA 1AR82 2D3RA 2D6MA 1EPWA 1MS5A 3RWNA 5JLVA 5C4WB 1ND2A 3V64A 1RUC2 4DNYA 4NOTA 2NP0A 1C1LA 2VUAA 3TWIA 2NLRA 1O3QA 1IKPA 1C8M3 3FFZA 4IXLA 4DS0A 3M8LA 4XIOA 1D0GA 2WS92 4QPGA 3WCRA 3NWKA 4YZ1A 2QFEA 3FZ3A 4N43B 1MZEA 4WZFA 4QT6A 3UKNA 4PIYA 5JAXA 3DKWA 4MGKE 1H1AA 1WA4A 3VHNA 4E2GA 1COV3 1V70A 5C8CC 1MZ6A 1TME3 2UY8A 2D43A 2XLAA 4AG4A 4PBPA 2SBAA 4JQRA 5E8AA 3EQEA 2ZBJA 5FLHA 3NV3A 4FTBA 1S0FA 2EXHA 2VOWA 3FBYA 2BVVA 3ES4A 3SITA 1DGLA 3AXDA 4COUA 2BNOA 3MPPG 5KXEA 1SLTA 3TBDA 5CG8A 4QD2A 1AR61 1RUD3 4R8HA 2XBO2 2W52A 3AKQA 1JTZX 1R091 2ZAHA 5K0UA 1FPN1 3V0BB 2VW2A 4CDUB 1DYPA 4EWDA 1RITA 2W08A 1DIWA 2XVGA 1J59A 3PVNA 3T2TA 1RHI2 5D8AA 4C91A 3S6PA 4GA9A 2WQ4A 4JTNA 3AMQA 4RSUA 4LLFA 5J37A 3VBHC 3CO2A 1V6KA 1ENRA 1KD7A 2JG9C 1PK6C 4CTEA 5SV5A 1FMD1 2ZABA 4D7TA 4XQDA 4XIKA 5JZGC 3ALQA 4LO7A 4IEQA 1ONAA 2RM22 3MIHA 1NQJA 4G9SB 4UBGA 1EAH2 3PJQA 3ZYJB 2X5IB 3MIEA 4FTEA 4GMP3 4LBJA 3SHRA 3GZAA 1O3RA 2IWGB 4LEJA 4Q1RA 1GZWB 1NA1B 3HAGA 4RQPA 3ZFGA 4CEWC 1VALA 3O7OA 1U5IA 2DUPA 4LLOA 1ZRRA 3KGZA 1DHKB 5GZGA 3HT1A 2UURA 1Y3TA 1COV1 1VP6A 3EXUA 3SXWA 3PMEA 5AC92 2JG8C 4P9GA 4WBBA 1SLIA 5GLZA 1PVC2 4B29A 3KCCA 3L2YA 4AVAA 2Y38A 3ZSEA 1YJLA 2HWD2 3AKTA 4IEZA 1XE7A 1WGPA 4K21A 3N7KA 1MEC2 1HRV1 1NYWA 1W0OA 1AXZA 4HN1A 1ND2B 4HPKA 2BBVA 4Y26A 2C1FA 4JVAA 4AFAA 1AR83 1DGWX 2ZHLA 1WW4A 1SLCA 2GC1A 3IMNA 3AFGA 4MYEA 4G4FA 3VBFC 3FUQA 1RUC3 4J1WA 2FZ2A 1EV11 1A3KA 3CEWA 1N1TA 1RMU2 2XJUA 3AP9A 4XDQA 1POV0 3C2UA 4AK3A 3S0MA 2WC2A 5J7MA 1LODA 3POSA 3WG3A 2WS93 5C8CA 4CP2A 4HT1T 2PTMA 2WFF1 4TLFA 1LHWA 5JI7A 3AYCA 1AYN2 1RUE2 2EXJA 2B46X 5AVPA 4FT8A 4GKXA 1IGOA 4L99A 2R16A 1ZNPA 2HWC1 4Q0QA 1S0EA 4NO4A 4KG0A 3WV6A 3AB0A 4LBNA 3ES1A 4B8EA 5FO8B 1AR71 5K0UB 3AYAA 3CJIC 1GQHA 3KGLA 3RI8A 3MYXA 4FP3A 4XJ9A 3L2HA 3JCIA 3MICA 5D8AB 4XE9A 1BMV2 2QZ2A 4FPYA 2WZPP 4XJZA 3VBHA 2XBO3 4XETA 1HXS2 4FQZA 1X7NA 3JBG2 2JG9A 1PK6A 2A75A 2RS31 2ZMKA 1AXKA 4HFSA 3BALA 3S7IA 3VBUA 4MVTA 5CBLA 4CDWA 1G9BA 1VBB2 5JZGA 1RHI3 2VMHA 4AQSA 2IXIA 1OLRA 2RS52 2CAVA 2JKBA 3INAA 4WVZA 3ZYGA 3IDCB 4Y22A 5DUXA 4XTMA 2UU8A 4BCUA 4DRVA 3AZYA 4DINB 3N7MA 4NWWA 4HL0A 3U10A 5ACA1 5I8SA 2D5FA 1YJKA 4A7ZA 1V6IA 1WMFA 1DQ5A 2D3PA 5JPMB 2RM23 1KDMA 4TSVA 1D4M2 3VHOA 1EAH3