3VKLA

Protease-resistant mutant form of human galectin-8 in complex with two lactose molecules
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
289
structure length
289
Chain Sequence
LSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
molecule keywords Galectin-8
total genus 60
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA02
5KXDA 3OGGA 3VKLA 2TEPA 5T50A 4XIKA 2NM1A 4LBMA 3WDUA 4XJ9A 3SITA 4Y22A 1WW4A 1N1TA 1WD3A 2P2KA 4XXPA 4YZ3A 1N1VA 1CN1A 4XJUA 4XZPA 1SLBA 3RSJA 2ZGMA 2R1DA 2D6KA 2ENRA 3M1HA 4FPKA 2PHRA 5L73A 1N3OA 1QF3A 1LOCA 3ATGA 4WV8A 2D3RA 4XJWA 4LBQD 3AYCA 2DYCA 1QKQA 4D69A 2SLIA 4BQ1A 1Z0HA 3N35A 2DUOA 1SLLA 1V6NA 2DVGA 2WQZC 1KQRA 4PBPA 1ONAA 1ULCA 1ULGA 1OQ1A 1ULEA 1ZA4A 2DWRA 2PHFA 5DG1A 3T2TA 4TZDA 2ZHMA 3PVNA 1YXWA 4BOWA 3USUB 1G86A 4XILA 1V6JA 2GNBA 5EXOA 5GLTA 2JKBA 2VXRA 4XBLA 5GLZA 2D6OX 1S0BA 4YG3A 1UPSA 2AUYA 5T5LA 4Y1XA 1JOJA 3BIWE 2CWMA 1S0IA 5DXDA 5JLVA 5T5OA 4YFWA 1YIFA 3V0BA 4UW3A 5H9RA 1KITA 1QU0A 4U2AA 4P9YA 4GALA 1RINA 4P9XA 1SFYA 1LECA 3AP4A 5JOXA 4YM0A 3RRDA 3ILNA 3WNXA 1YO8A 3LSEA 1LESA 1FX5A 1F31A 1UZZA 1UZYA 3WDWA 4C1WA 2D3PA 4JCKA 2P34A 2YROA 1YRZA 3AJZA 3MEPA 4NOTA 3AFKA 1BJQA 1DQ2A 5BYNA 4JRAA 1LHUA 4R9DA 5E89A 4M3CB 3DUIA 2ZGSA 3SH4A 1LODA 3NV1A 4F83A 1GKBA 2R0HA 4ITCA 3U4XA 1ENSA 2D44A 2HYKA 2A3WA 1LHOA 2ZGUA 3JUUA 2R49A 3O5SA 1JYIA 1UMZA 1UKGA 4OZXA 1A3KA 3WV6A 4Q27A 1SACA 5EYYA 3WOGA 2NZ9A 3AZXA 1N3PA 1W6OB 3V64A 2VU9A 2P3JA 4AVTA 5KXCA 2LTNA 2D3SA 1UL9A 4Y1YA 4DRVA 2ZACA 1LU1A 1W6MB 2JE9A 3AYAA 4DQAA 4GKXA 4AGRA 1GZWA 1A78A 1S0JA 2UWAA 4Y26A 3OY8A 3B01A 4GWMA 4LBQB 2D7FA 1IS4A 3VKMA 1BKZA 5KXBA 1I1EA 4HANA 3VKNA 1LHWA 4CRQA 1U0AA 2D6MA 3HN1A 4MYEA 1S0EA 1LEDA 4NO4A 4DS0A 4Y1VA 2ZGLA 3AP9A 1DQ1A 2D6LX 3M3EA 4XBNA 1V6IA 2A71A 1VIWB 1H30A 2P37A 4WVVA 3FUQA 4XTMA 3UK9A 2ZGKA 4XTPA 4R9CA 1AX1A 1UX6A 1BZWA 1C1FA 1C4RA 1H9PA 2FMDA 4M01A 3PJQA 2VW1A 2E7QA 2WKKA 1BYHA 2A3XA 1GYKA 3B69A 3VV1A 3WZ1A 1FNYA 3D4KA 5HCFA 3WUDA 2ARXA 2G4IA 1D0HA 4P14A 5T5JA 4XDQA 3WG3A 1AVBA 2A6XA 3V0AB 4L8QA 1CPNA 4YW4A 1D2SA 4R9AA 3TB0A 5JMCA 5JDBA 2EXJA 3AZWA 2VY0A 3AP7A 3B9CA 3ZSLA 1AX0A 4BMBA 2ZGTA 3QCWA 1CONA 3PVEA 4YLZA 2R0FA 3SLIA 2ZGQA 2A7AA 1MVQA 3ZSMA 2ZGNA 5HCAA 1ENQA 3BODA 2EAKA 5DUXA 1ENRA 1FV2A 1G9FA 1PZ9A 1VALA 2GMPA 3R4SA 4AWDA 2PELA 2Z42A 4FQ4A 1WW6A 3WDXA 5IK5A 5T54A 1AJKA 2OUJA 3W58A 3QLQA 3N7KA 3AZVA 4FPJA 2ERFA 4LBOA 1IS5A 3H0OA 4LBQA 1WD4A 4FQZA 2AENA 1LCLA 2DVBA 3NWKA 3ASIA 3OY8B 4YGBA 1G9CA 2WT2A 2ZHNA 1HKDA 1AXZA 2P3KA 2NP0A 4HL0A 1AXKA 1JN2P 1SLAA 2E51A 1MS9A 1YYNA 3APBA 5CNAA 2D6PA 4FP3A 1OKQA 3WVJA 1W6PA 2D6NA 2EXHA 3MW3A 4GXLA 1URXA 2W52A 5LK5A 1LOAA 2AR6A 2OUHA 1YI7A 4Y1ZA 2C5DA 2WLQA 5F9TA 4FP2A 4Q1PA 2EXKA 1JUIA 2ZKNA 2GALA 1DFQA 3A0NA 5GZGA 3SH5A 2A70A 1APNA 2BQPA 3I8TA 4M3CA 4Q2FA 4W65A 2P3IA 3N36A 2OW4A 2NYYA 1LTEA 3B3QE 4Q26A 1I3HA 5EWSA 1G9BA 1KJRA 1LGCA 2A6ZA 4CZSA 1NLSA 1W0PA 2D43A 2Q5TA 1CVNA 2PHTA 2E6VA 4DRRA 4Q1RA 2DU1A 5H9QA 4IQPA 1JW6A 3WDVA 2WT1A 4Y1UA 2WSVA 1WBLA 1GZWB 1A8DA 2W68A 1LU2A 3SNMA 4LBJA 1QOOA 2ZBJA 3UJQA 4YW2A 1W6OA 4YM2A 1MZ5A 3AP5A 4YW5A 3HR9A 1MZ6A 3KQRA 2LALA 1F5FA 1DQ6A 1S0FA 3IM0A 3SH3A 4TYSA 2ZGOA 5JOYA 1WBFA 3AP6A 1Q8SA 3D6EA 1KRIA 2GN7A 2AYHA 2YZ4A 4WVWA 1LOFA 4DPNA 3USUA 4JC1A 5JOZA 2GNTA 1LENA 2NMNA 1LOEA 3AYDA 3AK0A 1DQ5A 3JU9A 3INAA 1PZ8A 1Q8PA 2ZA9A 1DIWA 1MS4A 1SLTA 1GANA 1UAIA 1W0OA 4UW4A 2JJ6A 2RHPA 4XMAA 2AREA 4XHXA 2XB6C 3T1MA 1ZM1A 1LHNA 1N1YA 1V6OA 3WG4A 1WLCA 4Q8KA 3V0AA 4AGGA 3BTAA 2DTWA 1IOAA 2JE7A 2GMEA 5DZGA 1JXNA 3PMEA 4BM8A 4PQ9A 3N7MA 2ZMKA 1DYKA 3AZZA 2XG3A 1GNHA 3FUOA 3V0BB 4XYXA 1S0GA 3OPZA 1S1AA 3L2YA 4I30A 4XXAA 1J1TA 3TAYA 2OVUA 1WW5A 4SLIA 1HLCA 1LEMA 3N3HA 4FOWA 4YG6A 3FBYA 4P9WA 4YGDA 4RA0A 1W6QA 1JBCA 1PZ7A 2DTYA 2E53A 5GM0A 2ZMLA 4FPFA 5E88A 1DGLA 2A6YA 4KBBA 3M2MA 3O0XA 2B7YA 2NN8A 1N1SA 2ZHLA 2R16A 1IS6A 4FPEA 1EPWA 2GN3A 1IS3A 3OBTA 1AF9A 1GZCA 4AVVA 1FV3A 4FPYA 4PF5A 4YZ4A 5T55A 3WHTA 4YFZA 4ZKTB 2GNDA 2JECA 5H9PA 1RITA 5AVAA 3M3QA 1WUVA 2GNMA 1FYUA 1DLLA 1W6MA 3RMYA 2WT0A 2WJSA 5IK4A 2A3YA 1MS3A 4XMIA 4CTEA 1ULDA 2AH2A 3ZXJA 1CQ9A 1VLNA 1CESA 5IUQA 2A6VA 3O0VA 2CYFA 2DUQA 3OBRA 4ISRA 2CWSA 1JYCA 3MPPG 4BLJA 4XE9A 4LBNA 1O4ZA 1V6MA 4Y24A 1ULFA 1SBEA 2W08A 1LJ7A 2EF6A 2UURA 2V5YA 4ATFA 1DYPA 2DU0A 1GSLA 1MS0A 3ILRA 1O4YA 3BOPA 4YGEA 1LULA 3AZYA 1C1LA 3IPVA 5DUVA 1G8WA 4AVSA 1G9DA 4XIOA 1FAYA 4FVVA 4AGVA 3GALA 3ZXLA 5JOWA 1SLCA 3RQ0A 2CTVA 3B00A 2ARBA 2EALA 3FLTA 4YM3A 4ZXKA 1GNZA 1MR5A 1BQPA 1VAVA 3OJBA 4XJ8A 5SV8A 3ZPYA 4FOQA 4XHBA 3R05A 1SLIA 3WUCA 3AJYA 1C57A 2UWBA 3MW2A 4Y20B 1HDKA 5GZCA 1QDCA 5CAZA 4GKYA 5DUWA 4Z8BA 3DGTA 1HQWA 5GALA 1IKQA 1GZ9A 2EXIA 5GJ6A 1DQ4A 3FLRA 4DFSA 1LOBA 1DZQA 3LCPA 5FREA 2A5ZA 2CNAA 1QGLA 4M3CE 5IT6A 4XOGA 1OFSA 2GDFA 1LOGA 4XJAA 4YM1A 3RS6A 4YZ2A 3GNEA 1R1ZA 2UWCA 1AX2A 4K1ZA 3ENRA 3ILFA 5CBLA 4LBKA 5IK7A 5F5QA 1MACA 1UN1A 2WSUA 2ES3A 1KDKA 1MVEA 1IKPA 5E8AA 3ZXFA 3OYWA 3D5OA 1B09A 3V65A 1QDOA 1WLDA 2DUPA 3HMYA 1HQLA 3AYEA 1GV9A 1Q56A 1QNWA 3IKWA 4K1YA 3ZSJA 2CY6A 1SBDA 1TEIA 3PVOA 2NMOA 1WCSA 3N7JA 4R9BA 4PCRA 3M3OA 4Q8LA 4Y22B 5DZEA 3WLUA 4AYUA 2A75A 3RMXA 1CR7A 1GLHA 5GZFA 2YMZA 5H9SA 3WDTA 5T5PA 1V00A 2A6WA 1LOFC 2CL2A 1MS5A 1W6QB 1W6PB 1Q8QA 4M3CF 1QNYA 3SISA 2YV8A 3NV3A 3Q9OA 3A0KA 3ZVXA 4GA9A 3KM5A 3ZYRA 5CA6A 1G7YA 2SBAA 2ZGPA 3I4IA 2KM2A 3POSA 4WZFA 3WG1A 1XQNA 2PHXA 3ZXKA 3CNAA 3WG2A 1NXD1 5DG2A 5HCBA 5DUUA 1SBFA 2YY1A 1VAMA 4K21A 3WDYA 1W6NA 3AXEA 1V6LA 4YZ1A 1DHKB 2JD4A 3A4UA 4FOYA 4UW5A 1Q8OA 3AX4A 1LGNA 1WW7A 4PBOA 1QMJA 1BXHA 1X50A 1DQ0A 1CIWA 3ZSKA 4YG0A 1LGBA 5EYXA 3POWA 3UL2A 4C1XA 1JHNA 5GLVA 5GLWA 4ASMB 2ZMNA 3WCRA 2DV9A 3LSDA 1QOTA 3NV2A 4K20A 4U36A 1AJOA 1AXYA 3UJOA 3POYA 5GZDA 2PHUA 2VW0A 2DVAA 4ATEA 1FATA 1QOSA 1G9AA 1Q8VA 2R1BA 2ZABA 3IN9A 5GLUA 1Z78A 3FLPA 5DZFA 2GMMA 2ZGRA 1MS1A 1S0DA 4YW3A 1V6KA 1S0CA 4FPCA 2DVFA 1AZDA 3OYWB 5FRAA 5T52A 2ZHKA 4GWNA 1KJLA 1DBNA 2DVDA 4YGCA 1LHVA 3IMNA 1WLWA 1Y7BA 3VKFC 4BPZA 3AXDA 3M3CA 2VH9A 4UW6A 2PHWA 3WHUA 1CPMA 2YXSA 3W59A 2W39A 2V73A 4BMEA 3O0WA 2UU8A 5GZEA 3VKOA 1N3QA 4FOVA 3MW4A 3NV4A 2JDZA 3VUOA 1MS8A 1SCRA 2ZZJA 3O12A 4FPGA 4Y20A 1H9WA 3ZXEA 2C9AA 2VUAA 1KDMA 2VW2A 1W6NB 2WNEA 4YW1A 3R4UA 4RL7A 1SCSA 4H55A 4XBQA 5KXEA 4BLIA 4FPHA 1GBGA 3WCSA 4ISQA 4LBLA 3T1LA 3C2UA 2FHRA 2EIGA 3ZYPA 4M00A 3RG0A 2AGSA 4FPLA 1FNZA 4YZ5A 2I2SA 5JVVA 4FPOB 4XJZA 1CJPA 1RIRA 2DURA 1GICA 1N47A 2E7TA 5CB7A 2ZAAA 2H0BA 3FFZA 3IPVB 3N7LA 5IK8A 1F9KA
chains in the Genus database with same CATH superfamily
4N53C 1WCUA 5FUPA 4ES9A 2ZJCA 5T50A 4XIKA 1FMD1 4QPIC 1ODNA 3WNLA 4GH4A 5EP9A 3SITA 3NJXA 1OOPB 4Y22A 4TLGA 5FO8B 5CKMA 1WD3A 1WWYA 1M06G 4I3PA 4HXCA 4YZ3A 3FFQA 3X29B 1W8WA 5KHIA 4UWDA 1HB3A 1CGPA 2PLV3 5FZEA 2R1DA 3VBUC 1VE0A 3M1HA 4YW6A 4NIHA 3H3UA 3VD3A 1IZ3A 4RD7A 1ZZCA 4WV8A 3TNQA 4XJWA 2H6BA 4D69A 2WYSA 4EN7B 1POQA 1CAWA 1L7QA 1Z0HA 1ZBA3 3ABZA 2W5FA 2QQMA 3MLKA 5FZ9A 3UETA 1SLLA 2DVGA 4WZCA 1W28A 5JPNB 4RHV1 3VBUA 2BP6A 2BV4A 1ULGA 3WP3A 3S6PA 1IPSA 3HJRA 4Q0VA 1UXZA 3PIGA 1ALYA 4XILA 2XJPA 5I8SA 1O8PA 1JZ8A 1UKRA 2YC0A 4XBLA 3S5AA 1RUG2 4WM8C 5FP3A 1LAJA 2AUYA 5FV3A 1RGSA 1NQDA 1JOJA 3VZJA 1IGOA 4CEYB 2BERA 5F2WA 5JLVA 3AMQA 4YFWA 1YIFA 4PLNA 2XPJA 1HRV2 3LFMA 4P9YA 2WAAA 3BVCA 5EJ3A 1FXZA 1HRV3 1F15A 1RINA 4LQRA 3LFIA 4EZHA 1YQ6A 2RV9A 4QQHA 3O1MA 4LHKA 4QMAA 2O8OA 1NAEA 1SFYA 1EAH2 1D4M1 5EJZB 1YO8A 3T0DA 5J3UA 4CEYC 1UZYA 3KT1A 4C1WA 4AHXA 3PTRB 4AR2A 4YVWC 5ERLA 1O3RA 1XU1A 2FQPA 2YROA 2IXIA 3HBKA 4NOTA 4RFRB 4WM8B 5LY2A 1XSRA 3C7HA 5AC93 5E89A 1O5UA 4HKWA 4M3CB 3SH4A 5LBCA 3WF1A 1LODA 1W8NA 4P08A 3Q8AA 4XPVA 2BU9A 1GKBA 5EFUA 3MDPA 3U4XA 3ZFEB 1PIV1 2VOVA 3VDAA 2ZGUA 4QGMA 3OBAA 3ZN6A 5HBAA 3PDQA 1UMZA 5HPOA 4H14A 5FZAA 2QE3A 1UKGA 3LEKA 2VZTA 3CHXA 4ZY9A 4AI3A 1SACA 1W0NA 2NZ9A 3AZXA 3BYWA 1LB2A 1W6OB 3V64A 1EUUA 5KXCA 2VOKA 2WDBA 5FYHA 2BPA2 2CV6A 4TN7A 4XF9A 3PL0A 5F3EA 1W8OA 2UWAA 4AFDA 4MX3A 4XQWA 1YEWA 1STMA 1VRBA 1NG0A 5CISA 4HK8A 1TVGA 1BKZA 3VKMA 4OUMA 3IBMA 4CRQA 3F95A 2D6MA 2XOMA 2E32A 1S0EA 1LEDA 5I0SA 4P02B 4Y1VA 1X9PA 1A6CA 3KV5A 3I2OA 4IEYA 4IV3C 1NE4A 4N53B 4M4RA 5A3PA 2JDPA 3KHCA 4E9KA 1UYPA 1VIWB 1H2KA 2YDEA 4MXVA 3FUQA 5JR7B 4BQ2A 4JKLA 2JDNA 4R9CA 3VHPA 4M01A 1BZWA 3MYXA 4O7XA 1OF3A 1YJLA 2ORXA 1H8TA 2E7QA 2VTXJ 1AR81 5FMOS 3Q8CA 4LO6B 4ORFA 1ZNPA 3VZLA 2G4IA 1D0HA 1BBT3 4OHVA 4AQTA 3K4DA 4XDQA 4HZFA 1ZVFA 1CPNA 4Q4W1 3RDIA 3RJ2X 2Z5WA 4UFKA 5DDJ1 4CUBA 1YFXA 5F5AA 5E6HA 4LOTA 1UU6A 2EXJA 3ES1A 3MBWA 2PQSA 1TNRA 2VY0A 4QM9A 5JDBA 3CIHA 1AX0A 4QGLA 3QCWA 3ZSLA 2IXCA 5JXHA 4NRQA 2R0FA 5I8TA 4AFMA 1DGRN 5D8AB 4NIAA 1MVQA 4N53A 3AVRA 1ENQA 3QOPA 1ENRA 1FV2A 3LPFA 1PVXA 1RUH2 4A2UA 2YFUA 5K0UA 5IK5A 4MGQA 5F32A 5T54A 1PGL1 1YQCA 1AYN2 3QLQA 3N7KA 4IE5A 1AYM1 3AZVA 4QX5A 5J7MA 2XQRA 2XHKA 4I0AA 1HIXA 4K8RB 4AHZA 1IS5A 1CAVA 5D21A 3RZMA 2IC1A 4JKMA 5JAXA 3NWKA 4YGBA 5LATA 1UU4A 3VN4A 5BNNC 1AXZA 2P3KA 2VL4A 5CFDC 5IVCA 4AVAA 1QHDA 1HXS2 1SLAA 1MS9A 2PAEA 1D2QA 4DIQA 3IZOA 4N7IA 4XCAA 1LNSA 2LROA 4FP3A 2D6NA 2EXHA 1E5HA 1URXA 1LOAA 1Y43B 5BV6A 4LKDA 1DCSA 4RYDA 3UV9A 3H8UA 3TEWA 1YQ5A 1POV0 5FZ3A 3WXPA 3SH5A 4CXWA 3H9AA 2VUJA 4D6RA 4B1LA 3VBHA 2BQPA 4M3CA 4CP9A 3HT2A 3MIEA 4GB31 1QJX1 1G9BA 4Q26A 3QD6A 1KJRA 4QPYA 1RUH3 2VVFA 1NLSA 4QB1A 2E6VA 4Q1RA 5DDJ2 4XACA 2WSVA 1GZWB 4QQLA 4YSFA 2A73B 4Q4V3 1LU2A 3WP4A 2EIDA 1S2BA 4FSJA 2ZBJA 3GHMA 4P5YA 2VAUA 2X10A 3O1SA 1UMHA 4QX7A 1V0AA 2GAUA 2VNGA 3DL3A 3HR9A 3LEMA 5EQUA 1MZ6A 3KQRA 1H4GA 1XC6A 1DQ6A 2HWE2 1G6NA 2JDHA 2XJUA 1PMHX 2MEV1 3AP6A 4INDA 4AEKA 2ZKLA 5TSWA 5C8CA 2HYXA 3PTYA 3W20A 1WCDJ 1PGSA 3MLJA 4WVWA 4DPNA 4AXOA 1C5HA 2BYVE 5JOZA 1LENA 3ACFA 1LOEA 3I2KA 3JU9A 3S7IA 1R091 4LORA 2IXKA 3KT4A 1UOFA 3VDDA 3W21A 3NJVA 1GANA 1UAIA 1WA6X 2IXHA 3SEPA 3ZYHA 4AAXA 2AREA 4QX1A 1D4M2 2WWUA 1N1YA 3LIHA 4AVCA 2YPDA 5ANNA 4AGGA 3S0MA 2WAOA 3D0JA 1IOAA 5FK8A 1K12A 1TE1B 2TNFA 4KWLA 2ZMKA 3AZZA 1HXS3 4PDWB 3V0BB 3FUOA 2YG0A 3VBRA 1XE0A 1S0GA 5JUVA 4A3ZA 3L2YA 1TG7A 4I30A 3TAYA 1TMF1 1WW5A 1HLCA 2VZ1A 1RUG1 1AR73 3FBYA 4YGDA 1RUF3 4C90A 1K5MC 3NQHA 4RQPB 5GM0A 1CIYA 3KSCA 1DGLA 1GP6A 2I45A 3ZYGA 3M2MA 2PN5A 2WO1A 5KHKA 1Y9QA 1ZRRA 1N1SA 4QKFA 1IS6A 1EPWA 4NE9A 3BU7A 1E5IA 1JZ2A 4V1PA 2PLV2 5T55A 3WHTA 2XVLA 2GNDA 5H9PA 2L9LA 4ZXEA 3M3QA 1O8SA 1QJEA 3J8F1 3GJBA 3NNFA 1UNBA 3C7FA 4CCMA 5FZBA 4CDXA 1PX3A 4A4AA 1OQDA 2OKXA 1UY3A 1GQGA 4MXWB 3ZMNA 1VMJA 1WCQA 2HWB1 4H3WA 4LBNA 4Y24A 4JHTA 3KV4A 1RUC1 4LKSA 2Q8DA 3F2ZA 4CEWC 3H8XA 1IQAA 2JIGA 4DUWA 1JODA 3C7EA 3WEZA 1H1IA 4MGIE 5C6CA 5FK7A 1ZZ7A 1GSLA 2RM21 3GZTB 3ILRA 4MGYE 4CP2A 1AR91 2HKXA 4N7UA 4CCNA 3VD9A 1G8WA 4AVSA 4FFHA 4IV3A 4FVVA 2GH2A 4JDOA 4AGVA 2EAAA 2JG8C 2X09A 1RUI1 1GFF2 1AR63 3J8F2 3SKVA 4BIFA 2CTVA 4LT5A 2EALA 4FXGB 1BQPA 1OD5A 2DCZA 3ZPYA 1DYOA 1W04A 4XHBA 1YFYA 2JB8A 3OG2A 4QX8A 1VBD1 1TNFA 1SMVA 5GKAC 5FOJB 3MW2A 2NQYA 3DKWA 5GZCA 1QDCA 5FIXA 5APAA 4D6QA 3HQRA 1W9YA 2RMU3 3DGTA 3FWEA 5GALA 4KWKA 4NAMA 2TUNA 1HN1A 1GWKA 4IE0A 5C8CB 1LOBA 1BLZA 3WP5A 1QGLA 4M3CE 4XFCA 4XOGA 1OFSA 1OLMA 5F3IA 5LEJA 2UWCA 4IV1B 3H1YA 2VUDA 4K1ZA 5CBLA 1UOBA 5IK7A 3OPTA 4NN0A 2VMDA 4F7ZA 1MACA 4WVZA 4PF1A 1CAWB 5BUVA 1I9RA 1KDKA 4JGYA 4E2SA 3D5OA 1B35A 1B09A 3USSA 1WCKA 3VDBA 2DF7A 4EROA 2X5IB 2YC4A 3CZJA 5A1FA 2PLV1 3HMYA 1CWPA 4AAPA 5FY4A 2RDSA 2RG4A 3RPQA 2GP5A 4HG6B 1QQP2 5FUIA 3N9NA 3DF0A 2PXJA 1L3JA 1WCSA 2VBPA 2QDNA 1UYXA 1JS9A 3WLUA 1CR7A 3H50A 5GZFA 2BNNA 5H9SA 3WDTA 5FFOC 1V00A 2A6WA 1LOFC 3ZR6A 4CP9B 1RMU3 1RJ8A 4QKNA 3KD4A 4LE4A 2VBDA 1DU3D 3NV3A 3PU8A 2BGOA 4RS5A 2X5IA 3N9OA 5FKBA 4XAAA 5CA6A 2VZPA 3ZXGA 4AEMA 3I4IA 5F8PA 1XQNA 3VBOA 4I0BA 3BIEA 3CNAA 3WG2A 3ZXAC 1O59A 5HCBA 4KNCA 1PK6C 3HNBM 3UKTA 1XNBA 2VMIA 4GAZA 4GJYA 4GMP3 5A3NA 5HXVA 3S30A 1DHKB 2RE9A 3A4UA 4FOYA 5A7PA 3MZHA 2WS91 1Q8OA 1WW7A 1QMJA 2IVIB 2V5DA 3CEWA 3CJIA 1UCXA 3H8OA 4YG0A 4NHLA 5EYXA 1ZZ9A 4PIZA 3UL2A 4D0QA 1LR5A 1H8VA 1AR93 3ETPA 1AYN3 1EUTA 4LK7A 3UESA 3ES4A 1AJOA 1AXYA 4UYBA 2WZR3 2RS51 1A34A 2DVAA 2LRPA 1AR61 3VBOC 2ZABA 1ZRFA 1YQ8A 1Z78A 5DZFA 1JYWA 4AFBA 1VRH2 1MS1A 4E4SA 1UMIA 1DDLA 4AW7A 1TZOA 5FUNA 5FZIA 1RUJ3 1OXCA 3SMHA 2WN2A 1AZDA 5DAWA 5FJHA 3PLQA 4ZPIA 1JYVA 2VCCA 5A1LA 1DBNA 5JI9A 3VL8A 3AKRA 1VJ2A 2DVDA 1SEFA 3TEZA 5B4XA 1J3RA 4C0HA 1X33A 2XHNA 3RZKA 1HB2A 4NIDA 1PGL2 3LA3A 1F8VA 2WLPA 1Y7BA 2O0OA 4BPZA 2JG9A 1O6UA 4UW6A 4COYA 3L2HA 2VECA 1OHFA 1DGWA 1CPMA 2YXSA 5FP8A 3W59A 3GCXA 1C28A 3MPBA 4CPBA 3ACIA 4BMEA 5J09A 1AR83 3VKOA 1N3QA 2JDZA 3VUOA 4CXYA 1SCRA 2HWC2 3GF6A 1XOYA 1H9WA 4QDSA 2YGLA 3C7GA 4YVWB 2VUAA 5EHDA 2WNEA 1RJ7A 4IL7A 4N43A 4BXFA 2KA3A 3R4UA 1SCSA 3BTXA 2WYFA 4LBLA 5FAXA 3OUHA 4YZ5A 1FNZA 1QH7A 5JVVA 4XUNA 5IK8A 1H6XA 2WZEA 2BNMA 3KT7A 3LEGA 3U10A 3URFA 2RR13 3OB8A 1WGPA 5FZHA 1N47A 2HWF2 2MPFA 4UBHA 2ZAAA 3FE5A 1OLME 4S2DA 5CB7A 4BQXA 3ZSEA 2X5IC 1OI6A 2J1UA 2GC2A 3MGUA 3N7LA 1W9WA 1RL3A 3FHQA 2E33A 4BQ4A 2OA2A 4WVMB 5KXDA 1V9U2 1PGW1 3VKLA 2D5FA 1AYM3 2K46A 1PK6A 2TEPA 3T0BA 4QPWA 5FKCA 3IDAA 3ZPOA 2ZEWA 2JDYA 4KWUA 4XJ9A 3V56A 3JBG1 4IDZA 3FZ3A 1ZZ8A 4X8PA 2JICA 4RHV2 3FHAA 1QH6A 2WRAA 4QQOA 3N9MA 1KS5A 1SLBA 4D3WA 2D6KA 2VQAA 2ENRA 1CX1A 1C8M2 1HRI2 3NW4A 4E4HA 1N3OA 4OI1A 1LOCA 1XYNA 3I59B 4GULA 4LBQD 2DYCA 5JXGA 4LKFA 4Y5Z0 5K8SA 3IWZA 2QKDA 2VZUA 1RUI2 3VD4A 3N35A 4CYDA 2DUOA 1MQTA 4ASKA 1KQRA 4PBPA 3CU7A 1NX9A 1ONAA 1UO9A 1V70A 2IFRA 1ULEA 4Z2AA 3OOXA 5DG1A 4TZDA 4WBBA 3PVNA 3WNOA 2G1MA 3K3NA 4FFIA 3BU0A 4BK5A 2WFF1 1G86A 1Y9GA 2GNBA 2VXRA 1O3SA 4CPBD 4MADA 5GLZA 2OZ6A 2BTVC 3SH3A 4B4QA 5T5LA 2OPKA 4Y1XA 4D7SA 1YIPA 1UYZA 3GZUC 4IXLA 1S0IA 1JI6A 5A7OA 3N9PA 1U12A 3TNPB 5T5OA 3OGVA 3FMGA 1YHFA 5FXVA 1OT5A 4JKKA 4R4ZA 2WL1A 2HWF3 2W46A 4P9LA 1H2LA 2HH9A 3TBDA 5LCWL 2Y0OA 5JXJA 1US2A 3AP4A 4EWAA 4L9BA 3ILNA 1P8JA 1CZVA 3LSEA 4GWJA 4NPMA 4Z82A 4CCLA 2D3PA 3CF6E 1I5ZA 4QHBA 3VL9A 5FYIA 2YFZA 1DQ2A 4Q0SA 4QM8A 1SQ4A 5EIYB 5FOBB 3DUIA 3NV1A 1ND3C 3KF3A 4ITCA 3ZFEA 4GH4B 1VR3A 1FOD3 4ZS3A 5IVFA 4V2WA 4P00B 4HSJA 3TN92 4OCTA 3ZX7A 1A3KA 3WV6A 1TME1 5AFBA 3VBRB 1Z7S2 3K77A 4NR1A 4JTNA 3KQ4B 5IYYA 1IPJA 2DBIA 3TEYA 1UL9A 3SCGA 4DRVA 3T30A 1FPN1 2JE9A 3AYAA 4XUQA 3GZEA 1FPN2 2DFCA 3A7QA 3GBGA 5DPNA 3IDCB 2WABA 1BVVA 1VBE2 3UKVA 2OQ7A 2VR4A 1BCXA 1QJU3 4LOSA 4PDWC 2IWGB 3VKNA 1SDWA 1LHWA 3RZZA 1U0AA 3HN1A 3HD8B 4M0HA 4BB3A 1GUIA 2WQ8A 5IW0A 4DEQA 2G9ZA 3Q8EA 4FT8A 4NPLA 4CEYA 1K3IA 3RGBA 3NNJA 1FMD2 4YNIA 4CCOA 1J3PA 2HWC3 2RJ2A 4EN6B 2ZGLA 1DQ1A 3ETQA 2D6LX 1V6IA 2MEV2 4LHLA 5KC6A 2FMDA 5B4NA 2QQNA 1C1FA 1C4RA 2HWE1 3GDBA 4QB2A 4CDWB 5C3PA 3BUCA 1VBD2 2ARCA 2B9UA 1R082 1GYKA 2XQXA 3R6SA 3VV1A 1FNYA 4P14A 3K75B 2BOJA 2R7EB 4UFJA 1HRI1 5LBEA 1COV2 3CJXA 2E31A 5BNNA 1SFNA 1SHWB 5JIAA 3UGHA 5FBZA 2XJVA 2UYAA 2W91A 4BQ5A 5J37A 3JQWA 1NA1C 2RM22 3AP7A 3B9CA 1DZRA 1POV3 2RM23 2ZGTA 4RR3B 3JBG2 3PVEA 3SLIA 3OD0A 4COUA 1VB2A 3I7DA 2PHDA 2Y0IA 2BGPA 5HCAA 4JGZC 3BODA 5JSPA 3L9JT 3R4SA 4JX0A 1PGW2 1W90A 2MHFA 2RS12 1WW6A 4JZRA 3H8RA 1AJKA 4WM7A 2BZDA 2VZSA 1X8EA 1NCQA 4A42A 4LBOA 5IFTA 4RR3C 3H0OA 5FY9A 2RS32 4AI9A 3K4ZA 1WD4A 2AENA 2VQUA 1LCLA 4XFAA 2WT2A 2ZHNA 1HXS1 2OS2A 3LAGA 4HL0A 1XPWA 3VDCA 1AXKA 1JN2P 3JD71 4ZU7A 3K2OA 1C8M1 5J36A 1RUG3 2ZEXA 1OBNA 1WMFA 3P1IA 5I0TA 2VMEA 5JZGB 2K2SA 2QQPA 1AYM2 4ARYA 5A1AA 4JGZB 2OUHA 1YI7A 3I49A 5K0UB 2D93A 4FP2A 4Q1PA 5EZWA 1JUIA 2ZKNA 1VBD3 3CMGA 3A0NA 1XNAA 5FYCA 2ZX1A 2BEOA 5LRSA 4RHV3 2Y6JA 3I8TA 4RR3A 1V9U1 1RMU2 4W65A 4COWA 5EWSA 3VD5A 4IEPA 3CJIC 1I3HA 4Q4Y1 2JDMA 5A7NA 1AUYA 2D43A 1W0PA 2Q5TA 4JAAA 5SV5A 4CZSA 2Y60A 5KWRA 3DECA 5H9QA 1J1LA 4KGQA 4RGAA 4CXXA 1H1MA 1WBLA 5FPVA 2W68A 1H0BA 4NRMA 1OA3A 4LBJA 1PVC1 2ZEYA 1QOOA 2J1VA 1H8TB 4YM2A 1MZ5A 1MZEA 2WNVA 2JDKA 5CFDA 1LRHA 4CCKA 3U07A 2JDUA 4CDWA 4LTAA 3IM0A 3RVHA 2ZGOA 1GP4A 5DDJ3 5A7WB 3JB4C 3VBRC 5LA9A 5C3RA 2EIEA 3IDEA 3THTA 2ZX4A 1M4WA 2J1EA 2VPVA 2YZ4A 4J6GA 4OMDA 3T2PA 3PMSA 2OYZA 3USUA 1W9SA 1Q43A 4IEVA 2GNTA 1BMV1 4FAGA 3FC0A 1DQ5A 2W9XA 2XJQA 3P3NA 4GH4C 1Q8PA 4LR4A 4KI5M 4QQPA 2ILMA 2ZA9A 1DIWA 1MS4A 2WWJA 4LNVA 5DAXA 3T09A 3KF5A 2GSYA 2WNUB 3D8CA 4UW4A 2JJ6A 5C4WA 5LB6A 2VCMA 2QUOA 2Z69A 4UFMA 3T1MA 1ZM1A 3WG4A 1V6OA 3DYMA 1WLCA 3V0AA 3BTAA 5F39A 4CP0A 4ZZ5A 1UY2A 5DZGA 4IE4A 1XE7A 3VZOA 2JG9C 1ND2A 3M4FA 4D94A 2XG3A 1GNHA 2J1SA 4NHMA 4MH0E 1YJKA 4XXAA 3ZYIB 3N9QA 2BDRA 2YU2A 3GZAA 3N3HA 4FOWA 2FDIA 4YG6A 4QPGA 1PO23 5ACA2 4IUGA 2Q8EA 3ZKUA 5JCTA 4AEDA 4NIGA 4PI2A 1PZ7A 2E53A 2DTYA 2CSGA 4IW3A 1KFUL 2ZMLA 5F5CA 5A7WA 1T6GC 3KHBA 4OFGA 3C8XA 4BXSV 3O1OA 4KBBA 3NL1A 2GC1A 2B7YA 2FCUA 3TN93 3KGLA 4WM8A 1S55A 2NN8A 5FYZA 1HB1A 4B3NA 2OT7A 4FPEA 3KCYA 4Y4YA 4R8HA 3GGLA 1FV3A 4FPYA 3ZFEC 1ND2C 4FBFA 1RITA 2E9QA 5CKQA 3K46A 5AVAA 5CADA 4ES8A 3I59A 5JMOA 1NCRA 1W6MA 4UF0A 4EN8B 2VTFA 2WUHA 1GQHA 1XNDA 4LLOA 4NHYA 4ET7A 1FI2A 2A3YA 4XC9A 1ZRCA 1NT0A 1VLNA 4JGYB 5ABJC 2A6VA 3NNLA 2DUQA 2V72A 2F4PA 1VBB3 5K7PA 5A33B 1OUXA 1OVSA 3P3PA 4CCEA 3POGA 1RMU1 1O4ZA 1V6MA 5L9BA 4XFGA 1ULFA 2QJVA 4JHZA 3FHIB 3T2OA 4Q4Y3 4MGTA 4CVUA 3I2HA 2WR9A 1BVP1 2MEV3 1H2NA 2WNVC 4ATFA 1X7NA 4FFGA 1DYPA 2DU0A 1YI9A 1Q5OA 5CKNA 1YWKA 1LULA 5DUVA 5A6YA 2P6CA 1U5ZA 1FAYA 1MEC1 5L19A 4QHOA 3LD8A 3GALA 4I0WB 5JOWA 3ZXDA 5BNPC 1SLCA 1MQTC 3RQ0A 3ZYBA 3H3LA 3HEIA 3IB3A 2Y64A 1W05A 3AL5A 4W6YA 4NUBA 4ZXKA 1MR5A 1R081 5DN2A 2QTWB 3K3OA 1VAVA 3MF6A 4XJ8A 3ZOIA 1NKGA 3KCCA 4FOQA 4N43B 4LKEA 3T2QA 3KV9A 1C57A 3AM2A 4C8DA 3POFA 3KWVA 3WW1A 3ZKYA 2W3JA 1IKQA 1GZ9A 2EXIA 3O14A 1DQ4A 3FLRA 4R52A 1K42A 3NVCA 1DZQA 2BFUS 3LCPA 4B7EA 2RR11 2JEMA 4TSVA 1JMUB 5FXXA 4MLOA 4QXBA 5FYBA 1LOGA 3RS6A 4EWEA 1XNTA 2Q1MA 1T6BX 3GNEA 4IETA 4XURA 3H1WA 2OX0A 1ND3A 4J1WA 4LBKA 3JXSA 4Q4V2 5FZ4A 5CFCC 3KGZA 4OHYA 5F5QA 2RMU2 1JU4A 4YRDA 4B4PA 5IAVA 5FBJA 3LIGA 5FMDA 1AL23 2CAVA 5A3TA 2XBO1 3V65A 1O7FA 1YC61 5IATA 1VBE3 5KHHA 3U4SA 2DUPA 5FXZA 4CA9A 4EWDA 3O7OA 3KMHA 4K1YA 3IKWA 4Z92B 3S57A 2Z79A 4AQ2A 2X8KA 1UZVA 5CEHA 3PVOA 4KMQA 4RS5C 2ADEA 4OUSA 4AYUA 1GWLA 1W2NA 3RMXA 4CU8A 1WMXA 2FDJA 4Y4RA 2UYBA 3BPSA 3MO4A 2CL2A 2HEWF 3OCPA 2HWB3 3M7AA 3E1F1 2XJTA 4UOJA 2Q30A 3ZYJB 1FOD2 1RUC3 1E57A 1W6PB 4M3CF 3K51A 2QQUA 1BEV2 5FP7A 4KWJA 1ASJ2 2JWPA 2F4LA 1EV12 3A0KA 2WIIB 3VDDC 3ZVXA 2XL7A 3VD7A 3UNPA 5HCHA 5EPAA 2SBAA 4EQVA 4WZFA 2GH8A 3POSA 3WG1A 2UY8A 2PHXA 5FP4A 1TMF3 4D6SA 2VO5A 4TTGA 1YUDA 1VMHA 5DG2A 3ORJA 3VBOB 3JQXA 4AK3A 4IESA 1VAMA 4LO4B 5LZ6A 1QY4A 1VBB1 2YBSA 1PO13 1ZA7A 4K21A 1JU3A 3AXEA 2Y6GA 2K9ZA 4UFLA 1UOJA 3WD5A 4UXAA 2R061 2VNVA 3AX4A 1O3QA 4LIUA 4PBOA 2VZQA 4OHWA 1X50A 2RDQA 4LHNA 5FY0A 3POWA 3PUAA 1QIQA 4K7JA 1PHMA 5GLWA 3EBRA 4W6XA 2DV9A 3WCRA 2N7GA 2DFBA 2YUEA 4U36A 3TOJA 3UJOA 5ACA1 1IPKA 3I54A 2PHLA 3POYA 2CGPA 1ZBA2 3MHZA 3VHRA 2XONA 2W1QA 4META 3IN9A 4MOAA 3FLPA 4NWVA 5CYYA 3AKPA 1CX4A 2Y26A 1S0DA 3PU3A 4DUXA 4XCBA 3O1VA 4YW3A 2VJXA 3NAPB 1V6KA 1S0CA 2V09A 3B9IA 4FPCA 4UI9L 5FZ0A 1B35B 3HPNA 4HN1A 4Q29A 5HV4A 2A1XA 5FRAA 3HNMA 2GP3A 1COV3 2OQ6A 4IGOA 4PLOA 3MF9A 5I93A 2R30A 1KFXL 5A6XA 2C6SA 3EXUA 4JQRA 3U11A 5ABJA 2O1QA 1PO22 3M3CA 5T3NA 3UGGA 4N43C 4AI0A 3H1MA 4AVBA 4YYOA 1NE6A 5AC91 3O0WA 2UU8A 5GZEA 5B2GB 1VPHA 4B8EA 4FOVA 3NV4A 1MQTB 4NHXA 5A7SA 3PURA 4E4DX 3O12A 2HWF1 1PIV3 4F3JA 4AEJA 2D98A 1HB4A 4D8MA 3ZXEA 2C9AA 2VW2A 1W6NB 2JIJA 3TWIA 1J83A 4XBQA 2B39A 2ZOEB 4BLIA 1GBGA 1HV1A 4ISQA 5FZ1A 1UWWA 2FHRA 3KZ4C 3ZYPA 1F2NA 1POV1 1NY71 4M00A 4FPLA 3C3VA 5A6QA 2I2SA 5E1RA 4FPOB 4H7LA 4IV1C 4NROA 1R1A3 2LW8A 1RIRA 2PQQA 2E7TA 2R043 5L36A 3EQEA 4HOOA 2H0BA 5IVEA 1CJDA 3ZFFB 4CCDA 3RZHA 5C8CC 2FCVA 1F9KA 1RUNA 3OGGA 5A3LA 5FQ0A 1QXPA 4MHRA 4BHPA 2NM1A 4DY5A 4KBZA 3WDUA 1RUE2 5IFPA 1WW4A 4A41A 1H2MA 1N1TA 4XW3A 2P2KA 1Y3TA 5DMYA 4MXWA 5FR3A 1N1VA 5L7OB 4XJUA 2XJRA 4I09A 2RDNA 4XZPA 1VRH3 5JXIA 2ZGMA 3C7OA 5ISLA 1PM4A 2PHRA 4CDQA 3H3ZA 1QF3A 3ATGA 1A8MA 4GWIA 2W1UA 1QKQA 2SLIA 3R0RA 2QBXA 4IERA 4ZONA 1NQJA 4NWWA 2P4EA 3I3QA 4BWOA 4ARXA 1UY1A 2B46X 2DCYA 1RHI3 2BJSA 2HWC1 5A3OA 1SG3A 1UW8A 4N8MA 2DWRA 3HVDA 1MPXA 3RNSA 1K5MA 2ZHMA 1YXWA 5G04L 4BOWA 2YPJA 1RUE1 2VVEA 1GP5A 1KGYA 1UPIA 2JKBA 2VMCA 1NXMA 3NKGA 2ETEA 4YVSC 5FCCA 3ZLIA 4DUVA 4YG3A 3E6CC 3LGRA 4ZS2A 1EYBA 3BIWE 1K5MB 4RQPC 5DAQA 5DXDA 4E27A 2ZS6B 1RUF2 2Y6HA 4UW3A 1U5YA 5H9RA 1KITA 4U2AA 4E8DA 2AC1A 1REDA 1QJY3 4P9XA 1COV1 3KV6A 1CAUA 4ZU4A 4CDQB 2RVAA 3ACHA 1CAXA 2ZEZA 3ROUA 2XLAA 1LECA 2WC2A 5JOXA 4YM0A 3WNXA 4AEDC 1F31A 1UZZA 4LA2A 3T0AA 4AL9A 4KL1A 4TXWA 3TRSB 2O14A 5FWEA 2P34A 4XDPA 3A21A 4RFT0 4BQ3A 3AJZA 3MEPA 4Q5OA 5BYNA 1BJQA 3KVBA 5FZCA 5C3OA 1DZTA 2WWSA 4GMP1 1PVC3 4R9DA 4XUOA 3WINE 4A7KA 4PIXA 4A44A 5C7GA 2R0HA 4RQPA 4YPJA 1BEV3 1ENSA 2D44A 2HYKA 4LXLA 3JUUA 2FBEA 3BB6A 1JYIA 2XJSA 1E5SA 5EJ1B 4YWAA 3UT0A 3ZO0B 4FAHA 1QWRA 4EN9B 4FI9A 4Q27A 1J3QA 1YLLA 3AVSA 4XF4A 1QJX3 4QXCA 3S7EA 1RUD3 1HV0A 1N3PA 4AVTA 4QWNA 5HV0A 4LJHA 2WZR1 2D3SA 2RS53 1YFWA 2ZACA 1LU1A 5G05L 4DQAA 4EE2A 1R1A1 2R041 4AGRA 1GZWA 1A78A 2BUKA 4CCJA 4LBQB 1IS4A 2QQKA 3OD4A 1WLTA 4HK9A 5FZGA 5KXBA 1TME2 3LWCA 4HANA 3DKQA 1NUKA 1Z7S3 1JH5A 4MYEA 5FTTC 4L99A 2ZX2A 4NO4A 4DS0A 3B02A 3NRUA 1PMJX 4HVRA 2ZPXA 3AP9A 3WF4A 4JDMA 4V2VA 4W6WA 1H30A 2A71A 3GXUA 4XTMA 5FPBA 3UK9A 4XTPA 3U1XA 1AX1A 3VZMA 3PUIA 1H9PA 3VBFC 4UFIA 3VGIA 5JR2A 3DPRB 4G4FA 2A3XA 1NOVA 2VTXA 1VBB2 3AMPA 3B69A 3D4KA 3HIFA 3JD72 3LPGA 5F2SA 2ARXA 2OIIA 4IEWA 2XBO2 5HCFA 2B42B 3WG3A 3DYOA 4DZGA 3CZUA 5IAXA 1AVBA 2A6XA 4Y5SA 3WQ1A 3NMBA 4YW4A 4QKBA 1AL0G 1D2SA 3IAQA 4IV1A 4R9AA 5JMCA 2C1FA 3JBG3 4YW7A 3AZWA 2PAMA 1XXNA 3WP6A 1CONA 1JZ6A 3LZZA 4PI0A 1L7LA 1W3VA 4HMZA 3ZSMA 1YCIA 4COVA 5FZ8A 5DUXA 1RUC2 1MEC3 1PZ9A 1G9FA 1VALA 2EAKA 2GMPA 3KVAA 5FY7A 2BNOA 2IXJA 2PELA 3E6DA 3PNAA 3FL7A 2ET1A 1LKNA 4JVAA 4GD4A 1R083 2ERFA 3IIIA 4K40A 2J1RA 2HLEA 2W92A 4DNYA 4LITA 4O61A 1OH4A 4FQZA 5BNNB 3OY8B 2DVBA 4XUPA 2VCAA 3ASIA 4QXKA 4Z1VA 3NAPC 5LA1A 2FD8A 2VZRA 2E51A 3H7YA 5CZKA 1TQ5A 3OGJA 3WNMA 3RI9A 4Y3OA 2D6PA 3WVJA 2YC2A 4UBGA 2XWJB 4XEZA 3ZR5A 4GXLA 5BNQA 3LKJA 2VZ3A 4SBVA 4CP1A 4XFFA 1AR92 4LA3A 3ZMOA 4Y1ZA 3WF2A 1OSGA 5F9TA 2C26A 1SPPB 2HEYF 2FZ2A 3E97A 4LE3A 2EXKA 4LO7A 5C8WA 3ZM8A 4LEJA 3M8LA 1DG6A 2DDUA 4RGKA 2HWB2 2JENA 4BQWA 2OW4A 3LOBA 1LTEA 3B3QE 2BW8A 4MUVA 2XBO3 4QAWA 2A6ZA 2YGMA 2XLFA 5I0UA 4BZ4A 4E4ZA 2PHTA 2BWAA 4DRRA 4FXKB 3RWNA 2P17A 4IGPA 4CUAA 4CE8A 2UY9A 4IE6A 4N9IA 5LBBA 2C24A 5FZFA 3UYJA 2DBNA 4FO9A 4GQ7A 2VG9A 3U14A 4XZUG 4CDUA 3GCWA 3T08A 2QQJA 4IEOA 4YW2A 3I3BA 2P5BA 4B29A 3M70A 2XKOA 3AP5A 1ASJ1 4YW5A 2JX9A 4CU6A 3RFRA 5FXWA 1F5FA 1OURA 1S0FA 1FOD1 3CBNA 3LDKA 1R092 3JZVA 1W8HA 2H6CA 1WBFA 2PA7A 3MIBA 3AKSA 2QZ3A 1JZ3A 4FTEA 2VM9A 2AYHA 1VBC1 5C5UA 5CFCB 3DXUA 2EA7A 3E5XA 3FBMA 4MG2A 2J42A 1OLRA 3AK0A 3INAA 1PZ8A 1FPN3 2IXLA 1W2UA 3IMMA 4PT6A 5LY1A 2VMHA 3D3AA 1QJY2 1OPOA 3NNMA 1W0OA 5FPZA 4S2GA 2FDHA 2RHPA 3MICA 2JXAA 2WNOA 4XHXA 2XB6C 1LHNA 1QJU1 2LM3A 4AG4A 4Q8KA 1L7RA 3WNPA 2DTWA 5A3MA 2JE7A 4XVHA 4BM8A 1JXNA 2IUWA 5JPMB 3J7NA 4GMP0 1GWMA 4PQ9A 3N7MA 1O5LA 2WZR2 4I3GA 5D1IA 3DPRA 3NO8A 3THPA 1KS4A 4XYXA 2QQLA 1S1AA 2R6QA 4A7ZA 4HVQA 5LWBA 3RZJA 4S2FA 1LEMA 1U5IA 3E5UA 4GB32 5FYUA 4K9SA 4HKOA 1RVF2 2MNGA 2P1BA 3GHNA 4P9WA 4URTA 5BNPB 3ZFGC 1W6QA 4HPKA 4GIQA 5E88A 2CAUA 1S2KA 1X36A 2HWD1 5FZLA 5JSRA 4DO0A 4Z2WA 1HQNA 2W87A 2WNVB 1HRI3 2GN3A 5FMBA 1XNCA 2K0GA 4W8JA 1O3TA 4LUMA 1AF9A 4PF5A 3OUIA 3H42B 3UGFA 2C0ZA 1VMFA 2XKPA 1WUVA 1FYUA 3RMYA 4QDRA 2ZXQA 1YFUA 1JYNA 1ZRDA 4P5HA 3SKJE 2WO2A 4KQ7A 4LK6A 4LIVA 4CTEA 2AH2A 3ZXJA 1RUOA 1CQ9A 2Q0AA 1PO12 1PMIA 3O0VA 2CYFA 3OBRA 1EAH3 3MV11 4QD2A 4QU2A 4XUTA 3KLSA 2CWSA 1OH3A 3MPPG 4KU7A 3RI8A 4XE9A 4K6BA 3OSDA 2RS33 4FFFA 1SBEA 1WKYA 4MVTA 2R072 4NRPA 3RYKA 5BNPA 1LJ7A 2EF6A 5LA2A 2V5YA 3U37A 2BVVA 4JGZA 2TBVA 4IEZA 5AFEA 4WVMA 4AFCA 4HPKB 1MS0A 3TEXA 4OQ9A 4QPIB 4JGYC 5ABJB 4H7MA 3AZYA 3JD73 4XF3A 1QQP1 3I2JA 5A32A 1G9DA 2Q1ZB 4YVSA 4OULA 2C4XA 5FY5A 3WF0A 5I0DA 5CG9A 1HW5A 1RC6A 3B00A 2Y6KA 3FLTA 4QX3A 3J7MA 2R063 1ND2B 1PNFA 2QFEA 3FX3A 1W2AX 2ARAA 5SV8A 1QEXA 1SLIA 1W8FA 2Y38A 4ZZ8A 1UX7A 2UWBA 1FMD3 3CL1A 1NCRC 4Y20B 3P6BA 4Y5TA 3WX5A 5CAZA 2WN3A 5DUWA 4DXZA 4Z8BA 2HWD2 3J9SA 1HQWA 5FO7B 4BH9A 4EZ4A 5CFCA 5IVJA 2ZTNA 1C8M3 2QNKA 5FREA 2A5ZA 2EICA 3U78A 5HI0A 2VUCA 2GDFA 3I2GA 4JV4A 4ASLA 5FLJA 1PO21 3ZDVA 1R1ZA 1RUJ2 4X6QB 1RB8G 3T4HB 4TLFA 3VZNA 2W2IA 4QPGC 2RJLA 1W8UA 5FZOA 1UN1A 1XU2A 2GC3A 2WSUA 5C9AA 3A22A 5E8AA 3KS7A 5KHGA 1QJU2 3BKZA 2JG8A 3G7DA 3EJKA 5FPUA 3OTFA 1AR82 1VRH1 2JB4A 1OC1A 2WNUC 4B7KA 4CDUC 3MLLA 1K5JA 1ZBE1 4KG0A 2CGOA 4A7YA 1Q56A 4BISA 2VXJA 4XAEA 4XDOA 4COZA 4AI2A 3DCQA 3ST7A 3E6BA 3I3DA 3FJSA 4XFBA 5DAPA 1TEIA 2NMOA 5DZEA 1RXFA 5IVYA 1GLHA 2F17A 2J22A 3B94A 3WR0A 1PK6B 2KD7A 4D7YA 4HN0A 2GU9A 4Q4X3 4QKDA 1H4HA 4OYUA 1REEA 3CJIB 1MS5A 1W6QB 2WZPP 5C9AC 1Q8QA 1QNYA 3SISA 4M4PA 2R062 3EO6A 3Q9OA 4WM7C 4JRLA 1H8TC 3ZN4A 4N90A 1XJAA 3POBA 5A6ZA 4QXHA 2W1WA 4E2GA 3KM5A 3ZYRA 4URAA 2PMWB 5JZGA 4IEXA 2KM2A 1C8NA 4DXSA 1RHI2 3ZXKA 3POIA 2AEZA 1JTZX 1NXD1 4L92A 1UOGA 1NLQA 5DUUA 1UIKA 1SBFA 2YY1A 5BNOA 2VC9A 5FZ6A 1JUHA 4QX0A 1W6NA 1V6LA 4YZ1A 1C3HA 2JD4A 4UW5A 1NA1A 3W5NA 3DPRC 4A6SA 1BEV1 5F3GA 1LGNA 4J25A 3HOBA 3RYPA 3TN91 2XWBB 1SZBA 2OZJA 1BXHA 2VBBA 3GYDA 3WSOA 3WY6A 1DQ0A 4NMIA 1IG0A 4QDQA 4QHZA 4RN5A 3ZSKA 3ACGA 4BYYA 1J59A 1NLRA 2I74A 3WQBA 5BNOC 5AVPA 5K0UC 3NV2A 4K20A 3ECQA 4F8AA 2VW0A 5JZGC 1FATA 1RUI3 3HQUA 4Q0QA 1ZX5A 1OLQA 1Q8VA 2R1BA 2Q8CA 1F4HA 1G9AA 1ZREA 5FZ7A 3J26N 1T2XA 3POJA 5BNOB 4XQDA 1W99A 3AL6A 2F6BA 3VBFB 2DVFA 5FY8A 4KGGA 4DINB 1R1A2 2R042 3K4AA 2VQTA 1RHI1 3OYWB 5J98B 5T52A 2BBVA 4E2QA 2ZHKA 2FDGA 3TYJA 2RMU1 1J58A 2W47A 2XVGA 2VULA 1LHVA 4YGCA 1S4CA 1SDDB 3IMNA 1RUE3 4GJZA 2XH6A 1WLWA 2JE8A 2G9FA 2RS11 1UY4A 2VH9A 2Y8KA 3AXDA 2PHWA 3MIFA 2ATFA 3PUHA 5IWFA 3WHUA 4AOCA 2RR12 3GBWA 3HT1A 3U0ZA 3VBHC 3OBZA 3DXTA 3DN7A 3MIDA 5FMCA 4BCUA 1KXGA 4JQTA 2RJKA 2E7AA 3MW4A 5L9RA 4A45A 4BIOA 5IVBA 4OI0A 1XB9A 1SPPA 1BBT1 2ZZJA 4FPGA 2XDVA 2Y33A 5I91A 4Q4W3 1SFPA 3ME2A 1D0GA 3SHRA 5C4WC 5KXEA 5LA0A 1TME3 3HAGA 3WCSA 3T1LA 2AEYA 4DMIA 3GJAA 2EIGA 1MZFA 3MFCA 3LA7A 5C71A 2AGSA 2BBAA 1XBFA 2YHJA 4XJZA 1CJPA 4UAPA 3ZDSA 4CDQC 3J7HA 4CDWC 5JIUA 2DURA 1X8MA 1GICA 3MUY1 5FPXA 3DEMA 3FFZA 3IPVB 4A3XA 1OMIA 3LDBA 1DF0A 2XR4A 3NJZA 2R32A 4MGSA 2J1AA 1UQXA 4LBMA 3NNGA 4AEDB 2WFF2 4KU8A 4ZU5A 3E5QA 4QPGB 3KCXA 1AL21 1RUD1 4XXPA 4PJYA 1YQ2A 1CN1A 2ZZQA 4NPRA 3HNYM 1VBE1 4QX2A 5K9YA 5J48A 3RSJA 1EPZA 2ORZA 4Y33A 4CDXB 4O65A 3CDZB 2V4AA 3LQCA 4FPKA 4EV0A 5L73A 4HT1T 4AHWA 2RDRA 2CU5A 2D3RA 2W94A 2BGCA 3AYCA 4CUCA 1JZ4A 1X82A 4YVWA 4N9HA 4BQ1A 4MGKE 1IG3A 1Y9MA 1Z7S1 4W50A 4YVSB 4PHZA 2YYOA 1MEC2 1V6NA 2D97A 2WQZC 5A32B 4CEWA 4AI1A 1RVF3 1AHSA 4L0PA 2KR2A 4OI2A 1ULCA 1AYN1 1OQ1A 1ZA4A 2PHFA 3T2TA 4AF9A 1DGRA 1EV13 2BWCA 1RUH1 3USUB 1V6JA 5EXOA 5GLTA 4EYUA 3N4MA 3D82A 2D6OX 1S0BA 1UPSA 3J4UH 3HWJA 2X53S 1TMF2 2C9KA 1CD3G 2CWMA 2VGDA 2HEVF 4LUKA 1OA2A 3ZFFC 1W39A 4DB5A 3WW4A 1PO11 3V0BA 1QU0A 2QQWA 3VLBB 4GALA 3ITQA 1KD7A 3RZLA 1VAKA 3ALQA 4BA6A 1VBA3 5FZDA 5L7OC 5FPAA 1U5XA 3G6JB 3RRDA 1CZTA 3ZFGA 4MHUA 1RTVA 2VZOA 1LESA 1FX5A 2RS13 4XFHA 5DQ0A 3WDWA 4P9IA 3BCWA 4JCKA 1PNGA 4AQ6A 1UZWA 1YRZA 3AFKA 4OUEA 3U75A 5EV7A 1BK0A 2QZ2A 1LHUA 4JRAA 4EJRA 2VCBA 2ZGSA 3LDRA 3JB8A 2ADDA 3POEA 3OGRA 3LEIA 4EN0A 4F83A 3I2DA 4A6OA 3WF3A 2A3WA 3ZFFA 1LHOA 1WA4A 3W5MA 3I3MA 1W03A 3AFGA 5FYVA 2R49A 3O5SA 2ZAHA 3VBSA 4CSWA 5ANQA 1JHJA 2VMFA 3UKNA 4OZXA 2Z2SB 1ZBE2 2PAKA 1IQDC 2PTMA 1V9U3 2X29A 5EYYA 3WOGA 3NJYA 4PIYA 3O1PA 2VU9A 2P3JA 3WQ0A 2IZWA 2LTNA 5ACA3 5D2AA 4Y1YA 3ZFGB 4NAOA 1W6MB 4GZ9A 4GKXA 3P5BA 2VMGA 5M0TA 1S0JA 1B35C 4Y26A 4KH9A 3OY8A 5FYSA 2CHHA 3B01A 4GWMA 1RUF1 2D7FA 2VD7A 4QQ2A 5DAVA 1NZCA 3CQOA 3AKQA 1I1EA 5K4LA 3LOIA 3WW3A 1DGWX 1QJFA 2VE1A 5FMOL 5FZKA 4OHZA 1QJX2 4AZZA 5C3SA 5LW9A 2FDKA 1DP0A 3IT8A 3ACLA 4OQ8A 1PIV2 3VBSC 2NPIA 3PUSA 5F37A 1S2EA 1NCQC 1W9TA 3I2FA 3M3EA 4XBNA 4PQQA 3RZGA 4BK4A 4WVVA 2P37A 3B5LB 3S5QA 2ZGKA 2CDOA 1UX6A 3CKHA 3PJQA 2VW1A 2B9VA 3OEBA 2V4VA 1OD3A 2WKKA 4G3YC 3SQOA 1BYHA 3EHKA 3QH7A 3T3YA 3WUDA 3WZ1A 2QQOA 5FPLA 1VP6A 1XE8A 4BJ0A 5T5JA 4DOUA 4XETA 1I6XA 4BU2A 3V0AB 1R64A 4HSLA 4L8QA 2RS31 2WBKA 4L11A 1W9FA 3OUJA 1JYTA 3TB0A 1EV11 3VDDB 3I2IA 3AC0A 4K8FA 4OVEA 2JDAA 4MZUA 1UXXX 1QXRA 4XF0A 2X05A 4Q4Y2 5I0RA 4BMBA 5IJRA 4YLZA 2NLRA 5LK7B 2ZGQA 2A7AA 5L7OA 2ZGNA 2R071 3EMRA 1DLCA 2ZX0A 3LE0A 4AWDA 2Z42A 3EB7A 4FQ4A 3WDXA 1GOGA 4HBNA 2OUJA 3IIAA 5FQ0B 2XXZA 3QACA 3W58A 5JSOA 4FPJA 5FO9B 5IVVA 5A3WA 3SCFA 4Q0UA 2VQ0A 4OZOA 3SCHA 1Y4WA 4LBQA 4ONUA 1G9CA 2BOIA 1HKDA 1UU5A 2NP0A 4IE7A 3OEAA 3SXWA 4IV3B 1YYNA 3DYPA 3APBA 2G9GA 4LULA 1F35A 5CNAA 5BXXA 3BPZA 4HONA 1OKQA 1W6PA 2HBTA 2WO3A 3MW3A 3MI8A 2W52A 1BBT2 3AMMA 5LK5A 4RS5B 2AR6A 4MSVA 4W4ZA 2C5DA 2WLQA 4AQSA 3SEEA 2Z4FA 4M0NA 4UT5A 3WNNA 1CZSA 3ELNA 4RSUA 5FLIA 1XRUA 2E26A 2GALA 1DFQA 5GZGA 4P9GA 2A70A 3M3IA 3I3EA 4DXRA 1APNA 5C70A 4Q2FA 2P3IA 1NYWA 2B8MA 3N36A 2NYYA 4TWTA 2DCJA 1LGCA 1WZXA 2GC0A 2XL9A 4IGQA 5A80A 3W9AA 1CVNA 1ENXA 3LB9A 4MO3M 3AMHA 5F6LB 5CG8A 2DU1A 4IQPA 1JW6A 3ZIWA 3WDVA 3A23A 3OF1A 3OGSA 2WT1A 4Y1UA 3BI3A 4HLTA 1QJZA 1A8DA 3AKTA 1ACCA 2YBPA 3SNMA 2XVKA 3UJQA 1W6OA 2PFWA 3VBFA 3NAPA 1OFNA 5C3QA 1QJY1 4Q4X2 1F4AA 1NCQB 2EIBA 3WW2A 4CCCA 2LALA 5F1RA 2IVJA 4TYSA 1RYYA 3VBSB 4YARA 5JOYA 1D4M3 2VOTA 3QBQA 1Q8SA 3D6EA 1KRIA 2GN7A 3BOWA 5A7QA 1LOFA 2OXBA 3HQXA 4BQYA 1ZBE3 5FP9A 4JC1A 1QQP3 2NMNA 3AYDA 3DV8A 4HKLA 3HN3A 4AHYA 1W06A 1XSQA 4OLLA 5CU1A 1SLTA 1ZRIA 2Y34A 2BVBA 4B4RA 4XMAA 4Z07A 1I5PA 2QCSB 1OUSA 3PHMA 1O4TA 1VB4A 4H2AA 2WS93 3O1UA 2D40A 3LA2A 4OI4A 1REFA 2W95A 4NJ4A 2GMEA 4PLMA 3PMEA 2VVDA 5KR7A 2LUWA 2QVSB 3JCIA 5LRRA 2YBKA 5C5TA 1UIJA 1W8ZA 1DYKA 2AZ5A 4MGZE 4UFHA 5JWPA 2Y6FA 2O8QA 4LLFA 3OPZA 3D0SA 1K45A 1J1TA 3AB0A 2OVUA 4SLIA 2R073 4K3UA 2XMLA 3MIHA 4QU1A 2Q8OA 3AMNA 4RA0A 5LASA 1UF2C 1JBCA 1W2OA 5CVRA 3O1TA 4FPFA 3RWKX 1WMEA 1OKOA 5A33A 2A6YA 3O0XA 5A3UA 2FCTA 5L9VA 1YNAA 2ZHLA 1IHMA 1W2TA 2R16A 5LBFA 3VBUB 1IS3A 4CEWB 3OBTA 5E16A 1GZCA 3ON7A 4GB33 4AVVA 4YZ4A 4BDVB 4YFZA 2VOXA 4ZKTB 1UY0A 2JECA 3VHOA 2XLGA 5LEKA 4S2HA 1GQPA 1OOPC 1CAXB 2GNMA 1DLLA 3Q8FA 5BPXA 5C33A 1CAUB 3BN6A 2JG8B 4DY3A 2WT0A 2WJSA 5IK4A 3EYPA 1MS3A 3THDA 4XMIA 5FYYA 1ULDA 2ZX3A 1F5JA 1CESA 1HN0A 1W8TA 1PX4A 2EVXA 3CLPA 3GM8A 4ISRA 4Q4V1 5IUQA 4CU9A 5JI7A 1JYCA 4BLJA 5HXMA 5FDBA 4ZHNA 1RUJ1 1JYXA 3BGAA 3PIJA 3ZN5A 3N9LA 1ASJ3 1ULOA 3ZN6B 4AI8A 2W0XA 1E5RA 1ULPA 2W08A 2YU1A 2FDFA 3NKTA 1EY2A 2UURA 5FJKA 4IEQA 2JG9B 2FZ1A 1HX6A 1O4YA 3BOPA 4YGEA 1BHGA 3IPVA 1C1LA 2VOWA 4QB6A 4XIOA 5KHJA 5IHRA 2HJIA 5J1XA 1R093 4LPLA 2AACA 3ZXLA 2QQVA 4CDXC 1FT9A 2QDRA 4PDWA 4BE3A 2WQ4A 3WQ7A 1JZ5A 2ARBA 4CU7A 4YM3A 3O1RA 1ZYBA 1GNZA 2YB7A 1JZ7A 1GNYA 5FY1A 3OJBA 1H6YA 3R05A 2XUEA 3WUCA 3AJYA 1GOHA 1HDKA 2ET7A 5CIRA 5KC5A 4GKYA 3VB9A 2WNUA 5C4WB 3T4VA 1KEXA 4JTOA 5GJ6A 1QXJA 4QPIA 1ODMA 3IDBB 4DFSA 2HBUA 2VNOA 2CNAA 1BK1A 1GR3A 2PYTA 4G9SB 5IT6A 4YM1A 4XJAA 4LO8A 4B1MA 1AR71 3VHNA 4YZ2A 2XGXA 1AX2A 3IAPA 1O91A 3PVBB 3ENRA 3ILFA 2WA4A 2W1SA 4LHSA 2ZCWA 1NZIA 3WNKA 2B4KA 4HETA 2HWD3 2I07B 2WFPA 2WINB 5FYTA 4Q4W2 2ES3A 1MVEA 4L2NA 1IKPA 4XQ4A 5FYMA 3ZXFA 1NY72 3OYWA 1XNKA 1ZZ6A 4Q0PA 3NSTA 1OQEA 1QDOA 1OVPA 2BFUL 3PJYA 4KG8A 4AE2A 1Q3EA 3ZYFA 3BTYA 1JOPA 2ID4A 1WLDA 2VZVA 4O9EA 1HQLA 2CDPA 3AYEA 3J8F3 1AR62 1GV9A 5F6KA 1QNWA 3ZSJA 3VBHB 2CY6A 1SBDA 1X9TA 2RS52 1H1AA 4R9BA 4I2OA 1UD1A 2CGNA 3N7JA 4FTBA 4PCRA 1OOPA 3M3OA 4Q8LA 4Y22B 2A75A 1OF4A 5AC92 4LO5B 2P6HA 1C5IA 1BMV2 3Q8BA 2DCTA 2YMZA 4HVOA 3GBFA 5T5PA 1D7PM 1RVF1 3SC7X 2WZ8A 1VBA2 2FMYA 2YV8A 3MUZ1 1RXGA 1NA1B 1VBC3 3J7LA 4XABA 1UYYA 4GA9A 4LMFA 1PVC2 1G7YA 4NVPA 2JKXA 2ZGPA 3H7JA 3RJRA 5F7UA 1GMMA 1GOFA 4OHXA 2LS6A 5FLHA 4X8NA 3RYRA 4J1XA 3WDYA 2XUMA 3QH6A 3HBZA 3PUQA 5F3CA 1CAVB 5KBFA 1VBA1 5FZMA 1ZBA1 4I01A 1CIWA 2JD9A 3B7MA 1LGBA 4WM7B 3MIGA 4C1XA 2G19A 1JHNA 1HJFA 5F5IA 5GLVA 4CUGA 5A70A 4ASMB 2ZMNA 4C0BA 3LSDA 1QOTA 4C91A 3FN9A 5GZDA 2PHUA 3VZKA 5D8AA 4ATEA 1QOSA 4FCAA 4RGGA 1XYPA 2WS92 4QT6A 1XYOA 5GLUA 2GMMA 2ZGRA 1W3XA 5CFDB 1EAH1 2Y6LA 4X6RB 5DABA 4P9JA 1ZZBA 4CDUB 3MFAA 4E8CA 3ZIXA 1HRV1 3BTZA 1JOBA 1KJLA 2GZWA 4GWNA 5C9AB 1ST8A 2P3YA 3I97A 4FTSA 2WFF3 1AL22 4NIIA 4XFIA 3VKFC 1AR72 2BRTA 2Q4SA 3K48A 2B5HA 4NHKA 5I8YA 2HWE3 3MV01 2B45X 5FWJA 5D8AC 2J7MA 1HJGA 2V73A 2W39A 4O9GA 1VBC2 1OA4A 4OMCA 1J84A 2Q1FA 1GU3A 4XF1A 4D7TA 4DEVA 2WO7A 2DCKA 4IEUA 1D4VB 1MS8A 4DXTA 3B93A 4Y20A 2KXLA 4Q4X1 1KDMA 1OPMA 3KB5A 1EP0A 4YW1A 4AFAA 4HFSA 2QQIA 2E63A 1GZTA 4H55A 4RL7A 5BY5A 2J1TA 5J96B 4FPHA 4JDNA 4L97A 1NCRB 4R4XA 4UF0B 3THCA 3WT3A 3C2UA 1US3A 1WMDA 4QGNA 1PM7A 3RG0A 1UZ0A 5FZOB 2D5HA 3OPWA 3CO2A 2OPWA 4MV2A 1ND3B 2H0VA 2IFWA 2VNRA 3LF7A 4I02A 3R4DB 1RUD2 3BALA 2WA3A
chains in the Genus database with same CATH topology
4N53C 4ES9A 2ZJCA 5T50A 4XIKA 1FMD1 4QPIC 4GH4A 3SITA 1OOPB 4Y22A 5FO8B 1WD3A 1M06G 4I3PA 4YZ3A 3X29B 3FFQA 5KHIA 1CGPA 2PLV3 3VBUC 2R1DA 3M1HA 3H3UA 1IZ3A 4RD7A 1ZZCA 4WV8A 3TNQA 4XJWA 2H6BA 4D69A 4EN7B 1CAWA 1Z0HA 1ZBA3 3MLKA 1SLLA 2DVGA 4WZCA 5JPNB 4RHV1 3VBUA 1ULGA 3WP3A 3S6PA 4Q0VA 1ALYA 4XILA 2XJPA 5I8SA 1UKRA 2YC0A 4XBLA 1RUG2 4WM8C 2AUYA 1RGSA 1NQDA 1JOJA 3VZJA 1IGOA 4CEYB 5JLVA 3AMQA 4YFWA 1YIFA 4PLNA 2XPJA 1HRV2 4P9YA 5EJ3A 1FXZA 1HRV3 1RINA 4QQHA 4LHKA 4QMAA 2O8OA 1SFYA 1EAH2 1D4M1 1YO8A 5J3UA 4CEYC 1UZYA 3KT1A 4C1WA 4AHXA 1O3RA 4YVWC 1XU1A 2FQPA 2YROA 2IXIA 4NOTA 4WM8B 5AC93 5E89A 1O5UA 4HKWA 4M3CB 3SH4A 1LODA 4XPVA 1GKBA 5EFUA 3MDPA 3U4XA 3ZFEB 1PIV1 2VOVA 2ZGUA 4QGMA 3ZN6A 5HBAA 1UMZA 4H14A 2QE3A 1UKGA 4AI3A 1SACA 2NZ9A 3AZXA 1LB2A 1W6OB 3V64A 5KXCA 2VOKA 2BPA2 2CV6A 4XF9A 2UWAA 4AFDA 4MX3A 4XQWA 1NG0A 4HK8A 3VKMA 1BKZA 4OUMA 3IBMA 4CRQA 2D6MA 1S0EA 1LEDA 5I0SA 4Y1VA 1A6CA 4IEYA 4IV3C 1NE4A 4N53B 4E9KA 1VIWB 2YDEA 1H2KA 4MXVA 3FUQA 5JR7B 4R9CA 3VHPA 4M01A 1BZWA 3MYXA 1YJLA 1H8TA 2E7QA 1AR81 5FMOS 4LO6B 4ORFA 1ZNPA 3VZLA 2G4IA 1D0HA 1BBT3 4OHVA 4AQTA 4XDQA 4HZFA 1ZVFA 1CPNA 4Q4W1 3RDIA 3RJ2X 2Z5WA 5DDJ1 1YFXA 5JDBA 1UU6A 2EXJA 3ES1A 4QM9A 2VY0A 1TNRA 3ZSLA 1AX0A 4QGLA 3QCWA 2IXCA 5I8TA 2R0FA 4AFMA 1DGRN 5D8AB 1MVQA 4N53A 1ENQA 3QOPA 1ENRA 1FV2A 1PVXA 1RUH2 4A2UA 5K0UA 5IK5A 5T54A 1PGL1 1AYN2 3QLQA 3N7KA 4QX5A 1AYM1 3AZVA 5J7MA 2XHKA 4I0AA 1HIXA 4AHZA 1IS5A 1CAVA 2IC1A 5JAXA 3NWKA 4YGBA 1UU4A 3VN4A 5BNNC 1AXZA 2P3KA 5CFDC 4AVAA 1QHDA 1HXS2 1SLAA 1MS9A 2PAEA 1D2QA 4N7IA 4FP3A 2D6NA 2EXHA 1URXA 1LOAA 1Y43B 5BV6A 3UV9A 3H8UA 1POV0 3WXPA 3SH5A 3H9AA 2VUJA 3VBHA 2BQPA 4M3CA 3HT2A 3MIEA 4GB31 1QJX1 1G9BA 4Q26A 3QD6A 1KJRA 4QPYA 1RUH3 2VVFA 1NLSA 2E6VA 4Q1RA 5DDJ2 2WSVA 1GZWB 4QQLA 4YSFA 2A73B 4Q4V3 1LU2A 3WP4A 1S2BA 4FSJA 2ZBJA 3GHMA 2VNGA 2GAUA 3DL3A 3HR9A 1MZ6A 3KQRA 1H4GA 1DQ6A 2HWE2 1G6NA 2XJUA 2MEV1 3AP6A 4INDA 4AEKA 2ZKLA 5TSWA 5C8CA 3PTYA 1WCDJ 1PGSA 3MLJA 4WVWA 4DPNA 4AXOA 1C5HA 2BYVE 5JOZA 1LENA 1LOEA 3JU9A 3S7IA 1R091 2IXKA 3KT4A 3VDDA 1GANA 1UAIA 2IXHA 2AREA 1D4M2 1N1YA 4AVCA 4AGGA 3S0MA 3D0JA 1IOAA 1TE1B 2TNFA 4KWLA 2ZMKA 3AZZA 1HXS3 4PDWB 3V0BB 3FUOA 3VBRA 1S0GA 3L2YA 4I30A 3TAYA 1TMF1 1WW5A 1HLCA 1RUG1 1AR73 3FBYA 4YGDA 1RUF3 4C90A 1K5MC 4RQPB 5GM0A 3KSCA 1DGLA 2I45A 3M2MA 2PN5A 5KHKA 1Y9QA 1ZRRA 1N1SA 1IS6A 1EPWA 3BU7A 4V1PA 2PLV2 5T55A 3WHTA 2XVLA 2GNDA 5H9PA 3M3QA 3J8F1 4CDXA 1OQDA 1GQGA 4MXWB 3ZMNA 2HWB1 4H3WA 4LBNA 4Y24A 1RUC1 4CEWC 1IQAA 1H1IA 4MGIE 5C6CA 1ZZ7A 1GSLA 2RM21 3GZTB 3ILRA 4MGYE 4CP2A 1AR91 2HKXA 4N7UA 1G8WA 4AVSA 4IV3A 4FVVA 2GH2A 4JDOA 4AGVA 2EAAA 2JG8C 1RUI1 1GFF2 1AR63 3J8F2 4BIFA 2CTVA 4LT5A 2EALA 4FXGB 1BQPA 1OD5A 2DCZA 3ZPYA 4XHBA 1YFYA 1VBD1 1TNFA 1SMVA 5GKAC 5FOJB 3MW2A 2NQYA 3DKWA 5GZCA 1QDCA 2RMU3 3DGTA 3FWEA 5GALA 4KWKA 2TUNA 5C8CB 1LOBA 3WP5A 1QGLA 4M3CE 4XFCA 4XOGA 1OFSA 5LEJA 2UWCA 4IV1B 3H1YA 4K1ZA 5CBLA 5IK7A 4NN0A 4F7ZA 1MACA 4WVZA 1CAWB 5BUVA 1I9RA 1KDKA 4JGYA 4E2SA 3D5OA 1B35A 1B09A 3USSA 1WCKA 2DF7A 4EROA 2X5IB 2PLV1 3HMYA 3RPQA 1QQP2 3DF0A 1L3JA 1WCSA 2QDNA 3WLUA 1CR7A 3H50A 5GZFA 2BNNA 5H9SA 3WDTA 5FFOC 1V00A 2A6WA 1LOFC 1RMU3 1RJ8A 3KD4A 4LE4A 1DU3D 3NV3A 4RS5A 2X5IA 5CA6A 3ZXGA 4AEMA 3I4IA 1XQNA 3VBOA 4I0BA 3CNAA 3WG2A 3ZXAC 5HCBA 4KNCA 1PK6C 3UKTA 1XNBA 2VMIA 4GMP3 5HXVA 3S30A 1DHKB 2RE9A 3A4UA 4FOYA 3MZHA 2WS91 1Q8OA 1WW7A 1QMJA 3CEWA 3CJIA 1UCXA 4YG0A 4NHLA 5EYXA 1ZZ9A 4PIZA 3UL2A 1LR5A 1H8VA 1AR93 1AYN3 3ES4A 1AJOA 1AXYA 2WZR3 2RS51 2DVAA 1AR61 3VBOC 2ZABA 1ZRFA 1Z78A 5DZFA 4AFBA 1VRH2 1MS1A 4E4SA 1DDLA 4AW7A 1RUJ3 3SMHA 1AZDA 3PLQA 1DBNA 5JI9A 3VL8A 3AKRA 1VJ2A 2DVDA 1SEFA 1J3RA 4C0HA 1X33A 1PGL2 3LA3A 1F8VA 2WLPA 1Y7BA 2O0OA 4BPZA 2JG9A 4UW6A 4COYA 3L2HA 2VECA 1OHFA 1DGWA 1CPMA 2YXSA 3W59A 1C28A 3MPBA 4BMEA 5J09A 1AR83 3VKOA 1N3QA 2JDZA 3VUOA 1SCRA 2HWC2 3GF6A 1H9WA 2YGLA 4YVWB 2VUAA 2WNEA 1RJ7A 4IL7A 4N43A 2KA3A 3R4UA 1SCSA 4LBLA 5FAXA 4YZ5A 1FNZA 1QH7A 5JVVA 5IK8A 3KT7A 2BNMA 3U10A 3URFA 2RR13 1WGPA 1N47A 2HWF2 2MPFA 4UBHA 2ZAAA 3FE5A 4S2DA 5CB7A 3ZSEA 2X5IC 1OI6A 3N7LA 2GC2A 3MGUA 1RL3A 2OA2A 4WVMB 5KXDA 1V9U2 1PGW1 3VKLA 2D5FA 1AYM3 2TEPA 1PK6A 4XJ9A 3V56A 3JBG1 3FZ3A 1ZZ8A 4X8PA 2JICA 4RHV2 1QH6A 4QQOA 1KS5A 1SLBA 4D3WA 2D6KA 2VQAA 2ENRA 1C8M2 1HRI2 3NW4A 1N3OA 4OI1A 1LOCA 1XYNA 3I59B 4GULA 4LBQD 2DYCA 4Y5Z0 5K8SA 3IWZA 2QKDA 1RUI2 3N35A 4CYDA 2DUOA 1MQTA 1KQRA 4PBPA 3CU7A 1ONAA 1V70A 2IFRA 1ULEA 5DG1A 4TZDA 4WBBA 3PVNA 2WFF1 1G86A 2GNBA 2VXRA 1O3SA 5GLZA 2OZ6A 2BTVC 4B4QA 5T5LA 2OPKA 4Y1XA 4D7SA 1YIPA 3GZUC 4IXLA 1S0IA 1U12A 3TNPB 5T5OA 3FMGA 1YHFA 4R4ZA 2WL1A 2HWF3 4P9LA 1H2LA 3TBDA 2Y0OA 3AP4A 4EWAA 4L9BA 3ILNA 3LSEA 4Z82A 2D3PA 3CF6E 1I5ZA 4QHBA 3VL9A 1DQ2A 4Q0SA 4QM8A 1SQ4A 5FOBB 3DUIA 3NV1A 1ND3C 4ITCA 3ZFEA 4GH4B 1VR3A 1FOD3 3TN92 4HSJA 3ZX7A 1A3KA 3WV6A 1TME1 5AFBA 3VBRB 1Z7S2 4NR1A 4JTNA 1IPJA 1UL9A 3SCGA 4DRVA 1FPN1 2JE9A 3AYAA 1FPN2 2DFCA 3GBGA 3IDCB 1BVVA 1VBE2 3UKVA 1BCXA 1QJU3 4PDWC 2IWGB 3VKNA 1SDWA 1LHWA 3RZZA 1U0AA 3HN1A 3HD8B 4M0HA 4FT8A 4CEYA 1FMD2 4YNIA 1J3PA 2HWC3 4EN6B 2ZGLA 1DQ1A 3ETQA 2D6LX 1V6IA 2MEV2 4LHLA 5KC6A 2FMDA 1C1FA 1C4RA 2HWE1 4CDWB 1VBD2 2B9UA 1R082 1GYKA 3R6SA 3VV1A 1FNYA 4P14A 1HRI1 1COV2 3CJXA 5BNNA 1SFNA 5JIAA 5FBZA 2XJVA 2UYAA 5J37A 3JQWA 1NA1C 2RM22 3AP7A 3B9CA 1DZRA 1POV3 2RM23 2ZGTA 4RR3B 3JBG2 3PVEA 3SLIA 3OD0A 4COUA 1VB2A 3I7DA 2PHDA 2Y0IA 5HCAA 4JGZC 3BODA 5JSPA 3L9JT 3R4SA 1PGW2 2MHFA 2RS12 1WW6A 1AJKA 4WM7A 1X8EA 1NCQA 4LBOA 4RR3C 3H0OA 2RS32 1WD4A 2AENA 1LCLA 4XFAA 2WT2A 2ZHNA 1HXS1 3LAGA 4HL0A 1AXKA 1JN2P 3JD71 4ZU7A 1C8M1 5J36A 1RUG3 1WMFA 5I0TA 5JZGB 2QQPA 2K2SA 1AYM2 4JGZB 2OUHA 1YI7A 5K0UB 2D93A 4FP2A 4Q1PA 5EZWA 1JUIA 2ZKNA 1VBD3 3A0NA 2ZX1A 2BEOA 5LRSA 4RHV3 3I8TA 4RR3A 1V9U1 1RMU2 4W65A 4COWA 5EWSA 4IEPA 3CJIC 1I3HA 4Q4Y1 5KWRA 1AUYA 2D43A 1W0PA 2Q5TA 4JAAA 5SV5A 4CZSA 5H9QA 1J1LA 4KGQA 4RGAA 1H1MA 1WBLA 2W68A 1H0BA 1OA3A 4LBJA 1PVC1 1QOOA 1H8TB 4YM2A 1MZ5A 1MZEA 2WNVA 5CFDA 1LRHA 3U07A 4CDWA 4LTAA 3IM0A 2ZGOA 5DDJ3 3JB4C 3VBRC 3IDEA 3THTA 2ZX4A 1M4WA 2VPVA 2YZ4A 3ZMOA 4J6GA 1BMV1 3PMSA 2OYZA 3USUA 4IEVA 1Q43A 2GNTA 4FAGA 3FC0A 1DQ5A 2XJQA 3P3NA 4GH4C 4LR4A 1Q8PA 4QQPA 2ILMA 2ZA9A 1DIWA 1MS4A 4LNVA 2GSYA 2WNUB 3D8CA 4UW4A 2JJ6A 5C4WA 2QUOA 2Z69A 3WG4A 3T1MA 1ZM1A 1V6OA 3V0AA 1WLCA 3BTAA 4CP0A 5DZGA 1XE7A 3VZOA 2JG9C 1ND2A 3M4FA 4D94A 2XG3A 1GNHA 4NHMA 4MH0E 1YJKA 4XXAA 3ZYIB 3GZAA 3N3HA 4FOWA 4YG6A 4QPGA 1PO23 5ACA2 5JCTA 4AEDA 1PZ7A 2E53A 2DTYA 1KFUL 2ZMLA 1T6GC 4OFGA 4KBBA 3NL1A 2GC1A 2B7YA 3TN93 3KGLA 4WM8A 1S55A 2NN8A 4B3NA 4FPEA 3KCYA 4Y4YA 4R8HA 1FV3A 4FPYA 3ZFEC 1ND2C 4FBFA 1RITA 2E9QA 5AVAA 5CADA 4ES8A 3I59A 1NCRA 1W6MA 4EN8B 1GQHA 1XNDA 4LLOA 1FI2A 2A3YA 1ZRCA 1VLNA 4JGYB 5ABJC 2A6VA 2DUQA 2F4PA 1VBB3 5K7PA 5A33B 3P3PA 1RMU1 1O4ZA 1V6MA 4XFGA 1ULFA 2QJVA 3FHIB 4Q4Y3 1BVP1 2MEV3 1H2NA 2WNVC 4ATFA 1X7NA 1DYPA 2DU0A 1YI9A 1Q5OA 1YWKA 1LULA 5DUVA 1U5ZA 1FAYA 1MEC1 5L19A 3GALA 4I0WB 5JOWA 3ZXDA 5BNPC 1SLCA 1MQTC 3RQ0A 4W6YA 4ZXKA 1MR5A 1R081 3MF6A 1VAVA 4XJ8A 3KCCA 4FOQA 4N43B 1C57A 3AM2A 3WW1A 1IKQA 1GZ9A 2EXIA 3O14A 1DQ4A 3FLRA 4R52A 3NVCA 1DZQA 2BFUS 3LCPA 4B7EA 2RR11 2JEMA 4TSVA 4MLOA 1LOGA 3RS6A 4EWEA 2Q1MA 3GNEA 4IETA 3H1WA 1ND3A 4J1WA 4LBKA 4Q4V2 5CFCC 3KGZA 4OHYA 5F5QA 2RMU2 4YRDA 4B4PA 1AL23 2CAVA 2XBO1 3V65A 1O7FA 1VBE3 5KHHA 2DUPA 4EWDA 3O7OA 3KMHA 4K1YA 3IKWA 4Z92B 2Z79A 4AQ2A 2X8KA 3PVOA 4RS5C 4OUSA 4AYUA 3RMXA 2UYBA 2CL2A 2HEWF 3OCPA 2HWB3 3M7AA 2XJTA 2Q30A 3ZYJB 1FOD2 1RUC3 1E57A 1W6PB 4M3CF 3K51A 1BEV2 4KWJA 1ASJ2 1EV12 3A0KA 2WIIB 3VDDC 3ZVXA 2XL7A 2SBAA 4WZFA 2GH8A 3POSA 3WG1A 2UY8A 2PHXA