3VKLA

Protease-resistant mutant form of human galectin-8 in complex with two lactose molecules
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
289
structure length
289
Chain Sequence
b'LSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSHMRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galectin-8
publication title X-ray structure of a protease-resistant mutant form of human galectin-8 with two carbohydrate recognition domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 60
structure length 289
sequence length 289
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA01
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vklA02
3OYWB 1QDOA 3V64A 4XIOA 1DQ5A 1LHOA 1ULGA 1HLCA 4YZ4A 1N1YA 1G9FA 3OBRA 4AGVA 2DVGA 2LALA 1OFSA 3FLPA 2WSUA 5CA6A 4YZ3A 1Q8OA 2WQZC 2A6WA 2ZGLA 1MS1A 2D43A 2DU0A 3FBYA 5L73A 3JUUA 4AGGA 1FNZA 3WLUA 1SLIA 3RMXA 4PBPA 4DPNA 3WG2A 2CY6A 5T50A 3M3CA 1D2SA 4JRAA 5KXBA 3IM0A 3PVNA 1NXD1 2BQPA 1KQRA 1J1TA 1H9WA 2YZ4A 5IK4A 1QOOA 4H55A 1Z0HA 1C1LA 3ZYRA 4YM3A 1LHUA 1JBCA 2DVAA 1N1SA 4YW5A 5JDBA 2DUPA 4FP3A 3ILRA 1I3HA 4SLIA 4XJWA 4LBQD 4YGCA 4BOWA 1LGNA 3AZVA 4AWDA 1LULA 4FPFA 1ULDA 4FQ4A 1CONA 2FHRA 1TEIA 1CPMA 1W6NA 1S0GA 1WW7A 2AYHA 2ZMKA 5T5LA 1JYIA 1PZ8A 1UL9A 4M3CF 5IUQA 1LU2A 2D6OX 3POWA 3WHUA 2WJSA 1G7YA 3RMYA 1V6NA 1LOGA 5GM0A 2P2KA 1FNYA 5DZEA 4Q8LA 3AZXA 1Q8QA 1MZ5A 2CYFA 5DUXA 4FP2A 1YO8A 1LOFA 1W6MB 1DQ1A 4L8QA 4XHBA 4YM2A 2ZBJA 2E53A 4AVTA 3WDUA 2R49A 2A6XA 1V6LA 1ONAA 3B00A 3B01A 1GZWB 2P37A 1MACA 1LENA 1LESA 3ZSLA 1SLAA 5H9SA 3KM5A 3W58A 1IS5A 1WBLA 2GNMA 2PHWA 2DYCA 3N3HA 4P9XA 1QNWA 2DV9A 5E8AA 4YGDA 1HDKA 2D6NA 1SFYA 3QCWA 1WW5A 3NV4A 4ITCA 1Q56A 2W39A 2P3JA 3IPVA 4LBMA 2WT2A 4XXPA 5DZGA 2ZZJA 4ZXKA 4YW1A 1LGCA 2GNBA 3HMYA 2Z42A 4WV8A 1WD4A 2PHRA 1MS9A 3MW3A 4K20A 1WLDA 4GWNA 4PBOA 1WLCA 3ZPYA 2DUQA 1QOSA 2P3KA 2ZHMA 4ATEA 1AX2A 1CN1A 5GLZA 1AX0A 1SCSA 4XZPA 3USUA 3V0AA 2ZAAA 2GMPA 3ZSKA 1G9CA 1MS8A 2UU8A 4YGEA 3INAA 1EPWA 5JOZA 2YY1A 2UWCA 3NV2A 4DQAA 4DS0A 1S1AA 1SBFA 1KJRA 3ZVXA 1S0IA 2C9AA 3R4SA 1JW6A 3ZXFA 5F9TA 5T55A 1DZQA 1C1FA 1LOAA 2NP0A 5CBLA 2E6VA 2VW1A 1FV3A 3ZSMA 1AX1A 2GN7A 2JD4A 1JYCA 2EXKA 2ZACA 3BOPA 1O4ZA 2JE7A 4Y1UA 3WDWA 2ZGPA 4CRQA 4YW4A 4Y24A 1W6MA 4WVVA 5DZFA 3VUOA 3AZZA 3O5SA 3OPZA 5CAZA 1GZWA 4FPOB 1ENSA 4PF5A 1Q8SA 2LTNA 4R9AA 2D7FA 2E7QA 3N7LA 5T54A 2ZHKA 5GLTA 1FV2A 4C1XA 1CVNA 4KBBA 1CIWA 1LHVA 1QKQA 3POYA 1UN1A 1IOAA 3ATGA 1D0HA 2ZMLA 2GMMA 4M00A 3AP6A 2OVUA 3VV1A 1CPNA 1QNYA 1S0FA 1LEMA 4XIKA 1V6JA 1R1ZA 1ULEA 1KRIA 5T5PA 3C2UA 2AH2A 3AJZA 3RRDA 1UPSA 2ZGOA 3N36A 1B09A 2WSVA 2PHXA 4Q2FA 5DUWA 3WG3A 3ZXKA 1WUVA 2DTWA 2JECA 2YXSA 1W6OB 3LSDA 1VALA 2PHTA 1MS5A 3MW2A 1SLTA 1Y7BA 4K1YA 4RL7A 1I1EA 3AZWA 1A3KA 2CWMA 4HANA 3OGGA 4FQZA 4WZFA 4AVSA 4DFSA 4DRRA 1ENQA 2VXRA 2H0BA 3SH3A 4PQ9A 3IPVB 3POSA 4XXAA 2I2SA 4UW5A 4MYEA 4RA0A 4GXLA 2ZHNA 5EYYA 2TEPA 3WDTA 1H9PA 3NWKA 1YI7A 3M2MA 3IMNA 2EXIA 2ZKNA 3U4XA 3ZXEA 3MW4A 1MR5A 2CTVA 5JOXA 4XDQA 5GZFA 2GMEA 3M3QA 3USUB 3UK9A 3V0AB 3AP7A 5DUVA 4LBNA 1GKBA 4LBJA 3R4UA 1AXZA 2XG3A 2A5ZA 2NZ9A 3AJYA 3SITA 1N1VA 2DTYA 3A0NA 1ULCA 4FOYA 3AYAA 3DUIA 1N3QA 1VAVA 2A7AA 2ZMNA 3CNAA 1CQ9A 1ZA4A 3GALA 2ZGUA 3BIWE 3ASIA 1KITA 5DUUA 4HL0A 5GZEA 3T1MA 4Z8BA 1KDMA 3BTAA 3Q9OA 2EALA 2ZA9A 1W6PA 4XBNA 5HCFA 1JOJA 1YRZA 1LOFC 2EXHA 1GICA 4XJAA 1O4YA 1SLBA 2EAKA 2DU1A 3AP9A 4XOGA 3HR9A 1DYKA 1U0AA 2OUJA 1W6OA 4PCRA 5F5QA 3VKOA 3AXEA 1IS4A 4GALA 4F83A 2R16A 4P9YA 1V6MA 3OJBA 2R1BA 4YG0A 4ISRA 5GZCA 1MS4A 4XBQA 4XJZA 5JMCA 5DXDA 5GZGA 5GLVA 2V5YA 4LBOA 2A75A 1DQ2A 2EIGA 4Y22B 1BXHA 3PJQA 4CZSA 3A0KA 3UJQA 2DVDA 2A6VA 1G8WA 4Y1XA 4M3CE 3V65A 3HN1A 1DQ6A 1FAYA 2D3SA 4BM8A 1WW6A 3ZSJA 4DRVA 4FOWA 1Q8PA 5IK8A 2SLIA 2ZGNA 4WVWA 5H9PA 1G9AA 4UW4A 3WCRA 1AVBA 1LOCA 2WNEA 2PHFA 2ZGQA 3RSJA 1F31A 4K21A 2RHPA 1XQNA 3WNXA 1GBGA 3T2TA 3A4UA 1BKZA 4U36A 4LBKA 3IKWA 2AREA 2D44A 4YG6A 2VU9A 1DLLA 4ASMB 1NLSA 5GLUA 3WUCA 1LHNA 3WZ1A 4NO4A 4Y1VA 1IKPA 5IK7A 1RITA 1DQ4A 3ZXLA 1QGLA 1S0JA 1DBNA 4Q26A 2UURA 2YMZA 1GYKA 3D6EA 4ATFA 2NYYA 2WT1A 3RG0A 1VIWB 3AYEA 1C4RA 1CR7A 1LHWA 1JUIA 5IT6A 4XHXA 1SLLA 2VH9A 4JCKA 4YFWA 2VW0A 1H30A 2V73A 2PELA 2ZGSA 3KQRA 4YM1A 1HQLA 4GWMA 1QU0A 3BODA 4W65A 1CESA 3ZYPA 3PVEA 2JJ6A 1BQPA 2ZGTA 3AP5A 1QOTA 2HYKA 2CWSA 3D5OA 1CJPA 1FX5A 4FOQA 4Y1ZA 1GNZA 3V0BA 2WKKA 5JLVA 3AK0A 2W52A 2ZGKA 3AP4A 1G9DA 2D6MA 2XB6C 3N7JA 4XJUA 4XJ8A 2ARBA 1VLNA 2DWRA 4BMBA 1QDCA 4Y22A 3GNEA 1GZCA 1JXNA 2B7YA 2GNTA 3WDVA 1W6PB 1QMJA 4CTEA 3WUDA 1IS3A 1AJKA 1ENRA 3FUOA 5FRAA 3MPPG 3JU9A 5HCBA 3W59A 3O12A 1V6OA 3LCPA 3QLQA 3RQ0A 1LEDA 1URXA 1MS0A 4FPEA 4UW6A 1AF9A 4ISQA 1AJOA 1N47A 1UX6A 3M1HA 2EXJA 3B3QE 3DGTA 2NN8A 3FLRA 2PHUA 5T5JA 1ZM1A 3N35A 3R05A 1FYUA 2W68A 3OY8A 4FPJA 5JOYA 1OKQA 5GJ6A 3B69A 1GANA 3D4KA 5GALA 1IKQA 5H9QA 1N1TA 4GKXA 2YROA 4R9BA 1DIWA 1V6KA 4LBQB 3I4IA 5JVVA 3FUQA 1DHKB 1SACA 5CNAA 4AGRA 2DVFA 2JDZA 4XJ9A 5E88A 4YW2A 2VY0A 1PZ7A 1GSLA 3SNMA 4FPLA 2EF6A 3AYCA 4FPYA 1BYHA 1DFQA 5DG2A 4P14A 4FPKA 1HKDA 2D3RA 2ZHLA 3H0OA 3WG1A 2GDFA 1G9BA 1DYPA 3WDXA 5EWSA 1RIRA 1DQ0A 2D6KA 1PZ9A 2WLQA 2A3YA 1GZ9A 3T1LA 3AZYA 1UZZA 5CB7A 1WD3A 1UMZA 3TB0A 4ZKTB 1LJ7A 4M3CA 4XBLA 1X50A 4D69A 3UL2A 2GALA 3O0VA 4Q1RA 1SBEA 1MVEA 2ZGMA 2P3IA 2JE9A 2UWAA 3L2YA 1OQ1A 1GLHA 2ENRA 3AX4A 1YYNA 1N3PA 5DG1A 4AYUA 4Y26A 5T5OA 4FOVA 1LU1A 2UWBA 1KDKA 1WLWA 5BYNA 1WCSA 1UZYA 1W0OA 2DURA 4YM0A 2VW2A 2OUHA 1SLCA 2ARXA 1Q8VA 1VAMA 2A6YA 1MS3A 5LK5A 3VKLA 4BLJA 4YLZA 3V0BB 1FATA 3VKMA 1LTEA 5GZDA 4YFZA 1SCRA 1A8DA 4BLIA 2A70A 2GN3A 1S0DA 2DUOA 1N3OA 3N7KA 2P34A 1HQWA 3O0XA 1W6QA 2C5DA 1BJQA 3AFKA 3ILNA 1APNA 4FPGA 4XMIA 2NM1A 1C57A 1SBDA 4LBQA 3PMEA 3VKNA 4BPZA 3OYWA 2ZABA 3O0WA 1GV9A 1S0BA 2ZGRA 4Y1YA 2ES3A 4K1ZA 2D3PA 2CL2A 3M3EA 4GA9A 1WBFA 3WV6A 2AUYA 4R9CA 5HCAA 1W0PA 3ENRA 4Y20B 3UJOA 1F5FA 3NV1A 5AVAA 4YZ5A 4I30A 5GLWA 3FFZA 5H9RA 1JN2P 3OY8B 4YZ2A 5JOWA 1AXKA 1WW4A 4YZ1A 2A3WA 3N7MA 4Q1PA 4XILA 5KXEA 3SISA 1JHNA 5IK5A 4Q8KA 2AGSA 1BZWA 4XMAA 1ULFA 3B9CA 3M3OA 1UKGA 1KJLA 2W08A 4GKYA 4R9DA 4U2AA 2A6ZA 4AVVA 1DGLA 4TZDA 5EYXA 1IS6A 2R0HA 2NMNA 1LOEA 5T52A 1LODA 1V00A 2CNAA 2A71A 2GNDA 3WG4A 3PVOA 4NOTA 2NMOA 1A78A 3SH4A 4BQ1A 3FLTA 2SBAA 1LCLA 2AR6A 5SV8A 1AXYA 2DVBA 2VUAA 1GNHA 3WVJA 4JC1A 2JKBA 4OZXA 4M3CB 1LOBA 4XTPA 4XTMA 2R0FA 4TYSA 3MEPA 1AZDA 4Q27A 2KM2A 3OBTA 1QF3A 2WT0A 2Q5TA 2OW4A 3I8TA 3IN9A 4P9WA 2E51A 3VKFC 3LSEA 4FPCA 4IQPA 2D6PA 2R1DA 3WOGA 1S0EA 4FVVA 1Z78A 1S0CA 2E7TA 3ILFA 4UW3A 2G4IA 1F9KA 1MZ6A 2YV8A 3AXDA 3NV3A 4LBLA 1G86A 4Y20A 4M01A 4YGBA 4BMEA 1YIFA 1V6IA 3WDYA 4YW3A 2AENA 1W6NB 1LGBA 2D6LX 3SLIA 4XYXA 3TAYA 5FREA 1UAIA 2FMDA 5KXCA 1MVQA 4YG3A 5KXDA 4XE9A 1YXWA 3AYDA 1RINA 2A3XA 4FPHA 5E89A 3SH5A 3APBA 2ERFA 5EXOA 1W6QB 3WHTA 3ZXJA 3RS6A 3WCSA 1LECA 4C1WA
chains in the Genus database with same CATH superfamily
2Q8CA 1QXJA 1QXRA 1X7NA 2WNUA 4FAGA 3POBA 5I0TA 3ABZA 4AI0A 1DQ5A 1KFXL 3SKJE 1O6UA 1W0NA 4ZS3A 2TUNA 2HKXA 3VBUC 1RHI2 4QKFA 1ACCA 1VR3A 1WCDJ 1Y9MA 3OBRA 4RGKA 3I49A 2X09A 2LALA 1WA6X 3K4AA 5FZ7A 1X8MA 4KGGA 3FLPA 2WSUA 4YZ3A 2DCJA 5L73A 2DU0A 3H3LA 4AGGA 2RE9A 2FDFA 4IL7A 4JGYA 3OD4A 4AVAA 2BZDA 2QNKA 3RMXA 4DPNA 4RN5A 3TN93 1UY3A 3I59B 1JODA 4V1PA 1RMU1 2YZ4A 3M3IA 5BNNA 4H55A 3T2QA 3USSA 4L11A 5LB6A 1UO9A 2GZWA 1LHUA 1ZBE1 3DECA 3VZNA 4YM3A 3TEYA 1N1SA 4BE3A 3LZZA 5JDBA 4FP3A 4A7YA 3U14A 1VRH1 3AZVA 2VGDA 4NRQA 1LULA 3U4SA 4FQ4A 3H7YA 1TEIA 4IEWA 1CPMA 1WW7A 3C7FA 5IUQA 1VB4A 1R091 2AC1A 5FIXA 3POWA 2I07B 1G7YA 3RMYA 1ODNA 1V6NA 2MPFA 1WA4A 3JZVA 1I5PA 2J1TA 5DZEA 3MICA 4Q8LA 1DGRA 1HXS2 2WZ8A 4FP2A 1X8EA 1YO8A 2X29A 3CLPA 1W6MB 1DQ1A 5I0UA 2FCVA 5LBBA 4AVTA 5JR2A 3CZUA 2Y38A 4JZRA 4GWIA 3B00A 4N9IA 2VECA 4IEOA 1MPXA 4S2DA 1RJ8A 1LESA 4HMZA 3DV8A 1SFPA 4AHZA 5H9SA 3KM5A 4CDWB 2VMEA 2C4XA 2MEV1 2QVSB 2WYSA 1WBLA 4LK6A 3M7AA 4AE2A 1OOPA 4S2HA 2EIDA 2QJVA 2PHDA 2AEYA 2D6NA 5A3TA 2W39A 1HRV2 4XXPA 5DZGA 1HN1A 2P6CA 2W94A 2ZZJA 3T3YA 1ND2A 2VZRA 5FZ6A 2D40A 2GNBA 3HMYA 1WD4A 4K20A 3MW3A 3W21A 1ST8A 2VZPA 4UT5A 2ZHMA 2G1MA 2WNUB 1JMUB 3K77A 3ZPYA 3CO2A 4CPBD 3J8F2 1XPWA 2XH6A 1AX0A 4XZPA 2BUKA 3USUA 2Y6JA 1L3JA 2ZAAA 3DXTA 3IT8A 3VLBB 5CISA 5FKCA 1MS8A 4K9SA 3MLJA 2YY1A 1OVPA 4L0PA 5LRRA 5A7WB 1FMD1 1E57A 3UT0A 2GP3A 1CAWA 1S1AA 1KJRA 1S0IA 4Q4V1 1S55A 3ZM8A 5FLJA 4DOUA 1DZQA 3AMQA 3U11A 5CBLA 1UU4A 4IE7A 4JGYB 4JKLA 1SHWB 2GN7A 3SCGA 4I0AA 5T3NA 1HXS3 4HETA 3ZFFC 2LUWA 4QX1A 3S30A 2FMYA 4Y1UA 5GKAC 3IDCB 2YFUA 2D5HA 5BNNB 3O1RA 1AYN2 2IXKA 4FFHA 3ETQA 3VUOA 1GZWA 1W3XA 2JD9A 5ANQA 1Q8SA 2W47A 3MF9A 1G6NA 4PQQA 3HNMA 4R9AA 2OYZA 3O1VA 4QX5A 5FYTA 4ASKA 3FWEA 5JZGC 1AR82 4RHV1 5FZ4A 4QKDA 5T54A 2HWF1 4GULA 4A2UA 3POYA 2GSYA 1F35A 2GP5A 1IOAA 2RMU2 1HRV3 5FY5A 1D0HA 3WNOA 5I0RA 2VNRA 4NJ4A 4GH4C 4QQPA 3T0DA 1JOBA 5FTTC 1UY1A 1VMJA 4P08A 4MOAA 5F37A 1JYWA 1S0FA 4L9BA 1BVVA 4QQLA 1ULEA 1UOJA 4PHZA 1KRIA 2PTMA 3HOBA 1K5MC 5B2GB 1JYVA 1UPSA 3WP6A 3N36A 1X9PA 3MHZA 4N53B 5DUWA 1RXFA 3CJIA 2JECA 1EP0A 3AKQA 3NJZA 3FBMA 1D4M2 3NNMA 2HWB2 1I5ZA 1I1EA 3AMMA 5FYCA 2WAOA 1OOPB 3G7DA 1VBE2 1B35A 4WZFA 1IPSA 4QPYA 4DFSA 5LBFA 2H0BA 3WD5A 3WEZA 1JTZX 4PQ9A 4QX0A 2KXLA 3L2HA 3POSA 4XXAA 4JGZA 1AR72 4XF4A 4H7MA 1RGSA 4GXLA 5D8AC 4OZOA 1DP0A 5EYYA 5C4WB 1PK6C 4A3XA 3NWKA 5KBFA 1YI7A 2VD7A 5L36A 2WN2A 2F4PA 1AYN3 3MW4A 2I45A 3VDDB 1CGPA 2VTXJ 5JOXA 1ULOA 4R4XA 4CCNA 3USUB 2WRAA 1W8WA 3IIIA 2ZX0A 5DUVA 4D6RA 2WZEA 5FPAA 2HEYF 3AJYA 1N1VA 3AYAA 4XVHA 5E1RA 4LLOA 1DDLA 5FZMA 1RUC2 2ZMNA 3D0JA 2RMU3 1GFF2 2Q8OA 2WZPP 1CAWB 1ZA4A 5IVCA 3G6JB 3W5NA 4ONUA 1W99A 1RUF2 4L92A 4QM8A 3ASIA 5DUUA 2DF7A 5GZEA 1NAEA 5K4LA 3MO4A 4Q0UA 4Y5SA 1BK1A 3BTAA 4CDUC 2CAVA 5ERLA 1ND3A 2VL4A 4UFKA 1C8M3 2EALA 4O65A 1X82A 1NE4A 1RUD3 2CU5A 1ASJ1 1GOHA 5CVRA 5J7MA 4Z82A 5DN2A 4IV3A 1UOGA 4MADA 4DUWA 1IPJA 1D4M3 2HWB3 1HJGA 3T0AA 1DYKA 3BGAA 5F5QA 4A6SA 2QZ3A 3S0MA 4CP2A 1IS4A 5LRSA 1IPKA 3J7LA 2JDMA 3ZLIA 1MS4A 1W8NA 3WP5A 2IXLA 3QD6A 4K7JA 2P5BA 3U10A 3ZN6B 2A1XA 1OFNA 1JUHA 4LBOA 1AR73 2JG8C 1DF0A 2A75A 1DQ2A 2LRPA 2JDUA 1W8FA 4OMCA 2JIJA 3VD3A 1UYYA 2DVDA 2A6VA 4Y33A 4PLOA 4OFGA 2XVLA 4K8FA 1AR62 3S57A 3POFA 1E5SA 1OA3A 3GZAA 3POIA 3WQ1A 4FOWA 5IK8A 2RJ2A 3S6PA 3LB9A 1LOCA 1SQ4A 2BPA2 1WMEA 4NROA 4JX0A 1WCUA 2VAUA 3HEIA 4HK9A 3KLSA 3A4UA 3I2KA 1RUC3 1BKZA 3VDCA 1PMHX 4LBKA 3IKWA 4A3ZA 4AXOA 1JZ5A 3JB8A 4RGGA 2I74A 3ALQA 4E4DX 1RUF3 3CBNA 1H6YA 1DLLA 1UU6A 3VZMA 4NO4A 4XC9A 1IKPA 2YPJA 4JGZB 1DQ4A 2W92A 5FZHA 1QGLA 2HYXA 2G9FA 3LE0A 4L99A 3QH6A 5FXXA 5FOJB 2UURA 1NXMA 2VQUA 2WT1A 1VIWB 1K45A 1CR7A 3AYEA 2C24A 2YGLA 4KG0A 4JRLA 2XWJB 4FFGA 2BNNA 1W04A 1RVF2 2VH9A 4NHMA 2HWC1 4IEVA 2VZTA 4YFWA 1H30A 5F32A 5FYBA 3WP4A 5FOBB 4YM1A 1W2OA 1HQLA 1NUKA 1QU0A 3OCPA 4W65A 5A1AA 2HWE2 2JJ6A 2ZGTA 4JAAA 1QOTA 2HYKA 3D5OA 1CJPA 3ORJA 1CIYA 3OGRA 2BNOA 5FAXA 1GNZA 4XF0A 4Q0VA 1VMHA 2BJSA 2JG9B 4HSJA 5LZ6A 4H2AA 2W52A 3AKSA 3ZYGA 3NAPB 4NUBA 2Y33A 4XJ8A 4QXHA 3J7HA 4BMBA 4LITA 1AR63 1QDCA 1DLCA 1ND3B 1TZOA 2B7YA 2DFCA 5DABA 3T4VA 1RXGA 3PIGA 1QMJA 1IS3A 3ZFGC 3H50A 1J3QA 1ENRA 5HCBA 3MPPG 3JU9A 3W59A 1QJY1 4GD4A 1TG7A 1OURA 1CWPA 4ISQA 2QQLA 1AJOA 3CDZB 2RDRA 3LIGA 2WZR2 4QPIC 4XFCA 4NIGA 3D3AA 3DGTA 2NN8A 3HQUA 3ES1A 3N35A 3R05A 1W8UA 4FPJA 3NO8A 4I0WB 3D4KA 3LA7A 1IKQA 4LIUA 5ACA1 2VTXA 5FZAA 2Y6LA 4N9HA 3EQEA 1C8NA 5APAA 2W1QA 2YPDA 4XF3A 2YROA 3UYJA 2VOTA 1UXZA 1CAVA 1DIWA 3K2OA 4W6WA 4W6YA 3I4IA 1KEXA 4M0HA 1RVF3 1O5UA 2Y6KA 4P02B 5BNPA 1W9YA 3WW1A 3CU7A 2O8QA 2RS31 4LIVA 4O9GA 1UY2A 2JDZA 4AGRA 2VY0A 1HB1A 1GSLA 2HWE3 4AI2A 1D2QA 1DFQA 2HBUA 5FR3A 1LB2A 3Q8FA 4FPKA 3VBUA 3VZJA 2N7GA 2ZHLA 2GDFA 3OOXA 1G9BA 4A7ZA 5HPOA 3MZHA 5I0DA 1O5LA 1PGW2 1DCSA 3WDXA 5EWSA 1J83A 2Y60A 4OMDA 2WBKA 4LE4A 1EAH2 4NR1A 4CU9A 3OEBA 3T1LA 1BEV1 5CB7A 3PU3A 1PGL2 1UMZA 4ZKTB 4XUTA 1T6BX 4XBLA 1RUG2 3GF6A 2G19A 4Q1RA 1YFYA 2VOXA 3AMHA 4QWNA 1GLHA 1YYNA 1N3PA 3FMGA 1QJX2 4AYUA 4Y26A 3T2PA 1RUI1 4D8MA 3O1TA 4RYDA 4GMP1 4N53C 4XFAA 4BXFA 1NZCA 2QUOA 4XCAA 1WLWA 1WCSA 2DURA 4YM0A 2WZR3 4FO9A 5JWPA 4YARA 2ARXA 4FTEA 1W2AX 4BLJA 5LY1A 1PVC2 4BZ4A 1QQP1 5FZ3A 1PGSA 4YFZA 2VJXA 1SCRA 2F17A 2B39A 1ZNPA 2ZEYA 4NPLA 1A8DA 4XUNA 4BLIA 2JIGA 2A70A 2GN3A 2BWCA 4PI2A 4MH0E 5C4WC 3WR0A 1APNA 4FPGA 4LT5A 1OH3A 4XMIA 2BOJA 4CU7A 2W0XA 2VNOA 3O0WA 1GV9A 1S0BA 2ZGRA 4P9IA 4Y1YA 2ES3A 4XFIA 3VDDC 4GA9A 3OBAA 3C3VA 5HXVA 2PXJA 4UFIA 3K48A 5C71A 5HCAA 5HBAA 1A34A 2VZQA 4NRMA 4XACA 2OX0A 1DZRA 5C5TA 5A7NA 4AFMA 2AEZA 1NCRB 1CZSA 3LPFA 5GLWA 5JXJA 5JOWA 1EAH3 1AXKA 4CEYA 4OHWA 3TEZA 4WM8B 1AL0G 4N43C 5JXHA 3VBFB 2XONA 1RUG3 1FT9A 4BQ5A 4Q8KA 1XB9A 2AGSA 2CAUA 1YFUA 1MQTC 5A33A 3M3OA 1KJLA 4JHTA 5LATA 4AFCA 2WFPA 4U2AA 3WSOA 1QJX3 5A3WA 3KHCA 4B29A 2R0HA 4CA9A 1R081 1WLTA 5FZGA 2CNAA 5CFCC 2W91A 3PVOA 5FJKA 3MYXA 2KR2A 3SH4A 4BQ1A 3FLTA 1PVC3 3UGGA 2X05A 1UCXA 1LCLA 2BFUL 2AR6A 3LKJA 3H1WA 3ZYFA 2VUAA 4XFBA 5A6YA 4AFBA 4R52A 3WVJA 4BXSV 4OZXA 3H42B 3L9JT 3O7OA 3I2JA 4QX7A 2FBEA 1AZDA 2JKXA 3MF6A 3ZFFA 3DKWA 1J59A 1GP6A 3BALA 3NNJA 3POEA 4Q27A 4UFHA 5FPLA 2HH9A 2QQOA 1QF3A 1RUJ1 2PFWA 3GYDA 3MIHA 2Q5TA 4O7XA 5M0TA 4LR4A 3IN9A 1H8TC 1RMU2 2E51A 3VKFC 3LSEA 5BNQA 3O1MA 1YCIA 1S0EA 1H2LA 3BPZA 1NZIA 2CGPA 4FVVA 5FP4A 4MGKE 1ZBE2 2E7TA 3AMPA 5JPNB 3VBOB 1F9KA 1M4WA 1FPN1 2YV8A 3AXDA 5FLHA 4BQXA 2Y0IA 3CKHA 4M01A 1COV1 2J22A 1VRH2 1W6NB 5D1IA 4IETA 3SLIA 3AKRA 5IATA 1O8SA 5KXDA 4QKNA 1POV0 2E9QA 4X8PA 4GH4A 3BCWA 4COUA 2XKOA 4HVQA 4AVCA 2P4EA 3ZXDA 1JZ3A 1GWKA 3OSDA 3RS6A 1K5MA 2ZX1A 3T0BA 5IWFA 2RJLA 3E6BA 4AR2A 5FP9A 2GAUA 1QDOA 2YC0A 4NPRA 2R071 1VJ2A 1LHOA 2QDNA 4HK8A 4LOTA 5FZ0A 3UGFA 1HLCA 5CZKA 2Y64A 1N1YA 1Q43A 1ZRIA 2VCBA 1G9FA 3PUQA 5EJ1B 4AGVA 3T2OA 2MEV2 1BHGA 3THDA 1XNBA 4MGQA 2JG9C 3B94A 1Q8OA 2AZ5A 2ZGLA 4G3YC 1S4CA 2XJPA 3NAPC 4E8DA 5D8AA 5CKQA 1GZTA 2XJRA 3D8CA 1PK6A 2VUDA 3M8LA 3Q8EA 3WG2A 4ARYA 2CY6A 1H2MA 5T50A 1TNFA 5JI9A 5CU1A 1L7RA 1OBNA 3PVNA 5HI0A 3RNSA 1O3RA 1RMU3 2BQPA 1H9WA 1Z0HA 1C1LA 3RFRA 4JDNA 2Z69A 1ZBA2 4Y4YA 2Y6HA 4CU8A 1ZBE3 2QE3A 4RQPB 2DVAA 5ABJB 4PIYA 4YW5A 3DL3A 3SHRA 5I93A 4SLIA 4LBQD 4YGCA 3WNKA 1VRH3 1LGNA 4MG2A 3JQWA 3KV9A 3MGUA 5EJ3A 4AHYA 1W9SA 1CONA 2FHRA 5BNOC 4MUVA 2ZMKA 5FZFA 4M3CF 1LU2A 3THCA 4Q4V2 4G4FA 4CDQB 1C5HA 3DYMA 4CDUA 1LOGA 5EFUA 2P2KA 3ZFFB 4S2FA 1NCQA 1Q8QA 4NN0A 1MZ5A 2CYFA 2G9ZA 3EBRA 4E4ZA 4XHBA 4YM2A 2NLRA 2ZBJA 1O3TA 4IGPA 4XAEA 3GCWA 2A6XA 1V6LA 1JYXA 1XE8A 4JTNA 1QJZA 2P37A 4LHKA 5JMOA 5FZOB 1LENA 3ZSLA 1SLAA 1VBA1 5JZGB 2MEV3 5FYZA 4A41A 2W5FA 1RUE1 2PHWA 3N3HA 1OLQA 4RHV2 1XRUA 5E8AA 1SFYA 3QCWA 2XWBB 3Q8BA 2JG8A 2FZ1A 2ZZQA 5FUIA 4E2QA 4LBMA 2WT2A 3ZYIB 2HWD1 4I01A 1OXCA 3BTXA 2JDAA 2ZX3A 1K5MB 1WLDA 4GWNA 3NKGA 4ATEA 1GNYA 4Q4X2 1ZBA3 4IEQA 4IGQA 4P9JA 4LEJA 1QJU1 1RTVA 3MDPA 2EICA 2GMPA 3ZSKA 1G9CA 5LA2A 4K6BA 1HB2A 4CCKA 1XJAA 4YGEA 4E4HA 1JYTA 3INAA 3JCIA 3RZHA 1EPWA 4S2GA 3N4MA 4LXLA 5FZCA 1FMD3 3VBSC 1TNRA 3ZVXA 4URTA 4Q4V3 1S2EA 3R4SA 3ZXFA 5F9TA 1BMV1 5FUNA 5D8AB 4NAMA 2VW1A 1FV3A 1JYNA 4Y5Z0 2JD4A 1JYCA 4YW7A 5CADA 3F95A 3BOPA 2VR4A 1YNAA 2B5HA 1W6MA 4WVVA 2AACA 1ZZ8A 4COZA 4OVEA 1U5ZA 3AZZA 3O5SA 3OPZA 5CAZA 3BPSA 1VP6A 2QQNA 4FPOB 4LO4B 3POGA 3GJAA 3N7LA 4RHV3 4RS5C 5BPXA 4OULA 5GLTA 3THTA 2FDIA 1LHVA 1QKQA 1UN1A 5A6QA 1H1AA 2ZMLA 2YGMA 4M00A 5FP8A 1F15A 4WM8C 2VZUA 3B7MA 2OVUA 4QDRA 1CPNA 2FQPA 2ARAA 5FZLA 2DFBA 4XIKA 1V6JA 4YYOA 1O4TA 2RR11 3GZTB 4P9GA 3I2OA 4Q4X3 3ZFGA 5DDJ2 1B09A 2WSVA 4KU8A 2Z4FA 3WG3A 5IVBA 3SQOA 3LSDA 3E6DA 3GBGA 1J58A 1MS5A 3HNYM 2IZWA 4RL7A 1SPPA 4XAAA 5B4XA 4OQ9A 2Y0OA 5AC91 5KHJA 4TLGA 3ZXAC 4JHZA 4QPIA 5JSPA 3AZWA 3BB6A 4B8EA 1XYPA 1A3KA 4HANA 5FK8A 4K40A 5A7WA 1PO11 3E97A 1ENQA 2JG8B 2EAAA 3CMGA 3SEEA 5LASA 1OMIA 2ZEZA 3ZN4A 3KT7A 4EQVA 1STMA 1YEWA 3I54A 3WDTA 4LKSA 1KXGA 5EHDA 4BQYA 3M2MA 5LA1A 2BVVA 1REFA 4PLMA 2GH8A 2ZKNA 5JPMB 1RUH1 3PU8A 4QHOA 5EJZB 2CTVA 4XDQA 1YI9A 2GMEA 2JE8A 2XQXA 3UK9A 4QT6A 3AP7A 4LBNA 2BU9A 5JCTA 1AYM2 1CD3G 1HV1A 1VPHA 2K9ZA 3SITA 2YUEA 3DUIA 2EIEA 1N3QA 4IE0A 1F4HA 3VBOC 1VAVA 4AW7A 2A7AA 3CNAA 2FD8A 5A7SA 4QAWA 3GALA 1YQ5A 2ZGUA 3BIWE 4ZHNA 3K4ZA 4HL0A 3WQBA 3T1MA 1KDMA 3AL6A 1LAJA 4E4SA 2WWJA 4MXWA 4B7KA 1H8VA 3JD72 5DDJ3 3LEIA 3VZOA 5IJRA 1YRZA 5BUVA 2WNVC 3RZMA 1EUUA 1O4YA 1SLBA 2HWC2 4N53A 4XOGA 5C3SA 4Q29A 3UV9A 3BIEA 3OPWA 4GALA 1XNAA 2E31A 2R16A 2IFWA 1PO21 3AKPA 3OJBA 2WUHA 4IESA 4ISRA 4XZUG 4E9KA 1W8ZA 3W9AA 5TSWA 5KHGA 1KS4A 4BHPA 1W2UA 1UY0A 2VUJA 4QHBA 2VZSA 5GLVA 3WINE 3B5LB 1UMIA 4NIDA 2L9LA 3A21A 2IXJA 3O1PA 1ZRDA 3CF6E 3LOBA 1BXHA 3WP3A 1MEC1 3PJQA 4LUMA 4OI4A 4QX2A 2ZS6B 5FYYA 4CZSA 3LOIA 5C4WA 5A6XA 3HN1A 1DQ6A 3ZFGB 4P5HA 1WW6A 4AEDC 3OUJA 4DRVA 1Q8PA 5A3PA 2SLIA 2ZGNA 3VDDA 1G9AA 1CJDA 3WCRA 1AYM3 2JX9A 1ZRFA 1O59A 1QWRA 1QJY2 2PHFA 1SPPB 2ZGQA 5IFPA 4LOSA 2Q4SA 4K21A 1CZTA 4QPIB 4RQPC 5FXWA 3T2TA 4HSLA 5ABJC 1AR91 4U36A 4PLNA 3PHMA 3URFA 3PDQA 4IE4A 4MLOA 4CYDA 5K7PA 4ASMB 3MBWA 3U0ZA 3S5QA 1YQCA 5EPAA 3WZ1A 4N43A 1RITA 3U37A 4ORFA 3JD73 1MQTA 4CDQC 1DBNA 1NQDA 5ACA2 4ATFA 3D6EA 2NYYA 3RG0A 1LHWA 4CEWC 1SLLA 5FZBA 4EE2A 5FZ8A 3T09A 2HWC3 3KF3A 2V73A 2PELA 3KQRA 2E63A 2RS32 1EYBA 3OGVA 2DBNA 5F3GA 3TOJA 4F7ZA 5K9YA 1XOYA 3UKNA 5CFCA 1X33A 2CWSA 2R062 1W8OA 1FX5A 1UIKA 5IVEA 3E6CC 1U5YA 2QDRA 1Y4WA 1F8VA 4CCOA 3ZN6A 2XR4A 2ZGKA 3I2IA 4GB31 1TVGA 1WMXA 2QZ2A 2QQMA 1BEV2 2J1RA 3OBZA 4MXWB 2ARBA 3H1YA 3TNPB 2DWRA 1NOVA 1ALYA 3O1SA 3GNEA 3M4FA 2QQIA 3WDVA 3V56A 1REDA 4D3WA 2P3YA 2X53S 4A6OA 3FUOA 1C8M2 4E2GA 3U78A 3MUY1 1V6OA 1H8TA 1RUD2 1UOFA 4LULA 5FPZA 3RQ0A 1QJY3 4AZZA 5CFDB 5L9VA 4AQ2A 2XJQA 1RUI2 4FPEA 4LE3A 4UW6A 2YC4A 3CEWA 2CGOA 3E5UA 1W39A 1N47A 3HT2A 3M1HA 2EXJA 3CZJA 2YYOA 2CHHA 1PIV1 2E32A 3WW2A 1GOGA 1WMDA 5T5JA 4AQSA 2YBPA 2C6SA 3KB5A 2W68A 3OY8A 3ZO0B 2VE1A 3HBKA 4ASLA 5A70A 1W90A 2RVAA 5JOYA 1QQP2 5GALA 2CV6A 4NPMA 4KU7A 5H9QA 2B4KA 5ACA3 3VZLA 2RS11 3ZMOA 4GKXA 3SCFA 3NVCA 2R30A 2VZ1A 2XJSA 1V6KA 4LBQB 4Q4Y1 2B46X 5DAWA 3VN4A 2FCTA 4H7LA 2RS33 1SZBA 2DVFA 3IMMA 4NHXA 4XEZA 1PZ7A 3SC7X 5F8PA 4A42A 4FPLA 2J1VA 1VBD1 2RDQA 5I8YA 2E26A 2R063 4P14A 1ZZ9A 3TNQA 1NLQA 3RGBA 4W4ZA 5I8SA 3P5BA 2Y8KA 5IVFA 3KT1A 3VD5A 3ZFEB 1YUDA 1BBT1 1PZ9A 2JG9A 4N43B 3DXUA 1GZ9A 1BEV3 3KCCA 3ELNA 4UBHA 5L19A 4HOOA 3NAPA 5F5IA 5L7OC 1AL21 1MQTB 3WF0A 2VCMA 3PJYA 1RYYA 1SBEA 1MVEA 1HB3A 5F7UA 2P3IA 4MGZE 5JI7A 2UWAA 2PHLA 3ZIXA 1UKRA 2LROA 4AI1A 4UF0B 5DG1A 1WGPA 1RUI3 2WS91 3KGZA 1LU1A 3HJRA 4GMP3 3TYJA 1KDKA 5CFCB 4C0BA 2Q1FA 2VBDA 1UZYA 2VMIA 3HBZA 1R082 3HAGA 5BYNA 1RB8G 2W2IA 4NHLA 5LWBA 2W3JA 4L2NA 1F2NA 3B9IA 4GMP0 1ZREA 1MS3A 4DXZA 3ES4A 4QQOA 2BP6A 2NPIA 2RDNA 5BNOA 1QQP3 4A45A 2GC3A 2UYBA 3LA2A 5IAXA 4PT6A 3I7DA 3QBQA 4CCDA 1OLRA 2BV4A 4QB2A 2WWUA 4Y3OA 1S0DA 2DUOA 4XPVA 3N7KA 3IIAA 3O0XA 4Q5OA 1BJQA 4J6GA 5D2AA 3LIHA 1L7QA 1SBDA 2HLEA 2Y34A 1DU3D 1H8TB 4YSFA 1H4GA 1ZX5A 2PQSA 1OHFA 1W9TA 2CL2A 3M3EA 4Y4RA 2KA3A 3WV6A 1GOFA 1RHI1 2AUYA 1OD5A 1H2NA 1VAKA 3B93A 3K46A 3AC0A 3UJOA 4DINB 2R7EB 5A3UA 4H3WA 4C8DA 4I30A 1FPN2 3GDBA 3FFZA 5H9RA 3OY8B 1VB2A 4DIQA 1COV2 1WW4A 4YZ1A 4B4RA 1VRBA 3N7MA 4Q1PA 3SMHA 2UYAA 5KXEA 5JSOA 2WLPA 1XE0A 3ZX7A 1YJLA 4QPGC 1CAUA 4K3UA 4QKBA 1BZWA 1XNKA 4XMAA 4BDVB 4KWJA 4R9DA 4GKYA 4CCCA 5J36A 4MGIE 4AVVA 3LA3A 3LEMA 2ZCWA 5FYUA 5A7QA 3WW4A 3E1F1 4TZDA 5EYXA 4CP0A 3LPGA 3ZMNA 4CUAA 3VD4A 1LODA 1R083 2R072 3ZDVA 4AAXA 4D7SA 3WG4A 2QTWB 1OC1A 4NOTA 2NMOA 3ZSEA 4F3JA 5F2WA 1UYZA 5I0SA 3VHRA 1QJEA 2WA3A 4Z07A 2QQUA 1AXYA 5ISLA 3I3MA 1GNHA 2Z2SB 5FCCA 3T30A 4LKEA 5F6LB 4CEYC 3B02A 4XTMA 2DCKA 4TYSA 4MXVA 1IG0A 3MIGA 1QHDA 5K0UC 5AFEA 3OBTA 2HEWF 2WT0A 4BK5A 1IHMA 3HN3A 4P9WA 3LEGA 5FYSA 3ST7A 4AHWA 4MV2A 1HRI2 3EXUA 4HVRA 3LD8A 5IW0A 4LNVA 4FFIA 3ILFA 2PAMA 4TLFA 4YVWC 3NV3A 2JICA 1FPN3 4LBLA 4YGBA 4RS5A 1COV3 5LEJA 1YIFA 1LKNA 4YW3A 2AENA 4NIAA 1NCRA 3WDYA 5BNOB 1K5JA 1UAIA 2FMDA 1HRV1 3PL0A 1YXWA 3AYDA 5KC6A 4WM8A 5D21A 2Z5WA 1W2TA 3VBFA 4JKMA 5EXOA 2WC2A 3VBHC 2ZJCA 3J8F1 1LECA 3MIBA 1V70A 1PM4A 4BIFA 2RS51 1AHSA 3V64A 2R073 2J1SA 4XIOA 4HLTA 4LMFA 3BU7A 1ODMA 1EPZA 1OPMA 3WNPA 2VQTA 2VOKA 4OYUA 2ET1A 4NMIA 1VBA2 4N8MA 2XOMA 2VMCA 1KS5A 1RUE2 2JXAA 3GGLA 5CA6A 4XFHA 5JUVA 2WQZC 2A6WA 1LNSA 4B7EA 2WO7A 2JB4A 3LDBA 1CAUB 1FNZA 3T08A 1S2KA 4PBPA 2EIBA 1U5XA 2HWD2 1J3RA 2E33A 1D2SA 3M3CA 4JRAA 4PF1A 1VMFA 4HKWA 4BISA 1NXD1 1WMFA 1KQRA 5IK4A 1W05A 5DAXA 3H8OA 1HRI3 2IXCA 3ZYRA 2WYFA 5CFDC 4HKLA 3POJA 5B4NA 1JBCA 4LKFA 1FOD1 1AR81 2P6HA 4HONA 1I3HA 2IVIB 2IXHA 4Z1VA 1E5HA 3VBOA 5C3OA 2Y6FA 3EYPA 3VBSB 5FYVA 3VBRC 5CEHA 1W6NA 2AYHA 1EY2A 5LBCA 1JYIA 4N7UA 1UL9A 4XUPA 3ACFA 1BMV2 2WJSA 5FDBA 3NNGA 4BJ0A 2BRTA 4SBVA 1FNYA 1Q3EA 1QIQA 2PN5A 4L8QA 4FXGB 2WNVA 4NHYA 1LRHA 2R49A 3DKQA 3WDUA 3OUIA 5BV6A 5C3QA 4E8CA 1ONAA 1YQ8A 2FCUA 3H7JA 4D6QA 5HXMA 2VXJA 4CUGA 5A1FA 3WW3A 1UYXA 1VBA3 1VBE1 1IS5A 3J4UH 4RS5B 1RUE3 4OI2A 4UXAA 3P1IA 2OKXA 4B3NA 5A3LA 3ON7A 3H3UA 4YGDA 1HDKA 3RDIA 4LLFA 3TEXA 3FFQA 4ITCA 1Q56A 3ZFEC 3VL9A 2PMWB 3IPVA 4ZU7A 2HWD3 4IEZA 3P6BA 2WWSA 2NQYA 1SDWA 4YW1A 1LGCA 4WV8A 5BXXA 2V4AA 2Z42A 2PHRA 3JQXA 3UETA 4EN7B 3R0RA 1WLCA 1UNBA 2RR12 1QOSA 2WABA 4AEDA 1NY71 1TE1B 5GLZA 2BOIA 1SCSA 1QJU3 3V0AA 1GWMA 2UU8A 4RQPA 3GHMA 4LHNA 5ABJA 5AC92 2JDNA 3N9NA 4EJRA 4DQAA 5J96B 5FY8A 3MV11 5HV0A 3UKTA 2C9AA 4XQ4A 1PO12 1JW6A 3RYRA 2NP0A 2WO3A 4AI9A 1C1FA 4CDQA 1ZZCA 1UX7A 4NE9A 3ZSMA 5IYYA 3BKZA 3I3BA 3KV6A 4UOJA 4RFRB 1O4ZA 2JE7A 4KGQA 3WDWA 1PHMA 2ZGPA 5A7PA 4CRQA 1RUH2 1SFNA 4AFDA 2V5DA 4GQ7A 2B9VA 3E5QA 3RZJA 3EB7A 5EIYB 4KG8A 1U5IA 4PF5A 4CCJA 5FZOA 2LTNA 2J1EA 3CL1A 4JVAA 4YRDA 1Q5OA 4MHRA 5JZGA 1POV3 2ZHKA 3ACGA 1FV2A 4C1XA 4DY5A 5FUPA 1CIWA 1UPIA 1UZWA 4R4ZA 4M0NA 3RVHA 2GMMA 3VZKA 3QOPA 3VV1A 2W1SA 2Z79A 4IE5A 4EZ4A 5FZEA 1CAXA 4W6XA 1R092 2BGCA 4N90A 1R1ZA 2X5IC 4ZXEA 2RR13 5FO9B 1JZ4A 2AH2A 3AJZA 4I3PA 3RRDA 2FZ2A 2WNVB 5FQ0A 4WVZA 3CJIC 4Q2FA 3SXWA 4RGAA 2DTWA 4WM7C 3ITQA 1W6OB 1PM7A 2DBIA 2PHTA 2PYTA 3KCYA 1SLTA 1Y7BA 3MW2A 4K1YA 3U75A 3IWZA 4BIOA 5AC93 1WWYA 3LFIA 4DY3A 1PO22 3BUCA 2CWMA 1FXZA 3OGGA 4FQZA 4AVSA 1OI6A 2Q8DA 1PO13 1ZRRA 2VXRA 4ZZ5A 5K8SA 1JU4A 4HPKA 5FMOL 3IPVB 5FY0A 4C90A 4DZGA 2IVJA 3I97A 4UW5A 4RA0A 2OXBA 1MEC2 4DXTA 1H9PA 1H4HA 3FC0A 3IMNA 1OF4A 1WKYA 4AEDB 1RUH3 3ROUA 3U4XA 3ZXEA 4DEQA 4QDSA 1W06A 5GZFA 3NNFA 2VVDA 3M3QA 3R6SA 4QB1A 2WL1A 5A3OA 1NQJA 3V0AB 5FXZA 4DNYA 4LBJA 3R4UA 1AXZA 1XU2A 3WQ7A 1XNTA 4PJYA 5E16A 4B4QA 5C3RA 2NZ9A 4IW3A 5IVVA 2DTYA 1ULCA 3EO6A 4MGSA 1XSQA 4ES8A 1AR92 2ZX2A 3H9AA 1GU3A 3H8XA 3AMNA 3LDRA 1FMD2 3MIEA 5LW9A 3OGJA 4QGLA 2J7MA 4Z8BA 5A3NA 2P1BA 4TWTA 5L7OA 1R093 4P9LA 1UW8A 3LWCA 4UBGA 5CIRA 4I09A 3UNPA 2XUMA 4CEWB 4A4AA 4OUSA 4XBNA 5J98B 2O14A 1JOJA 1LOFC 2XJUA 4TXWA 1Z7S1 1GICA 1X9TA 5AFBA 2DU1A 3AP9A 3HR9A 1ULPA 2WZR1 2J42A 4F83A 5C9AB 1LR5A 1YQ2A 5FWEA 1PO23 4BQWA 4BA6A 5G04L 2E7AA 4QM9A 4KL1A 3WNNA 5J09A 2JWPA 2JENA 3KSCA 4I0BA 2V5YA 2HWF2 4OLLA 4GB32 1MEC3 4Y22B 2UY9A 3A0KA 3UJQA 1CAXB 5C8CB 4G9SB 1D7PM 3BTZA 1A8MA 4PIZA 1ZRCA 1NKGA 3V65A 1OUXA 1FAYA 3FN9A 4BM8A 3KHBA 3KT4A 3ZSJA 5FQ0B 1GR3A 4WVWA 5J1XA 2VVFA 4JDOA 2HBTA 3GM8A 4UW4A 3C7EA 1AVBA 1D4VB 2WNEA 2R6QA 3RSJA 3D0SA 3VHOA 3WF3A 3WNXA 4HN0A 1XQNA 2WR9A 1GBGA 3WQ0A 1AR93 2XPJA 4XUOA 4LKDA 3BI3A 2ORXA 2D44A 1PIV2 1JHJA 4HPKB 2OS2A 1LHNA 4XQWA 1AUYA 4Y1VA 2VCAA 5A1LA 1GQHA 4QPGA 4D7TA 3SCHA 1M06G 3K3OA 1S0JA 2WO1A 1R1A1 1W8TA 2VM9A 2YMZA 3AKTA 1GYKA 2RS12 3LDKA 4IEPA 4AEJA 5DMYA 5IT6A 1C4RA 2RV9A 1JUIA 3VL8A 5DQ0A 1HV0A 4MHUA 3ZYBA 1BVP1 4AOCA 2ZGSA 3EJKA 3OUHA 1V9U1 3RZKA 3DYPA 4QD2A 2VQAA 1UYPA 3LGRA 4NRPA 1CESA 1E5RA 4NVPA 4C91A 1BQPA 2VVEA 1VBD2 3LAGA 2Q1ZB 4UFJA 4GIQA 4IDZA 4AF9A 2DDUA 1P8JA 4Y1ZA 3ZPOA 3V0BA 1E5IA 2HWF3 2PA7A 3BOWA 1BBT2 1YJKA 2XLFA 3AP4A 4GB33 2HEVF 2W87A 2D6MA 2XB6C 3N7JA 4QXCA 5L7OB 1PVXA 2VPVA 2ZPXA 3HQXA 4LTAA 1GZCA 1AL22 1JXNA 4TTGA 4CTEA 1XSRA 3WUDA 1AJKA 3DPRC 4Q0QA 3C8XA 2O1QA 5FRAA 5FWJA 5FMBA 3LCPA 5KC5A 1ASJ2 3QLQA 2B8MA 2YU1A 4J1WA 1URXA 4P5YA 2WS92 1MS0A 4EN9B 2YBSA 1AF9A 1JOPA 4HKOA 3ZDSA 1UX6A 2IC1A 1OT5A 3OD0A 5F5CA 1T2XA 2C1FA 3B3QE 1W28A 1PIV3 3FLRA 4MX3A 2OQ6A 2PHUA 4O61A 5FJHA 5A7OA 1VBB1 2YFZA 3B69A 5LY2A 5FY4A 2BWAA 3UESA 4KWUA 2G9GA 1IQDC 5KHIA 3SKVA 2RS13 2VCCA 1N1TA 4R9BA 1OLME 3VBHA 1SEFA 1DZTA 4PDWC 4XF9A 4IE6A 3FUQA 1DHKB 4DUXA 1PNGA 4LORA 4ZU4A 4CDXC 4Z92B 2FDKA 3KZ4C 5FPUA 5FYHA 2EF6A 4RR3B 3AYCA 2R041 5EQUA 1VBD3 2B45X 1BYHA 2OZJA 2OA2A 3NNLA 4IV1B 4V2WA 5DG2A 4BQ4A 1HKDA 3J26N 4EYUA 3H0OA 3MIFA 2WAAA 4IEYA 4QHZA 5KWRA 2VMDA 1HW5A 1RIRA 1BBT3 2D6KA 4AQ6A 2WLQA 1O8PA 2IWGB 3AZYA 1UOBA 2BNMA 3C7OA 3NJVA 4HT1T 4M3CA 4QPGB 3TB0A 1AL23 2XL7A 3PTRB 5CKMA 2H0VA 4XFGA 4LJHA 4D69A 2GALA 3KF5A 1D0GA 5FK7A 4XCBA 2V4VA 2ZGMA 3AL5A 2JE9A 4D6SA 1OQ1A 2ZTNA 2ENRA 1TME1 3AX4A 1ASJ3 5FY9A 5CKNA 1ZZ6A 2WS93 5FZIA 3NJYA 2ZEXA 4RSUA 5T5OA 1JZ6A 4K8RB 5CFDA 4A7KA 4MVTA 1REEA 1OA4A 1UMHA 3DF0A 2Q8EA 5F3EA 2VW2A 1Q8VA 3HVDA 4I02A 4YVSC 2CGNA 1NA1C 4Q4W1 5FP7A 5LK5A 2QQVA 3V0BB 4LO8A 4EZHA 3VBRA 2BTVC 3VKMA 1OQDA 4INDA 4CEYB 4XUQA 4CSWA 2F6BA 1ZZ7A 2RM21 2XBO1 2VZVA 1HQWA 1TMF1 1W6QA 3EHKA 2C5DA 3AFKA 3ILNA 3WF1A 5K0UB 2VTFA 4QXBA 4LBQA 2GU9A 4B1MA 3VKNA 4BPZA 3OYWA 3O1OA 1XNDA 5F6KA 4WVMA 4K1ZA 2D3PA 3RZZA 2F4LA 1WBFA 2ET7A 4JQTA 1RHI3 4HXCA 3WT3A 3E5XA 4I2OA 4LHSA 4R9CA 3PMSA 4Y20B 4YVWB 1F5FA 3DYOA 2BYVE 3GZEA 4HN1A 4DXRA 1GQPA 2A73B 3LEKA 4CUCA 1SMVA 4BK4A 2JDKA 1H0BA 2A3WA 4XILA 3ZFEA 5BY5A 3NSTA 1JHNA 4I3GA 3VGIA 4EV0A 5JR7B 1BK0A 4CUBA 2W95A 3KD4A 5CYYA 1XU1A 3MV01 3VBHB 3H3ZA 2FDGA 3B9CA 2ATFA 5JIAA 4IUGA 4IEUA 4OCTA 2V72A 2BFUS 2C9KA 1YFXA 3S7EA 3IAPA 4D7YA 1NE6A 1T6GC 3WX5A 1DGLA 1PMIA 1ZBA1 2BDRA 3FHQA 1I6XA 1SG3A 3JB4C 1IS6A 4LUKA 4UF0A 2RS52 1V0AA 2WNOA 1V00A 3SEPA 1UIJA 2A71A 3RJRA 1JS9A 1OKOA 4QB6A 4XW3A 2K2SA 5C7GA 3N9OA 3QACA 5C9AC 2SBAA 1UY4A 2WFF1 3JBG1 4OHYA 2DVBA 1UQXA 4JC1A 2JKBA 4E2SA 2VMFA 3WNLA 1EV11 2J1AA 1LOBA 4M3CB 4XTPA 1VBC1 4UWDA 2R0FA 2B42B 4DEVA 1YIPA 4COYA 1KD7A 5C8CC 3J7MA 2DCYA 3J9SA 2PQQA 2OW4A 2YU2A 3AVSA 1ZVFA 4FPCA 4IQPA 4Z2WA 2D6PA 2R1DA 4XURA 5L9BA 4TN7A 2XHKA 3MI8A 3ZR6A 5DAVA 1Z78A 3IDBB 1S0CA 2XKPA 5DAPA 5LA9A 1RUNA 1GQGA 2XLAA 4BWOA 1FOD2 1MZ6A 2O8OA 3OTFA 4BMEA 1G86A 2RG4A 4JV4A 1V6IA 3TAYA 4KNCA 1LGBA 4J25A 3VBRB 3P3NA 4XYXA 5LA0A 3TWIA 1MVQA 2BVBA 1JH5A 3GCXA 3NW4A 4YG3A 4EN6B 1DG6A 2A3XA 3SH5A 1J1LA 3APBA 4Q4Y3 5J37A 2PLV1 3ACHA 3KCXA 1W6QB 3WHTA 5F3CA 2CDPA 2WQ8A 1OSGA 2X5IA 3M70A 4Q4X1 3J8F3 3WCSA 4GWJA 3OYWB 4CCMA 2GC2A 1BLZA 1PMJX 2RS53 1HQNA 3KS7A 4WVMB 5FMOS 4WM7A 4EWDA 1UF2C 3PIJA 1ULGA 4YZ4A 3GHNA 5KHHA 2DVGA 2W9XA 1OFSA 2MNGA 3LFMA 4NHKA 5C6CA 1UD1A 4FTSA 1MS1A 1HIXA 2D43A 3FBYA 3BTYA 2VOWA 3JUUA 3WLUA 1ND2B 1SLIA 2RDSA 3IBMA 1RL3A 3PVBB 4OHZA 3TN91 5KXBA 3IM0A 4NAOA 1FI2A 3CHXA 4AEMA 1J1TA 3FE5A 1GWLA 3MFCA 1QOOA 4OHVA 1NY72 3I2HA 3MIDA 4QU1A 4PIXA 5FMCA 4CP1A 1F5JA 1FOD3 1AR83 1JZ2A 2VNVA 1K12A 2DUPA 1PX4A 3ILRA 4XJWA 3KV4A 3NKTA 3TEWA 4BOWA 3I2DA 3NMBA 2Q0AA 4AWDA 4FPFA 1ULDA 3MUZ1 5AVPA 2ILMA 4AI8A 4QDQA 4AVBA 1S0GA 4OUMA 5T5LA 4ES9A 1PZ8A 3ZXGA 5L9RA 5C3PA 1Y43B 2D6OX 1HX6A 3RYPA 3DCQA 3WHUA 4CVUA 2LM3A 1XC6A 4XDOA 3RPQA 2ZXQA 1U12A 5GM0A 1NCQC 1DGWA 3FHIB 3PTYA 5DDJ1 3BU0A 4X8NA 3AZXA 3PUIA 3QH7A 5DUXA 2BGOA 1YWKA 1LOFA 2JEMA 3LQCA 4LO7A 3JXSA 4TSVA 2E53A 4QGMA 1UXXX 1RUJ2 2YHJA 3B01A 2WDBA 3P3PA 1GZWB 1UZ0A 2ZOEB 4META 4OUEA 1MACA 5FPVA 4GJYA 1UZVA 5EV7A 4RR3C 4DO0A 2W1UA 1WZXA 4EROA 1TQ5A 4IV1C 1VBE3 3W58A 1SDDB 2GNMA 2DYCA 3BN6A 5A3MA 4P9XA 1QNWA 2DV9A 3KGLA 3NL1A 1WW5A 3NV4A 2ETEA 1QY4A 3KV5A 1PNFA 3PUAA 2P3JA 4BH9A 2Q1MA 4ZXKA 3IB3A 4QGNA 2IUWA 2WO2A 4D94A 2X5IB 5FBZA 4C0HA 3WF4A 4A44A 1MS9A 2IFRA 4PBOA 1YC61 2DUQA 2P3KA 3AM2A 2VOVA 3CJIB 3RI9A 2CSGA 5FFOC 1AX2A 1CN1A 4WM7B 4BQ2A 1AYM1 1OH4A 4LK7A 2ARCA 5F3IA 4QQHA 3NRUA 3I2FA 2D97A 3HD8B 1GP4A 2GC0A 4AEKA 4IGOA 1H2KA 4CCEA 3EMRA 2IXIA 3TRSB 5JOZA 1B35B 2UWCA 3ETPA 3FX3A 5FV3A 4BQ3A 3NV2A 5G05L 4DS0A 5A6ZA 5C5UA 1SBFA 4NIHA 3VBSA 1IZ3A 1CX1A 4X6RB 3WNMA 4CPBA 5JXIA 3NJXA 5T55A 3JD71 1LOAA 1OLMA 2E6VA 4ZZ8A 4FBFA 2FDHA 1ZYBA 1WCQA 1AX1A 3CIHA 2ZKLA 3N9PA 1HXS1 2EXKA 1C5IA 2ZACA 2XVGA 2ORZA 3C7HA 4B1LA 2JB8A 3TBDA 3UKVA 3AB0A 1RUJ3 4XQDA 4YW4A 4Y24A 2XL9A 4QMAA 1US3A 5FBJA 5LK7B 2VG9A 2QBXA 3IDEA 5DZFA 1ENSA 1HB4A 5LBEA 4CXXA 4CDWC 3A7QA 2D7FA 2E7QA 5FZ1A 4E27A 3HNBM 1WCKA 1CVNA 4KBBA 2W1WA 5F2SA 3ZN5A 4XDPA 1OF3A 1DGWX 1QJFA 3ATGA 2VNGA 3AP6A 2XXZA 1GMMA 1QNYA 3NQHA 1LEMA 1EUTA 4HZFA 5T5PA 2W46A 3C2UA 3DPRA 4IV3B 2VZ3A 2ZGOA 4XABA 3K3NA 2WNUC 2PHXA 3X29B 2DCTA 3ZXKA 3GBWA 1OPOA 1UWWA 1W9FA 1WUVA 1Z7S2 3HPNA 3OF1A 2YXSA 3K75B 1VALA 5LCWL 3MPBA 4BB3A 2XMLA 1POQA 5FP3A 4FTBA 1C3HA 2WN3A 4HVOA 4LQRA 1J3PA 5IFTA 1BCXA 5J3UA 4F8AA 1ZZBA 4W50A 2QKDA 4AAPA 5FXVA 4DRRA 2EA7A 4GJZA 3SH3A 2VUCA 1QH6A 1L7LA 2I2SA 4MYEA 2QQWA 3S5AA 2ZHNA 2JDYA 1S2BA 4JGYC 2TEPA 2YC2A 4M4PA 2OPKA 1UU5A 4JTOA 4PDWA 2EXIA 3AVRA 3GJBA 4X6QB 3WXPA 1AYN1 2VBPA 4OQ8A 1MR5A 2D5FA 1DYOA 4XETA 5BNNC 4CDXA 1GKBA 2WQ4A 2R061 3U1XA 5C70A 2XG3A 2A5ZA 5E6HA 3ZR5A 1QJU2 3A0NA 4MGTA 4FOYA 1GUIA 2OT7A 3FZ3A 4L97A 2RMU1 2B9UA 1CQ9A 4UI9L 4AI3A 2VMHA 5FZDA 4MSVA 1YFWA 2HJIA 1KITA 2Y6GA 5F1RA 2XUEA 3GXUA 4RD7A 5DAQA 4DB5A 3ZYJB 4CU6A 4EWAA 5KHKA 2UY8A 1O91A 2XDVA 3Q9OA 5FMDA 4EN0A 5FPBA 1C8M1 1R1A2 2ZA9A 3PUSA 4MZUA 1YLLA 1W6PA 1RUD1 1A6CA 3KVAA 3KVBA 5HCFA 1IQAA 4FFFA 4DMIA 1O3QA 2EXHA 1XYNA 3I3QA 3O14A 1Z7S3 3PLQA 4UFMA 4XJAA 2EAKA 3R4DB 3OPTA 1D4M1 1V9U2 2HWB1 2EVXA 4JQRA 4LO6B 1U0AA 2OUJA 4PCRA 1W6OA 3DEMA 5FKBA 3VKOA 4DXSA 3AXEA 1Y9QA 4P9YA 1V6MA 4LO5B 4YG0A 2R1BA 4YW6A 4EWEA 4YVSA 2WINB 1NA1A 3MLLA 4XBQA 4XJZA 5GZCA 5JMCA 1OOPC 5DXDA 3ZKYA 5GZGA 3OG2A 3A22A 5EZWA 4COVA 4UFLA 1AR71 2YBKA 5A32A 2EIGA 4EN8B 2C26A 4AK3A 3RZLA 1ND2C 1VE0A 1G8WA 4Y1XA 4M3CE 4BU2A 4QU2A 1US2A 3DPRB 3ZYHA 2D3SA 1RC6A 4H14A 5CG9A 1YHFA 5H9PA 2GH2A 1W2NA 5FY1A 5C33A 1F31A 2RHPA 4AFAA 1XBFA 1RUC1 5C8WA 1XYOA 3WY6A 2ADDA 3PUHA 4LHLA 2AREA 2QFEA 4YG6A 3VB9A 1F4AA 1RUF1 2VU9A 3K4DA 5FZ9A 5FYMA 4DUVA 1NLSA 1VBB2 5GLUA 3WUCA 4OHXA 1QXPA 2C0ZA 4QX8A 2K46A 1K3IA 1OUSA 1W3VA 2VQ0A 3AFGA 3WF2A 5IK7A 3ZXLA 4Q0SA 4YNIA 1CAVB 4HBNA 1R1A3 1NYWA 4Q26A 5BNPB 5KR7A 3VD9A 1NLRA 2OZ6A 4PDWB 5LEKA 2BBVA 3KQ4B 5IVYA 2FDJA 4XHXA 4CEWA 4CXWA 4JCKA 1HJFA 1I9RA 4WBBA 2VW0A 3H8RA 4CDXB 2BGPA 4ET7A 1NG0A 4CXYA 1V9U3 3RWKX 1ENXA 4GWMA 3BODA 3CJXA 5FO7B 3VBUB 2X8KA 4ZY9A 3ZYPA 3PVEA 2TBVA 3AP5A 2H6CA 2R042 2VMGA 4LA2A 2BW8A 1XXNA 3IAQA 2VBBA 5I8TA 5C9AA 4FOQA 1QH7A 1KGYA 3RWNA 2QCSB 5DPNA 4QPWA 2WKKA 2XQRA 3ACLA 5JLVA 3AK0A 4FI9A 4WZCA 1G9DA 3K51A 1Y9GA 3OGSA 2D93A 2DCZA 3MFAA 4XJUA 5FYIA 1VLNA 1IG3A 1R64A 4Y22A 1AR61 3VDBA 3RYKA 3U07A 1KFUL 2GNTA 2ID4A 5C8CA 2QQKA 1W6PB 4XF1A 5FLIA 3HT1A 3N9LA 4QXKA 3O12A 1TME2 5HCHA 4AL9A 1LEDA 3N9MA 5F5AA 4MO3M 4ZU5A 4CE8A 4CP9A 1HN0A 3VHNA 3FHAA 4R8HA 2LW8A 2MHFA 3PNAA 4D0QA 4YVSB 1W9WA 1NA1B 3Q8AA 5JIUA 1Y3TA 1B35C 1VBB3 1ZM1A 1FYUA 4Q4W2 1OKQA 3OEAA 5GJ6A 1GANA 5A32B 4JGZC 4KWKA 2VC9A 3IDAA 4FSJA 3FJSA 2XBO2 2RM22 4B4PA 4N7IA 1TMF2 1RVF1 5JVVA 4KQ7A 1H1MA 1SACA 3HQRA 4KBZA 5CNAA 4XJ9A 5E88A 4YW2A 2P17A 3ZOIA 4V2VA 4QQ2A 2HWE1 3RJ2X 3SNMA 2ZX4A 3RZGA 2R043 4FPYA 1PX3A 4FT8A 3CQOA 2YB7A 2D3RA 3S7IA 3WG1A 3N9QA 1JZ7A 2XHNA 4Y5TA 4NWWA 2CDOA 5IVJA 1DYPA 1J84A 1MZEA 3KWVA 3VDAA 2XJTA 3VD7A 1ZA7A 1C28A 1DQ0A 3ECQA 2X10A 4KWLA 2A3YA 4FAHA 1UZZA 2TNFA 4GAZA 1WD3A 4M4RA 1LJ7A 5ANNA 2ADEA 1X50A 2YDEA 3FL7A 5A33B 2XLGA 3LF7A 3UL2A 3O0VA 1ND3C 3ZIWA 5J48A 4KMQA 2XGXA 4PI0A 3L2YA 1OA2A 1TME3 2JDPA 4J1XA 3ME2A 3MLKA 4P00B 3I3EA 1HRI1 4IV3C 3I3DA 4FOVA 3IZOA 3O1UA 2UWBA 3ZKUA 2O0OA 1W0OA 2XJVA 2OUHA 4BCUA 1SLCA 1VAMA 4RFT0 2A6YA 4Q4W3 4O9EA 3VKLA 4YLZA 1FATA 4IEXA 2WFF2 1QEXA 1LTEA 3JBG2 5GZDA 1CZVA 2OQ7A 3H1MA 4KH9A 2XBO3 1N3OA 2RM23 1EV12 2P34A 1TMF3 2VZOA 2R32A 1VBC2 3KMHA 2QQPA 4JDMA 5I91A 3GZUC 2NM1A 1C57A 2JDHA 4UAPA 5FY7A 3PMEA 2ZABA 1K42A 2WA4A 1OVSA 4OI1A 4ARXA 4RR3A 1W8HA 4CP9B 1W0PA 3ENRA 3I2GA 3NV1A 4IV1A 2BEOA 1PGW1 1XE7A 5AVAA 4YPJA 4YZ5A 4ZPIA 1MZFA 5F39A 2LS6A 5FO8B 1O3SA 4JKKA 1YQ6A 3RI8A 1JN2P 4W8JA 4YZ2A 5FPXA 1EAH1 1JZ8A 4HFSA 5A80A 1RUOA 1PGL1 4GH4B 2WIIB 2OPWA 3SISA 3UGHA 5IK5A 1H1IA 1RUG1 5EP9A 2GC1A 1ULFA 2PLV2 4IXLA 4AG4A 1NT0A 1UKGA 1X36A 2VULA 2W08A 1QJX1 2XVKA 2A6ZA 3I59A 1DGRN 4Q4Y2 3F2ZA 1W03A 5JSRA 2QQJA 4NWVA 2NMNA 1LOEA 5T52A 4IERA 2VO5A 2V09A 2GNDA 2H6BA 4URAA 1XNCA 1A78A 2ZEWA 4Z2AA 2ZAHA 3PURA 1GP5A 3THPA 1PVC1 3BVCA 3C7GA 2WFF3 2YG0A 3H8UA 2J1UA 5JXGA 3JBG3 5CG8A 5SV8A 4AQTA 4CCLA 3T4HB 2BERA 3VHPA 3W5MA 1EV13 1NX9A 1PK6B 1VBC3 4LPLA 5IAVA 1O7FA 3MEPA 4BYYA 2RJKA 4Q0PA 3D82A 4FXKB 2KD7A 2KM2A 4COWA 2PAKA 5K0UA 4MGYE 4AHXA 2Q30A 3GBFA 3J7NA 4GZ9A 5SV5A 3TN92 1RJ7A 3I8TA 4HG6B 2BBAA 4ZONA 3OB8A 4QX3A 4ZS2A 3WOGA 1CX4A 1OD3A 2Y26A 3HIFA 5HV4A 5FZKA 1OQEA 5JAXA 4LA3A 4CDWA 4UW3A 2G4IA 4Y20A 4UYBA 4YVWA 1JI6A 1POV1 3W20A 3A23A 1NCRC 4NIIA 2D6LX 3BYWA 5FREA 5KXCA 1JU3A 3HWJA 4XE9A 4YWAA 5IHRA 1RINA 3Q8CA 4FPHA 5E89A 4CDUB 3VBFC 4FCAA 3ACIA 2ERFA 1IGOA 1NCQB 2K0GA 2PLV3 4XFFA 1H6XA 2D98A 3ZXJA 2PAEA 4KI5M 5BNPC 4OI0A 2OIIA 4C1WA 3DN7A
chains in the Genus database with same CATH topology
4FAGA 1QXJA 1QXRA 1X7NA 2WNUA 5I0TA 4AI0A 1DQ5A 1KFXL 2TUNA 2HKXA 3VBUC 1RHI2 1WCDJ 1VR3A 3OBRA 2LALA 1X8MA 4KGGA 3FLPA 2WSUA 4YZ3A 2DCJA 5L73A 2DU0A 4AGGA 2RE9A 4IL7A 4JGYA 3OD4A 4AVAA 2QNKA 3RMXA 4DPNA 3TN93 3I59B 4V1PA 1RMU1 2YZ4A 3M3IA 5BNNA 4H55A 3USSA 4L11A 4YM3A 3VZNA 2GZWA 1LHUA 1ZBE1 1N1SA 4BE3A 3LZZA 5JDBA 4FP3A 4A7YA 1VRH1 3AZVA 2VGDA 1LULA 4FQ4A 3H7YA 1TEIA 1CPMA 1WW7A 5IUQA 1VB4A 1R091 3POWA 2I07B 1G7YA 3RMYA 1V6NA 2MPFA 1WA4A 3JZVA 5DZEA 3MICA 4Q8LA 1DGRA 1HXS2 4FP2A 1X8EA 1YO8A 2X29A 3CLPA 1W6MB 1DQ1A 5I0UA 4AVTA 2Y38A 3B00A 4N9IA 2VECA 4IEOA 4S2DA 1RJ8A 1LESA 4HMZA 3DV8A 4AHZA 5H9SA 3KM5A 4CDWB 2MEV1 2QVSB 1WBLA 3M7AA 4AE2A 1OOPA 4S2HA 2QJVA 2PHDA 2D6NA 2W39A 1HRV2 4XXPA 5DZGA 2ZZJA 1ND2A 2D40A 2GNBA 3HMYA 1WD4A 4K20A 3MW3A 3ZPYA 2ZHMA 2WNUB 3CO2A 3J8F2 2XH6A 1AX0A 4XZPA 2BUKA 3USUA 1L3JA 2ZAAA 3IT8A 3VLBB 1MS8A 4K9SA 3MLJA 2YY1A 5LRRA 1FMD1 1E57A 1CAWA 1S1AA 1KJRA 1S0IA 4Q4V1 1S55A 5FLJA 4DOUA 1DZQA 3AMQA 3U11A 5CBLA 1UU4A 4JGYB 2GN7A 3SCGA 4I0AA 5T3NA 1HXS3 4HETA 3ZFFC 2LUWA 3S30A 2FMYA 4Y1UA 5GKAC 3IDCB 2D5HA 5BNNB 1AYN2 2IXKA 3VUOA 3ETQA 1GZWA 1Q8SA 3MF9A 2OYZA 1G6NA 4R9AA 4QX5A 5JZGC 3FWEA 1AR82 4RHV1 5T54A 2HWF1 4GULA 4A2UA 3POYA 2GSYA 2RMU2 1IOAA 1HRV3 1D0HA 5I0RA 2VNRA 4GH4C 4QQPA 5FTTC 1S0FA 4L9BA 1BVVA 4QQLA 1ULEA 1KRIA 2PTMA 1K5MC 5B2GB 1UPSA 3WP6A 3N36A 4N53B 5DUWA 3CJIA 2JECA 1EP0A 3AKQA 3NJZA 3FBMA 1D4M2 2HWB2 1I5ZA 1I1EA 3AMMA 1OOPB 3G7DA 1VBE2 1B35A 4WZFA 4QPYA 4DFSA 2H0BA 3WD5A 1JTZX 4PQ9A 4XXAA 2KXLA 3L2HA 3POSA 4JGZA 1AR72 4XF4A 4H7MA 1RGSA 4GXLA 5D8AC 5C4WB 5EYYA 1PK6C 4A3XA 3NWKA 5KBFA 1YI7A 5L36A 2F4PA 1AYN3 3MW4A 2I45A 3VDDB 1CGPA 5JOXA 4R4XA 3USUB 5DUVA 2ZX0A 2HEYF 3AJYA 1N1VA 3AYAA 5E1RA 4LLOA 1DDLA 1RUC2 2ZMNA 3D0JA 2RMU3 1GFF2 2Q8OA 2WZPP 1CAWB 1ZA4A 3G6JB 4ONUA 1RUF2 4L92A 4QM8A 3ASIA 5DUUA 2DF7A 5GZEA 4Q0UA 1BK1A 3BTAA 4CDUC 2CAVA 1ND3A 1C8M3 2EALA 1X82A 1NE4A 1RUD3 1ASJ1 5CVRA 5J7MA 4Z82A 4IV3A 1IPJA 1D4M3 2HWB3 1DYKA 5F5QA 3S0MA 2QZ3A 4CP2A 1IS4A 5LRSA 1IPKA 1MS4A 3WP5A 2IXLA 3QD6A 4K7JA 3U10A 3ZN6B 1OFNA 1JUHA 4LBOA 1AR73 2JG8C 1DF0A 2A75A 1DQ2A 2DVDA 2A6VA 4PLOA 4OFGA 2XVLA 4K8FA 1AR62 1OA3A 3GZAA 3WQ1A 4FOWA 5IK8A 3S6PA 3LB9A 1LOCA 1SQ4A 2BPA2 1WMEA 4HK9A 3KLSA 3A4UA 1RUC3 1BKZA 4LBKA 3IKWA 4AXOA 3JB8A 4RGGA 2I74A 3ALQA 4E4DX 1RUF3 1DLLA 1UU6A 3VZMA 4NO4A 1IKPA 2YPJA 4JGZB 1DQ4A 1QGLA 2G9FA 4L99A 3QH6A 5FOJB 2UURA 1NXMA 2WT1A 1VIWB 3AYEA 1CR7A 2YGLA 4KG0A 4JRLA 2XWJB 2BNNA 2VH9A 1RVF2 4NHMA 2HWC1 4IEVA 4YFWA 5FOBB 1H30A 3WP4A 4YM1A 1HQLA 3OCPA 1QU0A 4W65A 2HWE2 2JJ6A 2ZGTA 4JAAA 1QOTA 2HYKA 3D5OA 1CJPA 2BNOA 5FAXA 1GNZA 4XF0A 4Q0VA 2JG9B 4HSJA 2W52A 3AKSA 3ZYGA 3NAPB 4XJ8A 4BMBA 1AR63 1QDCA 2DFCA 1ND3B 2B7YA 1QMJA 1IS3A 3ZFGC 3H50A 1J3QA 1ENRA 5HCBA 3MPPG 3JU9A 3W59A 1QJY1 4ISQA 1AJOA 4QPIC 2WZR2 4XFCA 3DGTA 2NN8A 3ES1A 3N35A 3R05A 4FPJA 3NO8A 4I0WB 3D4KA 3LA7A 1IKQA 5ACA1 4N9HA 3EQEA 1C8NA 4XF3A 2YROA 1CAVA 1DIWA 4W6WA 4W6YA 3I4IA 4M0HA 5BNPA 1RVF3 1O5UA 3WW1A 3CU7A 2O8QA 2RS31 4O9GA 4AGRA 2JDZA 2VY0A 1GSLA 2HWE3 4AI2A 1D2QA 1DFQA 1LB2A 4FPKA 3VBUA 3VZJA 2N7GA 2ZHLA 2GDFA 1G9BA 4A7ZA 3MZHA 1O5LA 1PGW2 3WDXA 5EWSA 4LE4A 1EAH2 4NR1A 3T1LA 1BEV1 5CB7A 1PGL2 1UMZA 4ZKTB 4XBLA 1RUG2 3GF6A 4Q1RA 1YFYA 2VOXA 3AMHA 1GLHA 1YYNA 1N3PA 3FMGA 1QJX2 4AYUA 4Y26A 1RUI1 4GMP1 4N53C 4XFAA 2QUOA 1NZCA 1WLWA 1WCSA 2DURA 4YM0A 2WZR3 4FO9A 5JWPA 4YARA 2ARXA 4FTEA 4BLJA 1PVC2 4BZ4A 1QQP1 1PGSA 4YFZA 1SCRA 2B39A 1ZNPA 1A8DA 4BLIA 2A70A 2GN3A 2BWCA 4MH0E 5C4WC 3WR0A 1APNA 4FPGA 4LT5A 4XMIA 2W0XA 2VNOA 3O0WA 1GV9A 1S0BA 2ZGRA 4P9IA 4Y1YA 2ES3A 4XFIA 3VDDC 4GA9A 3C3VA 5HXVA 3K48A 5HCAA 5HBAA 1DZRA 4AFMA 1NCRB 5GLWA 5JOWA 1EAH3 1AXKA 4CEYA 4OHWA 4WM8B 1AL0G 4N43C 3VBFB 1RUG3 1FT9A 4Q8KA 2AGSA 2CAUA 1YFUA 1MQTC 5A33A 3M3OA 1KJLA 4AFCA 2WFPA 4U2AA 1QJX3 4B29A 2R0HA 1R081 1WLTA 2CNAA 5CFCC 3PVOA 3MYXA 3SH4A 4BQ1A 3FLTA 1PVC3 1UCXA 1LCLA 2BFUL 2AR6A 3LKJA 3H1WA 2VUAA 4XFBA 4AFBA 4R52A 3WVJA 4OZXA 3L9JT 3O7OA 2FBEA 1AZDA 3MF6A 3ZFFA 3DKWA 1J59A 3BALA 4Q27A 3MIHA 1QF3A 1RUJ1 2PFWA 3GYDA 2Q5TA 4LR4A 3IN9A 1H8TC 1RMU2 2E51A 3VKFC 3LSEA 5BNQA 1YCIA 1S0EA 1H2LA 3BPZA 2CGPA 4FVVA 4MGKE 1ZBE2 2E7TA 3AMPA 5JPNB 3VBOB 2YV8A 1F9KA 1FPN1 1M4WA 3AXDA 5FLHA 2Y0IA 4M01A 1COV1 1VRH2 1W6NB 5D1IA 4IETA 3SLIA 3AKRA 5KXDA 1POV0 2E9QA 4X8PA 4GH4A 3BCWA 4COUA 2XKOA 4HVQA 4AVCA 3ZXDA 3RS6A 1K5MA 2ZX1A 2RJLA 3E6BA 2GAUA 1QDOA 2YC0A 4NPRA 2R071 1VJ2A 1LHOA 2QDNA 4HK8A 1HLCA 1N1YA 1Q43A 1G9FA 4AGVA 2MEV2 1XNBA 2JG9C 3B94A 1Q8OA 2AZ5A 2ZGLA 4G3YC 2XJPA 3NAPC 5D8AA 2XJRA 3M8LA 3D8CA 1PK6A 3WG2A 2CY6A 1H2MA 5T50A 1TNFA 5JI9A 5CU1A 5HI0A 3PVNA 1O3RA 3RNSA 1RMU3 2BQPA 1H9WA 1Z0HA 1C1LA 4JDNA 2Z69A 1ZBA2 4Y4YA 1ZBE3 2QE3A 4RQPB 2DVAA 5ABJB 4PIYA 4YW5A 3DL3A 3SHRA 5I93A 4SLIA 4LBQD 4YGCA 1VRH3 1LGNA 3JQWA 3MGUA 5EJ3A 4AHYA 5BNOC 1CONA 2FHRA 4MUVA 2ZMKA 4M3CF 1LU2A 4Q4V2 4G4FA 4CDQB 1C5HA 4CDUA 1LOGA 5EFUA 2P2KA 3ZFFB 4S2FA 1NCQA 1Q8QA 4NN0A 1MZ5A 2CYFA 3EBRA 4E4ZA 4XHBA 4YM2A 2NLRA 2ZBJA 1O3TA 2A6XA 1V6LA 1XE8A 4JTNA 1QJZA 2P37A 4LHKA 1LENA 3ZSLA 1SLAA 1VBA1 5JZGB 2MEV3 1RUE1 2PHWA 3N3HA 1OLQA 4RHV2 1XRUA 5E8AA 1SFYA 3QCWA 2XWBB 2JG8A 2FZ1A 2ZZQA 4E2QA 4LBMA 2WT2A 3ZYIB 2HWD1 4I01A 2ZX3A 1K5MB 1WLDA 4GWNA 3NKGA 4ATEA 4Q4X2 1ZBA3 4IEQA 4P9JA 4LEJA 1QJU1 1RTVA 3MDPA 2GMPA 3ZSKA 1G9CA 4K6BA 4YGEA 3INAA 3JCIA 1EPWA 4S2GA 3N4MA 1FMD3 3VBSC 1TNRA 3ZVXA 4URTA 4Q4V3 3R4SA 3ZXFA 5F9TA 1BMV1 5D8AB 2VW1A 1FV3A 4Y5Z0 2JD4A 1JYCA 5CADA 3BOPA 1YNAA 2B5HA 1W6MA 4WVVA 1ZZ8A 4COZA 4OVEA 1U5ZA 3AZZA 3O5SA 3OPZA 5CAZA 1VP6A 4FPOB 4LO4B 3N7LA 4RHV3 4RS5C 5BPXA 4OULA 5GLTA 3THTA 1LHVA 1QKQA 1UN1A 1H1AA 2ZMLA 2YGMA 4M00A 4WM8C 3B7MA 2OVUA 1CPNA 2FQPA 2DFBA 4XIKA 1V6JA 4YYOA 1O4TA 2RR11 3GZTB 4P9GA 4Q4X3 3ZFGA 5DDJ2 1B09A 2WSVA 4KU8A 3WG3A 3LSDA 3E6DA 3GBGA 1J58A 1MS5A 4RL7A 2IZWA 4E4SA 5KHJA 2Y0OA 5AC91 3ZXAC 4QPIA 5JSPA 3AZWA 3BB6A 4B8EA 1XYPA 1A3KA 4HANA 4K40A 1PO11 3E97A 1ENQA 2JG8B 2EAAA 1OMIA 3ZN4A 3KT7A 3I54A 3WDTA 1KXGA 3M2MA 2BVVA 1REFA 4PLMA 2GH8A 2ZKNA 5JPMB 1RUH1 2CTVA 4XDQA 1YI9A 2GMEA 3UK9A 4QT6A 3AP7A 4LBNA 5JCTA 1AYM2 1CD3G 1HV1A 2K9ZA 3SITA 2YUEA 3DUIA 1N3QA 3VBOC 1VAVA 4AW7A 2A7AA 3CNAA 3GALA 2ZGUA 3BIWE 4HL0A 3T1MA 1KDMA 4MXWA 4B7KA 1H8VA 3JD72 5DDJ3 3VZOA 1YRZA 5BUVA 2WNVC 1O4YA 1SLBA 2HWC2 4N53A 4XOGA 4Q29A 3UV9A 4GALA 2R16A 2IFWA 1PO21 3AKPA 3OJBA 4IESA 4ISRA 4E9KA 3W9AA 5KHGA 5TSWA 1KS4A 4BHPA 1W2UA 4QHBA 2VUJA 5GLVA 3WINE 3B5LB 2IXJA 1ZRDA 3CF6E 3LOBA 1BXHA 3WP3A 1MEC1 3PJQA 4LUMA 4OI4A 4CZSA 2ZS6B 3LOIA 5C4WA 3HN1A 1DQ6A 3ZFGB 4P5HA 1WW6A 4AEDC 4DRVA 1Q8PA 2SLIA 2ZGNA 3VDDA 1G9AA 1CJDA 3WCRA 1AYM3 2JX9A 1ZRFA 1QWRA 1QJY2 2PHFA 2ZGQA 2Q4SA 4K21A 4QPIB 4RQPC 3T2TA 4HSLA 5ABJC 1AR91 4U36A 4PLNA 3PHMA 3URFA 4MLOA 4CYDA 5K7PA 4ASMB 3U0ZA 3WZ1A 4N43A 1RITA 4ORFA 3JD73 1MQTA 4CDQC 1DBNA 1NQDA 5ACA2 4ATFA 3D6EA 2NYYA 3RG0A 1LHWA 4CEWC 1SLLA 2HWC3 2V73A 2PELA 3KQRA 2E63A 2RS32 1EYBA 3TOJA 4F7ZA 5K9YA 3UKNA 5CFCA 1X33A 2CWSA 2R062 1FX5A 1UIKA 3E6CC 1U5YA 2QDRA 1F8VA 3ZN6A 2ZGKA 4GB31 2QZ2A 1BEV2 3TNPB 4MXWB 2ARBA 3H1YA 2DWRA 1NOVA 1ALYA 3GNEA 3M4FA 3WDVA 3V56A 1REDA 4D3WA 2X53S 3FUOA 1C8M2 4E2GA 1V6OA 1H8TA 1RUD2 4LULA 5FPZA 5CFDB 3RQ0A 1QJY3 4AQ2A 2XJQA 1RUI2 4FPEA 4LE3A 4UW6A 3CEWA 2CGOA 3E5UA 1W39A 1N47A 3HT2A 3M1HA 2EXJA 2YYOA 1PIV1 4AQSA 3WW2A 1WMDA 5T5JA 3ZO0B 3KB5A 2W68A 3OY8A 4ASLA 5JOYA 1QQP2 5GALA 2CV6A 4KU7A 5H9QA 5ACA3 3VZLA 2RS11 3ZMOA 4GKXA 3SCFA 3NVCA 2R30A 2XJSA 1V6KA 4LBQB 4Q4Y1 2B46X 3VN4A 4H7LA 2RS33 2DVFA 4XEZA 1PZ7A 4FPLA 1VBD1 5I8YA 2R063 4P14A 1ZZ9A 3TNQA 5I8SA 3KT1A 3ZFEB 1YUDA 1BBT1 1PZ9A 2JG9A 4N43B 3KCCA 1GZ9A 1BEV3 4UBHA 3ELNA 5L19A