3VL8A

Crystal structure of xeg
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
221
structure length
221
Chain Sequence
QRRSDFCGQWDTATAGDFTLYNDLWGESAGTGSQCTGVDSYSGDTIAWHTSWSWSGGSSSVKSYVNAALTFTPTQLNCISSIPTTWKWSYSGSSIVADVAYDTFLAETASGSSKYEIMVWLAALGGAGPISSTGSTIATPTIAGVNWKLYSGPNGDTTVYSFVADSTTESFSGDLNDFFTYLVDNEGVSDELYLTTLEAGTEPFTGSNAKLTVSEYSISIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of xyloglucan-specific endo-beta-1,4-glucanase (XEG) by XEG-protein inhibitor
pubmed doi rcsb
source organism Aspergillus aculeatus
molecule tags Hydrolase
molecule keywords Xyloglucan-specific endo-beta-1,4-glucanase A
total genus 52
structure length 221
sequence length 221
ec nomenclature ec 3.2.1.151: Xyloglucan-specific endo-beta-1,4-glucanase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01670 Glyco_hydro_12 Glycosyl hydrolase family 12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.180 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vl8A00
1T6GC 2B46X 4XQWA 1UKRA 3VHNA 1H4HA 2F6BA 3WT3A 1XYOA 2JEMA 1BK1A 2DCKA 3VL9A 1XNDA 3VL8A 1UU5A 1QH6A 1TE1B 2BVVA 3AKRA 5HXVA 3WP3A 2DCJA 1KS4A 3MF6A 2JENA 4S2GA 1YNAA 3AKSA 1REDA 1H1AA 1REEA 3LB9A 3AKQA 1PVXA 1OA4A 3WQ7A 2B45X 1UU6A 4XQ4A 2BWCA 3LGRA 1AXKA 3VGIA 1HV0A 1NLRA 3WR0A 2D98A 1XNBA 1XNKA 1OLQA 2D97A 2C1FA 3WP4A 1XYPA 1XXNA 1BCXA 1F5JA 3MF9A 3WY6A 3MFAA 1BVVA 3O7OA 4HKOA 4IXLA 2NLRA 3WXPA 2DFBA 1UU4A 2Z79A 3VZKA 1W2UA 1M4WA 3VLBB 3HD8B 5K7PA 3M4FA 1QH7A 1OLRA 3VZOA 4XQDA 2BWAA 4S2DA 4HKLA 4HK9A 4HKWA 3VHOA 2NQYA 2VULA 3AMPA 2DCYA 3VHPA 2BW8A 3AMHA 1HIXA 3AMMA 5K9YA 3AMQA 3VZJA 3EXUA 4HK8A 3VZLA 3WP5A 1IGOA 2QZ3A 4XPVA 1H4GA 4S2HA 1XNCA 3WQ0A 3AMNA 1C5HA 3RI9A 2VUJA 3ZSEA 1OA2A 2B42B 3VZNA 3WP6A 3WX5A 4S2FA 1REFA 2VGDA 3AKPA 3WQ1A 3B7MA 2JICA 5EJ3A 1H0BA 2DCZA 3RI8A 3VZMA 2VG9A 1OA3A 1KS5A 4H7MA 2QZ2A 4NPRA 3B5LB 1HV1A 2DFCA 3AKTA 1XYNA 3MFCA 1H8VA 1ENXA 1C5IA
chains in the Genus database with same CATH superfamily
3IDEA 5CFCA 3EMRA 3H1YA 2GC2A 1YQ6A 2KD7A 4Y1ZA 5CG8A 2BBAA 4KG8A 1K5MB 3LSDA 1QNYA 2IC1A 2QVSB 5FZ3A 4YM0A 1O6UA 3KGZA 4ZKTB 1P8JA 2DUPA 4DY5A 2VZQA 2WL1A 4LKFA 3O1UA 1TG7A 2BDRA 2JDPA 4YM1A 1Y3TA 2H6CA 4K8FA 2BVVA 1HXS3 4AXOA 4FP3A 1FT9A 4YVWA 1LKNA 3MF6A 3E5UA 5IVBA 1YNAA 2XJSA 1HRI1 2ADEA 3M3CA 4RD7A 5A33A 1G7YA 5FK7A 2Y6FA 5EPAA 5EP9A 3RZLA 4NE9A 3IZOA 1CAXA 1OA4A 2BOIA 1ULCA 2OQ7A 2VVDA 2RV9A 2NPIA 2ZACA 2ZPXA 5F32A 5FP9A 3LCPA 2Z42A 1UX7A 4Z2AA 3H3ZA 1DZTA 1HV0A 3FWEA 4LBJA 1FPN3 5DDJ1 5L73A 1R083 5M0TA 2XJRA 1W8ZA 1PM4A 1XNKA 4PT6A 3AVSA 4Q4Y1 5IW0A 3U10A 5I8YA 2D97A 2X10A 1GSLA 2C1FA 5CB7A 3NNFA 3ELNA 4LHNA 5FOJB 5KR7A 1OVPA 4Y1YA 1YQ5A 2WFF1 2J1RA 3JBG1 3NV2A 4ZS3A 3WDXA 3NW4A 1JUHA 1O3RA 3S6PA 2IFRA 2RS32 3VHRA 2D5HA 5FUIA 4Y20A 4YW6A 1C8M2 4OHXA 1S2KA 3VZKA 4I0AA 1VBC3 3FUQA 5DZFA 1UOJA 1OVSA 2QBXA 3NJZA 2YUEA 2GC1A 5IVVA 4H55A 1UWWA 2V73A 5FUPA 1CAWB 4YG0A 3RZGA 1LHUA 3BTXA 1VBC1 3QH7A 3DV8A 4QQOA 1R1ZA 3BTAA 4JGZA 3T2QA 1QDOA 3HWJA 2D6MA 1KDMA 3BVCA 1D7PM 2XVLA 2XQXA 2O0OA 1DQ4A 1LESA 4RQPA 3VHPA 1AYN1 2R32A 3PVNA 2HWB1 3GHNA 4FP2A 4LHLA 3O1PA 2KXLA 4RQPC 1H6YA 4UW5A 1KDKA 5FREA 4BJ0A 5A33B 4N53B 5C5UA 1COV2 1ZBA1 1UMZA 1HRI2 1EY2A 1E5IA 4ATEA 5IVEA 4DXSA 4N7UA 1R64A 1HB3A 2UY9A 3NO8A 5AVAA 1S0DA 4FXKB 2LRPA 3WLUA 4AFCA 2VW2A 5JZGC 5FY5A 2VUJA 3WDYA 4CDQB 4V2WA 2ZX1A 3FLRA 3PL0A 2GALA 4OI1A 3T4VA 3AKPA 2VMFA 4BMEA 5L7OB 2GC0A 3D0SA 1RUE3 3DKWA 5F7UA 5FZBA 4WZFA 4WM8B 1U5ZA 2JE8A 2Y60A 2LALA 3CJIC 4FQ4A 1UMIA 2ET1A 1MR5A 4DNYA 1AR72 5FAXA 4A7ZA 3S57A 2VR4A 3NKTA 5KC5A 1GQGA 4R9BA 4AFBA 1R092 2D93A 2W1UA 1QMJA 2SBAA 4ARXA 4Q29A 1X82A 3GGLA 1X8MA 1OI6A 2WS92 4K40A 1S55A 2X8KA 3U78A 3MIDA 4HPKA 5BNQA 1RC6A 1W6MA 3GDBA 4HXCA 4YGCA 3RVHA 4IEPA 4UWDA 1WCUA 1STMA 2EXKA 5L9VA 3P6BA 3U4XA 2JDUA 3N3HA 3WHTA 1RVF3 1RINA 5FO9B 2BTVC 3NMBA 5JMCA 2MEV2 1R082 2BOJA 4J1WA 1MVEA 4OCTA 3N4MA 1QQP3 3KV5A 4OHZA 2EIDA 2GH8A 4L0PA 2ZCWA 4LITA 2G19A 5LWBA 5CG9A 4J25A 1PVXA 2DU0A 3VBHA 4I02A 5I8TA 4QPWA 2RS51 3MIBA 3HEIA 1D2SA 4Q4V2 1V9U1 4UF0A 5FLHA 2WBKA 1PNGA 3UGGA 3HBKA 3WDVA 1JZ3A 5FZ0A 3WR0A 3KT4A 2Y6JA 1OT5A 5C8CA 3HPNA 4IEWA 1SLTA 1S0BA 2E51A 4KWKA 4LK7A 4LO8A 5EZWA 2FDJA 2PLV3 3KSCA 4LBQB 2BBVA 5C3QA 2Y38A 2PN5A 3MW3A 4CEYB 5J1XA 2OT7A 4Z2WA 2UWAA 2XWBB 4F7ZA 1YHFA 2RVAA 3U11A 4QDQA 1IS6A 2CHHA 1I6XA 5JWPA 1BYHA 4QM8A 4CDXB 1NZCA 2YC2A 1S0GA 1TVGA 5DZGA 4LHKA 4A7KA 1UU4A 1F31A 2Q1FA 4EN8B 4PLNA 5B4XA 4EN6B 4ZY9A 1QJZA 5LY2A 4AVBA 1RITA 4MX3A 3QLQA 5L19A 1CJPA 1R091 3B93A 1UYPA 1FOD1 1GQPA 1IPKA 1DQ6A 3VBUB 1NE6A 2VECA 1ZRDA 1W8UA 1AUYA 5FKBA 1JU3A 5ACA1 2I07B 2E7AA 3LFMA 4MGKE 3U1XA 2VQTA 3KCXA 5LASA 5A3UA 5DUXA 1RHI2 2OZJA 5FYHA 4META 4A4AA 1ASJ1 4EZ4A 1U5IA 5IK7A 4XUPA 3IDAA 4JDMA 3WP5A 2D43A 1MS0A 4LKEA 3KHCA 3WDTA 2PHRA 4QPYA 5KXBA 1F35A 1WA6X 4J1XA 1F8VA 3QOPA 1ZRIA 1VBA2 5I0SA 4Q4V1 5EV7A 3OBZA 1VRH3 5CBLA 4E27A 4XETA 1CWPA 2HWC2 5FXVA 1BZWA 4NIGA 1SLCA 2RJKA 1NLQA 3VD5A 4M3CA 4PBPA 1BEV3 2WO1A 1LEMA 2A6YA 4JKMA 3FHAA 1H6XA 4Q2FA 1B35B 3KGLA 1LODA 4XUNA 4OMCA 2QZ2A 3Q9OA 2BRTA 2WA4A 2XHNA 3AZYA 2R062 1DYOA 1ASJ3 2H0VA 4XBQA 3UNPA 1NQJA 5FY8A 4BQ3A 2HWE3 4CXWA 4D8MA 4XQWA 4UYBA 3A4UA 2GMEA 4COZA 1L3JA 4CDUB 1V6KA 1GMMA 2XL7A 4FFIA 5KXCA 5F3EA 2X5IA 3W5NA 1KJRA 1BLZA 3C7EA 2W92A 3IMNA 4FPGA 4XZUG 1IQDC 2JDHA 5A32B 1LOFC 2WZEA 3OF1A 1XSQA 3H3UA 4AHXA 4CU7A 1OOPB 3AKRA 5HXVA 2XJPA 5FYVA 5LK7B 1D4M1 1R1A2 3CF6E 1QGLA 2GU9A 3MW2A 3U75A 4K7JA 4QX0A 1YQCA 3VBRA 3ES4A 1Q5OA 3ZYHA 4QHZA 1G86A 1MACA 2IFWA 2RDRA 4F8AA 1HXS2 4Y1VA 4FFHA 5FYYA 2ERFA 2YPJA 1AXKA 5FYBA 4QQHA 1MS9A 1NLRA 1WMDA 3ILRA 2D98A 2BFUL 2YY1A 4LIVA 4XFCA 1FATA 1QJX2 1YLLA 2J1SA 3CNAA 2RS12 3OD4A 4QX3A 1I5ZA 3CIHA 3SQOA 3T3YA 3M1HA 3VD9A 4QPGC 2VMCA 1W6NA 4B4PA 5A6QA 4XYXA 1BCXA 4OI2A 1PO12 1ZRRA 2WUHA 2PQSA 2YBKA 4Y24A 1JZ6A 5A3LA 1GOGA 3O7OA 4HKOA 1A6CA 1ND2B 1B09A 4H7LA 4XJ8A 1YQ8A 5T54A 2AGSA 2PHXA 1WWYA 4QKNA 4Y3OA 1W03A 2X29A 2AACA 1L7QA 1V6NA 4A44A 1LU2A 1UXXX 5D8AC 3SLIA 4AGVA 3LEGA 2XKOA 4HVRA 4NWVA 1RB8G 3JZVA 1YIFA 3NV1A 3Q8AA 5GLUA 3JU9A 5L9RA 1RJ8A 5C8WA 3HIFA 2LROA 5HI0A 5IVFA 4AQSA 4P9JA 3ZYIB 4AEKA 5L7OA 1BXHA 4EWDA 4FSJA 5FXXA 2OW4A 4JGYB 1W9YA 2DVFA 3WG3A 3OUHA 5D1IA 3VDAA 1YI9A 3V0BB 2BERA 4ZS2A 5KHJA 2YHJA 4QU2A 4Q4W2 3POGA 5IAXA 2R073 5KHKA 3KS7A 3SEPA 3PJYA 5A7QA 3AMQA 1WCDJ 1CAVA 4QXCA 3H8UA 5A3NA 1V9U2 2VQUA 4P14A 1UD1A 2GSYA 1BKZA 4HFSA 4RS5C 5F5QA 4IL7A 1H4GA 1PVC2 4AK3A 4GJYA 4C1WA 2IXCA 4FPOB 1RUG2 1WMFA 2VW1A 1C5HA 4E8DA 4FAHA 2XHKA 3AYDA 4P5HA 2B42B 2ZBJA 3MLKA 3ZSLA 3N36A 2FCTA 3J7LA 3DPRB 1JMUB 2GAUA 5F2WA 3NQHA 1OQEA 2DBNA 5J48A 1X36A 3ZXKA 2ZMKA 2ARBA 2HEWF 3KM5A 5EXOA 4I2OA 4LPLA 5DZEA 5I0UA 2ZZQA 2WDBA 3PVBB 4L99A 5JZGA 3V0AA 2WNUB 2JDZA 4CPBD 1VR3A 2PLV1 1IKQA 4OVEA 2ZXQA 3PUAA 3ALQA 4MO3M 2YXSA 4DY3A 1N1TA 1J84A 2PHLA 4IEOA 3T08A 1Q8SA 4DOUA 5LBBA 4CRQA 3I4IA 3PU3A 3ZYGA 3L2YA 4Y4RA 5IFPA 3Q8CA 5APAA 2ZGMA 3D82A 4O7XA 3RFRA 1PM7A 4DRRA 5FPUA 2WT1A 3GNEA 4GKXA 1PO11 2G4IA 4QHOA 4F83A 2ZMLA 4WM7C 5CFCB 2QKDA 4P9GA 5FP7A 1OOPA 3H8RA 1R081 2D6KA 3F2ZA 4A7YA 2EIEA 1UY1A 2V72A 1L7LA 4NRPA 3AK0A 4X6RB 5CNAA 3MICA 1JYWA 2HWF3 3TAYA 4XIOA 2HWD1 2ARAA 1FMD3 5T5OA 4B4QA 5BPXA 3VGIA 2EICA 5CEHA 4LUMA 2EF6A 4YVWB 5T3NA 4C1XA 3VBUC 1W9SA 4QWNA 3LDRA 2QQLA 4ZONA 1LECA 1J83A 2R0HA 4JAAA 2WNOA 3B02A 4GULA 3U07A 2WYFA 5DUUA 1VRBA 2MEV1 2Q8OA 1FPN1 1CAUB 5FMOL 4YZ5A 1NCRC 2ZX0A 4RR3A 4C91A 1ZZBA 3L2HA 2FZ1A 2OUJA 3W21A 1LEDA 2VNVA 4M00A 2BEOA 2DFBA 2VMGA 2WZPP 4UW6A 3SCHA 4LT5A 1XE8A 3FHIB 4UFHA 4Y22A 4TZDA 3HNMA 2RS52 3E5QA 4ZHNA 1YO8A 5F3CA 3BU0A 1RUC3 3AP5A 3PIGA 2QQWA 3U37A 4D94A 3T2TA 4JHZA 5HBAA 3K48A 2EVXA 1GKBA 3VHOA 1H9WA 1GWKA 1MVQA 4GH4A 5GALA 3UKTA 5EYYA 1FAYA 2VULA 1ND3A 3AL5A 2C24A 1KGYA 3ZXLA 5LK5A 4JTNA 4Q0PA 3AMMA 2JX9A 1Q8VA 1US3A 4CEWA 3THTA 5C3PA 2GH2A 3BU7A 1QKQA 3RYKA 1UW8A 4NOTA 4FT8A 3VZLA 1OKOA 2QZ3A 4YVSA 5C9AC 5B4NA 2ORZA 1XB9A 4URAA 1J59A 4HSJA 3CL1A 3S7EA 1NZIA 3S0MA 1XNCA 3IIIA 4QB2A 1X9TA 2PAKA 4M01A 1YC61 1WUVA 1O8PA 2WNVC 2W5FA 4RHV2 1YFXA 1HRV1 4N9HA 1FNZA 2W68A 4XJ9A 5LBFA 2RDSA 4S2FA 1REFA 3OB8A 2ZABA 4JKLA 4AW7A 3BCWA 4BU2A 2HWC1 3O1SA 1U5YA 1V6LA 1RVF2 2FBEA 2VCAA 4AAPA 2WJSA 1Z7S2 1Y9MA 3N7LA 4RGAA 4XOGA 4FOYA 4NHMA 4AQ2A 2OQ6A 4BH9A 3AXEA 4XMAA 5JIUA 1JYNA 3N9LA 3C3VA 1JXNA 2XG3A 3C7OA 1BVP1 1H8VA 2PQQA 4PF5A 5FP3A 5GM0A 3RJ2X 3UETA 4YZ1A 4XTMA 3CJIB 4AVCA 3PU8A 3OBAA 5K4LA 4M3CE 1RUF2 2WNUA 2YFZA 3JD72 5GZEA 1O4ZA 4GIQA 3TOJA 3W59A 1VIWB 1XYOA 3OTFA 5DDJ2 3AZXA 2W87A 4D6SA 1U5XA 3WCRA 2JD4A 4IE5A 5BUVA 4MGZE 1DQ2A 4R9DA 2PHDA 4XW3A 2ZGUA 2GNMA 4C8DA 1MZ5A 5A1LA 1GWMA 1V6JA 1GZWA 4XDQA 4W8JA 3J8F1 4M3CF 3KB5A 5CKMA 3VN4A 2TNFA 3T1MA 2AEZA 4YSFA 2N7GA 2Y0OA 1K5MA 4B1MA 5C4WB 5FQ0B 3RNSA 1MZFA 1REEA 3CZUA 4YRDA 3VBOA 1FYUA 2EIGA 1PVC1 5B2GB 2VBDA 1LOGA 3LA3A 3W58A 1JOBA 4XE9A 3ZKUA 3WINE 3POBA 3BTZA 1GV9A 2CNAA 3DYMA 1NUKA 3I2KA 2PAEA 2WLPA 4JKKA 2E31A 4Q4X2 5G04L 1AVBA 2WFF2 1YRZA 2VAUA 4R52A 2QUOA 1QJX1 3VBHB 3KHBA 1JBCA 3OGGA 5T52A 4P5YA 4Q0SA 2BNNA 4XFHA 1UIKA 3PUHA 2W46A 3ST7A 3GYDA 3D4KA 4KL1A 1ZX5A 2JJ6A 2NLRA 3WXPA 5LW9A 4ONUA 1PGSA 4QX7A 1Y7BA 5C3OA 4AQTA 5FXWA 2NZ9A 1MS5A 3PIJA 1M4WA 3VKFC 4W6YA 3HT2A 2WT2A 4QX5A 4Z82A 1VBE1 1OLRA 5FMBA 3SC7X 4QQLA 4XXPA 4CCMA 2E7TA 4I01A 2CV6A 2DVAA 3GZUC 4Y5SA 1HB4A 2DCTA 2Q4SA 3UGHA 4CZSA 1NA1B 3APBA 1BHGA 2RS11 4NUBA 1RUF1 4LBNA 1ZM1A 5FPVA 2R0FA 2OYZA 1IG3A 4YGEA 3CMGA 2Y0IA 4R9CA 1PO22 1NXD1 4IQPA 3IIAA 4QPIA 1OF4A 2XXZA 1UIJA 4OQ8A 3B01A 1UY4A 4LLOA 3MPBA 3QACA 4FOVA 4AI2A 2E32A 3MGUA 2ZKNA 4CU9A 1N3OA 1SLLA 1VB2A 3AX4A 4RHV3 4A6OA 1ENSA 1C3HA 3EXUA 3ETQA 2WN2A 1AR61 2B9VA 4CU6A 3NJVA 2IXKA 5GZFA 1UZYA 4YYOA 3RMYA 4CCOA 1LENA 2OKXA 4EYUA 5FWJA 1COV3 4CPBA 3QCWA 3WNPA 2YB7A 4AHYA 2FDHA 1EV13 1VMHA 2CYFA 3MYXA 3N7KA 2R072 4JHTA 1CX4A 4OMDA 3V64A 3H3LA 1S0EA 3WNKA 4YG6A 3VZNA 4Z07A 1CZSA 1O4TA 2TBVA 4DEVA 1QOOA 4N43C 1V9U3 4MUVA 4YNIA 2HWE1 5KHHA 4IV3C 1D2QA 5JXIA 4PDWA 1EV11 1TNRA 4AI0A 5FZKA 1GLHA 4AEDA 1S2BA 2UWBA 1AR83 4QM9A 1BBT2 5A6XA 4H7MA 4GZ9A 3HR9A 3I3BA 3JQWA 4IV1C 2O8QA 1D4VB 4E9KA 4X8NA 2DFCA 4N43B 4XCAA 4GJZA 2DVDA 1WMXA 3DL3A 5FZ1A 2W1SA 3NWKA 5FZAA 5LB6A 3AFKA 3WW1A 3P1IA 2JDNA 4HOOA 4XDOA 3I3MA 3KV9A 5JSRA 1W0NA 1JUIA 3WT3A 4XF9A 1W9TA 1AJOA 3HBZA 3H50A 1CAXB 2ZS6B 1PZ9A 4U36A 4INDA 3ZYJB 3VL8A 4CEWB 3V65A 3LOIA 4WVWA 4PQQA 1LGNA 1RMU2 4OQ9A 5A7PA 3JBG2 2RM21 4DQAA 2DU1A 5ABJA 1RUH2 5H9PA 5AC91 5IJRA 1RMU1 4I0BA 3OBRA 4GQ7A 1PNFA 3OGVA 2Z5WA 4NRMA 5JVVA 5FMOS 1CAWA 3GM8A 4I3GA 2XR4A 1NT0A 4LOSA 3OUIA 2VJXA 5LBEA 1UU6A 4CCDA 1DQ1A 1KFXL 1K42A 1HB1A 2JG9C 2Z4FA 5FPZA 4Q26A 5K8SA 2WWSA 1HRV2 3UGFA 1CQ9A 2BPA2 2VNOA 2VOXA 4PJYA 1JOPA 2V5DA 1RVF1 2Y26A 2YC0A 3VDCA 4DPNA 4YW5A 4R4ZA 1XYPA 2CGNA 4XZPA 1WLDA 4B3NA 1XXNA 1AL21 1Z0HA 4EN0A 1D0GA 3MFAA 5E8AA 1BVVA 3MIFA 4Q4W3 1OMIA 5FZ7A 3UL2A 2VNRA 3DYOA 3I3DA 3UJQA 3IN9A 4AWDA 5A3TA 4OYUA 4SLIA 3FBMA 3K75B 1XBFA 2HWD2 4MOAA 2RMU1 4PIXA 3NNMA 4HVQA 1UZ0A 1Q8QA 4XHBA 1QH7A 5CKQA 3RDIA 3EHKA 4RA0A 4MGSA 4YFWA 3DUIA 3POWA 5T55A 4KBZA 2P4EA 1LNSA 4ORFA 1YFYA 2WNUC 1JH5A 4WVVA 4CDXA 1H8TA 4AVVA 4CP1A 5JPMB 4OFGA 3U0ZA 2BGCA 1CZVA 3D0JA 4YGDA 1FPN2 3GJBA 1SLAA 2RS53 3KV6A 4IEVA 2XBO3 1RUC2 4XABA 1JHJA 3A23A 1EAH2 2QDRA 1RXGA 2VY0A 3RQ0A 4MGYE 1UCXA 3GF6A 1UZVA 1LTEA 1W6NB 3SEEA 1ND3C 2LUWA 4XVHA 3WDWA 4C90A 1S4CA 4LO7A 1SFYA 3VDDA 2Q8EA 1RUI2 1AXYA 2UYAA 3ACFA 3O0WA 1GP4A 4GB32 4UF0B 4TTGA 4P9WA 2QQIA 2VBBA 4LMFA 4JGYA 4LR4A 1LR5A 4S2HA 4DB5A 1IZ3A 1C8M3 1DGLA 4NPMA 2EALA 5A3MA 3M2MA 4XTPA 5FBZA 1Y4WA 4MH0E 4NO4A 1BK0A 3MUZ1 5L9BA 4EWAA 1VP6A 1PZ8A 1C1FA 1UZZA 2JG8A 2LM3A 2ARCA 2PTMA 3POJA 3QD6A 5E1RA 4YVSB 4DO0A 1ULGA 5FZFA 2D7FA 1KXGA 2E63A 2VGDA 3B9IA 5DG1A 4YW2A 1YXWA 2VOWA 3RMXA 2JXAA 4O9GA 2ZHMA 3TEXA 1PMIA 2YV8A 4OHVA 1DU3D 5F8PA 2W0XA 4O61A 2CU5A 4FFFA 3AM2A 2YROA 2V4VA 1HQNA 1COV1 4NHKA 3K2OA 3RGBA 4CA9A 4ZU5A 4ZXKA 5FZHA 3E97A 1TEIA 1UKRA 4XF4A 5DPNA 4QPGA 3V56A 5J37A 5BNNB 4GA9A 1I9RA 1GP5A 2Z2SB 2ZKLA 2JE9A 3R0RA 3RRDA 3FLPA 1UU5A 2YG0A 4QGMA 4K1ZA 2WZ8A 2K2SA 3KF5A 3POFA 3M3OA 5FZEA 2RJLA 3VKLA 4FTSA 1VJ2A 1KS4A 4P9XA 3NAPC 1QNWA 1X9PA 4JRLA 1RUF3 1LHNA 4TSVA 1DGWA 1XE7A 4QPGB 1WKYA 1REDA 3JD73 1GICA 4NJ4A 1YEWA 2JD9A 1R1A3 1MS3A 4R9AA 2W47A 1YJLA 4UFIA 4D3WA 3RZMA 1ZZ7A 4IESA 2R071 2WQZC 4NR1A 4GB31 4YW1A 4DS0A 1V6MA 3I3QA 4XFFA 1AL23 2Q0AA 3B00A 1AJKA 2DDUA 4A41A 1C8NA 3BALA 2Q1ZB 3I2HA 4GWIA 1XU1A 5LEKA 4KGGA 5FY7A 3H7YA 1RUC1 2XLGA 4JDOA 1QJX3 4LHSA 4QQ2A 2MNGA 4W6WA 1POV0 4BXFA 1ZZCA 3TYJA 4UFLA 1LJ7A 2UU8A 1OOPC 3J7MA 3HMYA 1PIV2 1G9DA 3VBSA 2MEV3 2WFF3 4CDXC 1ZREA 3R4SA 3POEA 3WD5A 1VMJA 1J1LA 4ISQA 4HK9A 1DIWA 1AZDA 3ZYPA 3WF4A 1QJEA 1K5JA 4WVZA 5EHDA 2VO5A 3I7DA 4OLLA 4OUEA 1ENQA 2VZRA 5F2SA 2BW8A 2ZHKA 3WF2A 3GALA 1NE4A 5T5PA 2RS31 1PO21 3NAPB 4RL7A 3T09A 1W2AX 5DG2A 2PA7A 4MXWB 3PUQA 3LIHA 4QAWA 4CP9B 3RZHA 1HW5A 4CUGA 4HANA 1QWRA 2ETEA 4I30A 2R041 1VBD3 3JUUA 5FWEA 1LOCA 3VBFC 2ZGQA 1RUG1 2BGPA 1R093 5FZMA 3ZXEA 1GZTA 5IVYA 3ZFGB 5EJZB 2ZGRA 5BNPA 3FC0A 4AOCA 3RWNA 3EQEA 1IPJA 4M4PA 3ZSEA 4D6QA 5HCFA 2X53S 1H2MA 4QX8A 4V1PA 4AEDB 4LE3A 4Q5OA 4JZRA 4FPCA 4EZHA 3IWZA 3PMEA 4RS5A 3WQ1A 1T6BX 2VZTA 3D3AA 3G6JB 3W5MA 2XB6C 4QDRA 5EJ3A 5JR2A 2DCZA 1CN1A 5IK4A 2C9KA 4W4ZA 5FJKA 1ZRCA 1EV12 5IVCA 1QXJA 2D3SA 1RHI1 2P37A 2VM9A 4UI9L 4CXYA 3VD7A 3WG4A 3DPRC 3N9QA 1A8MA 4E2QA 1GP6A 2C0ZA 4N90A 1C5IA 4BOWA 2YPDA 4WM8C 2B5HA 5FJHA 3HJRA 4RFRB 4COVA 3E5XA 3LOBA 1G9FA 3GHMA 4LJHA 5L7OC 2WS91 4GMP3 3J9SA 1LULA 2W39A 1UO9A 3Q8BA 3I2DA 4LORA 4RFT0 2K9ZA 3RPQA 3I2OA 3LKJA 1DF0A 4LE4A 1WW5A 4A6SA 1HX6A 3FX3A 4GWJA 5CZKA 4AGRA 4B1LA 5KXDA 3UYJA 2ENRA 1X7NA 3IPVA 1JYXA 4CEYC 3N9MA 1LRHA 1DLCA 1LOFA 2GC3A 1AR92 3HOBA 3LB9A 2XQRA 4JGYC 5FP8A 1W05A 1ACCA 1W06A 1JZ5A 2E9QA 5FFOC 2VXRA 4DUWA 1RMU3 4IGOA 5FLJA 2HLEA 2WZR2 4YZ3A 3ON7A 4UFKA 1DG6A 2HWF2 3ZSJA 3EO6A 4OI0A 3AL6A 4CUCA 2F4LA 4DUXA 3NNGA 5D8AB 5GLZA 1RGSA 2WFPA 4UT5A 4LA2A 2GNTA 1TQ5A 4JC1A 4H2AA 4HPKB 5CAZA 3O14A 3WP4A 3DXTA 4L97A 2VCBA 4WM7A 2AR6A 4MVTA 1Q8PA 1RUH1 5FY0A 3VBRC 4AE2A 3LDBA 1F5JA 3ACLA 3CBNA 1QOSA 4A3ZA 5BNNC 5I0RA 1O91A 2VZVA 3DN7A 4LK6A 3TN92 3H9AA 4NWWA 2AREA 3T4HB 3URFA 4QB1A 3KCYA 5IK5A 3PJQA 5KC6A 1MEC3 2VPVA 1ZZ8A 2FCUA 4X8PA 1SBEA 3N7JA 1QJU3 4B4RA 3HAGA 5HXMA 4BQ4A 1JZ7A 3OPTA 5AFEA 4RN5A 4CCLA 1RYYA 2W1WA 2JG9B 1E5RA 3OUJA 4DXRA 2RMU3 5DABA 5J3UA 4P02B 3F95A 3NSTA 5BY5A 2B8MA 2HWC3 4NIHA 2H6BA 1YUDA 3AYCA 2IXHA 1JTZX 3EJKA 1QEXA 1AR71 4Y5Z0 3ZLIA 3E6BA 5EQUA 5K9YA 3EBRA 5A7WB 4G9SB 4BISA 4C0BA 1YWKA 4I3PA 5C4WA 1EUTA 1EPZA 2P3JA 1NY72 1W9FA 5JIAA 3HVDA 4YLZA 2W1QA 3POIA 1DQ5A 4BHPA 4ZU7A 4HVOA 5DUVA 5C9AB 1CPMA 1JZ2A 4I0WB 2BV4A 3ZR6A 1DGRN 2VOTA 3MBWA 2WZR1 1W6QB 1VE0A 2ZHLA 4FPHA 4TYSA 3NVCA 3CDZB 1WMEA 5FZOB 3S30A 1PK6C 2PXJA 4MADA 2C4XA 5TSWA 1EAH1 3SXWA 1WW7A 5FO8B 1UL9A 2VMIA 3JBG3 4AVTA 2MHFA 2A75A 2VG9A 3WF3A 1O3SA 1PHMA 2VD7A 4Z8BA 5CU1A 3S5AA 4FPFA 1V0AA 1GZCA 4Q1PA 5HCAA 4YW3A 4BK4A 2ES3A 3ETPA 3J7NA 2A3WA 3USUA 3AXDA 1T6GC 3BODA 4XEZA 1G9CA 1F2NA 4XBLA 3IDCB 5EWSA 1H4HA 3MDPA 1HLCA 4IDZA 5LATA 1XC6A 4IE0A 4AGGA 2JEMA 2DCKA 2V5YA 4FO9A 5C71A 1FOD3 2ZGOA 3ZN5A 1PVC3 2DURA 1TMF2 3TEZA 4D69A 4NN0A 2HH9A 3ZDVA 4KGQA 3KQRA 3RWKX 1QJFA 3J8F3 1FNYA 5A7WA 2R042 1DCSA 3AKSA 2WN3A 4UFJA 1F15A 2YZ4A 2VOKA 4KWUA 4TN7A 3OYWB 1U0AA 3AKQA 4E2SA 1RUD2 4MHUA 4N8MA 5LA1A 4YVWC 1CONA 2G9ZA 2HWD3 2UWCA 4FPJA 1NA1C 3ZFFC 1WW6A 4YW7A 3ACIA 2HWB3 2A6XA 2Y64A 3A22A 4XF0A 5BYNA 3MPPG 1W6PB 2DUQA 2VCMA 2WNEA 1GBGA 3BKZA 5ACA2 1LCLA 4FAGA 4P9IA 1QJU2 2E26A 4Z92B 1D4M2 2FD8A 3ZKYA 3SCFA 1XJAA 2AC1A 3WNLA 5CFDC 2CGPA 3OSDA 2RJ2A 3MV01 2RR11 5C6CA 1N3QA 4JTOA 4FBFA 4LXLA 1AF9A 5FYMA 4AYUA 5LCWL 1Y9QA 2A70A 2OPWA 3IAPA 4JQTA 1F5FA 2O1QA 1VBE2 5A3WA 1PIV1 1UZWA 1SZBA 1UY0A 2QQOA 2XKPA 4ASKA 2OZ6A 3HD8B 5A3PA 4COYA 4IV1B 1VBD1 4QHBA 4Q27A 3VZOA 3WNNA 1K12A 2F4PA 4QDSA 5GZDA 4AFDA 2JWPA 1QJY1 1ZYBA 5GLVA 3ZPYA 1US2A 4IV3B 3GZTB 1PIV3 3IKWA 3PMSA 5BNOA 3HNYM 1W6MB 2ZMNA 4ISRA 3VV1A 1QJY2 1SDWA 3FHQA 1HQLA 3GJAA 4DXZA 1SQ4A 1RUNA 3RZKA 4CP9A 4RGGA 4FPKA 1SHWB 1ZNPA 3SNMA 3IAQA 3AP4A 2C26A 1AYM2 3ZFEC 2VUAA 4GWNA 4KU8A 1UYZA 4XAEA 1AR62 2WKKA 4CP0A 1DQ0A 2I2SA 1JW6A 4IGQA 1AYM1 3USUB 1APNA 4Q4W1 2PHFA 3VKOA 1DLLA 4MV2A 1PGL1 4K9SA 3FL7A 2FHRA 2OA2A 4SBVA 1OURA 2WAOA 1J3PA 1DYPA 1SFPA 1JODA 3A21A 3KF3A 4Q0VA 5JOWA 4RS5B 2YBPA 1VBC2 3RI9A 2Y6GA 3R4DB 3U4SA 3I2GA 3WSOA 1WA4A 5FPXA 2SLIA 3A7QA 2JECA 5GZGA 4FTBA 3INAA 3PUIA 3AZWA 3S5QA 1WD4A 4XF3A 4DZGA 2HBUA 1ZZ9A 3IPVB 2Y6HA 3SKJE 1DP0A 2A6VA 1VMFA 1S0CA 2GZWA 4FI9A 1WCSA 3Q8FA 1OHFA 5FKCA 1W2NA 4Q4V3 4X6QB 1SCRA 1ZBA2 5FK8A 2EXIA 1HV1A 2QQKA 3MFCA 3VD4A 4Y26A 5DXDA 1CVNA 3FN9A 1N1SA 1ODNA 5KBFA 3MLLA 3C7HA 1YJKA 2RM23 3T2PA 2R063 2OIIA 1W90A 2PLV2 2WSUA 4TWTA 5KWRA 1K3IA 3CO2A 3I2JA 4FOQA 2BJSA 3WEZA 1JI6A 5IK8A 5BNOC 2F6BA 2ZHNA 3LPGA 4JGZB 3GBGA 5J98B 3X29B 4K20A 3AJYA 3ZYRA 3ILFA 4ZZ5A 1ZRFA 5LBCA 2I45A 1VBB1 1XNDA 4RSUA 2OUHA 4XDPA 5AC92 1LU1A 1OPOA 3MUY1 2E6VA 2RR12 1OSGA 4KNCA 1GANA 4OULA 4DRVA 3I8TA 4EWEA 2WNVA 5IWFA 4N53A 1DYKA 4E2GA 4AFMA 4UOJA 1V70A 4BQWA 4BIFA 3LEKA 2EIBA 4BLIA 2ADDA 3ACHA 5FBJA 3O1VA 4CTEA 3AC0A 3WQ7A 1QY4A 1WLTA 5C4WC 2BWCA 1OFSA 2JDKA 1AR73 2BNMA 4JRAA 1X50A 2JIJA 4MGIE 1OLQA 1JYVA 3AYEA 1Q3EA 4RGKA 5JLVA 3D6EA 5FZ4A 1RHI3 3WF0A 4UFMA 2XUEA 2Z69A 2R16A 2HYKA 3FJSA 4LBMA 3BOWA 1V6IA 3NV4A 2GMMA 4MGQA 1ULEA 5DDJ3 5E88A 3DCQA 1ZA4A 4B7EA 5JI7A 1O7FA 3AYAA 3K4ZA 1MS4A 2D5FA 2HEVF 2RDQA 2VQAA 4QGLA 4QMAA 1UYXA 2QQUA 1KFUL 2IVJA 2Z79A 2VQ0A 4QGNA 5FMDA 1VBA3 1S0FA 2E53A 2YU2A 4NROA 4TLGA 2BGOA 5FMCA 3WQBA 3MO4A 4N7IA 1H2NA 2D6NA 1AX0A 3M4FA 4FOWA 3JCIA 3WV6A 4MGTA 1QXPA 3PVOA 5E89A 1OPMA 4FPLA 3MZHA 3PNAA 1AR81 3GBWA 2WINB 1CX1A 2GNBA 3FFZA 5BNNA 4Q4Y2 4UBGA 1GU3A 3LE0A 2XOMA 3I49A 4NAMA 2Q8CA 5JMOA 4AEDC 2O14A 1ULPA 5HPOA 1HIXA 4EROA 3PLQA 1CESA 1RJ7A 3ZM8A 4XJZA 5DAPA 4XFAA 3N9NA 1RUD1 1HRI3 2NN8A 5J7MA 4LO5B 3TRSB 4ZPIA 4KH9A 1LGBA 3H1WA 3H42B 3FE5A 4FXGB 2IWGB 2W52A 1UPSA 2R061 4PCRA 1A78A 2F17A 3TNQA 5JPNB 1H1IA 4TLFA 2ZEWA 1AXZA 1PK6A 2WIIB 1UMHA 3N7MA 3I54A 3VKMA 1B35A 1TME2 2ZGNA 4XCBA 3RS6A 4FTEA 1GOFA 3K3NA 3WDUA 5IT6A 1OA2A 2ZTNA 3AP9A 4LBKA 3I59B 5A1FA 2IXLA 2RM22 3ASIA 3L9JT 1FXZA 3ABZA 2VZUA 4B8EA 1OQDA 1KITA 1N1YA 2AEYA 3K77A 1SLIA 4OHWA 4QPIC 4YWAA 3WZ1A 2RDNA 3ZFGA 4CCCA 4BIOA 1NCQB 2W9XA 3OBTA 3KD4A 4WZCA 2ZGPA 4NHLA 5FPBA 3B5LB 1XYNA 2XJTA 5F5IA 4CCEA 2VU9A 2VOVA 2A71A 1GFF2 2D44A 5C7GA 2B46X 3GBFA 5ISLA 2E33A 4M3CB 3WW3A 3GXUA 3ITQA 1JYIA 1NCRB 1H9PA 3MLJA 1KQRA 1QXRA 2A5ZA 1H8TB 2CWSA 1Q43A 4PLMA 2ORXA 3MIHA 1ODMA 1POV3 2Q8DA 4DIQA 4EE2A 5JAXA 5FY4A 3KQ4B 4IETA 1SBFA 3ZN6A 1BMV1 4NIDA 1W99A 4M4RA 5FPLA 2EAAA 2BVBA 1NXMA 1MS1A 2ZGKA 4BCUA 2IUWA 3O1RA 1ZVFA 2Q5TA 5FZ8A 1K45A 1NYWA 2XPJA 1WW4A 2XJQA 1MEC1 2AENA 2Y6LA 4MXWA 1XOYA 1GZWB 5C3RA 1H2KA 3HQUA 1TMF3 3T1LA 1MEC2 4KWLA 3NV3A 4XQ4A 3THCA 1W6OA 4K8RB 1PMHX 1WBFA 3AVRA 5I91A 3P3PA 3NL1A 4UW3A 1JOJA 4F3JA 2R043 1TME1 4K3UA 2HWE2 2EA7A 2JKXA 1O59A 2Y33A 4IEZA 4AHWA 2I74A 1POV1 2K0GA 1EP0A 4ASLA 4AVAA 3KVAA 4CYDA 2CDOA 2VBPA 3I59A 4A3XA 1PO23 4D6RA 1LAJA 4NPLA 4BDVB 4Q8KA 1WGPA 5IFTA 2RHPA 1RL3A 2HWB2 4BQ2A 4IXLA 3MHZA 1HN0A 1SMVA 2J42A 1LHWA 1SLBA 1Y43B 3R6SA 1RUH3 3VLBB 1HQWA 5A7SA 4CCJA 4DXTA 1HXS1 3SCGA 3UV9A 4ASMB 1PGW2 4Y20B 3DYPA 2E7QA 3G7DA 2BWAA 3HNBM 2DWRA 4HKWA 4RHV1 5A3OA 2PFWA 2ZA9A 1HN1A 1DZQA 1WLWA 2QJVA 3P3NA 3FFQA 4LULA 1RIRA 3JQXA 3K3OA 4WM8A 5F39A 1OXCA 5JDBA 1EPWA 4IE4A 3KV4A 4XJAA 5CA6A 3AMHA 2PHTA 1DZRA 5FYSA 5CYYA 2VL4A 5DAVA 1GWLA 3WNOA 3ZYFA 2RS13 3LWCA 2VMDA 5LRRA 3W9AA 3VZJA 4JDNA 1VB4A 4KWJA 3BI3A 3BPSA 1TZOA 4OUSA 4XIKA 1J1TA 5G05L 5IAVA 1IGOA 5LZ6A 4CP2A 4XPVA 4AAXA 5IYYA 1ND3B 4LBLA 3I97A 1VAVA 2C9AA 3I3EA 1OBNA 4EN7B 1VAMA 1HDKA 1RUE1 3LAGA 1AYM3 5D21A 2PMWB 4AEJA 4ITCA 1XE0A 5BXXA 2WYSA 2OX0A 3BOPA 3WP6A 4CXXA 5T5JA 5CFCC 1BMV2 5A7OA 1FMD1 1UN1A 1YIPA 3B7MA 3VUOA 1WCQA 4N43A 4XFGA 4CDQA 3NRUA 3D8CA 2WA3A 2X5IB 4KI5M 4YW4A 1W04A 1WZXA 1XPWA 2VZ1A 3R05A 4P9LA 5FYZA 5FTTC 4XJWA 3SH5A 1IOAA 5A32A 1G9AA 3H0OA 1KRIA 1D0HA 1MQTC 3AKTA 4QQPA 5DAQA 2YC4A 2GP3A 2YMZA 1GZ9A 3MI8A 3H1MA 3J4UH 3C7FA 4I09A 1ND2C 1NCQA 5K0UC 3U14A 1UPIA 3MEPA 4NIIA 2UURA 1MZEA 2W08A 4QT6A 4AI1A 1HRV3 5CVRA 3E1F1 1NLSA 4URTA 2JDMA 1IKPA 2WRAA 2G9FA 3CJXA 2XDVA 3QH6A 2YU1A 4Q0QA 1W2TA 2OPKA 2BP6A 1RUG3 4QD2A 4R8HA 3WP3A 1VBB2 5E6HA 4BK5A 3OG2A 2P3YA 2ZJCA 3T0DA 4BA6A 3OD0A 1W8NA 3RZJA 5FYCA 2OXBA 2G1MA 2BU9A 1RUI1 3JXSA 3ZN6B 4EJRA 4FPEA 5FZCA 1T2XA 1YQ2A 2D40A 5FRAA 3ZYBA 2ZAHA 1G9BA 2MPFA 1AHSA 1QIQA 1YYNA 2B45X 2DBIA 2HWF1 1BJQA 1ULDA 4NHXA 1YFWA 2RR13 3E6CC 2R6QA 5FZOA 5HCBA 3GZAA 4JCKA 1OH4A 1OUSA 3BB6A 5JOYA 1PO13 1IS3A 2VTXA 4XFIA 2WO7A 1YI7A 5CADA 3M3IA 4P08A 1QDCA 4CDUC 3T0AA 1PX4A 1MZ6A 2XVGA 2JDAA 3RG0A 3SITA 5ANNA 3ZIWA 1UQXA 4XF1A 3MW4A 3IBMA 4IEUA 2XLAA 5JI9A 4DMIA 1WCKA 1NA1A 4HL0A 1NKGA 4CCKA 4M0NA 1B35C 1DHKB 4MZUA 5DAWA 5IUQA 4GKYA 2VZ3A 2V09A 2B39A 1A34A 4HKLA 2QFEA 3ECQA 5C3SA 1L7RA 1UKGA 1MQTA 4OZXA 4CU8A 5F5CA 5F5AA 5HCHA 3C2UA 4HG6B 2JDYA 5LY1A 1FMD2 3M3QA 5A7NA 1O3TA 1JU4A 2HEYF 1EYBA 1SDDB 1AL22 2VW0A 2A6ZA 5KHGA 1LGCA 4YARA 2HBTA 3DEMA 3POSA 3ZXAC 1JZ8A 4PHZA 1BBT1 5FZDA 1UAIA 5FQ0A 1JZ4A 3FLTA 2WS93 4GMP1 2VCCA 4YM3A 1N1VA 1Q8OA 1ONAA 1V00A 1ZBA3 3P5BA 4W65A 1PZ7A 3W20A 3V0BA 2J7MA 2R7EB 4GH4B 4BLJA 2VVFA 3ZXDA 2OVUA 2ET7A 5BV6A 1OH3A 1CAVB 2XVKA 5A6ZA 1HJGA 2D6PA 4AQ6A 1ULFA 2ZX2A 4PDWB 4H14A 4E4ZA 1ZBE1 2CY6A 4Q8LA 4LEJA 4DEQA 2XLFA 3UT0A 2D3RA 1G6NA 2ZEYA 3OY8B 1O8SA 3VBOC 2VXJA 5FZIA 2VE1A 2VUDA 3OGSA 4LLFA 4XFBA 2PELA 4COWA 5AC93 4B29A 5I0DA 1H0BA 3H8OA 1C8M1 4BQ1A 3VZMA 2RG4A 3IDBB 3ZIXA 4XUQA 4AEMA 3H7JA 4FCAA 4CUAA 1XNAA 4HSLA 1OC1A 4ET7A 5A1AA 3OJBA 1S0JA 2DF7A 1VBB3 3BIWE 3IMMA 3VD3A 1AX2A 5SV5A 5JSOA 5JCTA 1OKQA 1S0IA 2R49A 2VUCA 5LA0A 1KJLA 5I93A 3RJRA 5LA9A 3VBHC 1ALYA 3BUCA 3PDQA 1VPHA 3ZDSA 4IV3A 1AYN2 1SPPB 4V2VA 1A8DA 4N53C 3BN6A 2VZPA 1GYKA 1FOD2 4HMZA 4W50A 4HN1A 2P6HA 5JUVA 4MG2A 4XXAA 3TN91 4Y22B 3PVEA 3FUOA 2D3PA 3LEMA 1OD3A 5FY1A 3TBDA 4AI9A 3CHXA 5JXHA 5EFUA 5H9SA 3OPZA 1CAUA 3SKVA 2P3IA 1SPPA 1E57A 3B69A 4KG0A 4D7YA 2B7YA 2QQNA 5KXEA 4YM2A 5LEJA 3WG2A 4MXVA 5HV0A 2QTWB 1X33A 4BB3A 3RSJA 4TXWA 1VRH1 4QB6A 4D7SA 4QXBA 2P6CA 2AUYA 1W3XA 3HQXA 2G9GA 3ZSMA 3ZX7A 1NOVA 1LOBA 3NKGA 3ORJA 2VZOA 5JOZA 2PYTA 1Y9GA 1ZA7A 5IATA 5JOXA 2W2IA 3KZ4C 4L92A 3BYWA 4XACA 3VDBA 1DGWX 1OLMA 2WAAA 2JKBA 2UYBA 3WF1A 1W2UA 2HYXA 2A73B 4A2UA 4O9EA 3HQRA 2QCSB 5SV8A 1SG3A 4YPJA 1NQDA 2DV9A 2WSVA 3N35A 2WC2A 1CZTA 4XQDA 3ROUA 3VBSB 4KQ7A 5CFDB 1FV3A 3TEYA 1TME3 3KVBA 4IGPA 3K4DA 3TB0A 4Q4X1 1W0PA 3M3EA 3ZMNA 2NQYA 3MIEA 1I1EA 2XWJB 1GNZA 3AMPA 3WNMA 4KMQA 3THDA 2A3YA 2WNVB 4JV4A 1TMF1 3UKVA 1U12A 5JZGB 3SH3A 4ZU4A 3ES1A 3VBOB 3RYRA 4JX0A 2WO2A 3CJIA 4GWMA 5FPAA 5IHRA 4QX2A 2B4KA 4PDWC 4L11A 4ZXEA 3K51A 4HLTA 4WV8A 3M70A 3QBQA 4C0HA 1URXA 3DPRA 3TN93 1C4RA 5C8CB 3O1TA 2H0BA 1OLME 1K5MC 3AMNA 4E8CA 2VMEA 4DINB 4GH4C 4CCNA 2J1UA 3CZJA 3NJYA 1UOFA 1W8WA 3ZVXA 1SEFA 3BGAA 4AVSA 1A3KA 5FUNA 1RUJ1 2CL2A 1H2LA 2FDFA 4D7TA 1ENRA 1QOTA 2GDFA 2J1EA 3DGTA 3CEWA 4UAPA 2JICA 4CEYA 4NVPA 3T0BA 3WHUA 1RUJ2 4ES9A 2XGXA 5K0UB 5FZ6A 2YGMA 4IEYA 1QJU1 4QX1A 4R4XA 2KR2A 3PURA 4IW3A 2Q30A 1W2OA 2WWUA 3ACGA 4O65A 2WQ8A 5FZ9A 4WVMA 1LB2A 5E16A 3USSA 4IEXA 1ENXA 2W3JA 3KMHA 1NY71 4XJUA 3WVJA 4ARYA 4Y1XA 3D5OA 1UF2C 4MSVA 1W39A 4BXSV 4YFZA 2ZEXA 2EXJA 2CSGA 4IERA 4Q1RA 1PK6B 3C7GA 4QXKA 1BK1A 5C33A 3SISA 1UY3A 1XU2A 2AH2A 3KLSA 4COUA 1TE1B 2A7AA 3RYPA 5L36A 4KBBA 5I0TA 5GLWA 2YGLA 2JENA 3B94A 1W6PA 5CIRA 4OZOA 3NJXA 2CDPA 4LBQA 1OUXA 4GALA 4LBQD 2NMNA 1LHOA 4IUGA 3JB8A 5GLTA 3RZZA 1UNBA 1AR91 3B3QE 2LW8A 3VDDB 1BBT3 1J58A 4UBHA 3TWIA 3WUCA 3OYWA 1VALA 4WM7B 3N9PA 4Q4X3 1W8HA 2P17A 2X09A 3VBSC 1QF3A 1OQ1A 1KD7A 3JD71 2VC9A 2DTWA 2VZSA 2J22A 2ZZJA 3VBFA 2P2KA 1UY2A 2J1TA 2A1XA 2IXIA 2BZDA 2JG8B 5FO7B 5GJ6A 3ZFFA 1N3PA 2DVBA 4J6GA 1GUIA 3J7HA 5F6KA 1OD5A 5FR3A 3WCSA 4XAAA 2VNGA 1CR7A 3PUSA 4GB33 3WUDA 3WY6A 3ZPOA 5ABJC 4Y4YA 2CTVA 2FCVA 2FMYA 3DF0A 1DBNA 4MYEA 5DN2A 4WVMB 2DYCA 3B9CA 1WLCA 2D6OX 4YGBA 1C1LA 1CJDA 2Q1MA 2AYHA 3H8XA 1XRUA 2PAMA 2ILMA 2VH9A 4P00B 3VBRB 2NP0A 4G4FA 3ZXFA 2YFUA 3HT1A 3AJZA 1RUD3 2ZGTA 5I8SA 4CSWA 4LNVA 4A45A 3SH4A 4CDUA 3JB4C 2JB8A 3ME2A 4FQZA 4UW4A 1W0OA 4AI3A 2ZX3A 2R30A 4CE8A 1IS5A 1OFNA 2CAVA 2DCYA 2QQMA 2XJUA 3WW2A 3FBYA 3KT1A 4LIUA 4BZ4A 3PTRB 5AVPA 4BQYA 2RS33 1QU0A 1IHMA 1I5PA 4G3YC 3I2IA 4LO6B 4QKDA 1F9KA 3KWVA 4UXAA 5FLIA 2WO3A 4PBOA 5H9RA 4HK8A 2ID4A 4RR3B 5FYIA 3IM0A 2ZGLA 4CDWB 4EV0A 3I2FA 4JVAA 3O1MA 2LS6A 1RUJ3 4Q0UA 2K46A 4XMIA 1VRH2 1VBD2 3OY8A 4DUVA 2FDIA 2QE3A 1W6OB 4ES8A 1HKDA 4Z1VA 1O4YA 5FIXA 4FFGA 1F4HA 4HN0A 2QDNA 2C5DA 4GMP0 2VTFA 1LHVA 1BEV2 2XH6A 5DAXA 1GNHA 2XBO1 3NNJA 1XQNA 4LQRA 4FVVA 4PLOA 1RTVA 1NG0A 1IG0A 5T50A 1N47A 2A6WA 1OA3A 3ATGA 1JN2P 1QJY3 3J8F2 4YZ4A 1ASJ2 1KS5A 2O8OA 5FP4A 4CUBA 1X8EA 2A3XA 2TUNA 3T2OA 1E5SA 1ULOA 1ND2A 1DDLA 4QKBA 5FV3A 5F9TA 1GOHA 2JB4A 4QU1A 5LA2A 2IVIB 5FZLA 4AG4A 2TEPA 2WR9A 3A0NA 5EYXA 3OGRA 3ZMOA 3IB3A 2Y34A 3OCPA 3MV11 4AFAA 3VL9A 2XJVA 3PTYA 1EUUA 5IVJA 3OOXA 5FYTA 1W28A 4LKDA 5T5LA 3ZFGC 1D4M3 2DCJA 3LD8A 1SBDA 1AX1A 1VAKA 4HETA 4K6BA 5J96B 3VBFB 1PGL2 3ZFEA 5ANQA 4CDWA 5F37A 4NAOA 3UESA 3IT8A 3CLPA 2DVGA 4IEQA 4OUMA 1VBE3 3N9OA 1AYN3 3GCWA 1AR93 4U2AA 5DUWA 4E4DX 4XC9A 4B7KA 3BTYA 2JIGA 1OF3A 5FY9A 3ZXGA 2QNKA 2QQVA 2WWJA 4IE7A 4XHXA 1W8OA 1XNBA 3NNLA 3SMHA 2WZR3 1O3QA 2CAUA 2FMDA 3AP7A 3FMGA 2AZ5A 2ZX4A 5FXZA 1Z78A 1IQAA 3ZN4A 5C5TA 2ZGSA 5GZCA 2BYVE 1BEV1 4HONA 3MF9A 2RE9A 2W91A 3A0KA 4PF1A 4XURA 4D0QA 5C9AA 4BYYA 1H1MA 2L9LA 5LRSA 5HV4A 4QKFA 4W6XA 5D8AA 1H8TC 2JG9A 4BQXA 4AI8A 4YZ2A 5K7PA 4LTAA 1NX9A 1KEXA 4HT1T 5BNPC 5J36A 1M06G 4HZFA 4P9YA 4M0HA 1LOEA 3LFIA 4LBOA 2ZOEB 3GCXA 1QHDA 2GN3A 3LF7A 4FPYA 1MPXA 4L8QA 1FI2A 5CISA 1J3QA 2NYYA 2XBO2 3DXUA 4NHYA 1EAH3 1NCQC 5K0UA 1DFQA 2D6LX 4IE6A 1HB2A 3GZEA 3DKQA 1UX6A 1GQHA 2VTXJ 4BWOA 2QQJA 1RUI3 2Y8KA 1O5UA 2EAKA 4BPZA 2ATFA 5FZGA 2V4AA 2HJIA 3S7IA 4AHZA 2P3KA 3BPZA 4QXHA 5KHIA 3ZXJA 3EYPA 3O1OA 1LOAA 1RUE2 4GAZA 4MHRA 3AB0A 1Q56A 2WLQA 5C8CC 5J09A 3WQ0A 3BIEA 3T30A 5EIYB 2UY8A 4NMIA 4IV1A 2WQ4A 5DMYA 1UYYA 1NAEA 2W94A 3AP6A 5JSPA 4PIZA 3WX5A 1MQTB 4HBNA 2ARXA 3M7AA 3LEIA 3V0AB 3OGJA 2BNOA 5ERLA 4PIYA 4K1YA 5A6YA 2X5IC 4Q4Y3 2YYOA 3Q8EA 1ZBE3 1W8FA 3OEAA 5JR7B 2BFUS 5BNPB 1S1AA 3LDKA 3SHRA 1GNYA 2FZ2A 2P5BA 4XILA 4E4SA 3LA7A 3E6DA 4ZZ8A 4LUKA 3ENRA 3VHNA 1S2EA 2YBSA 3HN3A 1CIWA 4OI4A 2J1VA 2XMLA 1QQP2 2PHWA 1UOBA 5F1RA 1ST8A 2VMHA 3R4UA 4WBBA 2PHUA 4BM8A 3EB7A 1JHNA 1JS9A 4YVSC 1BQPA 1QQP1 5H9QA 1QH6A 4LA3A 1POQA 2IXJA 3AFGA 3C8XA 4CDWC 1NCRA 4RR3C 1XNTA 3NAPA 4XUOA 4Y1UA 3O12A 4KU7A 3MIGA 3TEWA 4LO4B 2FDKA 4BMBA 2R1BA 4S2GA 1PMJX 4A42A 4NIAA 1H1AA 3O0VA 4GXLA 4AR2A 2GN7A 1V6OA 1RXFA 2JE7A 3VB9A 3J26N 2NMOA 2DUOA 1PGW1 2GP5A 2RMU2 3LGRA 1F4AA 3KT7A 1WD3A 4GD4A 1W6QA 3CQOA 3POYA 2WABA 4MLOA 4PQ9A 1CGPA 1MS8A 3ZSKA 3K46A 3O0XA 2QQPA 3LQCA 2WT0A 4LKSA 4NRQA 3WOGA 3CU7A 4K21A 1GR3A 1Z7S1 4ATFA 3THPA 2IZWA 1CD3G 3WW4A 3LA2A 5AFBA 1SFNA 5EJ1B 3K4AA 1VLNA 4PI0A 5ACA3 2FQPA 3LPFA 1PX3A 5ABJB 4RYDA 1O5LA 4AF9A 4DFSA 1FV2A 5JXGA 1TNFA 3KCCA 3TNPB 1UXZA 2JG8C 4XUTA 4JGZC 4Y5TA 4CVUA 3LSEA 5BNOB 2GMPA 4JQRA 1JYTA 3VKNA 3PHMA 2R1DA 5JXJA 2Y6KA 3VBUA 4S2DA 2XONA 3WG1A 1J3RA 5F6LB 1WBLA 4EN9B 1VBA1 3VDDC 1W9WA 4L2NA 4EQVA 1W3VA 2BUKA 4PI2A 1AR82 5FYUA 2LTNA 5FDBA 1FX5A 2ZEZA 3AZVA 4CDQC 1ZZ6A 3ZO0B 5A80A 3ZR5A 4E4HA 2BQPA 2C6SA 1AL0G 1C28A 1E5HA 1HJFA 3ILNA 3UK9A 3ZFFB 3LIGA 1SCSA 1XSRA 1G8WA 5CFDA 3AZZA 2CGOA 5C70A 1C57A 2B9UA 1AR63 1JYCA 3UJOA 1IPSA 3CKHA 2YDEA 2EXHA 4BE3A 3M8LA 2FDGA 1I3HA 1SACA 1W8TA 4XBNA 3OEBA 1ZBE2 3HN1A 4RQPB 2HKXA 4BQ5A 1RUOA 1DGRA 5F3GA 4Y33A 2KM2A 3LZZA 2XL9A 4CEWC 1H30A 2W95A 3DECA 4LOTA 4AL9A 4YG3A 5A70A 5F3IA 5GKAC 1CIYA 1Z7S3 5FCCA 2XUMA 3UKNA 4N9IA 1YCIA 3ZFEB 5D2AA 2P1BA 2CWMA 5DQ0A 5FOBB 3RI8A 4L9BA 1IS4A 3O5SA 2NM1A 1UOGA 4QPIB 2X05A 1R1A1 5CKNA 2GNDA 2VVEA 2DTYA 2ZAAA 4NPRA 4OHYA 2P34A 1YFUA 3FZ3A 4H3WA 1CPNA 2KA3A 3ZOIA 3WNXA 2OS2A 4AZZA 3OPWA 2J1AA
chains in the Genus database with same CATH topology
3IDEA 5CFCA 3H1YA 2GC2A 4Y1ZA 5CG8A 4KG8A 1K5MB 3LSDA 1QNYA 2IC1A 2QVSB 4YM0A 3KGZA 4ZKTB 2DUPA 4DY5A 2WL1A 4YM1A 1Y3TA 2H6CA 4K8FA 2BVVA 1HXS3 4AXOA 4FP3A 1FT9A 4YVWA 1LKNA 3MF6A 3E5UA 1YNAA 2XJSA 1HRI1 3M3CA 4RD7A 5A33A 1G7YA 1CAXA 1OA4A 2VVDA 1ULCA 3WDWA 4CEWA 2NPIA 2ZACA 2ZPXA 3LCPA 2Z42A 3H3ZA 1DZTA 1HV0A 3FWEA 4LBJA 1FPN3 5DDJ1 5L73A 1R083 2XJRA 1XNKA 5I8YA 3U10A 4Q4Y1 2D97A 1GSLA 2C1FA 5CB7A 4LHNA 3ELNA 5FOJB 4Y1YA 2WFF1 3JBG1 3NV2A 3WDXA 3NW4A 1JUHA 1O3RA 3S6PA 2IFRA 2RS32 3VHRA 2D5HA 4Y20A 1C8M2 4OHXA 1S2KA 3VZKA 4I0AA 1VBC3 3FUQA 5DZFA 3NJZA 2YUEA 2GC1A 4H55A 2V73A 1CAWB 4YG0A 1LHUA 1VBC1 3QH7A 3DV8A 4QQOA 1R1ZA 3BTAA 4JGZA 1QDOA 3HWJA 2D6MA 1KDMA 2XVLA 2O0OA 1DQ4A 1LESA 4RQPA 3VHPA 1AYN1 2R32A 3PVNA 2HWB1 3GHNA 4FP2A 4LHLA 2KXLA 4RQPC 4UW5A 1KDKA 5FREA 5A33B 4N53B 1COV2 1ZBA1 1UMZA 1HRI2 1EY2A 4ATEA 4N7UA 2UY9A 3NO8A 5AVAA 1S0DA 4FXKB 3WLUA 4AFCA 2VW2A 5JZGC 2VUJA 3WDYA 4CDQB 2ZX1A 3FLRA 4OI1A 2GALA 3AKPA 4BMEA 5L7OB 2GC0A 3DKWA 1RUE3 3D0SA 4WZFA 4WM8B 1U5ZA 3CJIC 4FQ4A 2LALA 2ET1A 4DNYA 1MR5A 1AR72 5FAXA 4A7ZA 3NKTA 5KC5A 1GQGA 4R9BA 4AFBA 1R092 2D93A 1QMJA 2SBAA 4Q29A 1X82A 1X8MA 1OI6A 2WS92 4K40A 1S55A 2X8KA 3MIDA 4HPKA 5BNQA 1RC6A 1W6MA 4YGCA 4IEPA 3U4XA 2EXKA 3N3HA 3WHTA 1RVF3 1RINA 5FO9B 2BTVC 5JMCA 2MEV2 1R082 4J1WA 1MVEA 3N4MA 1QQP3 4OHZA 2GH8A 2ZCWA 5CG9A 3VBHA 1PVXA 2DU0A 4I02A 5I8TA 2RS51 3MIBA 1D2SA 4Q4V2 1V9U1 5FLHA 1PNGA 3WDVA 3WR0A 5C8CA 3KT4A 4IEWA 1SLTA 1S0BA 2E51A 4KWKA 4LO8A 5EZWA 2PLV3 3KSCA 4LBQB 2BBVA 2Y38A 2PN5A 3MW3A 4CEYB 4Z2WA 2UWAA 2XWBB 4F7ZA 1YHFA 3U11A 1IS6A 1I6XA 5JWPA 1BYHA 4QM8A 4CDXB 1NZCA 1S0GA 5DZGA 4LHKA 4A7KA 1UU4A 1F31A 4EN8B 4PLNA 4EN6B 4AVBA 1QJZA 1RITA 4MX3A 3QLQA 5L19A 1CJPA 1R091 3B93A 1FOD1 1IPKA 1DQ6A 3VBUB 1NE6A 2VECA 1ZRDA 1AUYA 5ACA1 2I07B 2E7AA 4MGKE 3KCXA 5DUXA 1RHI2 2OZJA 4META 1ASJ1 1U5IA 5IK7A 4JDMA 3WP5A 2D43A 1MS0A 3WDTA 2PHRA 4QPYA 5KXBA 4J1XA 3QOPA 1VBA2 5I0SA 4Q4V1 5EV7A 1VRH3 5CBLA 4E27A 4XETA 2HWC2 1BZWA 1SLCA 2RJKA 4M3CA 4PBPA 1BEV3 1LEMA 2A6YA 4Q2FA 1B35B 3KGLA 1LODA 2QZ2A 3Q9OA 2WA4A 3AZYA 2R062 1ASJ3 2H0VA 4XBQA 1NQJA 2HWE3 4XQWA 3A4UA 2GMEA 4COZA 1L3JA 4CDUB 1V6KA 2XL7A 5KXCA 2X5IA 1KJRA 3IMNA 4FPGA 5A32B 1LOFC 3OF1A 4AHXA 3H3UA 1OOPB 3AKRA 5HXVA 2XJPA 5LK7B 1D4M1 1R1A2 3CF6E 1QGLA 2GU9A 3MW2A 4K7JA 3VBRA 3ES4A 1Q5OA 4F8AA 1G86A 1MACA 2IFWA 1HXS2 4Y1VA 2ERFA 2YPJA 1AXKA 4QQHA 1MS9A 1NLRA 1WMDA 3ILRA 2D98A 2BFUL 2YY1A 4XFCA 1FATA 1QJX2 1YLLA 3CNAA 2RS12 3OD4A 1I5ZA 3M1HA 4QPGC 1W6NA 4B4PA 4XYXA 1BCXA 4OI2A 1PO12 1ZRRA 4Y24A 5A3LA 3O7OA 4HKOA 1A6CA 1ND2B 1B09A 4H7LA 4XJ8A 5T54A 2AGSA 2PHXA 2X29A 1V6NA 1LU2A 5D8AC 3SLIA 4AGVA 2XKOA 4HVRA 4NWVA 1RB8G 3JZVA 1YIFA 3NV1A 5GLUA 5C8WA 3JU9A 1RJ8A 5HI0A 3HIFA 4AQSA 4P9JA 3ZYIB 4AEKA 5L7OA 1BXHA 4EWDA 4FSJA 2OW4A 4JGYB 2DVFA 3WG3A 5D1IA 1YI9A 3V0BB 5KHJA 2YHJA 4QU2A 4Q4W2 5KHKA 2R073 3KS7A 3PJYA 3AMQA 1WCDJ 1CAVA 3H8UA 1V9U2 4P14A 1UD1A 2GSYA 1BKZA 4HFSA 4RS5C 5F5QA 4IL7A 1H4GA 1PVC2 4AK3A 4C1WA 2IXCA 4FPOB 1RUG2 1WMFA 2VW1A 1C5HA 4FAHA 2XHKA 3AYDA 4P5HA 2B42B 2ZBJA 3MLKA 3ZSLA 3N36A 3DPRB 2GAUA 1OQEA 5J48A 1X36A 3ZXKA 2ZMKA 2ARBA 2HEWF 3KM5A 5EXOA 4I2OA 5DZEA 5I0UA 2ZZQA 3PVBB 4L99A 5JZGA 3V0AA 2WNUB 2JDZA 1VR3A 2PLV1 1IKQA 4OVEA 3ALQA 2YXSA 4DY3A 1N1TA 2PHLA 4IEOA 4DOUA 1Q8SA 4CRQA 3I4IA 3ZYGA 3L2YA 2ZGMA 3D82A 1PM7A 4DRRA 2WT1A 3GNEA 4GKXA 1PO11 2G4IA 4F83A 2ZMLA 4WM7C 5CFCB 2QKDA 4P9GA 1OOPA 1R081 2D6KA 4A7YA 4X6RB 3AK0A 5CNAA 3MICA 2HWF3 3TAYA 4XIOA 2HWD1 1FMD3 5T5OA 4B4QA 5BPXA 3VGIA 4LUMA 2EF6A 4YVWB 5T3NA 4C1XA 3VBUC 1LECA 2R0HA 4JAAA 3B02A 4GULA 3U07A 5DUUA 2MEV1 2Q8OA 1FPN1 1CAUB 5FMOL 4YZ5A 1NCRC 2ZX0A 4RR3A 4C91A 1ZZBA 3L2HA 2FZ1A 2OUJA 1LEDA 4M00A 2BEOA 2DFBA 2VMGA 2WZPP 4UW6A 3SCHA 4LT5A 1XE8A 3FHIB 4Y22A 4TZDA 2RS52 3E5QA 1YO8A 1RUC3 3AP5A 4D94A 3T2TA 5HBAA 3K48A 2EVXA 1GKBA 3VHOA 1H9WA 1MVQA 4GH4A 5GALA 3UKTA 5EYYA 1FAYA 2VULA 1ND3A 3ZXLA 5LK5A 4JTNA 4Q0PA 3AMMA 1Q8VA 2JX9A 3THTA 2GH2A 3BU7A 1QKQA 3RYKA 1UW8A 4NOTA 4FT8A 3VZLA 2QZ3A 4YVSA 5C9AC 1J59A 4HSJA 3CL1A 3S7EA 3S0MA 1XNCA 2PAKA 4M01A 1WUVA 2WNVC 4RHV2 1YFXA 1HRV1 4N9HA 1FNZA 2W68A 4XJ9A 4S2FA 1REFA 2ZABA 4AW7A 3BCWA 2HWC1 1U5YA 1V6LA 1RVF2 2FBEA 2WJSA 1Z7S2 3N7LA 4RGAA 4XOGA 4FOYA 4NHMA 4AQ2A 4BH9A 3AXEA 4XMAA 5JIUA 3C3VA 2XG3A 1JXNA 4PF5A 1BVP1 1H8VA 2PQQA 5GM0A 3RJ2X 4YZ1A 4XTMA 3CJIB 4AVCA 4M3CE 1RUF2 2WNUA 5GZEA 3JD72 1O4ZA 4GIQA 3TOJA 3W59A 1VIWB 1XYOA 3OTFA 5DDJ2 3AZXA 1U5XA 3WCRA 2JD4A 5BUVA 4MGZE 1DQ2A 4R9DA 2PHDA 4XW3A 2ZGUA 2GNMA 1MZ5A 1V6JA 1GZWA 4XDQA 3J8F1 4M3CF 3KB5A 3VN4A 2TNFA 3T1MA 4YSFA 2N7GA 2Y0OA 1K5MA 5C4WB 5FQ0B 3RNSA 1MZFA 1REEA 4YRDA 3VBOA 1FYUA 2EIGA 1PVC1 5B2GB 1LOGA 3LA3A 3W58A 4XE9A 3WINE 1GV9A 2CNAA 2PAEA 2WLPA 4Q4X2 1AVBA 2WFF2 1YRZA 4R52A 2QUOA 1QJX1 3VBHB 1JBCA 3OGGA 5T52A 4Q0SA 2BNNA 4XFHA 1UIKA 3ST7A 3GYDA 3D4KA 4KL1A 1ZX5A 2JJ6A 2NLRA 3WXPA 4ONUA 1PGSA 1Y7BA 4AQTA 2NZ9A 1MS5A 1M4WA 3VKFC 4W6YA 3HT2A 2WT2A 4QX5A 4Z82A 1VBE1 1OLRA 4QQLA 4XXPA 1F8VA 2E7TA 4I01A 2CV6A 2DVAA 3GZUC 2DCTA 4CZSA 2Q4SA 1NA1B 3APBA 2RS11 1RUF1 4LBNA 1ZM1A 2R0FA 2OYZA 4YGEA 2Y0IA 4R9CA 1PO22 1NXD1 4IQPA 3IIAA 4QPIA 1UIJA 3B01A 4LLOA 3MPBA 3QACA 4FOVA 4AI2A 3MGUA 2ZKNA 1N3OA 1SLLA 1VB2A 3AX4A 4RHV3 1ENSA 1C3HA 3EXUA 3ETQA 1AR61 2IXKA 5GZFA 1UZYA 4YYOA 3RMYA 1LENA 1COV3 3QCWA 4AHYA 1EV13 2CYFA 3MYXA 3N7KA 2R072 3V64A 1CX4A 1S0EA 4YG6A 3VZNA 4Z07A 1O4TA 2TBVA 1QOOA 4N43C 1V9U3 4MUVA 4YNIA 2HWE1 5KHHA 4IV3C 1D2QA 4PDWA 1EV11 1TNRA 4AI0A 4AEDA 1GLHA 1S2BA 2UWBA 1AR83 4QM9A 1BBT2 4H7MA 3HR9A 3JQWA 4IV1C 2O8QA 1D4VB 4E9KA 4X8NA 2DFCA 4N43B 2DVDA 3DL3A 3NWKA 3AFKA 3WW1A 5JSRA 1JUIA 3WT3A 4XF9A 1AJOA 3HBZA 3H50A 1CAXB 2ZS6B 1PZ9A 4U36A 4INDA 3ZYJB 3VL8A 4CEWB 3V65A 3LOIA 4WVWA 1LGNA 1RMU2 5ABJA 3JBG2 2RM21 4DQAA 2DU1A 1RUH2 5H9PA 5AC91 1RMU1 4I0BA 3OBRA 4GQ7A 1PNFA 2Z5WA 5JVVA 5FMOS 1CAWA 4I3GA 1UU6A 1DQ1A 1KFXL 2JG9C 5FPZA 4Q26A 5K8SA 2WWSA 1HRV2 1CQ9A 2BPA2 2VNOA 2VOXA 4PJYA 1RVF1 2Y26A 2YC0A 4DPNA 4YW5A 4R4ZA 1XYPA 2CGNA 4XZPA 1WLDA 4B3NA 1XXNA 1AL21 1Z0HA 4EN0A 1D0GA 3MFAA 5E8AA 1BVVA 3MIFA 4Q4W3 1OMIA 3UL2A 2VNRA 3UJQA 3IN9A 4AWDA 4SLIA 3FBMA 2HWD2 2RMU1 4PIXA 4HVQA 1Q8QA 4XHBA 1QH7A 3RDIA 3EHKA 4RA0A 4YFWA 3DUIA 3POWA 5T55A 4ORFA 1YFYA 2WNUC 1JH5A 4WVVA 4CDXA 1H8TA 4AVVA 4CP1A 5JPMB 4OFGA 3U0ZA 2BGCA 3D0JA 4YGDA 1FPN2 1SLAA 2RS53 4IEVA 2XBO3 1RUC2 1EAH2 2QDRA 2VY0A 3RQ0A 4MGYE 1UCXA 3GF6A 1LTEA 1W6NB 1ND3C 2LUWA 4C90A 4LO7A 1SFYA 3VDDA 1RUI2 1AXYA 2UYAA 4GB32 3O0WA 4P9WA 4JGYA 4LR4A 1LR5A 4S2HA 4DB5A 1IZ3A 1C8M3 1DGLA 2EALA 5A3MA 3M2MA 4XTPA 5FBZA 4MH0E 4NO4A 4EWAA 1VP6A 1PZ8A 1C1FA 1UZZA 2JG8A 2LM3A 2PTMA 3QD6A 5E1RA 4YVSB 1ULGA 2D7FA 1KXGA 2E63A 2VGDA 3B9IA 5DG1A 4YW2A 1YXWA 2VOWA 3RMXA 2JXAA 4O9GA 2ZHMA 1PMIA 2YV8A 4OHVA 1DU3D 2W0XA 3AM2A 2YROA 1HQNA 1COV1 4NHKA 4ZU5A 4ZXKA 3E97A 1TEIA 1UKRA 4XF4A 4QPGA 3V56A 5J37A 5BNNB 4GA9A 1I9RA 2Z2SB 2ZKLA 2JE9A 3R0RA 3RRDA 3FLPA 1UU5A 4QGMA 4K1ZA 2K2SA 3M3OA 2RJLA 3VKLA 4FTSA 1VJ2A 1KS4A 4P9XA 3NAPC 1QNWA 4TSVA 4JRLA 1RUF3 1LHNA 1DGWA 1XE7A 4QPGB 3JD73 1REDA 1GICA 1R1A3 1MS3A 4R9AA 1YJLA 4D3WA 1ZZ7A 4IESA 2R071 2WQZC 4NR1A 4GB31 4YW1A 4DS0A 1V6MA 4XFFA 1AL23 2Q0AA 3B00A 1AJKA 1C8NA 3BALA 2Q1ZB 5LEKA 1XU1A 4KGGA 3H7YA 1RUC1 2XLGA 4JDOA 1QJX3 4QQ2A 2MNGA 4W6WA 1POV0 1ZZCA 3TYJA 1LJ7A 2UU8A 1OOPC 3HMYA 1PIV2 1G9DA 3VBSA 2MEV3 2WFF3 4CDXC 1ZREA 3R4SA 3WD5A 1J1LA 4ISQA 4HK9A 1DIWA 1AZDA 3ZYPA 4WVZA 3I7DA 4OLLA 1ENQA 2BW8A 2ZHKA 3GALA 1NE4A 5T5PA 2RS31 1PO21 3NAPB 4RL7A 5DG2A 2PA7A 4MXWB 1HW5A 4HANA 1QWRA 2ETEA 4I30A 2R041 1VBD3 3JUUA 1LOCA 3VBFC 2ZGQA 1RUG1 1R093 3ZXEA 3ZFGB 2ZGRA 5BNPA 3FC0A 3RWNA 3EQEA 1IPJA 3ZSEA 5HCFA 2X53S 1H2MA 4V1PA 4AEDB 4LE3A 4FPCA 3IWZA 3PMEA 4RS5A 3WQ1A 3G6JB 2XB6C 5EJ3A 2DCZA 1CN1A 5IK4A 1ZRCA 1EV12 1QXJA 2D3SA 1RHI1 2P37A 3WG4A 3DPRC 4E2QA 1A8MA 2C0ZA 4N90A 1C5IA 4BOWA 4WM8C 2B5HA 4COVA 3E5XA 3LOBA 1G9FA 3GHMA 5L7OC 2WS91 4GMP3 3J9SA 1LULA 2W39A 4RFT0 3I2DA 3RPQA 2K9ZA 3LKJA 1DF0A 4LE4A 1WW5A 1HX6A 3FX3A 4AGRA 5KXDA 2ENRA 1X7NA 3IPVA 4CEYC 1LRHA 1LOFA 2GC3A 1AR92 3LB9A 4JGYC 2E9QA 5FFOC 2VXRA 1RMU3 5FLJA 2WZR2 4YZ3A 1DG6A 2HWF2 3ZSJA 3EO6A 4OI0A 5D8AB 5GLZA 1RGSA 2WFPA 4LA2A 2GNTA 1TQ5A 4JC1A 4HPKB 5CAZA 3O14A 3WP4A 4L97A 4WM7A 2AR6A 4MVTA 1Q8PA 1RUH1 3VBRC 4AE2A 1F5JA 3ACLA 1QOSA 5BNNC 5I0RA 1O91A 3DN7A 3TN92 3H9AA 4NWWA 2AREA 3URFA 3KCYA 5IK5A 3PJQA 5KC6A 1MEC3 2VPVA 1ZZ8A 4X8PA 1SBEA 3N7JA 1QJU3 4B4RA 3HAGA 5AFEA 2JG9B 2RMU3 5J3UA 3NSTA 5BY5A 2B8MA 2HWC3 2H6BA 1YUDA 3AYCA 2IXHA 1JTZX 3EJKA 1AR71 4Y5Z0 3E6BA 5K9YA 3EBRA 4G9SB 4C0BA 1YWKA 4I3PA 5C4WA 2P3JA 1EPZA 1NY72 5JIAA 4YLZA 1DQ5A 4BHPA 4ZU7A 4HVOA 5DUVA 5C9AB 1CPMA 4I0WB 1DGRN 2WZR1 1W6QB 2ZHLA 4FPHA 4TYSA 3NVCA 1WMEA 3S30A 1PK6C 5TSWA 1EAH1 3SXWA 1WW7A 5FO8B 2VMIA 1UL9A 3JBG3 4AVTA 2MHFA 2A75A 2VG9A 1O3SA 1PHMA 4Z8BA 5CU1A 4FPFA 1GZCA 4Q1PA 5HCAA 4YW3A 2ES3A 2A3WA 3USUA 3AXDA 1T6GC 3BODA 4XEZA 1G9CA 1F2NA 4XBLA 3IDCB 5EWSA 1H4HA 3MDPA 1HLCA 4AGGA 2JEMA 2DCKA 2V5YA 4FO9A 1FOD3 2ZGOA 3ZN5A 1PVC3 2DURA 1TMF2 4D69A 4NN0A 4KGQA 3KQRA 3J8F3 1FNYA 2R042 3AKSA 2YZ4A 2VOKA 3OYWB 1U0AA 3AKQA 4E2SA 1RUD2 4YVWC 1CONA 2HWD3 2UWCA 4FPJA 1NA1C 3ZFFC 1WW6A 2HWB3 2A6XA 4XF0A 5BYNA 3MPPG 1W6PB 2DUQA 2WNEA 1GBGA 5ACA2 1LCLA 4FAGA 4P9IA 1QJU2 4Z92B 1D4M2 3SCFA 2CGPA 5CFDC 5C6CA 2RR11 1N3QA 4JTOA 4FBFA 4AYUA 1AF9A 1Y9QA 2A70A 1F5FA 2O1QA 1VBE2 1PIV1 2XKPA 2OZ6A 3HD8B 4COYA 4IV1B 1VBD1 4QHBA 4Q27A 3VZOA 2F4PA 5GZDA 4AFDA 5GLVA 1QJY1 1ZYBA 3ZPYA 4IV3B 3GZTB 1PIV3 3IKWA 3PMSA 5BNOA 1W6MB 2ZMNA 4ISRA 3VV1A 1QJY2 1SDWA 1HQLA 4DXZA 1SQ4A 1RUNA 4RGGA 4FPKA 1ZNPA 3SNMA 3AP4A 1AYM2 3ZFEC 2VUAA 4GWNA 4KU8A 1AR62 2WKKA 4CP0A 1DQ0A 2I2SA 1JW6A 1AYM1 3USUB 1APNA 4Q4W1 2PHFA 3VKOA 1DLLA 4MV2A 1PGL1 4K9SA 2FHRA 2OA2A 4SBVA 1J3PA 1DYPA 4Q0VA 5JOWA 4RS5B 3RI9A 1VBC2 3R4DB 1WA4A 5FPXA 2SLIA 2JECA 5GZGA 4FTBA 3INAA 3AZWA 1WD4A 4XF3A 4DZGA 1ZZ9A 3IPVB 2A6VA 1S0CA 2GZWA 1WCSA 1OHFA 4Q4V3 4X6QB 1SCRA 1ZBA2 2EXIA 1HV1A 3MFCA 4Y26A 5DXDA 1CVNA 1N1SA 5KBFA 3MLLA 1YJKA 2RM23 2R063 2OIIA 5KWRA 2PLV2 2WSUA 4TWTA 3CO2A 4FOQA 5IK8A 5BNOC 2F6BA 2ZHNA 5J98B 4JGZB 3GBGA 3X29B 3ZYRA 4K20A 3AJYA 1ZRFA 3ILFA 2I45A 1VBB1 1XNDA 4RSUA 2OUHA 5AC92 1LU1A 1OPOA 2E6VA 2RR12 1OSGA 4KNCA 1GANA 4OULA 4DRVA 3I8TA 4EWEA 2WNVA 4N53A 1DYKA 4E2GA 4AFMA 1V70A 4BIFA 4BLIA 4CTEA 3WQ7A 1QY4A 1WLTA 5C4WC 2BWCA 1OFSA 1AR73 2BNMA 4JRAA 1X50A 4MGIE 1OLQA 3AYEA 1Q3EA 5JLVA 3D6EA 1RHI3 2Z69A 3FJSA 2R16A 2HYKA 4LBMA 3BOWA 1V6IA 3NV4A 2GMMA 1ULEA 5DDJ3 5E88A 4B7EA 1ZA4A 5JI7A 1O7FA 3AYAA 1MS4A 2D5FA 2HEVF 2VQAA 4QGLA 4QMAA 4QGNA 1KFUL 2Z79A 2VQ0A 1VBA3 1S0FA 2E53A 4N7IA 1H2NA 2D6NA 1AX0A 3M4FA 4FOWA 3JCIA 3WV6A 1QXPA 3PVOA 5E89A 1OPMA 4FPLA 3MZHA 3PNAA 1AR81 3GBWA 2WINB 2GNBA 3FFZA 5BNNA 4Q4Y2 4UBGA 4AEDC 1HIXA 4EROA 3PLQA 1CESA 1RJ7A 4XJZA 4XFAA 1RUD1 1HRI3 2NN8A 5J7MA 4LO5B 3TRSB 4KH9A 1LGBA 3H1WA 3FE5A 4FXGB 2IWGB 2W52A 1UPSA 2R061 4PCRA 1A78A 3TNQA 5JPNB 1H1IA 4TLFA 1AXZA 1PK6A 2WIIB 3N7MA 3I54A 3VKMA 1B35A 1TME2 2ZGNA 3RS6A 4FTEA 3WDUA 5IT6A 1OA2A 2ZTNA 3AP9A 4LBKA 3I59B 2IXLA 2RM22 3ASIA 3L9JT 1FXZA 4B8EA 1OQDA 1KITA 1N1YA 3WZ1A 1SLIA 4OHWA 4QPIC 3ZFGA 4BIOA 1NCQB 3OBTA 3KD4A 4WZCA 2ZGPA 4NHLA 3B5LB 1XYNA 2XJTA 2VU9A 2VOVA 2A71A 1GFF2 2D44A 2B46X 3GBFA 4M3CB 3WW3A 1JYIA 1NCRB 1H9PA 3MLJA 1KQRA 1QXRA 2A5ZA 1H8TB 2CWSA 1Q43A 4PLMA 3MIHA 1POV3 5JAXA 4IETA 1SBFA 3ZN6A 1BMV1 2EAAA 2BVBA 1NXMA 1MS1A 2ZGKA 4BCUA 1ZVFA 2Q5TA 1NYWA 2XPJA 1WW4A 2XJQA 1MEC1 2AENA 4MXWA 1GZWB 1H2KA 1TMF3 3T1LA 1MEC2 4KWLA 3NV3A 4XQ4A 1W6OA 1WBFA 5I91A 3P3PA 3NL1A 4UW3A 1JOJA 4F3JA 2R043 1TME1 4K3UA 2HWE2 2EA7A 4IEZA 4AHWA 4ASLA 2I74A 1POV1 2K0GA 1EP0A 4AVAA 4CYDA 3I59A 4A3XA 1PO23 4Q8KA 1WGPA 2RHPA 1RL3A 2HWB2 4IXLA 1SMVA 1LHWA 1SLBA 1Y43B 3R6SA 1RUH3 3VLBB 1HQWA 1HXS1 3SCGA 3UV9A 4ASMB 1PGW2 4Y20B 2E7QA 3G7DA 2BWAA 2DWRA 4HKWA 4RHV1 2PFWA 2ZA9A 1DZQA 1WLWA 2QJVA 3P3NA 3FFQA 4LULA 1RIRA 3JQXA 4WM8A 5JDBA 1EPWA 5CA6A 4XJAA 3AMHA 2PHTA 1DZRA 2RS13 3LWCA 5LRRA 3W9AA 3VZJA 4JDNA 1VB4A 4KWJA 4OUSA 4XIKA 1J1TA 1IGOA 4CP2A 4XPVA 1ND3B 4LBLA 4EN7B 1VAVA 2C9AA 1VAMA 1HDKA 1RUE1 3LAGA 1AYM3 4AEJA 4ITCA 5BXXA 3BOPA 3WP6A 5T5JA 1BMV2 1FMD1 1UN1A 1YIPA 3B7MA 3VUOA 4N43A 4XFGA 4CDQA 3D8CA 2WA3A 2X5IB 4YW4A 5A32A 3R05A 4P9LA 3SH5A 5FTTC 4XJWA 1IOAA 1G9AA 3H0OA 1KRIA 1D0HA 1MQTC 3AKTA 4QQPA 2YMZA 1GZ9A 3MI8A 3H1MA 3J4UH 4I09A 1ND2C 1NCQA 5K0UC 1UPIA 3MEPA 2UURA 1MZEA 2W08A 4QT6A 4AI1A 1HRV3 5CVRA 1NLSA 4URTA 1IKPA 2G9FA 3CJXA 3QH6A 4QD2A 3ZVXA 4Q0QA 3V0AB 2OPKA 1RUG3 4R8HA 3WP3A 1VBB2 2ZJCA 4BA6A 3OD0A 1RUI1 3ZN6B 4EJRA 4FPEA 2D40A 5FRAA 2ZAHA 1G9BA 2MPFA 1AHSA 1YYNA 2B45X 2HWF1 1BJQA 1ULDA 1YFWA 2RR13 3E6CC 2R6QA 5HCBA 3GZAA 4JCKA 3BB6A 5JOYA 1PO13 1IS3A 4XFIA 1YI7A 5CADA 3M3IA 1QDCA 4CDUC 3RG0A 1MZ6A 2XVGA 3SITA 3ZIWA 4XF1A 3MW4A 3IBMA 4IEUA 2XLAA 5JI9A 4DMIA 1WCKA 1NA1A 4HL0A 4M0NA 1B35C 1DHKB 4MZUA 5IUQA 4GKYA 2V09A