3VM5A

Recombinant medaka fish alpha-amylase expressed in yeast pichia pastoris
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
499
structure length
499
Chain Sequence
QHNPNTRDGRTAIVHLFEWRWADIAAECERFLGPKGFAGVQISPPNEHILVSSPWRPWWQRYQPISYNLCSRSGGENELRDMITRCNNVGVNVYVDAVINHMCGAGGGEGTHSSCGSWFNANNKDFPSVPYSNLDFNDGKCKTGSGNIENYGDPYQVRDCRLVGLLDLALEKDYVRGKVADFMNKLIDMGVAGFRVDACKHMWPGDLDNVYRRLNNLNTKWFPGGSRPFIFQEVIDLGGEPITTGEYVGLGRVTEFKYGARLGELFRKWNGQKLSYTKNWGEGWGFMADGNAVVFTDNHDNQRGHGAGGASILTFWDPRLYKMAVGYMLAHPYGFTRVMSSYSWDRNFVNGKDENDWIGPPSNGDGSTKPVPINPDQTCGDGWVCEHRWRQIMNMVQFRNVVNGQPHANWWDNGNNQVAFGRGNRGFIVFNNDDWALDVTLNTGLPGGTYCDVISGNKDGGSCTGKQITVGGDGRAHFYINNSEEDPFIAIHADSKLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional characterization of recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris.
pubmed doi rcsb
source organism Oryzias latipes
molecule tags Hydrolase
molecule keywords alpha-amylase
total genus 173
structure length 499
sequence length 499
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vm5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vm5A01
3ARRA 1OBAA 4ACYA 2BHZA 2D0FA 1W2PA 1TQSA 1XSKA 1EGZA 4P7NA 3W37A 4CU7A 5A69A 5E6YA 2OYKA 1KR1A 1H3GA 2A3CA 2AMGA 2CBUA 4KH2A 1UUQA 3PZGA 3WD1A 3BC9A 5HPCA 1A47A 1ISWA 4PSPA 2CERA 4H7VA 2DIJA 1W32A 3LPFA 1CWYA 1BGGA 4ZE5A 1UR2A 4D1IA 5ABHA 1WDSA 1ZL1A 4N0RA 1US2A 5BXPA 1H11A 3UG5A 5GNXA 4MB3A 4B9ZA 4H04A 3AHYA 4IPLA 4J27A 4MB1A 3SCOA 3THCA 5CPSA 4Z2LA 1XSJA 2WVVA 2E9BA 3K4AA 4QP0A 2VX7A 1FP8A 1HVQA 2W92A 4GQRA 1US3A 4OBRA 3TV8A 1SFSA 1DWFM 3VM7A 4DWSD 1ZJBA 1UZ4A 2J8GA 4U5KA 1PJ9A 1XCXA 2G3NA 1J18A 3JUGA 3A23A 3VGFA 2YBUA 4L4OA 5A6KA 1UYQA 3CZ8A 1OIMA 4DWSB 1W1PA 2D24A 3MU7A 2OWCA 1R87A 3U5YA 1W3KA 1E4NA 1C7SA 1TFVA 4ZFMA 3LXAA 3GXTA 1OGBA 3VDBA 2MANA 2W66A 2Y2WA 1OIFA 3DYOA 2NSXA 5ABEA 1I1XA 3EDDA 2OW7A 2WZEA 4AZGA 8A3HA 1C93A 3SUWA 2VTFA 4P7RA 4LYPA 1XH2A 1EQCA 2WMJA 2D0HA 4QCEA 5I24A 2WCSA 2VRKA 4BF7A 2D0GA 2D20A 1GW1A 3B9AA 4M8UA 4GKLA 1R7AA 2ZICA 1W9VA 4N42A 3TP4A 1HVXA 4WJXA 1V6YA 1G1YA 4TXEA 1JZ8A 4AZCB 4B15A 3WH5A 4D6FA 2TAAA 1E71M 2JIEA 3EMZA 3WH7A 2WHJA 2DSUA 5GNYA 4CCCA 3ZJKA 5IHRA 1CXIA 3BVXA 3ZJ8A 1KGWA 1NOUA 3UR8A 3OBAA 2GJXB 1Q6CA 4NX0A 2YDQA 2XPKA 3WH8A 2GUYA 3D5HA 1J01A 2C7FA 2PI6A 1E43A 5BRPA 2Q8XA 3AOFA 1ECEA 3VX0A 2PB1A 2F8QA 1RH9A 3A4XA 3BAIA 1QBBA 3F5LA 2EACA 2EPKX 4P7OA 1JZ3A 5I6SA 4JKKA 1V0LA 4M1RA 4M81A 4V27A 4TOQA 3IGUA 5HXMA 4TX6A 3ARUA 1B3WA 1CBGA 2W4XA 2YL5A 1B2YA 3EDFA 1KQZA 2Z1SA 1CGWA 4PRWA 2D23A 3MMWA 3ZT6A 1ZBKA 2RGLA 1VRXA 3GXIA 3DHUA 5A8MA 1UKOA 1ISZA 2C0HA 4CU8A 5JBDA 4PCSA 4UTFA 4D6DA 4MNJA 4H41A 2XSAA 2QF8A 4PMNA 3PZUA 1ZU8A 4NXKA 1TQVA 1HKJA 2CITA 4M80A 1GOWA 2WVVB 1V3HA 5FL0A 3LX9A 3SCQA 2J78A 5EBAA 2J7EA 5A1AA 3LMYA 3GH4A 5D9NA 1SZNA 1KXHA 3LRMA 3VPLA 1F4AA 1FH8A 3A47A 3K4DA 5JIPA 2W5FA 5A6SA 3VGDA 9CGTA 2YDRA 2X05A 1PZ3A 3VIMA 4DUWA 1ODUA 1W9BM 1EH9A 1VB9A 1CXKA 4HPGA 1LG2A 3L4XA 3ZM8A 3VGHA 3ARVA 2W67A 1TCMA 1G01A 1QVBA 3CPUA 1B3YA 3DECA 4IM4A 4PYSA 4CD7A 4P8UA 1QW8A 1FHDA 1BYAA 2W61A 1MXDA 4AC1X 2AAAA 3WDPP 5EB8A 1DHKA 4AMWA 4KMQA 2QV4A 4CD4A 3VD3A 3K8MA 4UZUA 3AHTA 3VUPA 1L8NA 4X0VA 3ZSSA 4NZJA 4AD3A 3MUY1 1QI4A 2OSYA 3CZGA 1HT6A 3KLLA 4HZ8A 4M82A 3WEZA 1R7OA 4LQ1A 1MW1A 2VNCA 4EK7A 1R47A 2V5DA 2YDSA 1BVNP 2WBGA 3RDKA 1GONA 1CENA 1ZBCA 2EBNA 3NUKA 4HTYA 1AQHA 1E3ZA 5C71A 1H1NA 1UG6A 2VOTA 3WDQA 5A2AA 4BZYA 2J7BA 4JFUA 1AMYA 1Z32X 2VZOA 3WD4A 2PBGA 2X1IA 2XGIA 1W9UA 3F5JA 1O7AA 1CLXA 4ML4A 1W1YA 2WZIA 1HJWA 1NWSA 3S6TA 3NSXA 5CPTA 4UQ9A 1WDQA 1H0IA 4AD0A 4RE2A 3VD4A 1H4PA 1QNQA 2F61A 1BYCA 1WE5A 1UH3A 6TAAA 1HWWA 3VIGA 5LYRA 4AZ6A 1CNVA 3ARXA 4CCEA 1ODZA 1TVNA 2UY3A 3BUPA 1Q6GA 1YHTA 2V38A 1EQPA 4YHEA 5AC5A 2J7DA 2WC7A 3ECQA 7A3HA 2BXZA 1OT1A 3VKKA 3WMCA 3IAQA 3VMNA 2F7OA 1H49A 3RJYA 1XYFA 3WNMA 1W1VA 4GIAA 4H8VA 2Y24A 4XX6A 1UR8A 3AROA 5M3WA 1M03A 3HG3A 2CNCA 5HOSA 3FAWA 1S46A 1E6ZA 2PBOA 3A21A 3MO4A 2IGTA 4MDOA 3HG2A 1XYZA 3GXFA 3WEMA 3N1AA 2VMFA 3AYRA 1X1NA 3W24A 3ALGA 3OG2A 2ZX8A 1JDCA 3DYMA 4U3AA 2J74A 2JF6A 2UWFA 1CYGA 1PPIA 1JL8A 2WSKA 3T0AA 3OA5A 3EDKA 1K9TA 4E8CA 4OZOA 2DT1A 5DT7A 4W85A 4J3TA 3KL3A 1TA3B 5E6ZA 3W53A 3POHA 4AISA 4PMRA 2Z1KA 3K8LA 5CG0A 1K9DA 1MQRA 3K8KA 3W4RA 3BVUA 3S2CA 1BYDA 1VJZA 4WF7A 4B3KA 4BQ3A 3GH5A 2WWDA 3MMUA 2X0YA 2XN0A 2J77A 1OINA 1W91A 1E55A 3QHOA 4KRUA 1VIWA 3WN6A 3AHXA 3LRLA 5A6AA 3GXMA 1HIZA 5A2CA 3PTMA 2G3IA 3GZAA 4WK9A 4AZCA 2CYGA 5I23A 4QAWA 3AS3A 4JIEA 3GXDA 2VVNA 2J79A 4W88A 2YA2A 1KBKA 3BUQA 1JYNA 2DT0A 3BAWA 4M29A 3VIHA 2WCGA 1GOMA 4MNKA 4GINA 4GZJA 3WL1A 2WMKA 4YN5A 2HISA 3AYSA 4DM1A 3FHQA 1R46A 1D3CA 4IISA 2XG9A 3LPPA 3L4VA 2CKRA 1HP4A 3FN9A 2W62A 1V02E 2ZUSA 3MI6A 3WY3A 4PBGA 4HA3A 1HJSA 1SMAA 2D73A 2GVYA 5IDIA 1B0IA 4W8LA 4ZXOA 5CJ5A 1ITCA 5FOOA 2FYVA 1K9FA 2BY0A 3N13A 1J0YA 2VC9A 1MW2A 4MB4A 3H54A 5KZ6A 4UFIA 1GNXA 1U30A 1OD0A 3WD3A 1GVYA 2BY1A 1A3HA 1WAWA 5E0FA 2BFGA 1GJUA 1XH1A 4S3JA 3CZNA 4WSJA 4QLKA 3UETA 1Q6DA 1UWIA 3NYDA 2V3GA 1E0VA 4QCFA 1KWKA 3CIVA 1VFFA 2ZX9A 4GO8A 2F1AA 1ZB5A 1IT0A 3FNDA 3WFLA 1O7DC 3BSGA 1C7TA 3PTQA 1R75A 3QHNA 1OD8A 1CGUA 3ARQA 1WZAA 5A95A 1W2VA 3VGEA 4D6EA 1E56A 3O6AA 3ZT5A 1TR1A 3D50A 1E6NA 2DSVA 3S5YA 3BGAA 1NWRA 5IHSA 1JF6A 1RD6A 2G4FA 5A8NA 1EIBA 2CHNA 3WY4A 1GHSA 4JZ5A 4MJ2A 5CPQA 3A4AA 1JXKA 1BAGA 2JF7A 3WBEA 3CZKA 1QHPA 3LPOA 1CZ1A 1QWUA 1PS3A 3WQ6A 2E0PA 3AS1A 2NT0A 2WMIB 2IUZA 4OOZA 1E0XA 4FNTA 4PMQA 1UKQA 4S3KA 5D8WA 2E8YA 4W7UA 2YKKA 4UQDA 4UFLA 1O6IA 1LF1A 2ZXBA 5E09A 1I1WA 1EDQA 4MJ4A 2ZUNA 1EXPA 3BAJA 3BH4A 3VD9A 1UKTA 4D71A 5A8OA 2DSKA 3WUBA 3AIUA 3SCSA 3WY1A 2XGBA 1UASA 4K68A 2J7GA 4JCLA 3QHMA 1CXEA 1FH9A 3CH9A 3G6LA 2ZXAA 4MAZA 3GNRA 1DTUA 3IJ7A 3OZPA 4AMCA 4V2XA 3DX1A 3GTNA 3AS0A 4DUXA 2VZVA 4C7FA 3PZVA 3FHAA 2FE0A 4HA4A 1NARA 3ZJ6A 3WSUA 3MV01 3W29A 2DT2A 2VT0A 3ZJ7A 4W84A 2F7PA 2VRQA 1FH7A 1V6UA 3HMCA 1VEMA 1JAKA 1EOMA 2WKLA 1J0KA 2X2JA 3VDCA 2PWGA 4L4PA 3N11A 4HMDA 3MV11 2X2HA 2WK2A 4CVUA 1PEZA 4J3VA 2O92A 4J3SA 3CC1A 4W89A 5HDRA 1BSIA 3DDFA 4X0NA 3EMCA 1GHRA 3CUHA 4CD6A 3ZT7A 4U2YA 3AMDA 4TX8A 4OKDA 3H53A 3CBWA 4TUFA 1GOKA 2EPLX 3CMJA 4AD5A 3WIJA 1DWIM 2BVYA 4PMUA 1LL7A 1C8XA 1V3LA 3DYPA 1QNOA 1MQPA 1BGAA 2ZX5A 2JFEX 1H41A 3IAPA 2WAGA 4ATWA 1U2YA 2CBJA 2EPMX 2GK1B 4PCTA 4HZ6A 4TVUA 2EXOA 3OZOA 2F2HA 3VM5A 1F4HA 1HKIA 1OCQA 2F18A 4CN6A 5HBFA 3M6DA 4J7RA 1E1EA 3W81A 1V08A 3II1A 3TTQA 3N12A 1KBBA 2VR4A 4HOWA 2YOCA 3CO4A 3GYCA 4OOUA 3CZJA 3OLDA 5A3HA 4A4AA 3MSGA 4EANA 3KWXA 5AYIA 4BQ4A 4HOXA 4DWSC 1JYWA 1UWRA 3BLPX 3RPMA 1BTCA 3H55A 1C91A 3ZOAA 4MNMA 1GQJA 3EDEA 1QNPA 2A3EA 1E4LA 3RM8A 3MUAA 3W28A 3HG4A 3VILA 1BHGA 3GM8A 3ARSA 2VQUA 5TD4A 4JKLA 2CBVA 1V03A 3WL0A 4H8UA 1KWGA 1LLOA 2B31A 1UR9A 3F4VA 3PZ9A 3UG3A 2Y5EA 2FGZA 3UG4A 1KQYA 2FDMA 5GPRA 1HJUA 5LA2A 1XV8A 2G8ZA 1XRVA 3J7HA 4UOJA 2J4GA 3WH6A 1DP0A 3CZSA 2WMFA 3E1F1 1UD3A 5C8BB 3AMLA 1UR4A 3D4YA 1FFQA 3ZMRA 2EPNA 3HN3A 1YQ2A 1E6XM 2PWDA 2BHYA 4DUVA 5BXTA 4NZCA 2PWFA 2ZUWA 4GZEA 1CGXA 3AZRA 3SURA 2XWDA 3O9NA 2OWXA 1N82A 3CUGA 3MS8A 4UQAA 2X0HA 1FFRA 1GOQA 1G94A 2X2IA 3VIIA 4BA0A 3W25A 1DWJM 2VVSA 2JEPA 5D4YA 5F7UA 2O9OA 3POCA 5IFPA 1FP9A 4UCFA 3FAXA 4AMXA 4DO4A 2D22A 2GFTA 1HTYA 4U2ZA 3CZEA 2V3FA 3UERA 3L4UA 4A3YA 1HL8A 4AXNA 1FA2A 1WZMA 3T08A 3CV5A 4J28A 4NZFA 1V0NA 1Q4NX 4QFUA 3PZNA 2Y8VA 3VO0A 5DMYA 3BMVA 1BG9A 4URIA 1MWOA 4AD1A 1CXLA 1QPKA 1V3JA 3ZR5A 1CXFA 5IFTA 5BRQA 1B1YA 1TZ7A 1H09A 5CLTA 2XFFA 4Q7NA 2E40A 3LPGA 4ACZA 1JDDA 4UR9A 1RP8A 1I75A 2WMGA 2FHFA 2E3ZA 3PZMA 4FK9A 4DM2A 2DH2A 2ALWA 3AZSA 5A94A 5LA1A 3HU7A 3A3HA 1JIBA 1ESWA 5A6LA 3UR7A 1UR1A 4P8WA 1JNEA 5E0CA 2YBTA 4WKHA 4OGZA 5EMYA 3WMBA 3TTYA 3VGGA 3T2QA 1E72M 2YJQA 5I2UA 3S5ZA 4UQEA 1V0KA 1LL4A 1JZ6A 1D7FA 5D9OA 2CBIA 4JKMA 4BQ2A 1JYXA 1CIUA 2J7HA 3D4ZA 3DX3A 2DSZA 4Z2KA 2VCAA 5EFDA 1UH2A 2CESA 4MPKA 2XVPA 2CIPA 5GNZA 4JL1A 3VIPA 3W38A 4C7GA 3MANA 5A8PA 3FY1A 1WDPA 4AZIA 1MW3A 3AHZA 4AY1A 1C92A 3CLWA 1E40A 1TUXA 1FOBA 1GOOA 1J0HA 3W27A 3DHPA 3AMGA 1JDAA 4W86A 3BCFA 5DT5A 3RM9A 3GDBA 3T0BA 2A3HA 6A3HA 3BMWA 3EJUA 2WWCA 4J3XA 4AZBA 3CHDA 1CGYA 1E4MM 1PAMA 2E9LA 3GBDA 1RPKA 3TTOA 4TVCA 5BWFA 5I5RA 3BAXA 4TVDA 3EBVA 4PMDA 1K6AA 1XD1A 3THDA 3WQWA 2YFOA 1QI0A 2XUCA 5I3DA 1WO2A 4BS0A 3EDJA 1G0CA 3VMOA 2E4TA 2WVTA 1JD7A 2O9PA 3W0KA 4P8VA 4P8XA 1HXJA 3I3BA 3NSNA 4FNRA 2ZX6A 1WP6A 4AEEA 1OSEA 2CCRA 1DEDA 1JXJA 3I3DA 1WNOA 2ZOXA 3CHEA 3CUFA 3WEOA 1B31A 1BF2A 3VNYA 1G5AA 5A6BD 3OLEA 2XJ7A 4XZBA 4CVWA 2GJXA 5CSUA 1UA3A 4YPJA 2CEQA 3VSUA 4UOZA 4IPNB 3AQUA 4Y7EA 3WF4A 3KZSA 2ZE0A 3VIJA 3NCOA 4UFMA 4IUGA 4PMVA 1JYVA 5EFFA 2ZUMA 2WC3A 4LXFA 2UY5A 4PTWA 1Q6EA 4C7DA 4D6GA 4MADA 3WDIA 1NOWA 1B90A 3VNZA 2O9RA 4QDMA 2V3DA 4U5IA 4HOZA 2WCAA 5BXRA 2ZXDA 3U7BA 3MUZ1 3WQVA 2C8NA 1W9DM 3WNPA 3CZLA 2GK1A 2XVLA 3ZSTA 1AQ0A 3L4TA 1TMQA 1HJQA 3VVGA 1IV8A 2EEXA 5DEZA 1UQZA 2YIHA 4KRTA 2YA1A 2DT3A 4NI3A 1V3IA 3AXIA 3ZR6A 5CXPA 2Y8KA 1QI5A 5JBEA 4AD2A 3WFZA 2F7QA 1E15A 1R8LA 2QHAA 3I3EA 1M53A 2WSPA 3AIVA 2JALA 1D2KA 2WKGA 2VCBA 1C8YA 4EKJA 1NOFA 1CPUA 3WY2A 3NJ3A 2WMHA 2DSWA 3N04A 1L0PA 4PEEA 1TA3A 1KTBA 2OYLA 1QOXA 3OGSA 5KEZA 4CCDA 1JG9A 1KCLA 3U5UA 3WDJA 2WVUA 2XTKA 4MDPA 3U7VA 4W5ZA 1VJSA 1HKKA 4LYQA 2ZWZA 4FNUA 1HKMA 1PIFA 1PIGA 1QWNA 4JCMA 1CEOA 2X8RA 1EDGA 4E4PA 4HA1A 3ZIZA 1LJYA 2OLHA 3WF3A 4D1JA 3VSTA 1VBUA 1VFOA 1EA9C 1M04A 2X2YA 5E1QA 2WPGA 4FF5A 3AJ7A 2WXDM 2IXVA 3PHAA 5C70A 5FD0A 1CECA 4XZWA 2BNJA 4WLCA 1B3XA 1R33A 1B9ZA 5FKYA 3VU2A 1KXVA 4HMCA 4CGTA 1UZ1A 1SMDA 5I78A 4W5UA 4HP5A 3SCTA 2D3LA 1BQCA 1BLIA 2HVMA 2XVNA 5E9AA 1SR0A 3SCRA 2BS9A 5DFAA 3B8SA 2OYMA 2OSXA 1LG1A 1W9PA 4Z2HA 3PZQA 2YL6A 1Q6FA 3BSHA 7TAAA 1GPFA 4B3LA 3MSDA 1EO7A 4F79A 1V3MA 1LWHA 4EAMA 3EYPA 4JFTA 4E8DA 2XM2A 2AOSA 3DC0A 4FNQA 2NW0A 3ARWA 3VGBA 2BHUA 3NDZA 3RIKA 2W63A 3CHFA 4M24A 1JGIA 5I0DA 1AQMA 5DO8A 5ECUA 1JNDA 3VD5A 4KGJA 1WKYA 2ZX7A 3AZTA 4MAVA 2WBKA 1NP0A 1UWUA 4J3UA 4Z2JA 3WELA 1R85A 3T0DA 1V6XA 2J7FA 2YL9A 3HJEA 3WNNA 1QNRA 3CGTA 2WYSA 4ZXLA 5M03A 2J62A 2XFYA 4UZSA 4LGXA 1E0WA 1JD9A 1GJWA 1J0JA 1MW0A 4DWSA 3PZIA 3DX2A 3N17A 3WQ5A 3AISA 2VCCA 4UFHA 1V6WA 4RE3A 5LA0A 2J75A 1BPLB 2EADA 3BUIA 3VDAA 1OT2A 4ZE4A 1JZ7A 4HZ7A 3B9DA 3NSMA 2XYLA 3AXHA 2WHLA 4ATLA 3MMDA 2ZXQA 1VBRA 4WKFA 1B3VA 2QPSA 1G9HA 3B9EA 5A6MA 1E3XA 1FHLA 3ARPA 1JZ5A 5HNNA 4AYGA 5IXEA 4FLQA 1C90A 1UKPA 2WW5A 1KCKA 1CGTA 1EO5A 4W7WA 2PWHA 3DX4A 4B9YA 5AY7A 4JHOA 3EJSA 1JZ4A 4QLLA 3PZOA 2XSBA 2QLYA 4J3WA 3WMSA 3IANA 2W91A 1W1TA 2VX6A 3AMCA 2FHBA 2DPEA 2NT1A 1XH0A 2WHMA 2D2OA 1VEPA 5CZKA 1CTNA 1DWAM 2PF0A 4UQCA 3GNPA 1MFUA 6CGTA 4LPCA 2F7RA 3D52A 4FLOA 2DDXA 3A22A 2VI0A 1XHGA 1TQTA 1ZS2A 3KE0A 2V5CA 3AS2A 1J11A 3HZ3A 4PSRA 5GQBA 3AMKA 1GORA 1LL6A 2G41A 1CLVA 3L2LA 3WDRA 2WM0A 3TOPA 4Q22A 3EJQA 4E2OA 5I79A 3GNOA 1RP9A 2FGLA 3RMEA 3SIMA 2GDVA 4AIUA 5A6JA 4UFKA 3OGRA 2BVDA 3T2OA 1T0OA 5A2BA 1SYTA 3WUFA 2J47A 1LWJA 5I77A 1E6RA 1TQUA 2ZUTA 4CKQA 2IXUA 1E73M 2ZIDA 5DF0A 3BUDA 1KB3A 1DWGM 1V3KA 3RCNA 1MXGA 1ZBVA 4P7LA 1BG4A 2FH6A 1HJVA 3AXXA 5BCAA 5JIWA 3GBEA 5CGMA 1VEOA 4PTXA 2VZUA 4BCEA 4Z2GA 3SCWA 3IK2A 3SCUA 1EDTA 3EMQA 4R27A 2UY4A 2V3EA 3ARYA 3WQ4A 3ZQ9A 4UNIA 4AIEA 4LYRA 1XD0A 3VD7A 2J8FA 1C3FA 1GZJA 2FHCA 2DIEA 3KL5A 3TA9A 4HU8A 1KR0A 1IZKA 3QR3A 1E6PA 1GQKA 5AC4A 3AIRA 5A8QA 1EOKA 1X6NA 2XVGA 4MNLA 4JFVA 1HX0A 2ZWYA 3AIWA 4P7QA 5D9PA 1P6WA 2EAEA 2XM1A 2CKSA 4JFSA 4W8AA 3WQ8A 3A24A 2Y4SA 3M07A 1R34A 1UD2A 1UA7A 4AIOA 1OM0A 1V0MA 3VSVA 1QHZA 4PMYA 1UD4A 1IZJA 3VINA 4CD5A 3PBGA 2YA0A 3PTKA 2E9MA 3GH7A 4NXSA 2BVTA 3ALFA 4WKAA 4GO9A 1UD5A 2WLYA 4YHGA 1XSIA 1ISYA 1VENA 4RL3A 1GCYA 4NF7A 3WBAA 3D3AA 3ARTA 2D1ZA 4NRSA 3HG5A 1EHAA 1E5NA 3WUEA 3QOMA 4AWEA 3SUTA 4D6JA 4V28A 2DGAA 2PWEA 4H8HA 3CTTA 1NP2A 5CGTA 4BQ5A 1H5VA 2GDUA 8CGTA 4AD4A 1H2JA 3OIHA 4Z2IA 1UD8A 5A6BA 4XV0A 1JI1A 2DH3A 3WD0A 3VMPA 3QOKA 3BAKA 2D3NA 3GXPA 1BYBA 4F8XA 7CGTA 1ZBWA 4GI8A 5JBFA 3T2PA 2QPUA 1TQWA 1W3LA 1GVIA 1JAEA 3W6MA 4AZ7A 2XWEA 1ISXA 1J9YA 1UHVA 1MYRA 4F9DA 3CMGA 2O9TA 4R5EA 4FLRA 1UWSA 1U33A 3L2MA 1J0IA 1OGSA 3BLKA 3L4ZA 1TG7A 1OWQA 3BXWA 2XFRA 3WH9A 1QHOA 2GJPA 4GI6A 1KGUA 3WNOA 2EPOA 1UWQA 2VQTA 2XVKA 3AIBA 1UWTA 2XN1A 5AYBA 4OUEA 3AIQA 3N18A 2XN2A 1JZ2A 3MUIA 3KLKA 1UH4A 2WHKA 1PX3A 1VFUA 4D6IA 4UFJA 3A5VA 4GI9A 3WDHA 3SCVA 5BXSA 2EABA 4D6CA 3SCNA 1QNSA 4JFWA 1CXHA 1BVZA 1E4IA 1W3HA 3PZTA 1K9EA 4X9YA 1E6QM 2EQDA 3RJXA 4U31A 1JFHA 3BVWA 4W93A 3EJTA 3N15A 1E5JA 1B3ZA 3RO8A 2QMJA 2EJ1A 4D6HA 4ZENA 2XIIA 1KFWA 3WF0A 1Y7VA 3L4YA 4RE4A 1J10A 3AIEA 4GPNA 4AEFA 3AHVA 4HPHA 3ZO9A 2G3JA 5E70A 2VR5A 3BUBA 3WD2A 2BY3A 3PN8A 1LQ0A 3CUIA 2YL8A 3BVVA 4XB3A 1PBGA 1OB0A 1GUVA 1GQIA 3MKKA 1UQYA 1HXKA 4F9JA 4AZHA 2VURA 5BYWA 1HP5A 2GSJA 3AFBA 1JI2A 4OBSA 1GQLA 1NM9A 1HL9A 3K46A 2JEQA 4JAWA 2FH8A 1HN1A 2OW6A 2CXGA 3BLBA 1M7XA 4UOQA 2GJRA 3AICA 3SUUA 2J25A 1QW9A 1CDGA 1WPCA 1NQ6A 3WF1A 2BV9A 2VO5A 2VX4A 4PUDA 4ATDA 4DO6A 2WC4A 2XIBA 5M17A 3U57A 4PMXA 1C8QA 2VUYA 1VF8A 3CUJA 3OGVA 5FL1A 2DQXA 2ZUUA 2ESCA 4LX4A 4AYSA 4CUCA 2PC8A 4NRRA 3AI0A 4W7VA 2QMKA 1QI2A 4PTMA 3O2LA 3TONA 4W87A 1AVAA 3KL0A 3OLGA 3UCQA 3LXBA 3W6LA 4CN1A 2JE8A 1V6VA 5ABFA 2WVSA 1PX8A 3DX0A 4FNSA 1UOKA 2WANA 3VIKA 1UKSA 2CPUA 2CHOA 3NDYA 4GZIA 3BAYA 3EJRA 3RILA 3VDHA 1X6LA 2CETA 3FXYA 1XCWA 4PTVA 1CGVA 1VAHA 4D72A 4JHZA 5CLWA 4B16A 4EE9A 1DWHM 2XHYA 4CD8A 3UEQA 3BVTA 4CU6A 1HJXA 3SCPA 4MTVA 4M56A 1XC6A 3CHCA 2VX5A 4U33A 1NWTA 1HNYA 3APGA 4A3HA 5ABGA 1W9XA 2UY2A 5FIPA 5JUVA 3M7SA 4WSKA 1B30A 2WZHA 3ARZA 3SEPA 4MB5A 2VL4A 3G6MA 2YFNA 5HPOA 4ACZB 1NWUA 4KGLA 1E70M 1PZ2A 3W82A 3RM4A 3WENA 3WUGA 3WKZA 2OSWA 3WF2A 4GQQA 2JIWA 2EO7A 1E1FA 1R86A 3FW6A 1WDRA 1E9LA 2X09A 4FNPA 3VIFA 3KEHA 3VX1A 4HMEA 2BY2A 5FCZA 1QI3A 4FLSA 1KTCA 3UESA 4PMOA 4F66A 1GOIA 2ZUVA 4AZ5A 2A3AA 2VZTA 4KWUA 4WIWA 1WB0A 1OGGA 4JL2A 2G3MA 3K1DA 1KGXA 1W3JA 2VRJA 4U3CA 3N9KA 4QLJA 3QGVA 3A4WA 5D8ZA 1ISVA 4PN2A 1WZLA 4AW7A 1PX4A 3W26A 2WNWA 1BFNA 1VFMA 4PUEA 5ABFB 4HU0A 1MFVA 3L4WA 5CSYA 1KXTA 4TTGA 1QBAA 3SUSA 2BXYA 3BCDA 3IJ8A 1HF6A 5M5DA 1ITXA 3D51A 4OJYA 4CN4A 3OB8A 1UD6A 3OLIA 3LXCA 2VZSA 1E6SM 1WZKA 3A6OA 1J12A 4TTUA 3EJPA 2YLLA 3VTRA 4FMVA 3SUVA 2DEPA 1H0GA 1MVYA 4XUYA 3LRKA 4W8BA 1XGZA 2WB5A 5CQ1A 4DO5A 3GXNA 4OIFA 4UQBA 3TTSA 4NSBA 3VIOA 1V02A 1JFXA 1NH6A 3VOCA 1WCGA 4GXPA 2J7CA 3WNKA 3DDGA 1TE1A 2WLZA 3F5KA 5BROA 4ZEPA 4H2CA 2F1BA 1JF5A 1UR0A 5D9MA 1EHNA 1QX1A 2VJXA 2E8ZA 2WMIA 3WNLA 2A3BA 1TVPA 4PMZA 1MQQA 3NIYA 1ZJAA 3IJ9A 1J0ZA 2YLAA 3M46A 2OWWA 2RGMA 1M01A 3T09A 1KXQA
chains in the Genus database with same CATH superfamily
1J9CT 1OBAA 1FAIH 2UV8G 3WJYA 4ACYA 5EMLA 1JVLA 2R0WL 4DGIL 1RIHL 1LQSR 3EO9L 4CSPA 3V36A 2DMBA 2LGNA 4QYOB 3MV7A 3ARGD 4KTYA 2B14A 3SKOB 4BK5A 3P61A 4P7NA 5KG9B 5DJDB 1OEZW 3W37A 4CU7A 4N9GB 3SDYL 1L7IL 4LAKA 3MMEB 1SN5A 2YMTA 4ISVA 3GIPA 2A3CA 2AMGA 3QJZA 1DZ0A 4RGNB 5I66A 3STBA 1NINA 1I31A 2ICWB 2A21A 1CLCA 4PSPA 3WKQA 2CERA 2NYYC 4L61A 4H7VA 1I2RA 1CF8L 2AQ1A 3CXDH 3KAAA 4FQIL 4MJMA 3S5NA 4IBSA 4OZFA 3AY4A 1MJUH 1FWWA 4ZZFA 3NH7H 5F71A 3N2XA 5D2NC 3BWZA 5B7EA 3TA6A 4K36A 2Q9OA 1ZL1A 1IM9D 1US2A 3U36A 5HJDA 1H11A 3FUMA 4LRTA 5BOPA 1A5SA 1DVUA 1K4CA 1EFXA 4UTUA 1KGIA 1H5BC 4J27A 3EOSA 3A6BL 1C5BL 1UWYA 1JUFB 3L6FA 4O1EA 5CPSA 3SCOA 3KWSA 2DV6A 3THCA 1A4KB 4HAKA 3CQPA 4FXFA 1XICA 4IIQB 4ODWB 1HWHB 3S5LG 1KFLA 2VX7A 2WKJA 2X44D 3TV8A 3VFWB 1AS6A 4JFFD 1TZHB 1J8SA 1MFEL 3HC3L 4K9EL 2NW3A 5BRZE 5BO0D 5ENWA 3D9AL 4NQSB 3SE9H 4QQ3A 2IQTA 5B1AB 5BOFA 4HC1A 3N40F 2VGIA 4E41A 1BECA 1XCXA 4AUBA 4XNAA 4YCOA 3ILQC 2YBUA 4FQQA 1K6QH 2I25N 4H0GA 1EBHA 3AABA 3G1XA 1QLEH 3SFKA 4DWSB 4S2SB 3T3PE 1XHHA 2PW1A 4GXVL 1O4UA 2PTXA 2OWCA 3JTBA 3N0PB 4P5TA 4Y19D 3WU1A 1IAOA 3U5YA 4TL5A 5E94A 2HXTA 4PCYA 2IH1A 1AI1H 2OM5A 4LBAA 3LXAA 32C2B 3EA2A 4ZFMA 3CLEL 4KVPA 2R69A 2MANA 3U9IA 4Z1YA 2CGRH 2Y2WA 4FS0A 1U3HA 4FZ8H 4L1TA 5E8NA 3VXOA 1WG3A 3IFOB 4U1KA 4GW1A 2OL3B 2F54B 1X4ZA 2BCKB 2LV4A 5TQ2H 1A6VL 5D7JC 3EDDA 2OW7A 3DVNB 4JLRA 4JAMB 1BFVH 3ESPA 4MKTA 3QUYB 4RDQG 8PAZA 3M86A 1C93A 4HIJB 1URZA 1ET7A 4NP4L 4XNQB 3TPUB 3TU9A 4F7KA 4P2OB 4XNBA 3WFDH 3SGEI 1EQCA 1NIFA 4GIPD 4QCEA 1TWIA 4HT3A 4BF7A 4FNLH 1MLBA 4M00A 1SBSL 1K5WA 2VLJD 4M8UA 3VE0B 1GW1A 4KOBA 5PAZA 4GKLA 1VD6A 4H8WC 5E5MA 4AJ0A 1NUNB 2VQ1B 1S5NA 3GHTA 2WHLA 1D3HA 3RLSA 4DNHA 1JZ8A 3MV9D 1S39A 4PJ7B 5IIEA 5C7XH 2Y1VA 1XG3A 3M41A 4UCGA 1L6FA 4PI0A 4JTUA 4FXKB 1SXNA 1V7ML 5I1GH 4O2CA 3T8VA 3T0EE 1E71M 4S1FA 2DSUA 3LZLA 2OJEB 5AAMC 4M7TA 1UB5B 4DPCX 2KI6A 3RAJH 5JXAL 2O93L 1YYAA 2B81A 2TMDA 4JPQA 4LVDA 4JHBA 2ISDA 3SQLA 4LCVA 1YSOA 2DN7A 1RJLA 2RB8A 4LSTH 3SCMD 1D5BB 3GIVB 5TDNA 1IGCL 2J8HA 2ZCKH 1KFEA 3UR8A 1FYHB 2YGVA 2ZZUT 1KACB 3OBAA 4R83A 4GX9A 4HZAA 2GJXB 3V4UH 4KI5F 4PUKA 3LKOA 4N24A 4Q4KA 4MAUH 5TE7H 3F3HA 5KS9A 3TF4A 4HKJA 1CR9H 1N5AB 2LVCA 3QUZC 3V6BR 1TPUA 3D5HA 2QJJA 4GSDH 3GG7A 5BNKA 1OP4A 4AVJA 2F84A 3AOFA 4WK4B 3C6EA 5ANHA 5DC4B 4U1JA 1A14H 1Q7ZA 1ECEA 4PYGA 1UW9A 3G3DA 1PKNA 2PB1A 2BWIA 4J3OC 2DQGH 2F8QA 4DBDA 1X7QA 2IC2A 3OL2A 1L5GB 1T8QA 2GQ9A 4BEUA 4TSCH 1UURA 4XI5D 3MLYL 1TG8A 2P26A 4AKQA 3NEOA 4QJ1A 2IWFA 2NX5E 1ZE3C 2EACA 1YXCA 1JZ3A 4FB7A 3GSVB 4AC7C 2FX7H 1F00I 3WLPA 3DFSA 3GG1A 3CC5B 4R8WH 2UWEB 4JKKA 4JFDA 4WGKA 1EIXA 4E9TA 3HHMA 5A2IH 4KRZA 1NPJA 4JQ3A 5F9JB 2Z7ZA 4QRRA 4YLCA 1TVHA 3WFHA 3GYRA 2OG9A 2EG7A 1CBGA 4LSUH 3RZWA 3LOTA 4KNTA 5D7KD 5A7BA 3CHQA 4XMKL 1DFBL 4WV1A 1G7JA 3EBAA 2MFNA 3TFKD 4X4XB 2CPCA 4G8AC 4Y1AD 2FD6H 4JTEA 1CGWA 3NG3A 4EEEA 1ZBKA 3LLDA 4GB9A 2RGLA 2NNXA 3GM0A 3QCUH 4P2OD 2J20A 3MA7B 1IHIA 2GTQA 4L37A 3U4EB 5IVZB 4AV0A 1KFJA 1TR9A 3GQFA 4K7FB 5D2LB 3NXFA 4G7YL 2NY1C 5IFHH 5JPNC 3WQCA 2HPMA 5JBDA 4PCSA 4YSQA 4UTFA 4QRPD 3DBXB 3MROA 5D6DC 5B1KA 4MNJA 4DZ8B 2HWZH 1KJ3H 4HJGA 3DJSA 4ZOCA 1G4PA 4OBTA 2XSAA 1YMHA 2QF8A 3F64A 1K5NB 4OCXH 2V33A 3VD1A 2IGFH 1E9OA 1U8QB 2ZCZA 3P6LA 5DK2A 3WIAA 2NQ5A 2UV3A 3MYJA 1RVKA 4EN3D 2CITA 3FCGA 4WY0B 2IPKB 3NJVA 2BWGA 3GZ3A 5GJTH 4ES9A 1CD1B 1LTXA 4MJZA 1ETZB 1MCFA 2GGIA 3JZ7A 1PDKB 4A63A 5KSWA 1CLZH 4LLUB 1BD2E 3VFMA 5AG8A 3W57A 5D9NA 1TVHB 3WFHB 4PFMA 1T7XA 3WJLA 4OLXH 1Z41A 5FGCE 4ODUB 4K7YA 4KU1A 1XYMA 2I9UA 1J79A 1DQML 3NIFE 4K73A 4WUUB 4S2BA 1WAUA 2FBJL 2ZD0A 1H7RA 1QK2A 2H90A 1YA5A 5JIPA 4FMKA 4GRMB 4AL8L 2W5FA 3NQ7A 3T4AB 2B1HL 1BAFH 3C60D 4WJ5B 3UZVB 3BFWA 1RK0A 2E59A 5F3HB 3KZPA 4IOSA 4DUWA 1PZ3A 1AXIB 3VIMA 1L5GA 2EDEA 3S4SB 3BLDA 1IKOP 43C9B 3QXUA 5SX5K 3LJ3A 4KQ3L 5T5NG 1HKWA 1PL9A 4ZGYA 5GHWH 1NKRA 2JJVA 3JTSB 4KK9C 2Y1YA 3QFGA 4G7YH 5IFHL 1FF5A 3X3FL 2AK1H 5I6KA 1CI5A 4OIBA 4TU1A 4TN9A 4ENZA 3L4XA 3BQUC 1F07A 2OZNA 3VGHA 5DD5H 4XXDA 2DVUA 2W67A 1WBZB 4KJQD 5I8OL 4G6AC 1CYWA 1HHJA 4CD7A 4PYSA 4P8UA 1ZLEA 3PAUA 5CCHE 3AQXA 3QEHA 4AC1X 1GL4B 2X4NB 2PW2B 3EG9B 3MXVL 4JR9L 4DPBX 2ZZ7A 2G60H 4UU9A 2OTUB 5AZ1A 5HDBB 1XBVA 3AHTA 3VUPA 4HSAC 1QFWL 4P5MA 4WWKC 3UXFA 2NUYA 5C0EA 4YDNA 5CBAA 4M8QB 3C5JB 3WS3A 3QUML 1A5BA 2P3EA 1L9SA 3O7UA 3TO4B 4Q9RL 4WGVB 3EYFA 4LDOB 4JO3L 5JOPE 3NM3A 3KLLA 5IJVB 1Q4WA 3MLYH 1BQGA 4M82A 3AXLA 3AXLB 3U0PB 3U0PA 4LCYB 5D2NA 4OLWH 3GO2A 5BOOA 3C60B 1ITUA 2CZ5A 1F7BA 3MRFA 1R7OA 2XIDA 3GG0A 1YQVH 4KK8D 5IEKB 3O6AA 2AEPL 1Q7MA 5MERA 2QSCH 2YDSA 3DO4A 4XAGA 3BICA 1BVNP 1Y65A 1JMZA 3CN3A 5MEOB 2WBGA 5HINA 3RDKA 1GONA 2R7EA 3O8XC 3SKUD 4HTYA 1WEJH 2Y7LA 5CUSL 4EQ3A 1XYBA 3BZGA 2ZDSA 3MRPB 4GSUA 2F54A 4CNTA 4TMPA 3KS0J 4RFEB 5A2AA 3VYLA 1AMYA 2NX5A 3QQ3A 5AEAA 3WN5A 3ILDA 3RR1A 2NY3C 3Q5OA 4HPXA 3WD4A 2PBGA 2F7IA 5IOPB 3ARGC 2CO2A 3LV3B 5KANG 3N50A 3R06B 4XMZA 1KDIA 2YARA 2Z31D 4PJ5E 1W9UA 3HA0A 2VO8A 2PPFA 3AUVA 4NO2A 4XTRC 3W01A 5C6PB 1LO5A 3MRHB 1DUZB 4W9FC 5CJMA 1CLXA 1AQDB 3EOYG 3OR6A 3SPIA 2BK8A 3TM6A 5J6GB 4H8NA 3LQAH 5HHME 2WJFA 4JFFB 1N6VA 2VR9A 4UM9A 4BM7A 1HJWA 1T5WA 2VR6A 4Y5YC 5T8IA 4HV8A 4P2VA 5CPTA 4NENA 3C5ZC 1KB9K 4R84A 4UQ9A 2P5WD 2Q3ZA 1H0IA 1I4NA 2Q5BA 2ZUYA 3VD4A 5ENLA 4AD0A 3MRGA 5BVPL 2K9UA 5HHQB 5MEQA 3GLEA 1WE5A 4WKXA 4DGYH 4TV6A 4ERSL 2V5LA 3KM8A 3LUTA 3B0UX 3L6FB 2A3LA 3Q1SL 3ZKMC 5AC6A 5DS8A 3AWOA 2RQEA 4GT7A 5EPMA 5LYRA 1YNTF 2WJ5A 4YXHH 1RSYA 3DMMD 1J88A 1CLOH 1JVOA 1RAKA 2GQ8A 1MF2L 3ARXA 2PF8A 1ODZA 4P99A 4R7OA 5LVEA 3QCTH 1FCUA 4GNJA 3BUPA 4JTRA 1WBYA 3CLEH 1Q6GA 1NWPA 3KGUA 1YHTA 1IC7L 1NICA 3JWDL 2V38A 3W1TA 1TU2B 3BP6B 4DGIH 3VI4E 4C4BA 1XWVA 4HNOA 4C90A 2E56A 2X89D 1FZJA 1XINA 2VXQA 3GDLA 1A9BB 3ECBB 4DKTA 1PDYA 3W84A 3WO8A 1JHLL 1P1VA 1H49A 3ZVVA 1XG4A 3GHBL 1RHHB 1OAXL 5CCJA 1RSCA 4PWJA 1V51A 1W1VA 1NQKA 1XYFA 4N6EA 7PTDA 2UVEA 3IEAA 2VCOA 3S35X 3UC2A 2BP0B 3K72B 2EVGA 2KERA 4H8VA 2BDNL 3JR2A 1UR8A 1EP3A 2AZUA 4QYOA 4N9OB 3SY8A 3WD5H 4GLRI 3KOWA 2ZQ0A 5DJZA 2XHNA 3FU7B 4KO9A 3WUWB 2W9LA 4I6KA 3WQDA 1NGXB 2CNCA 1UJQA 1X96A 3ARDA 4X8JA 3STFA 3C2FA 5C7VA 4GH3A 4ETYA 5EWIH 5I75B 5KSVA 5HD8C 3O41B 3EJJX 2MEJB 3A21A 5FCSH 3F65A 5I16A 2F58L 4QE1A 5G5DB 3L7EA 1VCVA 3HB9A 1M6OA 4L0ZA 4IWWA 3GXFA 3QFDB 1XGRB 5J1AA 4NKOA 2IPFA 3N1AA 2VMFA 1C5DB 5E1AA 3AYRA 2WZPA 4K1WA 5FAJA 1A7RL 2QQKH 4G80B 3I50H 4HK3J 1ZLSL 5HP5A 4YGVB 4WDUA 5DXYA 1JDCA 3DYMA 4BK8A 4U3AA 1ECZA 3CXDL 3D0VA 4AKPA 3U2OA 3ELQA 2YPVL 4IBQA 2HBXA 1NEZB 2B3IA 2DZSA 3NNTA 3TJLA 1FNAA 2UWFA 1E51A 4U1GC 5E1HB 4FA8A 1FWNA 2DJLA 2WSKA 3T0AA 3ET9F 3P9LB 2ZCHH 1S7VB 2F5AH 5B1CA 4JFEA 1EUTA 4B5XA 1DBTA 4I18C 2EDDA 3GSQA 5DR5H 3NJHA 4KROD 1X7QB 3B56A 1MRAA 2ZZ3A 5E6ZA 3AALA 4KRPC 3W53A 4A8NA 1I7RA 1GSKA 4XPGH 1KIQA 2QFRA 3IDGB 5JPNA 1QFEA 4AISA 4DYKA 3KXFE 2MCAA 5F1IA 3GS4A 4BZ1L 3KPOA 4LVHC 2GJLA 3WKYA 5CG0A 3K5SA 4MWAC 1MQRA 2MHAB 4L1BA 4WF7A 1FXQA 1A6WH 4P0DA 3EBIA 4MQTB 3S36X 3SCMB 1ECQA 3MMUA 4LCIL 4EXPX 4YDIH 4Y9GA 3KYNA 1CFNB 2X40A 4JB9L 3O16A 5I6XB 5HI3D 3F03K 3GHEH 2KX9A 1U8NB 3LDVA 3W2LA 3QHOA 2JJTA 3WN6A 1XI3A 3VYPA 3IVKA 4GAGL 3V0VA 2OQLA 1K8DA 3Q2LA 4HVBA 4YWSA 3MJGX 2VLME 1DL7L 3QO0A 3SE3A 5A6AA 1TO3A 3GB7B 2H8XA 3QXWA 1UQSA 1NSJA 2HLFC 1YEIH 1V7AA 3LQLA 4X6DA 1HQ4B 4HXBH 4V1YA 4U1MB 4EAEA 2L8AA 2N7SA 4H1ZA 5D7LA 3N1MC 1KTRL 2CBOA 3V8CA 5I23A 1XLDA 1CLYH 3S48A 2KT6A 2CZFA 4RMQA 3MP5A 1WC7B 4TQIA 4D9RD 4XPAL 5BNXD 4XNUH 2VC5A 1W1B1 4ELDA 2W59A 2HJFB 2VVNA 2D7MA 2EUXA 4CW1A 2CK2A 1RKRA 1DTNA 3IDXH 2ZG3A 1U8IB 3C2AH 2YA2A 3IJ6A 3I6EA 1KGYE 3FA5A 3QAZC 1DJNA 1KBKA 3FEQA 1XF0A 1YJDH 4WXZA 3H7LA 1XW8A 3B9KC 5HDBF 2DW7A 2IKIA 2Y5QA 4HIEB 3FSTA 3M0LA 4A2GA 3BP4A 4D9PA 3VRIA 5GRZA 4IBLT 3AYSA 4I89A 4C55A 1XDTT 4ZODA 3MR9B 3EYOB 4PFHA 1MNNA 3M5YA 2FQEA 5EO9B 4IISA 5HYSA 2FSDA 4Q6IC 1DVFC 2FUTA 3GMLA 1VFAB 3DJZA 2IQ0A 4AH7A 2P8MB 3PPGA 4I77L 4PFEA 5HI4D 1LP9A 3EYUL 5KTLA 4XBMA 1SJVA 2ENQA 3AQDA 2OZ4A 2Z92A 3T65A 1XF4A 1FVDA 3VFUA 1V02E 1YMYA 2W62A 1QAWA 1SVZA 1P1MA 2C9AA 1Q9LA 3WY3A 1WA2X 1T1XB 1MIEH 5FEWA 1XAUA 2YPIA 1RJPA 1YE4A 5CJ5A 4ZXOA 1RZGB 3N4AA 4Y16D 4QS6A 5IRPA 1W8OA 3MXWL 1Q0XL 3BVNA 4FFYL 1K9FA 4YHZL 3N13A 2AP2A 4L7ZA 1XWYA 1CFSB 1EC9A 3E3HA 1SOXA 2BJMH 5D5MA 2ICWI 4EIVA 2QJMA 4XCYB 4WEVX 5IGXH 1LWIA 4IFOA 3Q13A 5D03A 1U30A 1OD0A 2JTDA 1IC4H 4UQ2B 4A2DA 3KTSA 3VABA 5BO1L 4Q9QL 3WD3A 1QBLH 4YSEA 2BY1A 1FZKA 3KYKL 3WJJC 5ICYB 5E0FA 3NYKA 2BFGA 1GJUA 5AB1A 2B08A 1YADA 1XH1A 2YBVA 5EC2A 3CZNA 3HE7D 5EB9A 2A6KB 1DDHB 1TZ8A 3RVVD 3ONCA 2ATKA 4W70A 1X9LA 4G5DA 2JXMA 2WTOA 3W7JA 3EYSH 3V5CA 2QADC 3F6IA 1E0VA 1EZWA 4V1DE 1HGYA 4QCFA 1KPUB 3B06A 4Q6XA 2DUZA 1SOKA 4B96A 3MC0A 2PP1A 1IWAA 1S5MA 2JI1A 3KLSA 4Q7DA 4L6OA 1VDGA 3FK4A 1MRFH 1K8CA 3L48A 4U1MA 1I9RL 1RULL 3PTQA 3CPGA 1Q7QA 2FPVA 1Y07A 1OD8A 1NZRA 4P07A 4ILDA 3ARQA 2CU0A 1WZAA 5A95A 4V2CB 4ABVA 3C75A 4S11A 2RDXA 3N1QC 4X4ME 3V0UA 4K3GA 3UPWA 3B5HA 4A35A 3QC6X 4ZB5A 5T5NF 1E56A 3KOZA 2K7QA 4A2MA 4Z42C 3D50A 4HSOA 1Q5MA 4Z0XB 2OK0H 3PJNA 4NNPH 1E6NA 3S5YA 3DURB 3FRUB 5ABZA 1KRBC 4IJCA 2BFVH 1NWRA 4Z8FL 5B39A 3NQVA 3TKFA 4JANA 3KFTA 2XLLA 4KZCA 1JF6A 4G7VL 5DUPH 3A9BA 2P76A 2G4FA 1FRGL 5A8NA 2CHNA 4Y9FA 1P7TA 3TCLA 5KW9H 3S83A 4U28A 3STZA 4DI9A 4JZ5A 1IQWH 3KP1A 2YMXL 2GVGA 4JGDA 3A4AA 1FNEA 3WLWC 4JNMA 4LEBA 3G2GA 1UBSA 3UBGA 3ITGA 4Z1BA 1QHPA 1DOSA 1OP3K 3V79C 1TPVA 1LEIB 5C0AA 2DS4A 4JG9A 4QITA 2G2PA 3CPLB 3MUGA 4JM2A 4PGBA 2HKHH 4UT9L 5TPWH 1LORA 3FOKA 4AC2A 3G22A 4H3DA 1AD1A 5DMLA 5DD3L 4OOZA 2F38A 4APQA 1NEZA 1GVQA 5DRNB 4M1CD 2F6KA 4GBXA 4PMQA 2BCMA 2IDSA 3GS0A 1H7XA 4UQDA 2C7UB 4JDTL 3QARA 1I1AB 4UT6H 1DSFL 2A3TA 1O6IA 2X3BA 1XGQA 5F7FA 2DZXA 4XN7A 2ERJC 4Y6GA 3BH9B 1BVLB 5CZSA 1EXPA 3UTQA 3MCOA 3R1GL 3HAEB 3HNSH 3IGXA 3O41A 5E0KA 1OF2A 3T8LA 1ZLWH 4KKXA 4PJEE 4KKAD 5A8OA 4HUNB 5I06A 3HJ0A 4PP1D 4ZUUA 1WYJA 1CU4H 5IMOA 3NPWA 4DVRL 4E42B 4XT1C 4HS6A 3WY1A 3Q37A 3MPCA 1MNZA 3LD8B 4JEJA 3UXAA 4WD0A 3BG5A 3D3VA 1BQHG 1E2VA 3HLAB 3MAWA 4GJTB 4NQDA 1AD4A 2V2TA 1J5SA 2BASA 4X0KA 2J7GA 1SN0A 2NZ9D 1NMCC 1JGUL 1OE1A 3D3VE 1E7VA 4PW9A 3CH9A 4KCWA 4P5KB 3G6LA 3JRKA 1FI8C 3IJYA 2OEMA 4MAZA 3HUJB 1W56A 1QRND 3AFLA 3IJ7A 1ACXA 3FFDB 2A7RA 3DWTA 2FQIA 2PDFA 4O19A 1HXMB 2SEBA 4G6ML 3GTNA 4ZFZA 3O3AA 5C0JA 1DBAL 3OHXA 4XP4L 1J5HA 2E09A 3FFCD 2EHHA 3CPRA 5D1XA 4DUXA 2PP3A 3V52L 4Q4RA 4KVNL 3UJ2A 2FE0A 3US9A 2VP8A 4GSRA 2WIMA 5JPMB 3WSUA 3P2TA 2BZ7A 3MV01 4F0SA 5ECVA 2HN7B 4UINH 4X22A 2PUQT 4WCYL 4AIBA 1IJ9A 4DN3L 1IBGL 1Y18A 3OJGA 1FZKB 1KBGH 5B7MA 3ILPB 4QUOA 5GGSY 4NZ1A 4O4WA 1Z7AA 1I8AA 4UTJA 4YHIB 2H2PC 3BSZA 3BE1H 3NCWA 5I74C 2A1YA 1EOMA 5C0DA 2BIQA 3PAZA 3MLVL 2JLLA 1GZQA 4OTKA 1U8KB 3VDCA 4MF4A 4L4PA 3BW3A 4POCA 4RAUA 3WJMB 1PU0A 1RIVH 2NUPA 3UPRB 3BGJA 3N11A 3MV11 1KJ2H 4XVSL 5EU3A 5GZNC 1X5JA 1QTPA 5ACZB 1A22B 1AR1C 2BG5A 3RWEA 4J3VA 4MJ6A 1SJHA 1KELH 4WHDA 4S3FA 1WFJA 1MDTA 3V95A 5KZCB 3RFZC 4YLWA 5D5MB 3WJXA 4PVMA 4AJWA 4X60A 2FECL 1Y5WA 3CUHA 4KAQL 4H8QA 1PBYA 4NJHA 1S9WB 4OF6A 2QXWA 3E0LA 2DWDA 3SW6A 1DO5A 1PYFA 4TX8A 3O6DA 3G5YB 1HI6B 4FYRA 3U30C 4R4ND 1NCHA 1REQA 4LLWA 3CMJA 3QORA 4RX4A 1F42A 3F6LA 1EXGA 4RV8A 2BVYA 4XVJH 1IBHA 1RZJH 2VM4A 3QS3A 4TLUA 5CN2A 5DI8A 5ESAB 1W6WA 1ZA6B 1BMZA 1JPST 3J07A 4MM1A 3GUTB 1V3LA 4EZLA 3EZ8A 2R56H 3GHSA 3DYPA 4IMGA 3T0ED 1ET5A 3BGFB 1MDRA 5L6YL 2R0ZH 3HUJF 2CIKA 3RLHA 2YAPA 2R2BB 1H41A 1D2OA 4PGEB 1OK4A 5DVMA 4R7WA 4F9LA 4WDXA 3GLZA 4ATWA 1U2YA 3DERA 3HE6D 2CXKA 4Q58C 1JV2B 4Z95L 2ZYHA 3OB0K 1W3TA 2PDJA 2XJKA 2EH7L 1YEEH 3FOMA 2DP3A 2Z6JA 3RWGA 3M0YA 3M8OH 3QHFL 3K6DA 1QR4A 2O7QA 4NAEA 2Z9TA 1UXSA 3K2KA 4U1HB 1J05B 4F7EB 1I0DA 2CLLA 4NT0A 4OR1A 5GSRB 1NIDA 2NY7H 3AB0C 4NIYE 4OJAA 3UZEC 2UY7B 3ZTEA 5BJTB 2H1XA 2J13A 1MKFA 3LHPH 2ZZ1A 2VXTH 1OCQA 3UYOD 5HBFA 3M6DA 5D7LB 2RTTA 4PTTB 4RAHA 4AHQA 4FYSA 5HI5D 1EJTC 3L7FB 1B4TA 2ZQKA 1RK5A 3RA7H 5CLXA 5AOIA 1J7VR 1V08A 3OP2A 2WXKA 5FF0A 3AG3B 4KKNA 3SCMA 2YOCA 1TSIA 3UBXG 4Q8BA 3CLMA 4JM4L 3EEGA 4OOUA 5HUPA 2EXWC 3GNXA 1NC4A 5KMYA 4JX0A 1QMLA 3MSGA 1NUGA 3TC3A 1HS6A 2DTMH 1TTAA 3NA9L 1F3JB 5AYIA 4GAYA 4HOXA 5F8QC 1PZBA 1LP6A 3P67A 2OMYA 4NAJA 3VG0L 3QYQA 3VXSD 2NV1A 4I8YA 1R5VA 3HE6C 3T8QA 4MASA 4PREA 5J5DA 2YRZA 4H6EA 1RZKC 2J6WA 3VI3F 2X2UA 4KFPA 1DQLL 2E1DA 1EAOA 2GW5A 1WOAA 1PDZA 1XEUA 1GQJA 1MQ8A 2NDFA 3BYYA 3ISRA 3RTQC 3W39B 2A3EA 4E9WA 5AOUA 5D02A 1N8OE 1NSNH 5IW6B 4O02H 3VW3L 4G6JL 3DDMA 1PLCA 1I8MB 3D0CA 1BHGA 3GSUA 3ARSA 1AD9A 2KLRA 3B5TA 1Q72L 3QXDA 1GGIL 3SN6N 4O0QA 3EOAB 4YHKH 5KBNC 3QLDA 2CCWA 3PRZA 1VFTA 1U8HB 2PD5A 3L5JA 3PWVB 2Y2TA 4JO4L 1KWGA 1U3HC 1G0YR 3UC0L 5LLIC 1L8PA 3F4VA 4HJIA 4M1GL 3ARFA 5CJOH 2FGZA 3KX6A 2IQAA 5D1QE 5GPRA 3ITVA 2FR4A 2YCJA 5TAOA 4GUGA 5IB3A 3QNYB 1KTNA 2XICA 3IV3A 5CWSB 1QOPA 4R7DA 3AXMA 4C4KT 1XGRA 4U7MA 5I2IB 5J1AB 1CB2A 3X1BA 3T3ME 1MFMA 3PUDA 2DLGA 3TT1H 4JTTA 4OJFL 1PD6A 3SSGA 3C0QA 3QHFH 4KK8C 5ABAA 3WH6A 3OZYA 1RAMA 1DP0A 1NCDL 3V9CA 4AM0Q 4LYKA 2DUXA 2X4TB 4JPVL 3EH4B 3GC2A 2GDQA 1IRAY 2DI7A 1U5VA 3LBOA 2CDEA 3FRPG 1FFQA 4LCWB 2FIKA 3IKCB 1IFHL 4WI6A 4XODA 2ETWA 3GEFA 1L3NA 2WOBA 3CHVA 3OPSA 3HN3A 4X5LA 5AYUH 1OX4A 7PCYA 3O3UN 2VIRB 1E6XM 3O0FA 4MZ1A 1L9RA 2BHYA 3KW3A 4LLDB 5EOTA 2Y6ZA 3GKFA 2YJLA 5AW7B 5AL8A 4NZCA 2FBOJ 4Q4QA 4PULA 1AXTH 3HMJG 1CGXA 4HH9A 3DGRA 4XIAA 1ZAHA 2QPFA 1UVQB 3FF8A 3B7SA 3LVEA 4LF3A 2NUWA 1R24B 1A3ZA 1AJ7H 4RFNB 3DSNA 4UT9A 5CWSA 1LD9B 3WMPA 4Y5YA 1W8SA 2VDPB 2OWXA 1USQA 2IDFA 3CUGA 1E9QA 5B7FA 2ZC1A 3CWOX 4UQAA 5F9JA 4ODXA 3UH8A 1NAML 3FH7A 3IDUA 1G94A 4IZGA 2X2IA 4PB4A 1T7ZA 2E77A 4XXWA 1DWJM 3DKHA 4XBSA 2HV5A 1PCKA 1HC1A 2HPIA 3S34H 4N2AA 5H2BA 2IMNA 3N3EA 4AMXA 1YRRA 3FUKA 4P5RA 5HVHC 3UBPC 4JZOB 2XN9A 5I73B 2GABA 2ZF8A 3DHDA 2PTDA 5J6GA 2YLHA 2YUVA 4RGOL 4PBEA 3W23A 4JM4H 4W4QA 4WY0F 5JH1A 4Z3EA 1QRNE 4FEZA 1WZMA 4AQEB 3FPXA 3RRQA 4DNLA 4HUUB 3H6OA 2XFXA 4NZFA 3W72A 2WM1A 3KWTA 3JU2A 4ROPA 3VO0A 3AQZA 1JGVH 4OI8A 4B92A 4M6OL 2WV8A 1MWOA 4AD1A 1VHNA 4XPBH 1K4DA 1ECYA 1AQDA 4PJCF 3OU8A 2PLMA 3UYPA 3ZR5A 3BRFA 3RRAA 1FP5A 2MRYA 1HSAB 3NP3A 4UNTA 5DEGA 2XZ7A 3RWDB 4WVXA 2ZCGA 2DM4A 1DLFH 4OB5H 4O2CB 1RMFH 1TZ7A 4XSLA 5CCKH 3L5IA 5HHNA 2QVKA 4TUKL 3D0LB 4Q7NA 1T6VN 2D7QA 2RQ8A 2E40A 3Q8AA 4ACZA 1WF5A 2R29H 3S6CA 1XKJA 1E0TA 1A8ZA 4FFZH 4BHYA 4DTGL 1G7LA 3VOGA 3UGEA 4A8LA 4I1PA 2PR4L 1G6RA 3AU2A 4F8PA 3O45A 2E3ZA 3N06B 3UO1L 4GYFA 1J48A 3PPSA 3IJQA 5FB8B 3WLTA 1W72H 1PHQA 4P5TD 5IFJB 1F4WH 3AZSA 2F54D 3OKLB 4MXQC 5DJYB 1JCTA 3A3HA 1AHWC 5A6LA 2A9DA 4JE4B 1EERB 4PW3A 5L9DL 2NLYA 3BTNA 3NWRA 1CURA 4P8WA 4LLDA 3CK0L 1WFMA 2JK5A 5EOTB 1JNEA 4DXXA 5A6IA 4ZCWA 4ZO6A 1M9HA 3K71B 5EMYA 5C07A 5AYZA 3TTYA 3VGGA 2EP6A 4F8NA 1RXLA 4KZEL 1XLGA 3ZU8A 1E72M 2BX7A 4KAQH 3S5ZA 4WRHA 1DE6A 3CU1A 5C9RA 3B0XA 1JJKA 4X9IA 1SOSA 3BAEL 4WFGD 4WW2F 1F3RB 1LL4A 4AEHL 1GK8A 1MOEA 3WLSA 2CK0L 3R1GH 2DWTA 2MQGA 1MJ7L 2HKFH 5FYJL 1FKXA 4R5XA 2J4WL 3MLUL 2V63A 4BQ2A 2ZWKA 2HVKB 3D25B 2G2RB 1Q9WB 4PJXB 5HY9A 3Q8CA 2EGZA 2QSVA 2X4NA 1HCYA 4MNQD 1M3IA 4OCRH 5GGVY 1H9DA 1TETH 2G2NA 1B4EA 2B15A 4L9LA 1ML0A 5IFAL 4J4KA 1OAUH 1TZGL 3F7PC 3JV4B 1POJA 1G7IA 4LEFA 3PZNA 5J6HB 4HGWA 2VW7A 1X4XA 3VYOA 1UH2A 4OZGA 2FKPA 1GTFA 2F2KA 3T4AA 3F5WB 1PY4A 1WBXA 2EDTA 1U3JA 2X9YA 4ICNA 2AXFA 3P81A 1ZPUA 3ZYIA 1CJYA 4H26B 5F70A 4Y9PA 2R2EB 4XN9A 1WA0X 3ES6B 1ZT4A 5LDSA 3W38A 4G9FE 3MACH 4C7GA 3MANA 5A8PA 3BQ5A 5IW6A 1R6VA 3RPKA 3FY1A 3LZ5A 2V17H 4AZIA 1R3HB 3V52H 2QDHA 4KJYB 4MFHA 3EADA 5CEXB 1AQKL 1FHGA 4M9OA 2FWLB 1C92A 1CGSL 1FPTL 1JPEA 2RR3A 1HW6A 1XUZA 2E6DA 12E8L 4X5PA 4QHMA 5K9DA 3RRXA 4MXVE 2BIPA 3T0TA 4ERAA 3HBZA 4F9PC 3UR2A 1AGCA 2C9XA 2AAVA 2F74A 2V2XB 1KFCA 4UWMA 5LHFA 3TX9A 3BCFA 1Z3GL 4DIXA 2AHIA 5DT5A 3RM9A 4E6MA 4NNXA 2OCFD 3BT2H 2XXFA 4WO4B 5EU6B 3GSNB 5FJOA 4QHUA 2ENYA 5K9QG 2LU4A 3EJUA 2BERA 1F74A 1DBML 1PSKL 5JHDA 5LQBL 2NXGA 3LOWA 1RUMH 3CTLA 3R0UA 2WTRA 3E38A 3GSRA 4DETA 5I17B 5A7EA 1CGYA 3LZ3A 2MIZA 2OP4H 5H8UA 1PVHA 2A1WL 2AMUA 2VXUH 2N0KA 3T0VA 4I90A 1ZSDB 3UY8A 3S8FB 3ES7A 3JTTA 3UXIA 2IDTA 4JY5H 1O5PA 2GGGA 5BWFA 5I5RA 3APYA 4XP1L 4LVHB 3M7WA 3FQYA 3OPZH 4UYPA 4GKSB 1JCNA 5EU4A 4HJGB 2Z28A 2X41A 2MQCA 3SCMC 2NR6D 1GOFA 4BKSC 1DSFH 3NN8A 2HXUA 5ADOL 4PMDA 2YSTA 3WQWA 4S1RH 3O3BB 3V4PA 4YK4C 2REQB 3ZL4L 1WKDA 4HPNA 3PNWA 1ZA3B 4HKXA 3G1AA 5GJMA 1A1NA 2H8PA 5IB3B 1R2RA 4L4VA 1NAMA 5GRJH 2FR4B 1TPEA 2MNUA 2HP4A 2XWBA 2EYRB 3TS8A 4XCCH 3VMOA 4GQGA 2WVTA 1BF6A 2Q01A 1MJJB 1ND0A 4NAQA 3W0KA 2ADIA 3SY5A 1Q0XH 4FNRA 3UTQB 4BQCA 4KI1A 1WP6A 4IXXA 1W0WA 1OSEA 4YZFF 2CCRA 4E2BA 4JW3A 2C9QA 4XXWC 4RSYA 4QHRA 4PCKA 1HCVA 3PS7A 4QXTA 1TWZA 5CR8A 1WS7A 2A9MH 2RA1A 4FQXD 4MCZB 4PBWD 5J57B 1T03L 3CN4A 2ZOXA 4NG3A 1XH3B 5IMLB 3CHEA 1D7DA 1KG0B 3CUFA 3QW9A 1B31A 1MAKA 4JQ1A 3EOEA 3FFOA 4HKJB 1T2XA 4WHCA 3HLKA 1RZ7H 4YVXA 1G5AA 5A6BD 1HI6A 3UTZB 1YEDA 4MZ3A 1QUNB 3MSPA 3IRCA 2OK0L 4NZ3A 2OCZA 3QWNA 4XBKA 4NYUA 1O6VA 2Q7NA 1UA3A 2VUNA 4OT1H 4PRHD 3VSUA 4ENEC 4UOZA 3W5NA 2VFDA 4IPNB 1KXVC 4UM8B 2JK2A 1KB5L 4K6AA 4H9MA 3NEEA 4GAYB 1GW0A 1UFGA 4R2GD 5IBUB 3W24A 2EIKB 2F53A 2QADD 3KBFA 4ZUTB 4ZMGA 4IUGA 3QXTA 1JYVA 1BJMA 4PWHA 5DJXB 3ABOA 4L4OA 2GHWB 5IKCA 1YEFH 1LK3L 3K5RA 2GVLA 5AHFA 4JANB 1TVLA 4UTWA 4HIPA 2X1XR 2Z65C 1GYCA 3LU2A 1JFQL 1GZQB 2UZIL 3ULSA 2VDIA 3TYUA 5AZ2H 3U79A 3XISA 1MZYA 4PJ9B 3VI4A 2GEEA 3NESA 2J5WA 4OM0H 1PLAA 1ZP3A 3ZDZB 5BUAA 1M7OA 3PL6B 3VXNA 1RZ8A 1KT2B 5I5MA 3KGTA 4GRLC 4BK4A 4HOZA 5L4JA 3VQ1C 4FA3A 3GIZL 1P43A 3P4NA 4MA7H 4XAKD 5GS0C 3O07A 3MUZ1 2LE9A 4PJAA 4JX4A 1XBYA 5BO1H 4GH7B 2WP3O 5CFHA 2O6FA 2QQNH 4UBDD 4ADTA 4C6PA 2W07B 4HIIB 1SJEA 3WNPA 4BFOA 1RLBA 2FLMA 1JDFA 3JWNC 1JHTB 1EAQA 4N28A 4HALA 3U25A 4HYRA 5M7QA 3VXOB 1H7OA 4L1XA 1EJ7L 3X1GA 4HGXA 2WWOA 4O2FB 4NJAH 3V4VA 2DQTL 3DUSA 1UQZA 2YIHA 1B4LA 4O1BA 3ECVA 4NJ9L 3TIDB 3WIFB 4Z0BH 1OE3A 4Z76A 4MVAA 4QR7A 2AQ2A 4PR5B 3GR7A 4P5TB 1FVCB 5AVWB 2IW0A 3TC6A 3AXIA 3EYUH 3QS2A 4Z7QF 3ZR6A 3QZAA 1MCIA 4KCVA 4R3SA 2HJLB 2V0TA 5K1VA 5FCUL 2A9NH 5JTWA 2CUAA 3UYRH 4ETQB 1T83A 4G43B 1W0YT 4HQQH 4IBYA 4P2RB 4LLWB 1EVTC 2F7QA 1PY0A 4E41B 4NWTH 3BSZL 4UTIA 3I3EA 1PZDA 1N6QL 3R19A 3HIJA 3OKEB 1M53A 2FJUB 4IBVA 5T1LD 2JALA 3ZE0E 2VCBA 4XZLX 3PCYA 3BIAX 3F00A 4XR8C 4DGUA 3NRPA 3GMQA 3OGRA 6REQB 2V2CA 2GJJA 3HGRA 3HI6H 2YPVH 2WXJA 4HD5A 2M26A 5FM5M 4H5SA 2B1AL 1L0PA 3S7GA 1DIEA 4X5RA 1E8YA 3H9SA 3O6CA 4DO7A 4MLIA 3P7YA 2AABH 3T2LA 1TA3A 2OYLA 5KSBB 4P61A 2BSEA 1TCRA 3H9SE 2F53E 3OGSA 3ULVL 1TZHA 2NW3B 3O9WA 5KBDA 4JM2F 4GWEA 1RZFH 2P7TB 3VFWA 1JTTA 4UTKA 3CDGB 4APQB 5D7SH 1EF2A 1KCLA 5KAQF 1A5MC 2D7TL 3RB7A 3U5UA 2I24N 2WVUA 4QDPA 1JK9B 4MDPA 4QO1A 2Z31A 1T22A 4OZFB 2PTWA 4OT7A 1IM3D 1L7TL 4IX2A 1I7UA 4LYQA 4DBUA 1PGRB 3ILPA 4WY7L 4JNXA 4ERIA 2ICWA 1PIFA 3MKCA 5AOKA 1XF2A 1QWNA 1WZ1L 1W1A1 3GVWA 4G7EB 4NP9A 4QTIH 5CSGA 2ANUA 3CN1A 2X8RA 1S5HB 1X5IA 3MNZA 3U7YH 3EJYD 3PG9A 4BI7A 4E4PA 1EEZB 3VWJD 5D2XA 3B2UC 3ZHNA 1QUPA 4H5SB 5DLCA 1XC4A 3D47A 2X2YA 4B5EA 2ZT9C 4H88H 4YDIL 4FF5A 2DQUL 3ATEA 3V5OA 5H2ZA 3QIBB 2VEKA 4C6CA 4EACA 4PV9B 3HRZA 5HYQA 4EI6B 3VACA 5C70A 1OK6A 2QCNA 5REQA 4KWWA 5FD0A 2VAAB 3AWEA 3QCVH 3QIWD 3SPCA 4H6RA 3IETA 3P62A 4PMFA 4XZWA 1MHEA 2YWZA 3WHXB 3C4UA 4WLCA 4QBXA 4RNIA 1SHWA 2GJ6A 4XCEB 3V5DA 5JYLA 3O0RL 3A0OA 5DJDA 1EJOH 3U4BH 3NXLA 5L4IA 2GFBB 4JVWA 2QCFA 2VLRE 4HMCA 4AVHA 4L80A 2E7MA 4PE8A 1IGTA 2EH8H 4CGTA 1JZIA 2YCLB 4OFDA 4XB8A 1SMDA 1EJFA 1X5KA 4JFQB 3D2TA 2FT8A 1VSCA 2X4RA 4PJBB 5ESVA 3T04D 4IJTA 1UOZA 2GGHA 2ROYA 2R9HD 2QHRH 3TIDA 3WIFA 2EICA 1KTDA 2HLEB 1KA9F 1XBDA 1FV1B 3IN2A 4HP5A 3O4LA 3UAAA 5B1JC 2D3LA 4KMTH 2B4CC 2Y0SA 4IKNA 4OCSH 3IJEA 2FTWA 5ID1A 4HSCX 2HVMA 5E9AA 3V0JA 4A6YA 2NDGA 1IJNA 4HNCA 1P84J 3KPQB 2FSEA 5DFAA 4L29B 2F58H 1TEFA 4AMAA 5MP6L 2FZ9A 2OSXA 4ZB2A 1LG1A 3BQ6A 4GBXB 4AV4A 1AW5A 4KERA 1ZLUK 1EF3A 3HMWL 1LRNA 3EGSB 3SFWA 1NY1A 1NBYA 1BWMA 3EGXB 2NXIA 5K2ZA 2BS8A 4FP8L 5I0YA 3OODA 3PG8A 4OV5B 2YYUA 4L9ZA 1EO7A 2BP5M 1CD9B 3VXNB 1XR8B 4AYDC 4FJZA 1RZGA 2A9BA 2ALRA 1LWHA 4EAMA 4E8DA 2DORA 2XM2A 4DF2A 4R85A 1YHPA 2YK1H 4YCPA 3PE9A 4PWGA 2J71A 3ARWA 1XFPA 2BHUA 3NDZA 2B77A 3RY4A 1Z6KA 4BFFA 4M24A 4PPTA 1Z9NA 4MZYA 2Z24A 5T1KA 1VFSA 1JGIA 3LEYL 4G83A 5AC7A 5I0DA 1X38A 5IR1B 1ZMYA 5DWPA 1QPQA 3DURA 3FRUA 4IRSC 7ODCA 1Q6OA 4G72B 3MKVA 1VCBC 4S1SH 3M9YA 1J96A 1P48A 2VR3A 4XE0A 4D9QE 3L23A 4Z17A 4Q74A 1CFTA 2O1AA 4MCNA 4XKYB 3VD5A 5F7MC 3GSXB 4QXWA 3QCTL 2DWYA 1WKYA 2APTA 4GYJA 1MF2H 2BP0A 3AZTA 3FQNB 1KJMA 4FQJH 1IIGA 1J9RA 1Q85A 3DCPA 1MCNA 4XAWL 5DYOA 4J3UA 2F19H 4Z2JA 1R85A 2Z35B 1T7VA 4G1EA 1CDUA 2OCCB 3Q1SH 4YJ5A 3MRQB 1PIIA 1V6XA 4NRZB 2J7FA 5CGBA 3WNNA 4GY7A 3W76A 1MCPH 2VLJE 4N8CH 5SWQB 3CGTA 3FYOA 4UC5A 5BVPH 3TJHC 2HVNA 2VABA 2FB4L 3ATFA 5ITFB 1LOSA 5TQ0H 3OSKA 3L3OC 1US0A 5EBWB 3RX9A 4LGXA 2XWTB 4Z3JA 1RQ5A 1QFWM 3FTVA 1O12A 3KVLA 1OARL 3GS7A 5IJDC 2J6XA 4U1GB 3HFYA 2XTJC 3Q6FA 1ZRUA 5MP6H 4PD4J 1NAMB 1D5ZB 3BWAA 2DQCH 3LCYA 4Z08A 4AX3A 2GBTA 3DX2A 3VI2A 3NR0A 3CNKA 3UT0A 3HGOA 1GGUA 1JV5A 4RGNE 5CIPH 4YAQB 2VB5A 4CMMB 2ISSA 5CCGE 1AG1O 4ZTEA 4YDLC 5EU4B 1BXBA 4L4MA 4MWAB 2PR9A 4IKKA 3X13A 1G4EA 3FULA 4M7JL 2O61B 4L65A 3HG1D 3DETC 4KO5A 5I76A 4AK2A 4RNHA 1FWDC 3F01A 3WKML 1QACA 4AYEC 4ZE4A 4HUVB 1LO5B 2R1XA 4M7ZC 4LFHD 1LP9B 4MJ5B 3PXLA 5KYYB 3BP7B 4OFYA 1A25A 1XIIA 2QKFA 4M4PA 3FKKA 3HMXA 5J0BA 3O6FA 3AXHA 3ZKXB 4Y2WA 3GRWH 4FP1A 1ANUA 4DY1A 5DU7A 3KJ6L 1OHLA 1QABA 3BEVA 3VXPB 1CG9B 3EUUA 5EEWA 4HUWB 3MMDA 2PCFA 3QQ3B 4NJGA 1PNDA 5ITBH 1MRQA 4QHLA 2CLPA 4DAGL 2QPSA 3QKEA 1VGKB 3CWGA 1GYNA 1E3XA 4FYQA 3E6FA 1FHLA 4Q9RH 2FLIA 1IBFA 4UB9A 5EBUA 3VE7A 2ESVA 4NYYA 3D08A 4P2YA 1CBVH 2WW5A 3C08L 3DGBA 2N1TE 2O26U 3D4GA 2G4GA 3IJSA 1EBGA 1O5RA 2AMXA 1TTJA 4WW1A 1WD9A 3BHBA 4D9LH 2GGJA 2OXGB 4OD1L 5ICUA 2UBPC 2HWZL 3CQKA 3U7WH 2G60L 4QLLA 3U9WA 4WY7H 3AU6A 3JV0A 1WC7A 2FZDA 1LLAA 3WMSA 4C6OA 2YGPA 4IBUA 5IJVA 4KJPC 3GI8H 4L3EA 1AGFA 1W1TA 1WBXB 2FHBA 4BFKA 2EIZA 3GNMH 2DPEA 3BLEA 3W86A 3PQYE 4XVTL 4AYID 2Q7AA 2RFXB 4ZNCD 1D6VL 1HQ4A 1VEPA 2D2OA 4M8QA 4NT6A 4NFBA 2HS8A 1JNLH 3CT2A 4K2UH 4NZ8A 6PAZA 2AQOA 1G9ML 1SLVA 3QEUB 4UQCA 2OO0A 3W7KA 3LCWA 2Y7GA 1GYUA 3DMMB 1ME7A 4NQVB 2X7LB 2GT9A 3H9ZA 4FX6M 5EIIG 4HDIB 5J5EA 2E9IA 3IVKB 1LOLA 1RHHA 2B1AH 2O5NA 2YCEA 2WGNB 2XZ9A 1KM3A 1M5WA 5I1KH 2WQ8A 4ACTA 5DRCA 3TMLA 1T0NA 3N6HA 1LDCA 4FADA 4BF9A 4F0KA 3NGFA 3RGHA 1K8YA 3AS2A 2HFGL 3TH2T 4XAYA 3KWWA 1NCAH 4PSRA 1DJXA 4N3TA 5GQBA 4NC1C 4ZK8A 1POKA 1TTIA 2O7SA 4HHPA 4CBPA 3M43A 4WUUD 1H8OA 4OLXL 1CLVA 1PQZB 3L2LA 4TNGA 2G41A 5C2GA 1QQDA 1VPOL 1HZKA 4RESB 1SFJA 1C1EL 1J8HE 2B59B 3EX1A 3TU6A 3KPSA 4MYPA 4TUJB 4YZFE 4YFLI 5I79A 2J57A 2Y6SC 4JDYA 3VE9A 3GNOA 2HK1A 3NPSB 4IQEA 2PDBA 2FGLA 4A3RA 2VFIA 1D9EA 4JFHD 2VMCA 2GDVA 2X6UA 5CC5A 2G5BA 3GMMB 3P54A 5A6JA 1CFQB 4UFKA 5FJUA 4NGHH 1RA0A 1CICC 1QLFB 3Q01A 5CBEB 2FUQA 4RX0A 5FEPA 1QFUH 2PDMA 1T0OA 4YQXH 1SYTA 3V0TA 4FHKA 3CZFA 1L6GA 5AG9A 1LWJA 3LQAC 1WIPA 4W4OA 2ZNXA 4J39A 1G4MA 2PCFB 4OZGF 1XLLA 4LVBA 4IQHA 5DF0A 3UPMA 4PRTA 2C9VA 2GTZB 3E0FA 5H8PA 1V3KA 1GCFA 1BXNA 3EZJB 3L1EA 1DXEA 3RWDA 1TVBB 1MNUL 4HJJL 3IFLH 3HZKB 5HSFA 3TIEB 1ZS8B 3JVGC 3BN9D 3H3BC 1T2QH 2QUMA 4G7RB 4HBCL 4X4MA 1SRDA 3L3KB 3JSSA 2NX5B 4IHBA 2OTWA 5BCAA 2FD6L 5CGMA 5DELA 4PTXA 1THAA 4BY3A 3SCUA 3X13B 4OFQA 4K39A 2Q6WA 5PTDA 2WYZA 4QRAA 1EDTA 5I28A 4ZS6D 4LSUL 2GZXA 5CBEA 1ZALA 3FBQA 4NJIA 3FX4A 1YEFL 5LNGA 4EOUA 5SV3A 4F8LA 5IHUH 1XD0A 5D2LA 3CBRA 2J8FA 3UVIA 4I5UA 3C08H 5C0FA 4NHCH 2WZAA 1BVWA 3MRMA 4NO3A 1GZJA 5DHMC 1KB5H 1KR0A 4R8WL 1FZJB 3UWYA 3HC2A 4M6NL 4NI6A 4U4BA 1A0EA 1GQKA 5AC4A 5A8QA 3FCSA 5CBJA 2Z4GA 1F18A 2CHWA 4WJG3 2XVGA 4DAGH 4JTFA 1P4IH 4JFVA 4JE0A 1YEGL 3VWKC 2TSYA 2VN6A 4NZTH 1T1WA 1OY0A 1V79A 3P5ZA 3ULUE 3ZVIA 2I07A 1KKRA 4O13A 4RIRB 3OTTA 4M7LT 3TQPA 3LHYA 2CKSA 7XIMA 4W8AA 3RWHA 1PV8A 3A24A 3EJZC 1EPXA 5I8EB 2CQVA 4OD3L 4NASA 1PNCA 3JW7A 1ZLVK 2YS4A 3NA8A 5DVLA 3E0WA 1MCRA 4TKWA 3V4UL 2ERJB 5MEQB 1QHZA 1KM6A 1EEXA 1RD5A 4NQVA 4C6MA 1PB0A 1UD4A 4HSQA 1IZJA 1OP9A 2H6PA 4JG0L 1F8MA 3LD5A 4LUIA 3B2VH 4OECA 1E9ZB 3U1SH 2VDKL 3VINA 3DLQR 2R51A 3QSKB 3PF2A 3P2VA 2YA0A 4HU3A 4N02A 1BYPA 1O0VA 5I3KA 1GKRA 2GJ6E 4A67A 3ARDC 3GH7A 4NXSA 2NVDA 4UTHA 3OR6B 1SEBA 1FH2A 4JN1H 4I4WA 4LHUG 1DL3A 2NVAA 1HCZA 2Q87A 3UJEA 3NQEA 3JTSA 3PWPA 4BQBA 1TNMA 3PXHA 4GO9A 4XCNA 3HC4H 4NEHB 2W65B 2B7NA 1V05A 2ARWA 1XSIA 1VENA 3DX8A 3NOIA 3UZQA 4AC4A 1K7FA 1FO0A 4HT1L 3SHSA 4FXJA 4O54A 4RL3A 3RL2A 5I1AB 3ARTA 3FZUD 2NY0B 1OP3H 2FB4H 5GS1B 2PRHA 1EHAA 2Q86B 2Y62A 3M5XA 3QOMA 2GIXA 1V7YA 5DO2C 3H8NA 1SXCA 4D6JA 4JTAA 3QNXB 5B1BB 2OP4L 3BFQG 3ZDYB 1UB5A 3SOBL 2EO1A 1I3RA 5HDQH 2OR7A 4N86A 4RGND 1NBYB 1XR9B 1D7KA 1PSKH 3CTTA 4H8HA 2Z34A 2ZRXA 4ZFGH 2F19L 2XU2A 4LLUA 3CAWA 3RU6A 3SDYH 4BQ5A 5CJNA 4HKBB 2GDUA 4PJ7E 4TO8A 1CUOA 1YDOA 3UMNA 3T3MB 2QKIB 4QMEA 1SYSB 3Q48A 4MJIB 4XHQA 2ABBA 1R9ZA 2DH3A 1WICA 3B7YA 2G3FA 1LDPH 3QCVL 3QOKA 1XLIA 1BDYA 4QIUA 2R0WH 1FV1A 2KS0A 4OY9A 3G1RA 4DWSC 3TCTA 1SW3A 5EEZA 5G4HC 3BAKA 7CGTA 3P2BA 1T0NB 1TTRA 5C55A 3FK3A 4MSSA 2APXA 4GI8A 3T2PA 2QPUA 3K1GA 3DFPA 2E7LA 1W3LA 2ITDA 4B5TA 5GRVK 1GVIA 3O4LE 1ZT1B 3H2PA 4K7FA 3EX4A 2MOQA 2GT9B 3CIAA 3V5DB 1ISXA 3FSUA 3THUA 1BOGA 2PU0A 4I0PC 2R1LA 4L1WA 3QUXB 2R27A 5HGAA 4IMCA 1I2OA 3E7JA 3J8F7 1AHMA 4C8XA 4R5EA 3RDJA 5JO5B 4MWFA 4ASTA 4ZZ9A 2MCPH 4FLRA 1S7SB 2EDXA 3OZ9L 2CWRA 2WBJD 1UWSA 4ONHA 4UDTA 1TETL 4ZS7H 1NVMA 3QV6A 4C5ZA 4FRWA 4MXQD 3O11B 4KPHL 1OGSA 3BLKA 3HIZA 3WN5C 3T6QC 3W1MA 1NGPH 3G8EA 3K6OA 2J2ZB 1JS4A 3HUJE 1OWQA 2A2IA 5SWQA 4BA8A 1KGUA 3WNOA 5GGSB 1GW9A 3NCXA 3MDJA 2UWEE 1OHQA 2XVKA 4AEHH 2AABL 1FWEC 3PF3A 1UWTA 3GBNL 1JXFA 4GY0A 4KROB 4E8GA 3T4AC 2XN1A 5AYBA 4FQIH 4OUEA 1F4YH 1GOGA 3WL9A 5H1WA 2AJUL 1QRNB 2DMGA 5GSVB 2BVPA 2ITEA 2XN2A 4JN2B 3QQ9D 2YW3A 3MUIA 1SEQH 4QO1B 3RVTD 3A5FA 1OM9A 1VGKA 5BW7A 1UH4A 3L1FA 3H42L 3AYTA 3RZCB 1PX3A 4QYAA 2FO1A 1CG9A 2QR6A 3CFKA 4IPJA 4CEUC 4AL8C 4GI9A 3UACA 3WDHA 2JIXA 5DQDL 4HCIA 3UYRL 5JDSA 4H8PA 5TGBA 1WUFA 3DEQA 2V7NA 1BIIA 3RHWF 3B5GA 1CXHA 1BVZA 1ME8A 2UUDK 3HBPA 1P2CB 1RZJC 3GI9L 3P77B 3QZEA 1FAIL 4MWAD 4Z0BL 4JRFA 4DKEH 2ZAHA 5H91A 4H88L 3T6WA 3CXFA 3IXTA 4XPFH 2HEJA 3LLXA 2I9LB 3KCWA 1K02A 1IXOA 2DPKA 1E6QM 1XIFA 4Q14A 5H6HA 1LZOA 3OF6A 1U1JA 1S9XB 3FCUB 2EPHA 4U31A 3LCFA 3BVWA 3RJXA 3MP4A 2BZCA 4B4HA 1JHKH 3FGCB 1B4JH 1LO2L 4TL4A 1E5JA 1NKOA 4XPHL 3APTA 3PUOA 3Q45A 4HK7A 2QMJA 4JO5A 3F04A 2EJ1A 3OPUA 4ZW7A 4RCAA 1A65A 4KUZL 1EEPA 4ZENA 1KM0A 4HWBA 1OALA 4J2MA 3TXZA 5DHEA 1R3VA 2VLLA 4AXWA 1SSDA 1VZWA 3V35A 2XIIA 4TS6A 1JCYA 3WF0A 3L4YA 4AIXA 1U8OB 3IFNH 4HF5H 4OGAC 4DVBB 2V6AA 3P3TA 1AG6A 5T1DH 1TJIH 5KAQG 5F97E 4GPNA 4KXZI 5AKQA 4G6KL 5FWRA 1KN4H 5F3BB 5T91A 2FZBA 1AKJD 2Y7FA 1P0BA