3VM5A

Recombinant medaka fish alpha-amylase expressed in yeast pichia pastoris
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
499
structure length
499
Chain Sequence
QHNPNTRDGRTAIVHLFEWRWADIAAECERFLGPKGFAGVQISPPNEHILVSSPWRPWWQRYQPISYNLCSRSGGENELRDMITRCNNVGVNVYVDAVINHMCGAGGGEGTHSSCGSWFNANNKDFPSVPYSNLDFNDGKCKTGSGNIENYGDPYQVRDCRLVGLLDLALEKDYVRGKVADFMNKLIDMGVAGFRVDACKHMWPGDLDNVYRRLNNLNTKWFPGGSRPFIFQEVIDLGGEPITTGEYVGLGRVTEFKYGARLGELFRKWNGQKLSYTKNWGEGWGFMADGNAVVFTDNHDNQRGHGAGGASILTFWDPRLYKMAVGYMLAHPYGFTRVMSSYSWDRNFVNGKDENDWIGPPSNGDGSTKPVPINPDQTCGDGWVCEHRWRQIMNMVQFRNVVNGQPHANWWDNGNNQVAFGRGNRGFIVFNNDDWALDVTLNTGLPGGTYCDVISGNKDGGSCTGKQITVGGDGRAHFYINNSEEDPFIAIHADSKLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase
publication title Structural and functional characterization of recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris.
pubmed doi rcsb
source organism Oryzias latipes
molecule tags Hydrolase
total genus 173
structure length 499
sequence length 499
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vm5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vm5A01
4MB3A 3ALFA 1XCWA 4XB3A 4NX0A 5FOOA 3WEZA 1JD7A 2G3IA 5A6AA 3GM8A 1ZBWA 1HJUA 4D6IA 5A1AA 3BAWA 3ARVA 1GJUA 1JZ4A 4L4OA 2BHZA 4H2CA 1W2VA 1UR0A 2ZIDA 1U2YA 4HMEA 1OT2A 3AJ7A 3CHEA 2GJPA 5CSUA 1HF6A 4X0VA 3WSUA 1WB0A 2VRKA 3L4ZA 3EMQA 2G3MA 3WMBA 3WDRA 3W29A 1R7OA 5I24A 1SFSA 2W66A 2F7PA 2XJ7A 1EO7A 3VU2A 3ALGA 4MAZA 5D8ZA 1TVNA 4OBRA 2OW6A 2YA0A 1NARA 1JNEA 1WZAA 1FHDA 2W91A 1E4NA 4CU8A 1EQCA 4HOXA 1B3VA 1M03A 4B9YA 5AY7A 1GPFA 3T0BA 1YHTA 3BAYA 2JALA 1HL8A 3F5KA 4IPNB 1WAWA 3VIFA 4ZFMA 4PMXA 3ARZA 1AQHA 2ZUTA 5I79A 3WH9A 3MV11 3VD9A 3AMLA 1LWHA 2G41A 4OUEA 4H41A 3MUZ1 1CPUA 3ZQ9A 1LJYA 3AXIA 5HOSA 1LL6A 2YBTA 1V03A 1JZ2A 1UG6A 2F2HA 1WZMA 1LF1A 3CUHA 1XH2A 1VEOA 4NSBA 3FNDA 3IK2A 4EE9A 1H0IA 4MNJA 4Z2IA 2ZX8A 4TX6A 4C7DA 3SEPA 3A4XA 2PBGA 3U5UA 3K4AA 2F7QA 1E0WA 1QNQA 1V0KA 3AS3A 2G3NA 3WY3A 1V3MA 1J18A 1BPLB 2YIHA 2YA2A 2VURA 2CBIA 1HP5A 4UQAA 1V0NA 3HU7A 2GSJA 1HTYA 1TFVA 2Q8XA 3EDKA 3BVVA 4CU6A 4UOQA 3RPMA 1NH6A 4A3HA 1QW8A 2CHOA 3WQVA 4D6EA 4QP0A 1QHOA 3VMPA 3PZQA 1I75A 4Z2HA 3EDDA 1A47A 2VZVA 1E73M 2F7RA 4UQ9A 1KQZA 2PI6A 3S5ZA 1NWSA 3MKKA 1LL7A 1OGBA 4GZJA 5GPRA 1HJWA 3TTOA 1C90A 3WH5A 2PB1A 2XHYA 3N17A 1E70M 4OOUA 3H53A 4AD2A 3VGEA 5BCAA 3CZGA 3VD7A 2WLZA 3NSXA 1J0ZA 3AHZA 1P6WA 2CERA 4HU8A 4J3SA 1OCQA 4HTYA 1OIFA 4M1RA 3N12A 1LG2A 2VRQA 2NSXA 2G4FA 4AD4A 1CECA 3A24A 5BXPA 1DWAM 3AMKA 2VI0A 3BH4A 1BQCA 1R75A 4GQQA 1MQRA 3WELA 1R85A 4UFLA 2V3GA 5HPOA 1V6WA 2YDSA 3WIJA 5M5DA 3KZSA 3IJ8A 3HG3A 1EDTA 3VIGA 2J7CA 4BZYA 5A6BD 2J79A 1B3YA 1SR0A 4AEEA 4K68A 3NSMA 2DIJA 3WUGA 4LGXA 4AIEA 3LPGA 2FGZA 4TUFA 4GZIA 3PHAA 3VD5A 1DTUA 1UKSA 3FY1A 1XV8A 3AYSA 1E15A 2CYGA 1CXEA 1ZJAA 2WYSA 1NP0A 5A94A 4MJ4A 3T2QA 3ZOAA 4CD6A 2IGTA 1G1YA 4AISA 1B3ZA 1VIWA 4ATLA 3A21A 2XN2A 3WQWA 3GXMA 3L4XA 2BV9A 2WANA 5BRQA 5EBAA 1XYZA 3K1DA 1JZ7A 4H7VA 5BXSA 4M81A 1CXFA 2J25A 2D24A 1KXHA 3A5VA 3BSHA 3H54A 1MW1A 2ZICA 2YFNA 1HKIA 1ZJBA 1MQPA 1H41A 2WZIA 3WUEA 4MNKA 4NZCA 3BGAA 1OWQA 3VDHA 2DGAA 4D1IA 1J12A 1NQ6A 1UWUA 4JCMA 2E3ZA 2GJXA 1QI0A 4BQ4A 4FNUA 2AAAA 1OD0A 1CGWA 3A4AA 4CN4A 4W5UA 3K4DA 3WQ4A 1IV8A 2WAGA 1F4AA 4U5KA 1CIUA 2XIBA 1MW3A 4JHZA 3OIHA 3EMZA 3WNLA 2O9PA 2G3JA 4WKAA 3WFZA 1CGYA 1TA3B 1UQZA 3EJPA 5A3HA 1UWTA 3DECA 3VINA 1FH7A 2O9OA 3BVUA 3L4VA 4QLLA 4HP5A 4X0NA 1ZU8A 5ABFB 1GOIA 1JYXA 1QI5A 4F66A 2V5CA 1TQWA 1EO5A 2YFOA 2XUCA 4N0RA 1UD6A 4FLOA 3N13A 2XWDA 3UG3A 1UUQA 3W6LA 3U7BA 3ZJKA 2E8YA 1BYCA 1CXIA 1OT1A 1W1VA 1C8YA 4P8VA 1UQYA 3HG2A 2ZX5A 4MDPA 1MQQA 3F5LA 1G01A 3ARQA 2YL8A 3E1F1 4P8WA 2E9LA 3NSNA 2X05A 3VSVA 2W5FA 1E6PA 5CGMA 4WSJA 1JFHA 2C7FA 1IZJA 5I23A 1JAKA 4JFTA 3ARWA 3KL3A 2JF6A 4WKHA 2WHKA 3POCA 3VIOA 2E40A 2Z1KA 4Q7NA 1TQTA 4M56A 1FA2A 4D71A 4DM1A 3GTNA 2BXZA 3IGUA 3ARXA 3HN3A 2CCRA 2WMIB 2D1ZA 1B2YA 1QOXA 1E55A 4S3KA 3WH8A 1JI2A 2A3AA 2WMGA 2ZX7A 3LRKA 1B3WA 2YLLA 1WDPA 3GH7A 2VR5A 1W3LA 1HKKA 2EPKX 1JDCA 2A3CA 3PZ9A 3PTKA 2WLYA 4D1JA 2O92A 4U33A 1BGGA 2PWFA 1UWSA 3VIJA 2ZUUA 2A3EA 2Z1SA 5CSYA 2VZSA 1KXQA 5A2CA 4W89A 2BNJA 1CXLA 4CN6A 1E9LA 1ZL1A 2X0YA 5DT5A 5AC5A 1J01A 3WD2A 3WF4A 3EBVA 4WSKA 2CEQA 4D6FA 1O6IA 2XFRA 2X1IA 2ZUVA 8A3HA 4HMDA 1V02A 1H4PA 1KQYA 3BVWA 1YQ2A 3BVTA 3WF1A 3OBAA 1OM0A 3BAJA 3WMCA 5A6JA 4AZCB 3WD3A 3NIYA 3PZIA 2F18A 2VZOA 2WVVB 2VO5A 4LYQA 2J7FA 2VCBA 1HWWA 5E6ZA 2GJRA 1V0MA 1J10A 4P7OA 3BMVA 3FHQA 1V02E 1GZJA 4QLKA 3MANA 3B9AA 3S5YA 3GNOA 1UR4A 2J7HA 5CXPA 1EHNA 3W28A 4CU7A 1IT0A 4MB1A 3AOFA 1KXVA 2GK1B 1BGAA 2JEQA 2WWDA 4UFHA 4OBSA 1LQ0A 1VF8A 3T09A 1R46A 4RE4A 4AEFA 1V6YA 2J75A 5GQBA 3OZPA 3GXDA 2BY0A 1G5AA 3BLBA 3WD0A 3QR3A 4F9DA 3PN8A 3LRMA 1M7XA 4P8UA 3QGVA 4FMVA 3CMJA 3A3HA 4FNRA 5C70A 4HA3A 3WQ5A 4QFUA 2PWDA 3S6TA 1FFQA 1CENA 1HX0A 4TVUA 1J0IA 1HT6A 4OOZA 2J8GA 5CJ5A 4J7RA 2QLYA 4F79A 1QX1A 1S46A 1Z32X 1E56A 1EOKA 1RD6A 2XVGA 3AI0A 3G6LA 3BUDA 1DP0A 3UERA 4PEEA 3LPPA 3W37A 3BVXA 2JF7A 4RE2A 5DT7A 1TR1A 4XV0A 5C71A 3AIUA 4PMRA 4GINA 3BUBA 3L2LA 1PX4A 4W85A 1QW9A 4PMYA 3VIIA 1W3KA 1CYGA 2VCAA 4ZENA 5JIPA 2X2HA 4JL2A 5I2UA 1K9EA 3VGDA 3GNRA 3FAWA 4HA4A 1I1XA 1H2JA 5A2AA 3IANA 4ZE4A 1XC6A 4PMUA 4RL3A 2C8NA 1W1PA 2QV4A 5LA0A 3DX0A 1QNSA 3N1AA 1E1EA 1UKTA 2D0GA 3VD4A 2PWHA 2ZUMA 1V3JA 4EANA 1HJXA 3M07A 1BHGA 1JFXA 1NOFA 4KWUA 2E0PA 4LX4A 2UY5A 4HOWA 2YL9A 2VX6A 3A23A 1FFRA 4W7UA 3THDA 1EHAA 3F5JA 3AS0A 1GQIA 2PC8A 3WKZA 4JAWA 2GDUA 3EJSA 3LRLA 1BFNA 1UR1A 4M80A 1QBBA 3WFLA 3UCQA 3ZSTA 2VOTA 1E6XM 3VGBA 5F7UA 3VMOA 4AXNA 3DYOA 5A6BA 2VCCA 2WVSA 4P7RA 5BRPA 2E8ZA 3CC1A 3CO4A 2YA1A 2OLHA 4BQ3A 1ISWA 4W93A 5FKYA 3I3DA 4DO4A 2EPMX 3VO0A 4EK7A 1CTNA 4AYGA 3TONA 2A3BA 3SUUA 4Z2JA 5CZKA 5FD0A 5E09A 2J7BA 1DWGM 3MUIA 1JI1A 3WUBA 3UG4A 4U3CA 2D22A 3ZR6A 3AMCA 1KGWA 3OLDA 1NWRA 4PTWA 2WB5A 1JYWA 1QBAA 1IZKA 2QPSA 1CDGA 2FGLA 3M6DA 2CBJA 3WH6A 2PWEA 2ALWA 1OIMA 3N18A 1TMQA 4JKKA 2XSAA 3CV5A 2DT3A 1KFWA 4TTUA 1VAHA 1XD0A 4U2YA 1Q6CA 3KEHA 3W81A 3HG4A 1Q6EA 3GDBA 1FHLA 2VX7A 4H8VA 1LL4A 1GHRA 1D7FA 3TTYA 2MANA 2DT2A 2J7GA 1CLVA 5FL0A 4J3XA 2CNCA 3OGVA 3EJTA 3TTSA 4HU0A 1UZ4A 2WC7A 3ARUA 1ODZA 4AD1A 5E0CA 3VGFA 1UD8A 5IFTA 3EJUA 2CETA 3CHDA 1KCKA 1K9FA 3OA5A 3VM5A 2G8ZA 1PZ2A 3LMYA 5EFFA 2JEPA 3ZT7A 1H5VA 1SMAA 1XSJA 3QHMA 2VQTA 3NJ3A 5HNNA 5EMYA 1HL9A 4Q22A 1GJWA 3VIKA 3IJ7A 4MB4A 3WBAA 1E0VA 1BG9A 2DPEA 4BS0A 3N15A 3LPFA 1TUXA 2UY3A 1ECEA 4N42A 4B3LA 2YJQA 4CD8A 1VFMA 2O9RA 3CBWA 3PZUA 1B1YA 5A8NA 3WL1A 3QHOA 1JAEA 3SCWA 1E4LA 1WKYA 3GXFA 2FH6A 4HMCA 3VGHA 1E6SM 8CGTA 3ARRA 3VGGA 4HA1A 2BY3A 2OSWA 1TCMA 1OGSA 1L0PA 3WUFA 1H09A 2WHJA 2J77A 2F7OA 1V6VA 4UTFA 1W91A 3FN9A 1KWGA 2C0HA 2X2JA 2WK2A 3WBEA 2XGIA 5IHSA 1V3KA 1EA9C 1XRVA 3DYMA 3A47A 2OYMA 2VX4A 2W61A 2PBOA 3OLGA 4E4PA 5A8MA 1TQUA 3WF2A 4ML4A 1KBBA 2EABA 2BY2A 4LQ1A 3MMWA 4CKQA 2GJXB 1GOOA 2HVMA 1H1NA 2WZEA 2JFEX 1MXDA 4IPLA 2Y8KA 2FH8A 4PSPA 3ZO9A 4MNLA 4WJXA 3N11A 1SYTA 1X6LA 4URIA 3MV01 2OSYA 2OWCA 2XM1A 2NT1A 1R7AA 1CXKA 3GH5A 3AFBA 5BYWA 2EPOA 5ABGA 3HJEA 1EXPA 1U33A 1F4HA 5CLWA 3CUFA 1Q6FA 4M24A 1JF5A 1QHPA 1C91A 3RM9A 2NT0A 1JD9A 3VNYA 5HDRA 2FHCA 2WKGA 5E9AA 1JDAA 5D4YA 4IUGA 2OWWA 3VIMA 3L2MA 3VPLA 3WDQA 3ZJ7A 4AMCA 3ECQA 2ZOXA 4NRRA 4DWSD 4E8CA 4LXFA 4Z2LA 3AQUA 3OG2A 3WQ6A 4PN2A 3UR8A 1R47A 3VX0A 3NCOA 4UFJA 3T2OA 4NXKA 5CPTA 1UD2A 1PAMA 3AIVA 5BWFA 4UFMA 3GZAA 4XUYA 2GFTA 4F8XA 3RILA 1KB3A 1W9DM 2FYVA 1BVNP 4FNSA 1UKQA 4UQEA 1XH0A 4CD7A 3RCNA 1C8QA 2QPUA 3KLLA 4OJYA 4NXSA 3WF3A 4AC1X 1SMDA 1UOKA 2WMFA 1PIGA 2BXYA 3F4VA 2YL5A 1OSEA 4MNMA 1QNOA 2WHLA 1W9XA 1L8NA 4FF5A 2VR4A 5E6YA 4BQ2A 1WP6A 4AZ5A 1QPKA 2VVNA 1R87A 2DH3A 2YKKA 2VX5A 1KBKA 1JIBA 3WMSA 3M46A 4GPNA 1XD1A 3EJQA 1JG9A 4KMQA 7A3HA 4W88A 4PMNA 2RGLA 3B8SA 4D6DA 3AISA 4PUDA 5I78A 3CGTA 4CGTA 4UFKA 1GCYA 4NRSA 4W8BA 3VTRA 3PBGA 1EDGA 4J27A 2ZUSA 3KL5A 1GQKA 3A22A 4JFSA 1OINA 1UH2A 2X2YA 1BLIA 1ISZA 1Y7VA 2FE0A 4XZBA 1GQJA 1E40A 1FH8A 2D20A 2VJXA 1GVYA 2YLAA 3W4RA 2WMHA 1CGXA 2CKSA 4UOZA 2E4TA 3WY1A 2XSBA 3ARSA 3LX9A 1UD4A 3LXAA 2UY4A 1MFVA 3ARYA 4U2ZA 1KGXA 4UQDA 3WNPA 1PBGA 2ZUNA 4AZBA 1U30A 1W9UA 2EJ1A 1JZ6A 4C7FA 1PIFA 3ZT5A 2BHYA 1NOUA 3BCFA 5JUVA 4H8HA 5BROA 3D4ZA 1C7TA 2CPUA 4TOQA 3IAPA 3N9KA 5A69A 1X1NA 4DO6A 3K8KA 2F1BA 2VRJA 4XZWA 4YPJA 3CPUA 2DSVA 2B31A 4QAWA 5I77A 2EAEA 5CGTA 2VMFA 2IXVA 5EFDA 1AMYA 2EPLX 4PCSA 1G0CA 1HP4A 3ZJ8A 3NDYA 5LA2A 4J3VA 3WNNA 1UWQA 4AD5A 2XN0A 1O7AA 3OGSA 1UD3A 4FNPA 3AHVA 4W7VA 1QNPA 3W24A 2WKLA 2ZWZA 3PZGA 1VFOA 3RMEA 1CGUA 1G94A 1E5JA 1TZ7A 1US2A 3PZVA 1B90A 1EIBA 2ZXQA 3RM4A 2YOCA 1CWYA 2FDMA 3TV8A 4WLCA 2XPKA 3MI6A 1QHZA 4PTXA 3WH7A 4H04A 2VZUA 4TXEA 4E2OA 3U57A 1GNXA 4WIWA 2ZWYA 1E1FA 4QCEA 1J0KA 4LYPA 7TAAA 5M3WA 2BVTA 5DO8A 1H49A 1BTCA 2XWEA 3WNKA 2ZE0A 4PMZA 3VSUA 1M01A 3WN6A 3DX3A 4W7WA 2J47A 3CMGA 1J0YA 3AHXA 3GNPA 2DEPA 5A2BA 3WL0A 3BCDA 4V27A 4J3UA 1AQMA 3L4UA 1DWHM 1GOKA 6CGTA 3VILA 1H0GA 4HZ7A 1UD5A 3NUKA 1ZB5A 1FOBA 5BXRA 4WF7A 4ATDA 3BXWA 1WNOA 4AW7A 3SCRA 1WPCA 4JZ5A 2DH2A 3AROA 1SZNA 3MSGA 1E6NA 1BVZA 3K8LA 3WDJA 2W4XA 4JKMA 1KTBA 1RH9A 2WC3A 4KGJA 3W6MA 5A8OA 1D2KA 2YDRA 2X09A 2BVDA 3RJXA 2XIIA 1ZBCA 3K8MA 2YDQA 2XVNA 4YHEA 1WZLA 3CH9A 3K46A 4P7QA 4GI9A 3LPOA 4HOZA 5CPSA 3BAIA 2XN1A 4FLSA 3KLKA 1HXJA 3AS1A 5LA1A 1JZ3A 2PF0A 3UG5A 4KRUA 3OGRA 1BYAA 4OGZA 1AQ0A 3MMDA 2XTKA 3D5HA 4B9ZA 1I1WA 2D23A 1V08A 2VT0A 3ZIZA 2YL6A 3AIBA 4GO8A 1PS3A 2DSZA 3CUGA 1ISXA 2XYLA 3EDJA 3SUVA 2D3NA 3VSTA 1UWRA 1GOWA 4LYRA 2W63A 4W86A 2WHMA 2FHFA 3RM8A 4QCFA 1VBRA 3MS8A 1TQSA 3D50A 3WEOA 3H55A 4RE3A 3DDGA 1W3JA 1KCLA 1E3ZA 2OSXA 2CIPA 4DUXA 3DHUA 1UH4A 4YN5A 1GONA 2WW5A 1UKOA 3HZ3A 1CGVA 3SCOA 1V3IA 3VDCA 4J3TA 4LPCA 2V3DA 5HXMA 2WCSA 3FW6A 1KXTA 3BAKA 2QMJA 2EPNA 1JYNA 4MJ2A 3VMNA 1MVYA 3VD3A 1JXJA 5BXTA 4ACZB 2WNWA 5TD4A 4W87A 3ARPA 1B30A 1CGTA 3W27A 5JBFA 4BCEA 4GZEA 3IJ9A 5KZ6A 1VFFA 1E6RA 1J0JA 1KGUA 1BYDA 1W32A 5ABHA 1D3CA 4KRTA 1E4IA 3A6OA 5FIPA 1US3A 5FCZA 4JFWA 1MXGA 1CLXA 3AXHA 1E72M 3D52A 4UNIA 2WZHA 3GXTA 4KH2A 1JYVA 3POHA 4DWSA 4PSRA 2V3FA 3N04A 5DF0A 3CZSA 1UYQA 2EACA 1ISVA 3SUSA 1VEPA 4FNTA 1UH3A 1AVAA 3LXBA 2J74A 4S3JA 1GOQA 3AXXA 1LG1A 3APGA 4TX8A 1GORA 3RIKA 5CQ1A 1W1TA 3M7SA 4UZSA 1HKJA 3A4WA 4PMOA 3CZEA 1ESWA 3TP4A 5DEZA 1C93A 4IM4A 1QNRA 1V6XA 3ZJ6A 2W92A 1XYFA 5IDIA 1K9DA 4EKJA 4WK9A 2DSWA 3II1A 2DT1A 1WZKA 3AMDA 3ZR5A 1T0OA 3PTMA 4ACZA 1WDRA 1EGZA 3PTQA 2CBVA 2DSKA 3CHCA 3MU7A 2OYKA 3DC0A 2E9MA 2GDVA 3AHYA 5I0DA 3KWXA 2XVPA 2TAAA 5FL1A 4A4AA 3AIWA 4NF7A 4WKFA 2JIEA 4D6JA 4JFUA 2J4GA 3RO8A 3W38A 1C8XA 1FP9A 3U7VA 4OKDA 5ECUA 5JBEA 3TTQA 4AD3A 3AZRA 4JHOA 1EOMA 3MO4A 2OWXA 4TVCA 2WSPA 4GXPA 2WVTA 4ZEPA 1B3XA 3BMWA 4DO5A 4U3AA 1W2PA 3VDAA 1E43A 1MWOA 1HVXA 3QHNA 3BSGA 1EH9A 2ZX9A 1HVQA 2JIWA 4BA0A 1B9ZA 3UEQA 4MB5A 3D3AA 4ZXOA 1V0LA 1JNDA 4FK9A 3GH4A 4PTMA 4CCDA 3O2LA 4DUWA 2X2IA 1W9PA 3FHAA 4ZE5A 1PZ3A 3D4YA 4AZ6A 4CVUA 2EADA 4X9YA 4D72A 3OLIA 3WDIA 1GUVA 5C8BB 4NI3A 3WY2A 4JKLA 4FLRA 3L4TA 1UR2A 3WEMA 1RP9A 3SCSA 1ODUA 3WF0A 4YHGA 4HPGA 1ZS2A 4W84A 4NZFA 1Q6DA 3U5YA 2DDXA 3SURA 2XVLA 4KGLA 1VJZA 3DYPA 1A3HA 3L4YA 4D6HA 1BYBA 2AOSA 1ISYA 1PEZA 1WCGA 4AYSA 3W26A 2D0FA 4H8UA 1WDQA 2XFFA 5CLTA 3CZNA 1Q6GA 1W9VA 1E0XA 2V5DA 1DWJM 3AIRA 1EQPA 3DDFA 1TQVA 1H11A 4QLJA 3SUTA 4AY1A 1DHKA 3VVGA 1M04A 4MTVA 1UA3A 1NWUA 4PRWA 4TVDA 3TA9A 3MUAA 2CBUA 1EDQA 1R33A 1MW2A 2CHNA 1XH1A 5AYIA 3AIEA 3RJYA 4PMDA 2Y4SA 1R8LA 3B9DA 3QOMA 3BUQA 3WNOA 2UWFA 1C7SA 4OIFA 1W9BM 3PZNA 1UR8A 4AZ7A 1DWFM 2WXDM 3AYRA 5D8WA 2DT0A 2WBKA 2WVUA 4BF7A 5I6SA 2VC9A 1V6UA 5D9PA 1N82A 3TOPA 1C3FA 1JDDA 1M53A 3VX1A 1RPKA 4AZIA 3VIHA 3GYCA 4F9JA 4MAVA 2EO7A 4HZ6A 1HNYA 4V28A 5I5RA 3CIVA 5M03A 3WNMA 4U5IA 4R5EA 1GQLA 1VENA 3W25A 3LXCA 3DHPA 3O6AA 4Z2KA 4AWEA 3SCUA 2JE8A 2W67A 1W1YA 5A6SA 2ZXBA 3OLEA 1XSIA 2F61A 4J3WA 2VTFA 4L4PA 2IUZA 4CVWA 1QVBA 2VL4A 3AZSA 3O9NA 2EBNA 2EQDA 2WM0A 5D9OA 4GKLA 4NZJA 4EAMA 4B3KA 4FLQA 1MFUA 1HJVA 3VOCA 1ZBVA 4DM2A 2QHAA 2WWCA 5E1QA 2BVYA 3CHFA 5IXEA 2FHBA 2WCGA 4HZ8A 4M8UA 1JZ5A 1CBGA 4M82A 5DMYA 3BLKA 2D73A 4P7NA 4AIUA 1QWNA 1K6AA 3GBDA 3VNZA 3WDHA 1UHVA 4W8LA 2QMKA 2D3LA 1HJSA 2XGBA 1PX8A 1BG4A 4MDOA 1KR1A 3DX2A 5DFAA 1CEOA 5A8PA 4BQ5A 4M29A 4J28A 5AC4A 1WDSA 2EXOA 4PTVA 3UR7A 1K9TA 1UA7A 2ZXAA 1QI3A 4PCTA 1JL8A 3G6MA 3EDEA 3GBEA 3ARTA 5AYBA 2WMJA 1G9HA 5CPQA 3MMUA 2J62A 3GXPA 2YBUA 4ZXLA 3CTTA 4W8AA 2VNCA 4DUVA 3W82A 1HN1A 3DX4A 3BAXA 3SCQA 1QI4A 3T08A 2CKRA 5GNXA 5M17A 3OZOA 5IFPA 2VUYA 3SCPA 3ZM8A 5A95A 1OB0A 1FP8A 4QDMA 2WCAA 4CD4A 2J78A 2Y2WA 3HG5A 2RGMA 4OZOA 4AIOA 4Y7EA 1UKPA 1OGGA 3CZ8A 3CUIA 2W62A 3AS2A 2WSKA 3CUJA 5E70A 3NDZA 1GVIA 3PZTA 1V3HA 3BLPX 1CXHA 3FXYA 3AZTA 2UY2A 3SUWA 2VZTA 3T0DA 2O9TA 4PYSA 3CLWA 1WO2A 4UR9A 2WPGA 5EB8A 1BF2A 3DX1A 4GI6A 1NOWA 2IXUA 2XM2A 1E4MM 3EJRA 2VQUA 3CZLA 2EEXA 1UASA 4UQCA 6A3HA 1NWTA 1V3LA 2ZUWA 2GVYA 1GHSA 2BHUA 2V38A 4PUEA 4JFVA 2X0HA 2J8FA 4GI8A 2DSUA 3VIPA 3MUY1 5HBFA 5JBDA 1QWUA 1NM9A 4P7LA 3RDKA 3OB8A 3EMCA 3MSDA 4C7GA 1J9YA 1BSIA 3AMGA 5GNZA 4AMWA 2ESCA 1UR9A 3SCTA 3SIMA 1XGZA 1DEDA 3QOKA 5A8QA 1TA3A 3L4WA 4UFIA 1E3XA 2HISA 3FAXA 5A6MA 2F1AA 2Y8VA 1JZ8A 3UESA 1R34A 3W53A 2PWGA 2Y5EA 2X8RA 4PMVA 3CZKA 1VB9A 3T0AA 5ABFA 1LWJA 5I3DA 3KE0A 1KTCA 3EYPA 3ZSSA 2NW0A 4JCLA 1JXKA 1J0HA 3J7HA 2V3EA 3UETA 1QI2A 1X6NA 3VDBA 1UZ1A 1VJSA 3VKKA 4ACYA 3ZT6A 4ATWA 5ABEA 2CXGA 1JGIA 3GXNA 4JL1A 1HKMA 3SCVA 3AICA 2ZX6A 1OD8A 1RP8A 2J7DA 1HIZA 4CCEA 1E71M 6TAAA 5A6KA 3GXIA 4R27A 1O7DC 4CUCA 3S2CA 3PZMA 4GIAA 1E6QM 2XFYA 4B16A 1MYRA 9CGTA 4D6GA 4PBGA 2ZXDA 2CITA 4GO9A 3AIQA 3WD1A 5KEZA 2BY1A 4AZGA 1KR0A 1B0IA 1KWKA 5A6LA 2CESA 3I3BA 4Z2GA 4UZUA 3ZMRA 1ITXA 1CNVA 1VBUA 4MADA 4UQBA 4GQRA 1FH9A 2A3HA 2WMIA 5LYRA 3HMCA 3BUIA 4TTGA 1CZ1A 1E6ZA 4W5ZA 4FNQA 3EDFA 2WBGA 5HPCA 3T2PA 1XHGA 2E9BA 2GUYA 3BUPA 3BC9A 4AD0A 5IHRA 1E5NA 2D0HA 4XX6A 4DWSC 3WD4A 3PZOA 1GOMA 1J11A 1NP2A 2WMKA 3WQ8A 1H3GA 1TG7A 7CGTA 5GNYA 3WDPP 4D6CA 1XSKA 3AHTA 3WY4A 1Q4NX 5E0FA 4CN1A 4IISA 4AZHA 5D9NA 2BFGA 4DWSB 4AMXA 2OYLA 1OBAA 4U31A 4V2XA 2D2OA 1HJQA 3THCA 3CZJA 4A3YA 1JF6A 4E8DA 1HXKA 1C92A 3SCNA 4PMQA 4CCCA 1GW1A 4AZCA 2BS9A 2VVSA 4CD5A 5D9MA 1WE5A 4B15A 2OW7A 2WVVA 4HPHA 4MPKA 1B31A 2Y24A 3W0KA 3I3EA 2XVKA 3VM7A 3KL0A 1MW0A 1PJ9A 1R86A 4P8XA 1UWIA 2F8QA 1PX3A 3D51A 3WENA 5JIWA 5CG0A 1VFUA 4UCFA 1PPIA 2GK1A 1VRXA 1BAGA 2DQXA 2AMGA 1XCXA 2J7EA 4UOJA 1TE1A 2WC4A 2XG9A 3JUGA 1W3HA 1TVPA 4JIEA 1LLOA 2DIEA 2QF8A 3VUPA 1DWIM 1VEMA 1ZBKA 3B9EA 3NYDA 1ITCA 3IAQA
chains in the Genus database with same CATH superfamily
4MB3A 4NRXA 3PG2A 5EB9A 4XO9A 4ES4A 2C3VB 1HJUA 4IQHA 1MZYA 4L4OA 4MQXD 2IPTH 4F57H 2GC7C 4HMEA 4MWAE 4DBEA 2GJPA 4WGKA 4ZTXA 1LP9B 1WB0A 2O72A 3QXAB 2I9TB 3ATBA 1OAQH 4DTGH 1NFAA 4AQ8C 3P3SA 2ZSVB 1E9IA 2F7PA 4JY5H 3BVNB 2MSPA 3C8KB 4L4TD 1E28B 1DDTA 3NYKA 4MAZA 2EXYD 4GNKB 2WLMA 1AFVH 3WMLA 1CL7L 3MRRA 1MCKA 4GH7B 1KPRA 5AY7A 2LLNA 4NEHB 4WJKB 3V7AG 4B5XA 3SQOH 1HL8A 1OHQA 4ZFMA 3VW3L 2QSCL 1MWAL 2J24A 2AJVL 1QW7A 1PVHA 1EX1A 2Q3XA 3FQXB 5XIAA 5C7XL 1V03A 5HANA 4F8QA 1X38A 2JH2A 3CFEA 4C7DA 3P4LA 6ENLA 2DV6A 5CUSL 3WO4B 1U1HA 2C15A 1ACXA 2XWBB 3STEA 2DEYX 1VPXA 1R3LA 4CQ9A 3H2MA 1QVOA 5FF7A 4KRLB 4V11A 2VN6A 4ATTA 4HVXA 4IBSA 3LRSA 2Q1EA 4AHPA 3EDDA 2NNCA 4JPSA 3VRIA 2G3ZA 3DVNA 2A5HA 2ENQA 1OGBA 3WD5H 3QXWA 4NRZA 2PB1A 3GS0A 1IT9L 4AD2A 3O06A 1AGCA 4US6A 4PBXA 3MCOA 3HJZA 3IJHB 1KV5A 2VRQA 3L5LA 4YHIB 3TNMB 4PJFF 5LKYA 4H7ZA 1H0DA 4LLYA 3DBNA 1TIMA 4HUXA 3LS5H 2NXIA 5ICXB 4XXCA 2OB3A 4Q33A 2E6AA 3D3VB 2FD6H 3KBFA 1FNFA 1ETZB 4AUBA 3SR7A 1OB1B 1T2JA 1I82A 1ZLDA 2J79A 3V2AR 3VXMA 3PPHA 2ARJQ 4MAUH 4RZ5A 3RX3A 4O58L 2WWKO 1E4XL 1PG7H 3LSOA 2BIMA 1HQRA 4WTXA 1XR9A 3A21A 4XPTL 4TNWF 5BRQA 3EA2A 2HG5A 3ZXAC 3QQDB 1CBJA 4ZQNA 4YSDA 2KHAA 4IMKC 4F91B 3MRMA 2ZUQC 3CX5J 5CZXD 3KLAB 4QM1A 4G7EA 3QUXB 3MO7A 4OQTL 3FEMA 3NO3A 4FFTA 1DVSA 3FTZA 3P74A 1OAYH 5REQB 4JQVA 1JPEA 3RWDA 1Q9OA 3QAZC 2ITCA 2FNBA 1XL9A 1M71A 1XZ0B 2AZUA 4PUWA 4LLVB 3SDXE 1TA3B 3LCFA 4WFFD 1C9WA 5E9DB 1FZJB 4N9BA 4XVJL 3MBXH 4LALA 1AH4A 3HNSH 4DWDA 4HT1H 3AQZA 4NQSA 2V5CA 2EXWC 4KZCA 2WAHA 3ZJKA 3GYEA 1XDTT 1NBZA 1OT1A 1IWAA 4P8VA 2SEBA 4EACA 3M6YA 2VXQA 3IJSA 1S7QB 4MNQD 4TX9A 4Z3IA 4IHBA 3MAWA 1E6PA 1PL9A 3O0LA 2ROYA 2ZCZA 3OC5A 2XZAL 3BUYA 1SZFA 1IIIA 3SBWC 5ICZA 3LIZH 1QRKA 3FF7A 4LRIC 3IDNB 3T8LA 4WDTA 2FB2A 4NX5A 5B8CC 3IVSA 3NQ8A 3QORA 4EAYA 3O9WA 1TVBA 1EMTH 3PUEA 1I9RH 1B3WA 1MI5E 3OO2A 4N2AA 3UY8A 4C1KA 3LMZA 3O07A 4M7ZC 1S7XB 4Y9AA 1QA9B 2P8PB 4PGBB 4A21A 4PFMA 3WLLA 3K6DA 4TULL 1PDKA 1FBIH 3Q3GB 1NC4D 3KYOA 3VAEA 4KIEA 3ZYZA 4L37A 1NGPH 4BBWA 5I66A 4XIAA 1FNAA 4P2QA 5D7IE 3M0XA 2EIZB 5F2LA 5KAQF 3S2JA 1EBAA 3ZDXF 2UWEB 5ID0B 2AXJA 4F33A 3SIZA 4N6RB 3ZKMC 5DGRA 4AENB 5IV2A 3UC2A 3IFPB 2E4FA 3EFOA 3SYQA 1IHIA 2PPGA 3O6DA 5CJQL 4FQXB 4ERIA 2WUBH 4OF5A 3NA9H 2CG9X 4OBSA 2OZ0A 4JEGB 3KVMA 2WXIA 4FQIH 3VI4E 4D8OA 5CEXB 3IJEB 3WTTA 1D8CA 2JKWA 4QWWD 3WD0A 4LNYA 5DJZB 4WI0B 3CQPA 3O0KA 5JQ6L 1RULL 5IFHH 1J05A 3MRGB 1Z32X 5BW7C 4IH3A 1I7UB 1UB5A 4XD4A 4MCYA 1ZNNA 3X3GL 3ZLHA 3NIFE 4FZEL 4IEFB 4AMKL 1Q45A 3RIFF 4HPYL 4DN4H 1QW9A 2YD6A 1RPUA 1KJ2B 4HA4A 5AOIA 4XWOD 1SBSL 3CH1B 3MJ8A 2YKLH 1H1ZA 3ZK0A 5H37H 2D0GA 3RY5A 4MJZA 2ZUMA 1IL1A 1ZSXA 4NQQA 1ZWIB 3QI9D 3TO2B 2Z92B 3C8NA 3VXPB 5C0BA 3JT0A 3QFDB 2PYFA 4A7VA 4MXWH 4DH2A 1FFRA 1MWAA 4HJUA 3L6FB 1C16B 1VKXB 3KHJA 1K8DA 3ATZA 2XETA 2PZNA 2YA1A 3MREB 2XJKA 4GT0A 5TNVA 3DSNB 1AGBA 2EILB 3ARDD 5TDPB 4BWLA 5KVDH 1IUZA 1L7IH 3LQZA 2YO3A 5KYYB 4YDJB 1DWGM 3ARFC 1ZHLA 2IVFC 2NY7H 4GAJL 1HHJA 5EEUA 2N7BA 2QPSA 1LO2H 4HZMA 1E1CB 1IFHH 2PWEA 3CFCL 1UJPA 2XWTB 2HJFB 3ALXA 3DG3A 3KUMA 4NI6A 1FVDA 5BZZA 3DJRA 4WY0A 5GGRB 1YBQA 3MV8D 5ALBL 4HW6A 4LK4A 4LLWA 3TR9A 1LE9A 5U7SA 2JXMB 4AKPA 1UZ4A 2CZNA 3ARGA 3QDMB 4AD1A 2Y36L 2CCWA 2PURA 5JW3H 4YTQA 3FJLA 2P5WB 4XVSL 1JEZA 1SDDB 5I1LB 1OG0A 3ZT7A 4XN9A 5GGVY 2X3CA 2PCEA 2QUNA 5HMEA 3IFOB 1FHVA 4PJ5B 5CPLA 1GJWA 4WI5A 1PCKA 2EG6A 4MB4A 1GMEA 4X6DE 2VFIA 3T8QA 1AOZA 2OQJB 1TU2B 3N15A 3U0WL 1JCTA 4DJEC 2VLLB 1JPDX 2QKIA 5A8NA 1AI1H 1G7MA 5E94B 4BDVA 1SO3A 4OVUA 4IGSA 4GAAA 3E0IA 2X1UA 1N19A 4WQOA 1EJSC 4EOUA 5FYKL 5KSUA 3QP3A 2DMCA 3CBKB 2E74C 5B38B 1EA9C 1UMYA 4N2HA 4N1EA 4ML4A 3QUMB 3UXIA 4FL4C 1VBGA 1I7RA 4HFWA 5KVGE 2GJXB 4OQTA 4ONFL 5ENWA 2VUNA 1SY6L 2QJHA 5C7ZA 1ET5A 3RGVB 3KNBB 4H8WH 1RJZA 4YXLH 3KHQA 5FJTA 1LK3H 4FR6A 1A5KC 5MEQA 4JO4L 3NJKA 1EXPA 5CLWA 3VXRE 4Z7OB 4M24A 2YEZA 2P3YA 4AQ1C 1QUMA 3O6YX 1L6SA 5BOJA 5AYXA 3S36H 3TURA 3VPLA 2AQ3A 1RD5A 4LJ3A 3KBWA 3H6AA 3TEZA 2W65B 3OSVA 4DJFC 1GZQB 1MLBA 2A6KB 4L9DA 1F90L 4WUUD 2YUWA 5FHBL 4R85A 3PDDA 2XKUA 3CXHJ 3C3UA 5LNVA 4CD7A 1OE3A 1C8QA 3D3FA 1XIDA 4X8JA 4QTFA 5FYJE 3UC0L 2CHDA 1JCVA 2OKTA 4MLSA 3NPZB 1S5NA 4X9BA 1WFOA 3OGOE 4LSDA 1JG9A 3QAZB 2Y7LA 1SJBA 4PRHE 4LAMA 5DK0B 3JZ7A 2ZUSA 4V1YA 4QYOA 4BUGA 3IDGB 2AEQL 4LOEA 5E08L 4L1BA 4IXXA 3KBSA 1U36A 2ZZ1A 1ZY9A 2ZC1A 2XNAA 5T5FL 3LZ3A 3K30A 1W9UA 1IIKA 3GZ3A 1RZGB 4YFDB 3IKCB 3W0WB 2P4AB 4ZS7L 2RB8A 2EE3A 4K3JL 3EZ8A 1JPSH 5LXGL 1EF2A 4JTIA 4FYTA 2CE6A 2E75C 2LLEA 1JK8B 2H1XA 4PCSA 3B2VH 5LIXX 1MCPL 5BZAA 5C07A 2CGZA 2XN0A 3NVTA 1UD3A 3U6XS 3APCA 2GG1A 2R7EA 1F6PA 4MNGE 4JO1L 1VFOA 1FYTE 4NO0B 4R3SB 4M6NL 1MI3A 1OW0A 1VGEH 1EIBA 5C0QA 6ALDA 2CMRH 1QHZA 3WH7A 4M7ZB 3OG4B 1M2OA 3LBCA 5TQ0H 3QXDA 4DI9A 1EEPA 3QUGA 1H49A 4AEOA 5MP6H 3CB3A 2B0MA 4LBUA 2B5IC 5F2IA 2YD8A 3H3BC 4KHTL 3AHXA 4JN2A 5DA0B 3L4UA 4FXLA 4WXZA 4HZ7A 2YMXH 1ZB5A 5F9OL 4WF7A 4FG6C 1WNOA 5C9KA 3EYOB 1N4XH 4WKZA 4ZL1A 4JTEA 3O7UA 3HKZA 3EFFB 2PD9A 1UT2A 5EH1A 1LD9A 4PJIF 4AEHH 2RDTA 1J8RA 1K3IA 4PD4K 2PR4L 4YHEA 3NSDA 2GT9B 3LZPA 2ZZ7A 1HCFX 3KLKA 1RR2A 1JK9B 1MN4A 4YE4L 2FB3A 2XTKA 3NOIA 4FOMA 2M2DA 1KFKA 1XP3A 1S7WB 3ULVC 3NIGB 4L0ZA 1QDSA 1ISXA 4WW1A 4DBDA 4LYRA 1IGCL 1TJGL 2PDKA 4W70A 4OD1L 2YUZA 3D50A 1K4DA 2VDKH 3DDGA 2QVIA 3WTYA 4JZNA 1FL5B 1BVKA 3MYJB 1OTTC 1V3IA 4JIQA 4NO3A 5HVHB 1Z9PA 1JF1A 3UNTA 4RX0A 1JWUA 1NBYB 3P2TA 2NQLA 1E0TA 3QMTA 2C5DC 1ZPTA 5DQPA 1CGTA 5KG9A 2ZCGA 1VFFA 4HBKA 1FLRH 5MEPA 1D3CA 1E8WA 1SXSA 4ODWB 3DMMB 4QHKI 2RCSL 4JJOA 4KH2A 5CP3A 1G7LA 2AAVA 4YDKL 1F18A 2V3FA 3MRBB 2EACA 2P8MA 1P4BH 1UH3A 1HUVA 1OFRA 3N2OA 3RKPA 1Q5MA 2VEGA 3S5LB 2A7BA 3KAAA 3TS8A 3JWNE 3EOSA 1TQJA 2J6EL 3PYCA 3CZEA 2OR7A 4KCUA 1QUPA 1XYFA 1IGFL 1I3GH 2X4RA 2ACQA 4C83B 3II1A 3AMDA 4V2CB 3Q1SH 4HJFA 25C8L 5AWNL 4TL4A 5I0DA 1XIIA 2CR3A 2WZTA 4YL4A 3GJFB 1SY6A 3SE9L 5BZDA 3IACA 3AZRA 2ZG1A 2Y6ZA 3PULA 5CEYA 1B3XA 4NO2A 5G55A 2VELA 3RX2A 1RFDH 3K1KC 2JKSA 1OXYA 3GDKA 3V6ZB 2FMNA 4Q9QL 2DYSB 1QYGL 2R4RL 4AZ6A 1K5NB 1DVFC 4R4ND 4MDJA 4QKXB 2XBZA 3X3FL 1CQKA 3SCSA 4M00A 1QOKA 3ZUNC 4LCWE 1XBXA 1Q6OA 3DFOA 4KGLA 2XQYG 5EEYA 4I6VA 1OG6A 1M42A 3NQ7A 3V18A 2XFFA 4WO0A 4TUOA 4P5TA 4MTVA 3MUAA 4ODXB 3WQGA 4PMDA 4UT9L 1MAJA 2QJNA 3EPMA 2XXFA 2ZYIA 4FL4B 2UWFA 4RMTA 2ICWJ 1TEFA 3QNYB 4NQXB 4X99B 2EYTB 2DT0A 2I69A 3TW9A 2EE0A 3N6JA 3RWCB 1FWIC 2MHAA 4OZIF 1HNYA 5B7ZA 2NR6A 4HS8H 5HDBB 2FR4A 5JW5B 1CL7H 3K6SA 2XV2A 1QVBA 5D1XA 5T5FA 3UBHA 3FUKA 3V4UL 2L5HA 4IBZA 1QLFB 2BHFA 3T6ZA 1T5WA 3VW3H 1MWAH 2D73A 3UOAB 1TPC1 3SQLA 5C7XH 4ZO9A 1BG4A 2Z1XA 4M29A 4LNRA 3BWSA 1I53A 3QIBC 5CBEB 1QLEB 1S1RA 4MX7B 2BWQA 5AKVA 1XBRA 2F2KA 5LSMA 3QC3A 4PJGB 2EYRB 1CICC 4HLEA 3W1QA 2NV1A 4QRNA 2Q8ZA 3SE3C 2GIMA 5FM8A 5C55A 3TAKA 3HG5A 3SHSA 2BSSA 1JNNH 5C97A 2Y2TA 3TXVA 4DK3A 3ZL4H 1GC1H 4WAFA 3JUZA 3MOQA 1IT9H 5BU6A 2C9AA 3EJRA 2GI0A 1U2HA 3OKLA 4OD2A 3DTXB 4Y4FA 4NQEA 4JFVA 4C4KO 5HJYA 4LSRL 3MLUH 4L3FA 3RDKA 1VESA 3PPSA 1Z2KA 2Z34A 5I16B 3QWRD 2WLLB 5J9PB 4L29A 5AVUB 3QYMA 5DUMH 3VQ1C 4YLCA 3VWJD 3C5SB 3UZQB 1Z7JA 4KQ0A 3MJ7B 2A83A 4X61A 4HNCA 3KWUA 4O58H 3OPZH 5F9WC 5KYUB 4IQDA 2HVKB 1FL6A 2IPTL 4F57L 1JGIA 2PO6D 2J7DA 4MJIB 4TV5A 2RQ8A 4BH8A 2XFYA 1OAQL 4DTGL 2CITA 2NUPA 1Y0EA 3STZA 2VDRB 1OYAA 2CGRH 2BERA 5LQBH 4OM1L 1SJEA 2B5IB 4EF8A 4JDZA 5B4MD 4ENED 2WMIA 3X1EA 1PKLA 3QRBA 2ANUA 3E2HB 3BARA 2E5DA 1S5IL 4JM0A 2AMXA 4LBAA 3IJ6A 5J5EA 3REQA 1MCJA 4G8GE 2DQDL 3FT0A 4XVJH 1GK8A 4FN0A 1ORQA 3K91A 2IBGA 5GNYA 1WC7A 1TWDA 2FTPA 2HLEB 2A6IA 2JKNA 1OBAA 1PHQA 3VFRB 4J4PD 3SCNA 1NJ9A 3E3QC 4AHQA 1GYVA 2A5UA 4LLUA 2E7LA 3ZQXA 3NSJA 1MXSA 4ZTOH 3NFPA 4AXWB 4MS6A 1TJXA 3F65A 2CNYA 4UI2A 3L2NA 1UWIA 3KW7A 4DAFA 4QS6A 3WD5L 1VFUA 4KNUA 1UOVA 3QKEA 2DQXA 3BP7A 3TO4B 3V4PA 2XG9A 4G8IB 1TFHA 1U92B 4P2VA 4LHJB 3SO3C 1SPQA 1A6AB 1PKQA 3WEZA 1NAL1 1OD9A 2Z8VC 1U58B 3BAWA 2QELA 4XBGB 2D4FA 1O5QA 1GSKA 1TJRA 3S88L 1XX1A 2MEJB 1R24A 4HQVA 4TULH 4UTMA 3AJ7A 3NGBB 4TF4A 2IADB 2QKSA 1O1ZA 3UNDA 1OGAE 2WNZA 2WWKT 2X70B 4MAUL 2CZEA 3LEVL 2RAMA 5CPNA 1TVNA 3EBHA 3QFJE 4WI7A 2XXGA 1I8IB 5HGDB 4S0HA 1OK4A 2I25N 2QPFA 3HLAA 4FSAA 4R7LA 5CJQH 1OO2A 3VIFA 1AQHA 2HJLA 2CU0A 4GKSA 4LLDA 4K7PX 4ZX6A 1Y0LA 3TFKD 3T0EE 1W0YT 1J9QA 1WZMA 4FEIA 4UT9A 3EEGA 1FWEC 1M5WA 3T07A 1OAYL 3D25A 3H3KA 1RULH 1GRWA 2DJXA 4JQXA 4P4KD 1PHWA 4U1MB 2ZXCA 5E0QA 3P7YA 1OHZA 4M02A 1R3JA 5KSBE 1ZHBB 4IG2A 3HB3C 1P6FA 3HG1B 3X3GH 3LSCA 4AVIA 2GSJA 4LUSA 1YE4A 4OSUL 4JICA 2I9LB 4HT1L 4Y19D 3F6IA 1MNSA 3BPOB 3MWAA 1SBSH 3UP8A 1E73M 3ZJAA 4JRFA 1TETH 4UQ9A 3BGMB 4XRCA 4BEIA 1GYNA 3G7TA 3SDAD 2ZFAA 3PWLA 5AHIA 5LBVA 1T1WA 3BV7A 3VWKC 4OOUA 3H53A 4IKIA 2IANB 1CR9H 4BI7A 2B1AL 2XLLA 4NKCA 1WBJA 3SY8A 3DX9B 3LIZL 1S2CA 5GGRY 4HKPA 1DLHA 4ORGA 3PWPE 1AYOA 1R85A 3W7NA 2NUYA 1FCVA 1I7ZA 3WIJA 4PTDA 3GMNA 3LCIA 3KZSA 1ZOXA 4PG9A 1J5DA 3CFIC 1RV8A 3VFWB 3U46B 2X3BA 3QQ0A 4F7CB 4GAJH 4DIAA 4OF8A 4Y8FA 3I6TA 1S9WB 3PHAA 1J8HE 1B0GB 1N5AA 3CFCH 2CYGA 1JTTA 3KPLA 3PWJB 3TPUA 5F7AA 1RCQA 4L4VA 3GIVB 3JW7A 5ALBH 5EU5B 1OCZB 3L4XA 4Z1DA 4I0PC 1XYZA 2REQB 1NGPL 3T05A 4MAYA 3EYVB 4M93B 1H41A 2QJMA 5IJCC 2E5CA 2XFWA 1YPZA 4LLMB 4M3JA 3PBMA 5I3JA 1TJ0A 3GMLA 2BP3A 2PKDA 4RRPG 1I1AC 5DELA 5IIEB 4U5KA 2YXXA 5HYSA 1SJCA 2XIBA 1MW3A 2QUVA 5FFGA 1XBYA 3ABKB 2A74B 3W00A 3WFZA 5CP3H 2LFEA 4ZUUB 5A43C 5JMOC 3MSPA 2Y1HA 3ESVF 3STLB 5AYYA 2YFOA 5E9XA 4HFUL 4GYKA 1QO2A 1BYCA 5IFHL 3MUCA 3EWUA 2FT7A 3URQA 1Z9AA 5DDHA 3F5LA 1G01A 4PRIB 3FCSA 5FYKH 5KN5A 1K3UA 1KCRH 4YIQA 1ENUA 4LAQH 4P04A 1JERA 2H1LM 4AOFA 4NPJA 4KQ3L 4P46B 2EGZA 3TJEL 3EGXB 3ARWA 2Z1KA 4ONFH 2YKLL 4WU5B 4QG8A 1XQ4A 2CCRA 3MLZL 1M57B 2Q6WB 2E6QA 4JO4H 5C09E 4B7LA 5C6TL 4JFEE 2DZTA 4A2DA 1AKJA 3B06A 3HGRA 4D1JA 3D7PA 3PY9A 2O92A 2PU0A 4X4YB 1P2CA 2J9ZA 4A7QA 2R2BA 4W89A 5DT5A 1H3WM 1J01A 3VXMD 3GSWA 2OMVA 4WSKA 3U9WA 4D6FA 4R5VA 3MYPA 3PGCB 4QHMA 3G5YB 1H4PA 5D2TA 3MTRA 3ECBA 1A4MA 1EAPA 2NY7L 1F90H 1T22B 4HIJA 5C0CE 3ZTJH 3NESA 1IFHL 5TK4A 1AZCA 1V02E 3O8XD 3B9AA 2J7HA 3UC0H 3JU2A 1KXVA 1U3YA 3ZE0E 1SLUA 4AEFA 2JVUA 5CJXC 2J75A 5BS0B 2BY0A 3U4FA 4OLUL 3QR3A 2OL3L 2OXHB 3JSSA 5JW3L 2JKLA 3FC8A 4HA3A 5I1KH 4LPWA 5DANA 1NGYB 4QSFA 2AEQH 4FXSA 3UERA 3BP4A 2BJMH 5T5FH 3LB6D 3HZVB 2WJZA 2CLFA 4ZQKB 1FG2B 1AI1L 1IKOP 1XC6A 4Q2ZB 1IXQA 5D7LE 1ID5I 3D4CA 5IT2L 4H40A 5LXGH 1HJXA 1KTNA 4KWUA 2UY5A 1Z5YD 2O5YL 3GS7A 2JCCA 4JAWA 4NNCA 1JVNA 1MVFA 3DJZA 3ZTCC 3VMOA 3DYOA 4PRAB 3SJVE 2AL2B 3CO4A 1LEIB 3FCUB 4M6NH 2IKIA 4YXLL 4DO4A 2A3BA 1KRMA 5EOTB 4FX5A 2DQGL 4PC8A 1VRDA 1ICQA 3UH8A 3BW9B 4K71C 5HPMA 4HKZB 3V6FA 4ALDA 4WJ5B 2IPUG 3UDWA 2FJSA 4I87A 5HHQB 4P2QD 5F1NB 5F9OH 5SV3A 1A5CA 1LROA 2PDNA 3H2WA 2OTWA 1KLYA 4W6YB 2NY1D 1T1YA 3CL7A 3NABL 2VEIA 4PJDA 1FG9C 5IVXF 2PR4H 3LIZA 1TQCB 4RESB 5EFFA 4IBLT 4WZ9A 4YE4H 7XIMA 4XWUA 3OIXA 1BQHB 1TNNA 2HUEA 3W9EB 4Q22A 1O60A 3OU8A 4AX6A 4Z8FH 2VC2L 1IGCH 1TJGH 3LPFA 3CQFA 3B3IA 4OD1H 3PBVA 4QHRA 3N2TA 1CC3A 2WCPA 1XIBA 2HRGA 3DXAE 3L23A 4S1DC 4QXGL 4B5TA 3GXFA 1VHPA 4W9GC 1K7XA 1ZGLP 2P8LA 3CIWA 1TRDA 2ZQ0A 1FNSL 3P4NB 3KDOA 4GRLB 1LDPH 4GKNB 3U2OA 1VBJA 1F6YA 1YAIA 2F7FA 1HHIB 1XCTA 1UUSA 1EJUC 3WLMA 1AZBA 3N11A 1G1OA 3UYRL 1FIGH 4EEEA 2XH0A 2RCSH 4IRJA 1Y18A 3B2VL 1E8YA 3JZUA 5IG7A 3CUFA 3AB0C 2J5WA 3GG1A 2C9UA 4GO6B 4O1FA 3WIFB 1AH3A 5TIMA 3O3DB 3IRSA 2OMWB 3P0YL 2CDEB 2J6EH 4GPVA 1FBAA 4QGCA 2CMRL 2FJHB 1IAMA 3UR8A 4XAGA 5TQ0L 3PY2A 4P9MH 5HYJD 4UFMA 5MP6L 4UTKA 1A80A 2XFXA 1A3XA 1JRCA 3B0VC 2FYVA 5CN1A 5CSZB 4QF1B 2QPUA 3JV0A 1HQ4A 4BSVB 1VF5C 5E4AA 3REVA 3P77A 4PE8A 5H37A 4JFFD 4E9SA 2FSEA 4F7TA 1A1OB 3SE9H 1N4XL 1DUYB 2YWZA 2Z64C 3UVIA 3ZKNC 1S7TA 3APDA 3ULSB 5C0IB 2LVEA 3UWWA 1KBKA 1DBJH 1I1AB 4HMNA 3CUPB 3DG7A 3MV7A 4X4KA 3GPEA 4WO4D 1TZHB 4Q9QH 1QYGH 1S1PA 2GSIA 5HGAA 3BP5B 4WTZG 2PCXA 3BWZA 3ZDYF 3X3FH 3QMRA 5BUAA 5C0AA 3GR8A 1Q94B 4UDTB 2P5ED 3HI6H 3W4RA 2E4TA 2PP9A 1N2RA 3A4FA 2VQ4A 3WQDA 3B40A 4AIBA 4NQDE 1TTUA 1AHWA 1FRGH 1HHHB 3IB4A 2HFGH 3BCFA 3WTXA 4BKTC 4OF6A 5MENB 3KBVA 4R0LB 4Z7UF 1YDOA 1AGFA 3QDHA 3MNDA 2Q3OA 4YPJA 1XGYH 1WD8A 1A1NA 4NP7A 1LRNA 4HIHB 5EFDA 1BBDL 1IIHA 1U3ZA 4OBTA 1U42A 2HKHL 5IOBA 4AYID 1X7TA 4U3SB 3D48R 3ES7A 4FNPA 4M4PA 1CE6B 1MELA 1UB6B 2OL3A 3QK0A 4UTAL 5SWZE 4L4JA 1G94A 3PZVA 3JVGC 3RWJB 3RM4A 4PTXA 4EI6A 2VZUA 4E2OA 2R1LA 3HQOA 1GNXA 2EDMA 2ZWYA 4LASL 2DKUA 4N0CD 3DLQR 1TZOA 1P4BL 1AZ1A 4GAYB 4ZX5A 3Q5TA 2DQHH 4QG6A 1S7SB 3ZZSA 5I74C 5IROC 3Q8CA 1UD5A 5C08E 4F93B 1ACZA 3EF7A 2CLKA 3CHPA 1X9UA 4M1CD 4FOJA 5GGSA 2P43B 4X5WA 4YSOA 4NHUB 3RJXA 4WWKB 4L1HA 2A85A 2XVNA 4XKMA 2D7PA 2RQEA 4XAPA 5H8DA 4DPBX 4I48A 3E0FA 4X4ME 1YJDC 1YA5A 2WM1A 5D7EA 4BK9A 4YVUA 5C0FB 1DQQB 1GKOA 4AYEC 1QQDB 3KVPA 2DIAA 1RFDL 5ITBL 3B3DA 1IGSA 3BI9X 2G9KA 4DJDC 3S3DB 3FUIA 4YN5A 5FO8A 4UILL 4IFKA 1RJLA 4DJMA 1TTFA 4J3TA 2QBWA 3KPQA 3QG6B 4ZQOA 2QFRA 3LLFA 4LSRH 4JX6A 5SX5H 5BXTA 4NCC2 2V5YA 2W0KA 4RIRB 5T8GA 2AW2A 2WMPA 5MF5A 2EDEA 3OG3A 2HZHA 3KM2A 2B9AA 3H9SE 1NDMB 4AGQA 2XSKA 4KCVA 2FJKA 4FS9A 1W0VA 5KINA 2L7QA 5HYEA 4MHHG 1NC2A 2XT1B 2AV7A 1W3TA 3CN3A 2PN5A 2I07A 1QR1B 3SQBB 1JV5B 2MTAA 4LOUD 1TSRA 5CQ1A 1MVUB 4QHNA 4DZAA 1BQUA 4HUVA 4KXAA 2C1GA 5D71H 4OV5A 2WBJD 4OM1H 3BHBA 5D7KE 4HS8L 4LVFA 5GHWH 3BMXA 3EJYD 4YHNB 3IU4H 2XV3A 4ACZA 1FL3A 3CZFB 1E9QB 3H7VA 1S5IH 3C60C 3K2GA 4IDJH 3KPOB 2BNRD 3HAEB 4NUJB 4FHBD 2O5XH 2DQDH 3VU1A 1RIUH 3BWUF 4H8NA 4ZEPA 3F12A 3D0VA 1AD0A 3I10A 3QHNA 5FGSA 1HVQA 1GTFA 2W07A 3UEQA 5TH2A 1V0LA 1JNDA 4FMKA 1OCWL 4LVOC 2EIBA 2BIPA 3L81A 1FN4A 1W9PA 3WJWA 4NZ4A 1BFOB 5BUPA 2VW4A 2WWMD 4WU7B 2WXNA 3K71A 3L3JA 4IU3B 1XYAA 2YQGA 3LGDA 3VZZA 1JNNL 2CGYA 4GXVL 1IMHC 4HLJA 2D0FA 4HCDA 4I8DA 4GACA 1TEYA 2RGSA 3ZL4L 2R24A 3E74A 1GC1L 5AVZB 1Q6GA 2HXTA 4BE6A 3MOAL 4QHLA 3S4TA 3Q2DA 1QUNA 4MZ2A 4TVDA 1UM4L 4C4KT 1MW2A 3AIEA 4PRBB 3OJ2C 2EDJA 3AAMA 1O5DT 1DL3A 1DHPA 5D2NE 3MLUL 5D93C 3S88H 1IEBB 1KF9B 5J1AA 4IOIB 3QUYB 5MHBA 5DUML 1E51A 3NPSC 4WI2A 2LE9A 3SGEI 1DQJA 1RPKA 3VIHA 4F7MA 1P1XA 3RTQA 5ETUB 3BW3A 5J89A 3LEVH 3HCVB 3RY6C 2AERT 3OPZL 3LXCA 5CJBA 4ZYKA 1M1XB 1XSIA 5AUMA 3NR0A 4WR3A 2FJGA 4J35A 1HKWA 4Z1YA 1LLWA 2A6JA 3F5WA 4JEJA 2CGRL 4HU4A 1QPOA 5KS9B 5LQBL 3QY8A 3DX2A 3VB9A 5A8PA 2EG7A 3S4SA 4JX0A 3D2UA 3DGDA 3WSQL 1JL8A 2X4UA 3NO1A 1B3IA 2XQYK 3OB0H 2VLRA 4Y5VC 3I9PA 3L5AA 3AXLA 1BF8A 5M17A 3CBRA 4E42B 2DQ6A 4OSUH 4X2PA 5C7VA 2YPKB 4LV9A 1UUMA 3CWNA 2W62A 2WSKA 3UYPB 1ZVYA 4LPTA 1V3HA 1RK1B 4ZOEA 2QCLA 2ODOA 2W60A 1UC5A 3RFZB 4HJSA 3CHRA 4UQCA 2BG5A 4ZTOL 1OT4A 2B1AH 5EU3A 1S39A 1UJ3C 4FQQB 2Q8BL 4JKNA 2ZOWA 2QZRA 1FH2A 2PU1A 2FQGA 2NV2A 2KDYA 3DURB 3U2SB 1R9XA 1ORSA 5C0EB 4KTDH 1KFCA 1IR1A 5A6MA 1E3FA 1UP0A 1O5XA 3CZKA 3U9IA 1BRLA 1QHQA 5AFDA 1J0HA 4HJ0C 1ZXKA 4MYPA 5DJYA 3GXNA 4AZ8B 3UPRB 1RP8A 4Y4KD 2WJ7A 1P0NA 1B6DA 3KPPA 4JJ5A 4R27A 4CUCA 4B16A 4D6GA 3QNXA 2DBLL 4MXVF 1J87A 5I5MA 4YSPA 3SY5A 1DO6A 5LKNA 2CESA 1K6WA 5KYXA 2EE2A 2VWTA 3VCLA 4PRRA 5M1TA 4W5ZA 4FNQA 1CW2A 3HE7B 2E9BA 4DWSC 1J11A 3TNOA 5BRZB 4JPWH 3PWAA 5JIMA 5EU4B 3WDPP 5LO7A 1WHOA 5FA4A 4HFUH 4X6CE 3ID7A 1FVCB 4DW2L 5BRBA 4RFNC 32C2A 1EXHA 3RWGA 1VPOL 4QXWA 2R1NA 4ADTA 4AZCA 1HIMH 4KQ3H 3TJEH 4FEMA 4QR7A 2Y24A 3SZKC 8RUCA 3HR5B 2EAWA 3CFUA 4WGWB 4UM9A 3ZDWA 1TETL 3CT7A 2X30A 4GG6E 5JHDB 4XZ4A 3MLZH 3VXOB 1PPIA 1N7ML 1OAJA 2WC4A 4G6KL 2B7OA 3JUGA 1BZOA 3NDOA 5C6TH 4GUOA 1CR9L 3NZRA 2YAMA 3LZFH 3MCG1 2LV4A 1NCAL 2RD0A 3WL9B 4HULB 1ZBWA 2WO2B 1C12B 4Y5XC 1UXSA 4HG4J 1GJUA 2QGBA 1BVLA 3NCFB 1XRFA 5CSUA 5KANI 3NZSA 3ZDZE 4H0HB 3W7CA 4B5ZA 3CC5A 3ABGA 1F6LL 4WGVB 4ZMWA 5KAQG 5IEHA 3T7VA 2YYUA 2HVBA 4DK6A 3S5OA 3MTXA 4PTUA 2UUDH 2QGYA 2A9ML 3FTGA 1QEWB 2ZUTA 3VRLE 1NL0H 3DARA 4LOCA 2NY3D 1CN4A 3ZLFA 4OLUH 4R7OA 2OL3H 4IHOB 2F2HA 5EU9A 1Y1DA 3U2ZA 1KLFA 3MRCA 3CQ0A 5I6MA 5DU7A 1H0IA 3N1QC 3TZVD 2FPYA 3S6OA 1RZFL 3A4XA 2KZHA 4YZFF 2X1RA 1V3MA 1UWXK 1TPFA 2VURA 3S37H 5B22A 4MKSA 1W5QA 1JPMA 3DPBB 1DVQA 4WW2C 1UT9A 3MQIA 1LP9E 3MV9A 2PI6A 1H50A 5K4XA 1PZ5A 5IT2H 4DGUA 4JZOA 1H15B 5I8EB 1KCRL 5BOPA 3MLSL 1HOCA 3QBUA 4LAQL 1E42A 3CIAA 2O5YH 4HU8A 3IWPA 4GEJA 3UCCA 5E6ID 4K4KA 3ZFHA 3QEHB 1XRTA 4AYFB 2OR2A 2R9RA 1A1MA 4JY4A 5B1BB 4D9QD 1U2CA 1H60A 5CSGA 1ETJA 3HV9A 4OFKA 3FSUA 1KOAA 4D9RE 3SFWA 4PCNA 4OLXH 2DQGH 4O2EA 4TUFA 1EGJH 1S2VA 5IY5B 1QSEE 2B15A 1EJ7L 4Y1AD 5CFHA 3HPZA 3VXNB 3IGHX 4WWOA 3R6IA 3G9VA 4AL8C 4LBSA 4AISA 5KVGL 1M9SA 2PXYA 4RZ6A 5AW8B 3WQWA 4PRPB 2WANA 3K1DA 2BSRB 1IT7A 3PDOB 5BV7C 3VKBA 3NABH 1U8IB 1WBHA 4GFTB 2DQTL 3ZTDC 1Q9KA 3JR2A 5T1KB 4RNRA 4K36A 2R1XB 2QT6A 3OHXC 2X4NB 4UMSA 2ZUQB 2IWKA 1AD9B 3FJ6A 1Q65A 5EBWA 3GSUB 4IP4A 3G1FA 4HPJA 2VC2H 4LGRB 2ESVD 1NM4A 3CMFA 1FWRA 3D3VE 2ADGB 1JZDC 2R2HA 4BV1A 3HBPA 5I1KL 4Z7VB 4QXGH 4Z95H 1ZV9A 3DHDA 2QL1A 4PJ7E 2YL8A 5LNGA 1KB5L 5C9UA 3FT1A 3IF1B 5FYJL 1MDRA 1FNSH 2GVEA 1UUOA 2W5FA 2BJML 3G08B 1I85A 1E9ZB 1IZJA 1JZGA 2F8IA 1RLDA 2GBTA 4HUUB 2PDHA 5HJ3B 4PJEA 1MI5A 2V17L 3X11A 4J3BA 4DEPC 2V2WB 2KLSA 5DVOA 5DYFA 2FJFA 5AKSA 4K7FB 3UYRH 4L8CA 5DMNA 1KEGH 3WYZA 2Z0BA 1UXWB 1SR9A 8FABA 4U33A 5B8CB 5CS7A 4XE0A 5A16A 2NY5H 3DX6A 4HS6B 2J20A 3KXFD 2VZSA 4I18A 4GUFA 5E9DE 3P0YH 2GUOB 5D7IA 3FF8A 2BP1A 2WO4A 1ZJHA 4OCSH 1YQ2A 2LAGB 2WJFA 3BEWA 4GIRA 2MCMA 1CFQA 2J7FA 3PLYA 3P02A 2C1IA 1TUFA 3P9WB 4IU2A 3P3YA 3IGKA 3S5YA 2DQWA 4CU7A 4IRZH 1BGAA 1A5UA 3D0LA 3BZ5A 4ECLA 4I9AA 4RE4A 4KJYB 1UEMA 1P1ZB 4AC4A 3WQFA 2FX7H 6PAZA 1FZMB 3BLBA 2WXRA 2OBGA 1TWIA 3RNKA 3B9NA 4LVNC 5HY9B 1MCNA 3VA8A 3DBPA 2P44B 5DURB 4O15A 1UMLA 1KGJA 4HK0A 4Q6IC 2J8GA 5DMLA 4F9PA 4ELDA 4CLMA 1MCDA 2E6FA 2OJ1A 2MNWA 1XMEB 4Z8FL 3ETBJ 3NCEB 1UIOA 1PX4A 3LZOA 4JVUA 1OTSC 4MA8H 1HC1A 3QUZA 5HI4C 4LUYA 4HJTA 3AY4C 2NWRA 1SFJA 4RFNB 3GLDA 3EGSB 2OMTB 4N87A 3D39E 1T1XA 2NY4C 3KRZA 4KIRA 2X53A 2VN7A 2UWEE 1BHGA 1NOFA 2WGNB 4KKXA 4RKAA 2OMUB 1LDPL 1BBDH 4W7UA 2HKHH 3IFNL 5CZRA 5C2UB 1Q9WB 2GDUA 1UOZA 5HTSA 4G5DA 1F6KA 2VOTA 4N9GB 4UTAH 4N4QA 1KNOB 1R9YA 3DFQA 3GG0A 4LIQE 3I3DA 2EPMX 4E9YA 3M43A 2YR3A 3TONA 3HC3H 2VFGA 3UZXA 1FIGL 2YBGA 3W7GA 5IBLD 5AVYB 3V0DA 1JE6A 2J43A 1DSWA 4LASH 3UG4A 3NZGA 4Y5XB 2N59A 2ZOKA 5J0BA 4P3DA 1OOAA 3QY7A 1IZKA 3MUXA 2YXWA 3WEXA 4WY0F 2OX5B 3L7EA 3N18A 3ARFB 3CV5A 1XD0A 4FXKC 3W81A 3T1GA 3ESOA 2HWGA 3MROA 4P9ML 1IM9D 2Z2UA 4OD3H 3H7BA 1T1ZA 1BEYH 2HS6A 2QVKA 3ANYA 3AADB 2CETA 1X5KA 3CIXA 4L2YA 2BP5M 2TYSA 3TC3A 5IWLC 4X6DA 4IIEA 4Q4MA 4XTDA 2G3XA 5D2LB 3W7MA 1PBYA 3O3EA 4HWUA 1N10A 4PY7B 1XSJA 1E65A 4WHDA 5EMYA 1KBWA 1BX2B 5T1LB 5ITBH 1DBJL 1U8PA 4R26L 6TIMA 2Y7MA 2UY3A 3GDTA 1ITUA 2DF3A 3PZUA 5J6GA 3MGAA 4AY7A 5GS0D 3CSFA 1JAEA 5F97E 3K2KA 2VDOH 1DBKH 3EKGA 1TCMA 4JKPH 4UILH 3IN2A 2A1YA 3SCMC 4ODTH 4ZSOA 4DKDC 3UXAA 3HI6L 4HIIA 4Z1CA 1NIEA 5IHSA 4WV1C 4LEXL 2QVNA 2OQYA 3RBSA 4Q4QA 4GB9A 1XRVA 5I0WA 2VE6B 3GDLA 5IBUG 1VRSA 1J5IA 1FRGL 4GIPD 1REIA 1NFKA 4S0SD 2DM7A 4MLRA 2HFGL 3Q4DA 2ZC8A 5IM7A 2YPLE 2IPUK 2OJEA 3D34A 2I14A 5AYQA 3ZO9A 5LGJB 3M4HA 5J13C 3MV01 3LN9A 1XGYL 2B0SH 3CG8A 4D9LL 2XG5A 4JGJA 5ABGA 2P5WE 3HJEA 1QACA 3L9RA 5CR8A 3VFGH 1JF5A 2C91A 2JB5L 3B05A 4KKBC 1GZ1A 5DBUA 4ZPVA 2OMBA 1OC7A 5EUOE 4EI0A 3ZJ7A 5IW3A 3ECQA 4AAJA 1HSBA 3FFCD 3HV8A 4AQ1B 3MGOA 2VXNA 4Z5RA 3NCOA 1KB5A 3QBTB 1UD2A 1WQVT 3T65A 3ZVHA 1UKQA 4AX7A 2XA3A 3L17A 3M86A 3RCNA 2DQHL 2V6HA 1SF5A 4EXPX 4ZBJA 3OYXA 2CW6A 4E0CA 2WHLA 4RDQF 4JRLA 3GZKA 4M1BA 3STGA 5I76B 2YCEA 2WXLA 2GVGA 3O6FD 3SDDA 2DH3A 3PL6C 4GRWF 3FZUD 1S5TA 3NZ8B 4JVPA 4HT3A 1XF5A 2ERJC 3KCPB 4KUCF 5C9JB 4UAHA 5L0QC 1OCWH 4NRSA 1OLLA 4Z7OE 1AGEB 2RBLA 1ZS8A 1Y7VA 4E5XA 4H01A 4IIQC 3RR4A 1DO5A 3QEQB 3DX7A 1MJ7H 2XN9E 2NNXA 1LTXA 4AYBA 5IMLA 3T1WA 4GXVH 3N2MA 2MQGA 1MFVA 3WNPA 3UTTB 2PGRA 3ZVIA 2OLDA 1I0BA 4G43B 2Z26A 2P24B 3MOAH 2OPJA 3NG3A 1WISA 4U4BA 3MHFA 1TJPA 5FW8A 2IDSA 5BROA 1UM4H 3W7RA 3LCLA 1H8LA 2CJUL 4F3FA 5E8EA 4OU1A 3MRKA 5E5RB 2VRJA 3V52L 1RHHB 4NUGL 3CPUA 2Y7GA 1A5NC 3ZXWA 4TV3A 1HP4A 3NDYA 4LHUD 4MWFA 3PTDA 4JFYA 4QT5B 1JVLA 3IMSA 2WQRA 2BOBA 3WLTA 1IAII 5F1KC 1QNPA 3W24A 4BUHA 3COOA 2ZWZA 5GJTL 1E5JA 1TZ7A 3CVDA 2ZXQA 4N2MA 4JX4A 3O3RA 3EO1B 2XPKA 4N5UA 3TPKA 3KEDA 3ABZA 3V5KB 2YAEA 4WIWA 4LYPA 3IUDA 3EYSL 5I6NA 5AVNA 2F54E 2Q7YA 3AITA 2VISA 3I6LD 3GNPA 3W70A 1AQMA 4LFHD 4HOMA 1XS2A 4PRNA 5JUEH 4C8XA 5BZXA 3ES8A 3EOYG 1EPXA 5D71L 5IDZA 2CBTA 2IWGA 2UX7A 3W0WE 2TSAA 5GHWL 5E93A 3IU4L 2BC4B 2W59A 4FFVC 1PCWA 3WSQH 2Z4QA 2PDPA 2AKRA 2TSYA 4KO5A 4DZ8A 3KGRA 4IDJL 4PTTB 5FYLE 4B5VA 1PFCA 5AZUA 4MVBC 1HXJA 5LA1A 2GYIA 2O5XL 4P23C 5IEKB 3P4MA 1NF0A 4YYFA 1RIUL 3MV7D 1IC7L 2VSMB 3OKKB 4U7MA 1AACA 4IM8A 3MI2A 1A6TB 2JNZA 5CZTA 1FX6A 4TRPL 2FHFA 4IMDA 4Q6IB 1EEXA 3A67L 1LBMA 1E3ZA 3B9VA 3RZCC 3G1SA 4AHOA 4UV7H 3X12B 2J6EA 1YMMB 5G4EA 3GI8L 1CGVA 2L8AA 4GX9A 1CF1A 2W0LA 3CB8A 3AQYA 1BD2B 3D0AA 2Q8BH 3VMNA 4QRAA 1MVYA 4XTRC 3QZLA 2DORA 5TD4A 4HA0A 4W87A 5LGKA 4TMPA 1B30A 3DK0A 1WTGT 5E1GA 4OAWB 5DI8A 1XGRA 1M05A 1TFPA 3VNDA 2L3BA 1IZCA 3QJOA 3RL1B 1MXGA 4X6FB 3SKJH 1NGWB 1YMYA 1MOEA 2WZHA 4HHMA 5FA3B 4G59C 1IGYB 4QD2E 4JUTA 1GJPA 1HK6A 3B97A 2B39A 4UNUA 1TQBC 2VWSA 2K4AA 1Z41A 1LG1A 3CFNA 3NN8B 4V2BA 3NIGE 2YZ8A 3SJNA 2B1HH 2DBLH 4YVNA 4PMOA 4KC3B 1SVBA 3ZJ6A 2F6KA 1XF2A 3W1UA 1CFTB 5ABZA 3GO1L 2FEEI 2EDXA 3KPSD 2PF6A 3ABOA 3AUJA 4OZFG 2GYSA 1IEXA 2XBDA 4KK6C 3ZZQA 4GABA 2G0LA 4U1KA 1XXXA 2GSGA 1FP9A 3LKNB 1EOMA 1Q72H 1KJVB 4TVCA 1M1BA 2VL5B 3B5TA 4GKOA 2VM9A 3O3AA 1W2PA 1EWDA 1I31A 3HPJA 5G1TA 3FSVA 3BOXA 5B1AB 1J79A 5BQ7B 3BSGA 1J5SA 4DW2H 4MB5A 1IBDA 3U0PB 3RWEB 5DD6A 3G3DA 2A6LA 1VPOH 4GKZA 5G1YA 3MGTA 4Z18A 2QADC 1T20B 4X7SH 1W31A 3U25A 4HNUA 2WIMA 4XN5A 1J4EA 1DVFB 1U5VA 3TSDA 4L1WA 1X8CA 3N42F 5C3LD 1N7MH 1TQVA 4XCCL 4G6KH 4GUCA 2NY2D 4OR1A 2XQ0A 1MO0A 1XG3A 3DOSB 3TNNB 4OZGA 5F1OB 3K4ZA 1NCAH 1EQWA 2VMJA 1H7XA 4Y2WA 1DWFM 3AYRA 3KWWB 5AOMA 5J13B 2J1KA 5DVLA 4KTDL 2AV1A 3FYEB 2F6AA 4W68A 3ZHNA 3LV5A 3C75A 4LRSA 1X8FA 1I8AA 1CI5A 1OWWA 4Z2KA 2PUZA 4HX1B 4CVWA 3OKNA 3WJJC 2PGEA 2NRDA 2X3AA 3ZYOA 3O11B 2BGQA 5IXEA 2A9MH 4M8UA 5TDOA 4Q7BA 3U83A 3GZPA 4NRYA 3EX4A 4Y7OC 3UX9B 4F48A 5IMOA 3ETBF 1CEOA 5IJVB 4PJAA 5HI5C 3MYOA 1WX0A 2X6AA 4GYPC 3EDEA 3VGAC 1RZFH 3GBEA 2BOCA 4HUCA 3UJIL 5BXFB 4B9PA 2FZ3B 2DWEA 3DX4A 3CVIH 3EJZD 3PL6B 4FP8L 3BESR 3QIBB 4JPWL 5JOPE 3TWBA 2FGBA 2APXA 2GABA 1XC4A 3N29A 1P7QB 5L0QB 3CZ8A 3L5WB 1CICB 4Y4HA 3T6CA 3R58A 3QZ6A 1EXUB 4X7FC 4Q9CA 3LCXA 1X3DA 4PYSA 3QDJE 3MLSH 3SGKC 2QW5A 1WO2A 3QPQD 5HDBE 4DOHB 1HIML 4GK8A 4ELME 2EEXA 3WCYA 2MKWA 3W2KA 1A6WH 5T26A 2EIDA 5DUBA 4AK1A 5GJNA 3OGCA 1X7QB 4K15A 4Z7WB 2JMRA 1YAZA 4UINL 1AG6A 1R5IB 3GIPA 3J27A 4GZ7A 1RERA 1AO7E 4LT9A 4RW5A 2F1EA 4HZ1A 4H88H 4OZHA 1BBJB 5JW4M 3UTSB 1FJ1B 3LZFL 3WLPA 4GC3A 4PJGE 2NW0A 3QCTH 2HG0A 1X6NA 4LF3B 3VDBA 3ABSA 3VKKA 4ALAL 1FZOB 3REWA 4S3CA 3GINA 4NDMA 5KVGH 4PMFA 5DC9B 3S2CA 4RLDA 2DZBA 9CGTA 5F9WB 2ZXDA 1NFDB 4O1DA 1O6SB 2DQTH 1C9DA 4MZRA 3ZMRA 4OUUB 4MKVA 3R2GA 2FTAA 5C0DB 1AIFA 3G5EA 3L67A 2D3VA 3GYRA 4UNKA 3H12A 1NL0L 2O6PA 4Q8BA 3IIPA 3FT2B 2EE6A 2FX8L 2Z7YA 4O57A 3GVVA 2XA8L 1M1SA 2VLRD 2NYZA 4AZHA 1KTDA 3WBYA 1WA1X 3VFVB 2I7SA 2VERN 3ZHKA 1HKVA 4NNBA 4HKBB 1VYSX 1KB5H 4QOKA 3S37L 5FYJH 3NPVA 3UYCA 1UXLA 1E0UA 2HPTA 2BXVA 1FH5H 2WVVA 1B31A 5D02A 4EPEC 3H7LA 4ZA0A 1RL1A 4JO3H 2XVKA 2V17H 1F86A 4DZBB 3H7RA 3I4EA 4KVPA 3RZCB 2DQEL 1DPMA 2PCYA 2J7EA 1K8IB 2NUTA 3O2DH 3QZNA 4TNWK 1L3NA 1V8HA 4KK5D 3EFDL 2GSMB 5K1NA 3QORD 1VP5A 3F4WA 3O9WD 4NX0A 1IEQA 4GIYA 5I75C 2YD5A 1OGAA 2A0LD 3STBA 3PSVA 2BHZA 4XMLL 1XWYA 5HVWA 3SO3B 4QRSB 1XIMA 2DI9A 3FUNA 5JZ7C 4TPRL 3BE1H 4OLXL 4Q6JA 4IMFA 1EGJL 4NASA 1SYVB 4G6FD 2WNQA 2E59A 3LN5B 1XGPA 2Y7FA 1QTWA 4M7LH 4MFHA 5FF6A 1B3VA 4H9XA 3T0BA 1YHTA 3QJTB 5AOZA 4PMXA 3CJJA 4EZMA 5IMMB 3WH9A 1BF6A 1MCRA 5I6PA 4MY8A 2Z7GA 4G2AA 1RMFH 2GLKA 3N6YA 5KSBA 3CUHA 1TCRA 2B20A 5CHNB 2NX5A 4MNJA 3DV4A 3N85H 4TSAH 5B7YA 2E6DA 3V4VB 5F7EH 1EYWA 2IH1B 1M6UA 5FUCE 1HTYA 4Z0JA 3LTVA 3BH8A 4JRYA 3FJNA 4AYDC 5AB1A 3NQMA 1X4ZA 5F0JB 4OW6A 3B9KA 3HB3B 2IXQB 3PHOA 4Z95L 5D7JC 4DP5X 1R38A 4YE0A 2WKOA 1J1OL 2WYTA 3O4LB 4W9TA 2NVDA 3UD6A 1KM6A 1PLGL 5H2BA 4AWJC 2F5BH 2XX0A 3CZGA 5AC7A 3WQCA 4LC8A 4J3SA 2I5IA 3SB0A 3IFNH 1WH0A 2LR4A 4RAVA 1YEJL 4G80B 3UF9A 1OCNA 4JXCA 5C0BD 2Y25A 3VWKB 4NENA 1OZTG 2XRAH 4XG1A 2K4WA 4H4NA 5M5DA 1KEGL 4KRPC 2K78A 3ZKXC 3COTA 1SR0A 4HK3N 2G96A 1GVFA 5IB2B 5EO9B 3MLWH 3TEXA 3RR1A 4Q8NA 3U4BH 3AYSA 2NY5L 5DJXA 4TUKL 1Z1WA 4Z77A 3HG1E 3EX6A 4G7QB 3SECA 4GMTH 5FGBC 1WDAA 1N7KA 4FXGA 4OCSL 5EO0A 3BSHA 5CKSA 1P0KA 1YPZF 2ZNWA 4N2FA 1ZJBA 3B2UC 4UMGA 3KDMA 2PYEE 1OWQA 1V7YA 1A53A 1Q6QA 3LNGA 2X9ZA 3RIFK 4TS6A 4I0PB 2B08A 4CVXB 2P88A 2QSTA 3BJTA 3ARGD 5IW1A 4IRZL 3T71A 4WDIA 5CU5A 3JWNH 2IMMA 4A8RA 1G9NL 4AT6B 3T3MB 3TXAA 3DECA 1W17A 2FX7L 1RJQA 4R26H 2ZPKL 4TMCA 1F11A 4A2MA 3V1PA 3RP1A 5FO9B 5I2IA 2XWDA 1UUQA 3GU2A 3W6LA 4FA6A 3HR6A 5GSRA 3SIKA 4L5ZA 4LS1A 3M7WA 2ZX5A 3SQSA 1ZT4A 3TX4A 5G4OA 2XWXA 1KM3A 3SE4C 1C9SA 1OTUD 2C4FT 4LEXH 1I3RA 4MA8L 3UAJC 5HHNA 5J11C 3CUZA 5C09A 4Q7NA 1N3NA 3IGUA 3MYZA 1JBJA 3D46A 2D1ZA 1Q2RA 4WQ6A 5DRIA 1BTMA 3WOVA 1K72A 4LVHC 1A7PH 5LBGA 1O12A 43CAA 2WMGA 4P5MA 2GPZA 4D9LH 3LRKA 4P2OA 4ZUTB 3GH7A 4CILA 2HLAA 2DWDB 2F74A 2JB5H 4D8PA 3A5FA 1XF3B 4ZNCD 3HFTA 3CXFA 4OFIA 2ZYSA 3GLZA 3EYQC 2OZ4H 1ZHNB 2HA1A 1FWJC 5IHZB 1MDAA 3HC3L 3U36A 1D5XB 3TVMA 1V02A 4NZ3A 3DI0A 2VZOA 4OKVA 1UQSB 2VWEE 3LTPA 1KIRB 4ZB2A 2DQIL 2WB1A 4PRIE 1J10A 2BODX 2DYRB 3WEBA 2H2PD 1GZJA 1OEPA 4X98A 5TFSL 4CSZA 5HYSG 3V0HA 3QB7C 2DLTA 2V8MA 4OD3L 2FBRA 1BEYL 4X2RA 3MSRA 4C6IA 3FMGL 3LH2H 2EDTA 4ZX4A 5D1ZC 4JFDE 4QX4A 4J7RA 5JH2A 1G6VK 1RZIA 4RFEA 4KUCD 2NOYA 1J96A 1KD0A 4QTHA 3WBWA 2JV6A 2HMID 1EGJA 1X5GA 4I9JA 2Y22A 1QAPA 1SJXA 4NFBA 2VDOL 1DBKL 2PWHA 4JKPL 3VOGA 2AZAA 4EPBC 2CJUH 4JIHA 3V52H 4NUGH 4ODTL 2OXGB 2E0PA 2JCCF 3FQTB 3R4IA 2X4PA 3THDA 4JK0D 1TPEA 2BIQA 1D5BB 3WFLA 4H1LA 3T1FB 2X2GA 4KERA 5LXXA 5CG7A 2WXQA 2Y06L 2V63A 5GJTH 3FN3A 3BCJA 5FAGA 4CA4A 5BS0E 5C07D 2B0SL 1XDMA 4QRRE 4XMZA 3MUIA 3KTXA 1G9MC 1GYLA 1F02I 2D22A 4GFIA 4I5BA 3VFGL 1OGPA 1NWRA 2WQPA 3EYSH 2HX9A 1V51A 5KJ7E 3OKDB 2IKGA 1QSFE 5C92A 4QRFA 2B4CL 2DT3A 5DJCA 4DBUA 3AT9A 3GDBA 1FHLA 1XFBA 5IP4A 4NM4L 5AW5B 1W5NA 2BM3A 4K71B 1CLVA 3O6LH 5L8JB 1MEXL 4N4YB 4UT6L 4PJDF 5E5MB 4HU0A 4M6VA 1FHNA 3ZRFC 3ML9A 2EDNA 3UBXB 1XICA 1R3KB 1ZP4A 1MCWM 1AUSL 5KSAA 3NXFA 3LMYA 1CMOA 2AQRA 4M8QA 1EP2A 2VLJE 5SX4I 2H26B 3W86A 1BQKA 1IC7H 1PD6A 3VIKA 2X9WA 3M7FB 3PAYA 2B8OT 4JTCA 3M1BB 4KI5E 4TRPH 5CJMA 2MCAA 2F0CA 4I0KA 4JYDA 1B1YA 4C6CA 4BSJA 3A67H 3UPAA 1JGEA 4R4FL 4RCAA 5GZOC 3QUZD 4KROC 1H09A 5GGVL 1N68A 3Q67A 1MJ7L 5ECJE 1V6VA 3GI8H 1W72H 2AGJH 1I1YA 2A73A 3NJJA 3WBEA 4FALA 5I6XC 1P0SE 5D7JB 1Q2SA 4XN2A 2DZUA 4PGZA 5HJLA 4AXKA 2FVKA 1WJ3A 1KY6A