3VM5A

Recombinant medaka fish alpha-amylase expressed in yeast pichia pastoris
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
499
structure length
499
Chain Sequence
b'QHNPNTRDGRTAIVHLFEWRWADIAAECERFLGPKGFAGVQISPPNEHILVSSPWRPWWQRYQPISYNLCSRSGGENELRDMITRCNNVGVNVYVDAVINHMCGAGGGEGTHSSCGSWFNANNKDFPSVPYSNLDFNDGKCKTGSGNIENYGDPYQVRDCRLVGLLDLALEKDYVRGKVADFMNKLIDMGVAGFRVDACKHMWPGDLDNVYRRLNNLNTKWFPGGSRPFIFQEVIDLGGEPITTGEYVGLGRVTEFKYGARLGELFRKWNGQKLSYTKNWGEGWGFMADGNAVVFTDNHDNQRGHGAGGASILTFWDPRLYKMAVGYMLAHPYGFTRVMSSYSWDRNFVNGKDENDWIGPPSNGDGSTKPVPINPDQTCGDGWVCEHRWRQIMNMVQFRNVVNGQPHANWWDNGNNQVAFGRGNRGFIVFNNDDWALDVTLNTGLPGGTYCDVISGNKDGGSCTGKQITVGGDGRAHFYINNSEEDPFIAIHADSKLHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase
molecule tags Hydrolase
source organism Oryzias latipes
publication title Structural and functional characterization of recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris.
pubmed doi rcsb
total genus 173
structure length 499
sequence length 499
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vm5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vm5A01
3OLEA 3AIRA 1K6AA 2X0YA 3WF2A 3A47A 3L4UA 1ZBVA 1X1NA 3J7HA 2ZOXA 3LMYA 2BXYA 4CUCA 1BGGA 4GIAA 4CN4A 2WVVB 1CIUA 1CXEA 2C0HA 1BVNP 4PMOA 4GINA 3SCNA 2W4XA 1J18A 1UR0A 3MV11 3VD3A 5GNXA 1W3KA 1KXVA 2A3HA 6A3HA 4WF7A 3ARWA 1KGWA 4UTFA 1FFQA 1C8QA 4D6FA 5E9AA 5I5RA 2BY1A 3VIMA 3FNDA 1JYVA 3WDQA 1MQRA 4BA0A 4H8UA 4NRRA 5JBDA 2OYMA 1ISWA 2JF7A 5CG0A 3BH4A 2PWEA 5CJ5A 2DH3A 3OG2A 3MUIA 2HVMA 3CZLA 1V3HA 3BAXA 1HXKA 3TTOA 3VIOA 4B9YA 4QAWA 2OW6A 4GO8A 3NDYA 2ZX7A 1V3LA 2WVVA 2CPUA 2EPNA 1FA2A 2YLLA 1TVNA 4PUDA 3GM8A 3NDZA 3QOKA 1G0CA 1US2A 3SCVA 3BSHA 2EABA 4AD1A 1PZ2A 4NZJA 2GJRA 1UWUA 2VURA 3TA9A 1WP6A 1LWHA 2YJQA 4UOZA 5ECUA 3K46A 1DWFM 3AHTA 2F7PA 3ARXA 4HA1A 4PTVA 4XV0A 3B9EA 3TV8A 5HBFA 1EO7A 4JAWA 3AMLA 3VKKA 2ZWYA 2WCSA 3F5LA 1HKKA 5A8NA 4UZUA 4BF7A 1E6QM 4MJ2A 2EAEA 5D9NA 2O9OA 4UNIA 3AS0A 3VM5A 4H2CA 5DO8A 2CERA 2YDSA 1QBAA 2WHKA 2JIWA 4M24A 4R5EA 1C8YA 4EANA 3EMZA 1ZBKA 5A8PA 1QOXA 2WHMA 3BMWA 1B30A 1G1YA 3ZQ9A 1HX0A 1VJZA 4FLRA 3VNZA 4KRTA 1HKIA 1FH7A 1VB9A 2X05A 4K68A 1C7TA 3PZTA 4IM4A 1E0WA 1NWUA 4TUFA 3KE0A 3OZPA 1W1YA 4UFMA 1TFVA 5A6SA 4NZCA 4WIWA 4HP5A 2XJ7A 1UA3A 4U2YA 1QNQA 1SR0A 1CECA 4F8XA 4MNJA 1TQTA 5A94A 3LRLA 2QF8A 3RJXA 4PSPA 3CHCA 2V5DA 4CU8A 4W89A 3T0DA 3WF4A 2BHUA 1XH2A 4IPLA 3U5YA 3LRKA 2ZXQA 2VZVA 2YL5A 2WVUA 3D4YA 1PIFA 1MW3A 1EO5A 1QI0A 1HL8A 4WKAA 1E1FA 4AIOA 1UKPA 5BRQA 3AOFA 4HU8A 3K8LA 5I77A 1UKTA 2J25A 2J7FA 3IK2A 3QGVA 4CCDA 1V6UA 2J7HA 3DYMA 2IXUA 3WY4A 4C7DA 2E9BA 2OYKA 3VSVA 3CUGA 4ZFMA 1CGWA 3PTQA 1JF5A 3VD5A 3T0BA 3WL0A 3FN9A 1UR4A 4JKKA 2ZWZA 3SCRA 1XRVA 1YHTA 1C8XA 4M81A 3AIBA 2G3NA 1HJWA 3B9AA 1LL4A 5ABFB 3WEMA 4EE9A 1JXKA 3MSGA 3CZKA 4CVWA 5I78A 2WKLA 2Y8KA 3K1DA 4WLCA 1C90A 1FH8A 3EJTA 2QMKA 5M03A 1HWWA 4YHEA 1PPIA 4Z2HA 1CGTA 2EEXA 4X0NA 5CGMA 3N11A 4PMRA 5A6AA 2BV9A 1E6ZA 4C7GA 1TA3B 1XCWA 1G9HA 1UKOA 3BAWA 1BYCA 4RE2A 3EDKA 1JFXA 4AY1A 3BUQA 5KZ6A 4BS0A 3ZR5A 2QPUA 3A6OA 2Y2WA 3VX0A 1BGAA 3AIEA 2OYLA 1ZJAA 1J12A 1VFUA 4TTUA 4BQ5A 1B3XA 3AISA 4F66A 3H55A 4PMDA 3BXWA 3CTTA 2J77A 3WUBA 1ITCA 3VO0A 2J78A 2E40A 4AMXA 2VCBA 4B15A 1U33A 1OT2A 2GVYA 4UFKA 2X1IA 1ODZA 1HT6A 1V6WA 3VILA 3DDFA 2D22A 3WQVA 3WEOA 5CQ1A 3HG3A 2C8NA 4CN6A 4AD2A 4UFHA 4PMVA 1HIZA 1UASA 4HOZA 1D7FA 3BVVA 4PCSA 4P7RA 2GJPA 1E4NA 2WLYA 3EJUA 5F7UA 4MAZA 1KXHA 3BSGA 1UR2A 2WZEA 2OSWA 3KL5A 1NOWA 2XGIA 2J7DA 1JG9A 1V03A 1PAMA 3CPUA 1OM0A 2VJXA 3ARPA 4UQAA 4LX4A 4JFSA 2OW7A 2CBIA 1BF2A 4FMVA 1V6XA 3NJ3A 1MXDA 1I75A 5CPQA 2B31A 5HXMA 3VU2A 3PTKA 5A6JA 4AZCB 2D2OA 1GVIA 3PZUA 4W85A 1JZ4A 1GJWA 1OIFA 3AHXA 3ZO9A 1XC6A 2XIBA 4CD4A 1C92A 2J79A 3VDAA 5HPCA 4B3KA 1HNYA 1UQYA 2VVNA 2WWCA 2F1AA 3CUHA 3WSUA 3VMPA 4AZGA 1HJXA 4E4PA 5AC5A 2X2JA 2W63A 3T2OA 1NP2A 4LYRA 4PRWA 1UOKA 5CZKA 2AOSA 1B3VA 5FIPA 3O9NA 4A3HA 1OSEA 3HN3A 1XSIA 3KWXA 1NOUA 2FE0A 3KEHA 3WDPP 4U2ZA 4CKQA 3HZ3A 5EBAA 3CZSA 4L4OA 2CYGA 2YL8A 4M56A 2ZXAA 4AXNA 3VM7A 4EKJA 3D5HA 3N12A 5EFDA 4AEFA 1HN1A 1UR9A 3K4DA 2VT0A 1MW2A 4UOJA 4NXKA 2DGAA 3AJ7A 1ZS2A 2XVNA 4HA3A 3VVGA 2WHLA 3K8MA 2VZUA 4PMNA 3EDFA 2WMJA 2F1BA 1S46A 4D1JA 3AZTA 4OBRA 3AS2A 1F4HA 3WQ8A 1KQZA 4KGJA 1Y7VA 3ZMRA 5FOOA 1OWQA 3WH8A 1W1PA 3WQ5A 4AD0A 1VFOA 4NX0A 1IZJA 5BROA 2BHZA 3LRMA 2GUYA 1ISVA 2X0HA 2W66A 1AVAA 4CCEA 4P8VA 5A8MA 4J3XA 3D52A 1KBKA 3CH9A 1B3WA 2UY4A 1CGYA 1CGUA 1Z32X 1B3ZA 4P8WA 4JFTA 4EAMA 3WD1A 1UWIA 4AZ6A 1E71M 3PZGA 1J0ZA 4W93A 2VOTA 4UQDA 2BFGA 1JYWA 5LA2A 1KCLA 1V6VA 1JIBA 1B0IA 4OBSA 3K8KA 4M82A 3WFZA 4NI3A 4KH2A 5CPTA 1CLVA 2J8GA 4TX6A 2HISA 4MDPA 3IAQA 3NSXA 4X0VA 3EMQA 2WCAA 1V08A 2PBOA 2A3EA 3W0KA 3S5ZA 3AZSA 2WMHA 2CHNA 5M17A 1H11A 2ZX5A 4JIEA 4W87A 3BAYA 1OBAA 1G5AA 4HMDA 4Z2LA 1CTNA 4AZBA 2RGMA 2VX4A 1QX1A 4UQBA 3ARYA 2OLHA 5EB8A 1JZ6A 2PB1A 4JHOA 3OGRA 3TOPA 4HTYA 1R47A 2TAAA 3WNMA 2XYLA 5LYRA 3N1AA 1J9YA 4PMYA 2WMKA 3MUAA 1GJUA 4HZ6A 1JGIA 1R7OA 4QP0A 1ESWA 3SCQA 3BVTA 3DX2A 3SUVA 1E6RA 1M03A 5DF0A 3BAJA 1SFSA 3T0AA 1R85A 3AXIA 3B9DA 3O6AA 3FXYA 2E8ZA 1JYXA 5A2AA 4QLLA 3L4YA 3PBGA 2O9RA 3MANA 3T2PA 1GQKA 1IT0A 3NYDA 4BQ2A 4LPCA 1HP4A 2ZICA 1AQMA 1BYDA 1LG1A 3I3DA 3VUPA 1E6PA 3DX0A 2YLAA 2X09A 3U7BA 1HTYA 1M7XA 2PWDA 1ZU8A 1JZ8A 3L2LA 2G41A 2XSAA 4UZSA 1QNOA 1XD0A 3VGGA 4U31A 1CBGA 3SUUA 1RP9A 1NQ6A 5BCAA 3ECQA 1P6WA 2ZUNA 1XH1A 3WUEA 1J0YA 3AIQA 1GQLA 1GUVA 1QW9A 2X8RA 4MB1A 1FFRA 5ABFA 1GOIA 3MI6A 1XSKA 2E4TA 5I6SA 4Z2JA 3AS1A 3OBAA 1JZ2A 1UZ4A 2MANA 5FL0A 3JUGA 2IUZA 4FF5A 3W38A 1DWHM 3L4TA 3EBVA 3WQWA 4PMUA 2F18A 2XWDA 3RPMA 3VSTA 4UFIA 3DHUA 3EJPA 4U5KA 4RE4A 1RP8A 3WNNA 2Z1KA 4MB3A 1JD7A 3WY2A 4HOXA 1QVBA 3VDBA 1B9ZA 4AD4A 1A3HA 4CCCA 3ARRA 2WPGA 1VFFA 4XZBA 5A6LA 1E6XM 3ZJKA 1CXFA 2D1ZA 2F61A 1IV8A 1D3CA 2J7CA 1NOFA 3VDCA 1V6YA 1JDAA 1G01A 1WE5A 1JDCA 1N82A 5IXEA 4AZCA 3N15A 5E09A 4M29A 3BAIA 1LL7A 2WM0A 2CBVA 3G6LA 3WNLA 1RH9A 3WFLA 4JFWA 4DWSC 2VX6A 4OOUA 3F5KA 1UKSA 3CHDA 2QLYA 1SYTA 2UY5A 1Q6EA 3NSNA 4U3AA 3ZM8A 1W1VA 3RO8A 2D0FA 3WD4A 4AD5A 4DUVA 5C71A 2BY3A 3HG2A 1B31A 1W1TA 2XTKA 4CD6A 3AICA 1R86A 5GNZA 3VIGA 4FLSA 1BVZA 5IFPA 4ZENA 5I0DA 1TQUA 1UG6A 3FHAA 1PIGA 3IJ9A 2XIIA 1W2VA 3CIVA 1KWKA 2BHYA 5LA1A 2ZX6A 3LXBA 3QOMA 2J7BA 2JALA 3GZAA 2G8ZA 1W2PA 1LL6A 4TTGA 3S6TA 4AZIA 4D71A 1Q6GA 2GJXA 3SUTA 3VTRA 1VF8A 3N13A 5FCZA 4PUEA 1CNVA 1GPFA 1UZ1A 1QWNA 2FHBA 3ZT7A 2EPOA 3AHZA 1PJ9A 1E56A 3BUBA 1CXIA 3WDHA 2JFEX 5FKYA 3NIYA 2NT0A 4TXEA 3L4XA 1ZB5A 3VD9A 3VNYA 1R33A 1BFNA 4WKFA 1UH2A 4QDMA 2YOCA 4HMEA 2XN1A 2ZXDA 1TR1A 1EH9A 1V0LA 2BVTA 3CMJA 3WQ6A 4RL3A 1WCGA 3GNRA 1UQZA 1OT1A 4B9ZA 1XH0A 1E43A 5BRPA 1PBGA 3KLKA 1ISYA 4DO5A 2D23A 1E1EA 3DX3A 3WBEA 4CVUA 1QNSA 1WKYA 3W37A 2CBJA 1UKQA 4WK9A 1JI2A 4UQ9A 5E6ZA 1QI2A 4GQQA 4CU7A 1OCQA 4AIUA 3AZRA 2OWWA 4DM1A 4J28A 2WBKA 2WC7A 1HKMA 3W4RA 1BTCA 2JEQA 2G3IA 3MS8A 4JHZA 1W9PA 4WSKA 1CEOA 1UH4A 4YN5A 4D6HA 4A3YA 2IGTA 1E9LA 2CKRA 3VIKA 4URIA 2VZOA 4DWSD 1GOMA 1W32A 4TVCA 2WMIA 3TP4A 3U57A 2JEPA 1PS3A 3WDIA 1H1NA 3W81A 1LJYA 1IZKA 1H2JA 1GCYA 2QV4A 3A22A 3H53A 1UUQA 2J7EA 1GORA 1T0OA 3POCA 5BXRA 5GPRA 5AYBA 4GI9A 2GK1A 1TMQA 2FDMA 3AYRA 1M01A 5DEZA 2AAAA 3ZIZA 4B16A 2WBGA 4DUWA 5A69A 3WH6A 3ZT6A 3A3HA 5CSUA 1VBRA 2D20A 1E40A 4AIEA 4E2OA 3VIHA 3CZ8A 5C8BB 1HXJA 1Q6CA 4W5UA 4H04A 1C7SA 3LXCA 4FNPA 4X9YA 3PZMA 4AWEA 1V02E 5E1QA 3DX4A 1Q6FA 2VO5A 1OD8A 4C7FA 3DX1A 2GK1B 1BG9A 4W84A 4GZIA 1QI3A 2VUYA 3WUGA 2XG9A 1DWIM 3FAXA 1HKJA 3ZT5A 4ZE5A 4FNRA 4QCEA 2ZE0A 3T2QA 3T08A 4DWSB 1K9EA 4CU6A 3QHOA 4D6DA 2VCAA 3IJ7A 4J3TA 1SMAA 3AQUA 4Q7NA 3MU7A 1EQCA 1NWSA 5HDRA 1BYBA 5CPSA 3BLBA 4XB3A 3LPFA 1J0KA 2ZUWA 2DPEA 3WIJA 2WVTA 1WDQA 3EMCA 3G6MA 4P7OA 4PCTA 1E15A 2CIPA 1NH6A 5I79A 3OGVA 1XHGA 2WC4A 1V0MA 4BCEA 3MMDA 2WHJA 3ARQA 1H4PA 3BAKA 1KR0A 1SMDA 7A3HA 4HZ7A 1ZBCA 4BQ3A 1KQYA 4FNQA 2D73A 1EHNA 1OD0A 4GQRA 3BC9A 2JF6A 4W8AA 5DMYA 4FNUA 2WXDM 3NUKA 3VOCA 3AXXA 1J0JA 3CGTA 4OJYA 2GFTA 4V28A 1CWYA 1V02A 2X2YA 3KLLA 1R34A 5A8QA 1OGBA 2XM2A 2J4GA 1JNDA 4YHGA 1M53A 3CC1A 1BSIA 4YPJA 4W8LA 5I3DA 2QMJA 1GVYA 2GJXB 4ATDA 4N42A 5BWFA 3AIUA 1BG4A 2ZX8A 3VGEA 4DO4A 2XPKA 3VPLA 1GHRA 3ZJ6A 1OB0A 2BVYA 3AHVA 3MUZ1 3QHMA 5A8OA 5BXSA 2NW0A 4AZHA 2DIEA 3E1F1 1CXHA 1UD6A 2V3EA 3FHQA 4AMCA 2W62A 3CZGA 1UD2A 2WWDA 1E5NA 3D3AA 1CLXA 2CESA 3AI0A 1UH3A 4KRUA 2EXOA 2F2HA 5A3HA 3WEZA 3RM8A 3GXDA 3WD3A 2OSYA 3PZVA 1QPKA 2CXGA 2O92A 4P8XA 3CUJA 3RM4A 3FW6A 1C93A 3CUIA 2OWXA 4H8VA 2YA0A 4JFVA 1TVPA 4P8UA 3BUPA 6CGTA 3HU7A 4M80A 3BGAA 2OWCA 1JZ5A 4H8HA 7TAAA 1J0HA 5EFFA 4AW7A 1E4MM 3TONA 3AXHA 2Y4SA 1MVYA 3TTSA 3AFBA 1GW1A 4FLOA 4D6GA 2V3DA 3RMEA 3LXAA 4JCLA 4N0RA 1WAWA 3A24A 1Q4NX 2VI0A 8CGTA 2OSXA 2VX7A 4W86A 3CLWA 4PMXA 3K4AA 4R27A 4V27A 4B3LA 2A3AA 1CYGA 2XVPA 3M46A 1OGGA 3SCUA 2Y8VA 4KWUA 1VEOA 1E73M 5HOSA 1VEMA 2EO7A 2EADA 1AQHA 4HPGA 3ZJ7A 2VCCA 5M5DA 1KCKA 2XFFA 3SUWA 4OOZA 1XD1A 2D24A 4AMWA 1W3LA 3AS3A 2ZIDA 1U2YA 1A47A 3EYPA 2O9TA 3A4WA 5HPOA 1E3XA 2UY3A 3KL0A 2CITA 5ABGA 1JYNA 3QHNA 1UD3A 4JFUA 2WK2A 2XN2A 4ZE4A 3D4ZA 2V3GA 1WDPA 5GNYA 2Y5EA 3PN8A 1OGSA 3W27A 5IHRA 3ALGA 3ARZA 3AIVA 4JKLA 3S2CA 1QWUA 3HG5A 3L2MA 5JBFA 4AD3A 4L4PA 1O7DC 4D1IA 1R7AA 1VRXA 1EXPA 4WJXA 1E72M 4J3VA 3GNOA 2YA2A 1UHVA 3CHFA 4NF7A 4ZXOA 4J7RA 1E70M 3DDGA 5JBEA 2EPLX 4MAVA 4MADA 1UR1A 1HVXA 1B2YA 1DHKA 3GYCA 2Q8XA 1ITXA 1B3YA 1TCMA 3WDJA 1FH9A 4OZOA 4P7LA 5D4YA 1KXTA 3EDEA 4XZWA 1QI4A 1MWOA 3WNOA 1R8LA 4PMZA 1M04A 1FP8A 1W9DM 2J62A 5FD0A 1X6NA 3M6DA 4GO9A 3SCOA 3RM9A 1CDGA 2E0PA 5JUVA 1BAGA 2J74A 3GTNA 4LXFA 3OA5A 3W82A 2G3MA 3CZNA 3EJSA 5E0FA 5DT7A 2FHCA 1H5VA 5I2UA 2E9MA 3W24A 4LGXA 1JZ7A 2WVSA 3MMUA 4AISA 1JDDA 4A4AA 4HMCA 1JNEA 3VGFA 4Y7EA 3ARTA 1KBBA 4BZYA 1XGZA 5HNNA 4U5IA 2E8YA 2DSWA 3BMVA 2XSBA 2WCGA 3S5YA 1WDSA 4HPHA 2WANA 2ZUSA 3GXTA 1FP9A 3MO4A 4WSJA 3TTYA 5ABEA 3B8SA 1GHSA 4OUEA 1W9BM 4FK9A 1UD4A 1EOKA 4U3CA 1XYFA 4NXSA 2G4FA 2V5CA 3ZOAA 2ESCA 2EJ1A 2DT1A 3GXNA 1HJQA 1V0KA 1DWAM 2QPSA 4D6CA 4KGLA 2YDQA 1VAHA 5E0CA 2UWFA 4AYGA 3EDJA 1JL8A 3U7VA 3VIJA 3SCTA 2E3ZA 5CLTA 1W3HA 2AMGA 4HOWA 2FGZA 1DWGM 4BQ4A 4ACYA 2X2HA 1BHGA 1WNOA 2XFYA 3UCQA 1DWJM 4GXPA 4RE3A 3WNKA 3IANA 1UWQA 1CGVA 2D0GA 3WY1A 1C3FA 1JZ3A 5D9PA 1LQ0A 1UD8A 2DDXA 2WZHA 2XUCA 4AEEA 3MUY1 1KTCA 3L4ZA 1KFWA 3CO4A 3W26A 5A1AA 3WY3A 3PZIA 1O6IA 3GXIA 3BLKA 1D2KA 5AY7A 3PHAA 2BS9A 5TD4A 2XVKA 2WMIB 4E8DA 4MB4A 3VX1A 1GOQA 1X6LA 2DSUA 2NT1A 1HVQA 2BY2A 3THCA 1BLIA 1V3MA 1WZMA 2VNCA 4Z2IA 4V2XA 3WELA 1PX8A 3ALFA 4D6IA 3RIKA 3UETA 1WZAA 4IPNB 4ATLA 1CXKA 2ZX9A 4UCFA 1I1XA 2XM1A 3UG4A 4OGZA 2YDRA 4MNLA 2VRQA 3LX9A 4GPNA 2X2IA 1H0GA 3VINA 3DYOA 1FHLA 4S3KA 3WMSA 1QHPA 3VIFA 5I23A 2FYVA 5IHSA 1QI5A 1J0IA 2ZUUA 1L0PA 1JAEA 4MDOA 2DSVA 1XV8A 4F9DA 5JIWA 1ZJBA 1PZ3A 3AYSA 2PWHA 3OZOA 3OGSA 2A3CA 4GZJA 1E4IA 3CV5A 3PTMA 1TA3A 4MPKA 4W7VA 4CGTA 3AMDA 6TAAA 3WKZA 3BVUA 2DEPA 3VMNA 1CZ1A 1QBBA 4W7WA 4PMQA 1WPCA 4UQCA 2D0HA 5A2CA 4FLQA 1EHAA 1ISZA 1H49A 4W5ZA 4CD7A 2JIEA 1F4AA 3WL1A 2F7QA 5E6YA 4AZ7A 3F5JA 1QHZA 4PBGA 3WF1A 2XVLA 4AZ5A 1KWGA 2NSXA 5DT5A 3AIWA 3GH7A 3GNPA 5D8ZA 3M7SA 3SEPA 3SCWA 3W29A 1AQ0A 1EA9C 1TUXA 1EDQA 1XYZA 3CBWA 1W91A 3LPPA 2PBGA 1H41A 1EDGA 3MMWA 4F79A 3WF0A 4ATWA 2WSPA 3WMCA 4PTXA 3A4XA 2JE8A 1GQJA 2J8FA 2VVSA 2J75A 1TQSA 1W9XA 1JXJA 3W28A 2PI6A 3QR3A 3H54A 4J3WA 3CMGA 2ZUVA 3F4VA 5AC4A 3VD4A 1J01A 1L8NA 1V3KA 1QW8A 4D6EA 2PF0A 3VIIA 1JAKA 4PN2A 1V3JA 5I24A 1BQCA 1LLOA 2VZTA 3GBDA 3PZNA 4H41A 3LPGA 4PYSA 1DTUA 1NWRA 4TX8A 3DYPA 4Q22A 4CD5A 5BXTA 1VBUA 8A3HA 4LYQA 4ZEPA 3OLGA 2ZUMA 3BUIA 3I3BA 4EK7A 5LA0A 4XX6A 3UEQA 3BCFA 3AMKA 2PC8A 1LWJA 1R46A 1TZ7A 4TOQA 3VD7A 2BY0A 3A23A 3WNPA 3WBAA 2D3LA 4W8BA 3WD2A 3VGBA 4MNKA 1VIWA 4W88A 3WH7A 1TQVA 2CHOA 3SIMA 1R87A 4HZ8A 4MB5A 1DP0A 4UFLA 1KXQA 2W5FA 3UG3A 1E0VA 1E5JA 3RCNA 3ZJ8A 3HG4A 4JL2A 1QNRA 3NSMA 5IDIA 5EMYA 1UYQA 2CNCA 2DSZA 2VR5A 3DC0A 2W67A 5DFAA 1K9DA 2XHYA 4QLJA 2DQXA 1EGZA 4GI6A 3GXMA 3WENA 2WSKA 2V3FA 4HU0A 3VGHA 3AMGA 2PWGA 4UFJA 4Z2KA 3IAPA 4F9JA 4AYSA 2WMGA 2VRKA 2VTFA 2V38A 3ARSA 2FHFA 2XWEA 2EPMX 3ZR6A 2CBUA 2BNJA 3WD0A 5A6BA 3W6MA 3FY1A 1NP0A 1MW1A 4PSRA 2W92A 1US3A 3LPOA 9CGTA 3WQ4A 3KZSA 4JKMA 1K9FA 1WB0A 2CKSA 4Z2GA 4QLKA 2WYSA 1PX4A 1O7AA 3N18A 5D9OA 1WZKA 1JI1A 3ARUA 2J47A 4H7VA 2BVDA 1NWTA 3T09A 3FAWA 2IXVA 1H0IA 1EDTA 4QFUA 1CENA 5JIPA 5D9MA 3UESA 2F8QA 1ODUA 1E6SM 3OLIA 1VENA 1RD6A 3D51A 4NSBA 4D6JA 1RPKA 1TQWA 2BXZA 5A6BD 3CZJA 4M1RA 3W53A 4CD8A 2XGBA 4ACZB 3VGDA 3SURA 1EIBA 1ZBWA 4DM2A 4NRSA 1MFVA 5CGTA 3ZSSA 1DEDA 1UA7A 3WH5A 2O9PA 2C7FA 3U5UA 1FOBA 3HMCA 2DH2A 2WKGA 2DIJA 2YFNA 3THDA 1B90A 2WMFA 3CUFA 4P7QA 1HL9A 4MNMA 2XN0A 4PTMA 2VQUA 1W9VA 2ALWA 3W25A 2WZIA 4KMQA 4PTWA 1UR8A 1KGXA 3ARVA 3POHA 4XUYA 3EJRA 4J3UA 4FNTA 1C91A 5CSYA 4CN1A 2DSKA 3PZQA 1U30A 3BLPX 1GQIA 1HJVA 2XVGA 2CCRA 3AMCA 3GXFA 4AC1X 1GNXA 1WO2A 2GDVA 3BUDA 2CEQA 4JCMA 4IISA 3BVWA 4MTVA 3CZEA 1KB3A 5GQBA 2YKKA 3RILA 3MSDA 5A6KA 3VSUA 1CGXA 3PZOA 4D72A 4GKLA 1VJSA 3UG5A 1KTBA 3WUFA 3N04A 3L4VA 1VFMA 2W91A 2WLZA 2RGLA 5A95A 1R75A 1J11A 2A3BA 4UR9A 1HJSA 3OIHA 2YL6A 1HP5A 3WF3A 1LG2A 2GDUA 1UD5A 3TTQA 4ML4A 3BCDA 3IGUA 1NM9A 1H3GA 3CHEA 1GOKA 1NARA 1CPUA 3SCSA 3KL3A 4W7UA 3RDKA 1KGUA 3DECA 4DO6A 4E8CA 1GONA 1MYRA 4ZXLA 1H09A 2WAGA 3UR8A 5CLWA 4UOQA 1W3JA 3BVXA 5C70A 3VIPA 3O2LA 3DHPA 5ABHA 1I1WA 1GOOA 4ACZA 3EJQA 3GXPA 2FH8A 2CETA 3SCPA 3N9KA 1Q6DA 1EOMA 1MQPA 2VC9A 3GBEA 2QHAA 5KEZA 2Y24A 3IJ8A 1UWSA 2VMFA 4IUGA 2YFOA 1E55A 2VZSA 4JZ5A 2VQTA 2J7GA 4MJ4A 3GH4A 1UWTA 3APGA 1UWRA 1CXLA 1E6NA 3A4AA 5A6MA 1PEZA 1LF1A 1E3ZA 4UQEA 1GOWA 2YBTA 2ZUTA 1GZJA 2EBNA 5A2BA 3WN6A 3WMBA 5BYWA 1MXGA 4OIFA 2DT3A 3WH9A 2W61A 3II1A 3MV01 5D8WA 1XCXA 1BYAA 1WDRA 2UY2A 2FH6A 1MFUA 3MKKA 4GI8A 3M07A 3D50A 1XSJA 1QNPA 1FHDA 3ZSTA 1V3IA 1WZLA 4TVUA 1ECEA 2EACA 4JL1A 2D3NA 3NCOA 1AMYA 4LQ1A 3HJEA 2YL9A 2Z1SA 3A21A 5CXPA 3W6LA 1TE1A 4TVDA 3AHYA 2EPKX 2WC3A 1OIMA 3I3EA 3PZ9A 2ZXBA 5FL1A 4FNSA 2E9LA 2VR4A 4GZEA 2FGLA 2WNWA 1B1YA 1JFHA 1G94A 4DWSA 1YQ2A 1SZNA 2F7OA 2YA1A 1OINA 3GDBA 1W9UA 2DT0A 1VEPA 4OKDA 1JF6A 3SUSA 5M3WA 4QCFA 2WB5A 4P7NA 2G3JA 3EDDA 1EQPA 1PX3A 2EQDA 3VDHA 1JD9A 4S3JA 3RJYA 3VMOA 3A5VA 2WW5A 3L4WA 4LYPA 1KR1A 1ZL1A 4M8UA 1BPLB 2F7RA 1TG7A 3OB8A 3WDRA 2VL4A 3UR7A 1MQQA 1ISXA 5BXPA 4HA4A 2XFRA 4WKHA 4PEEA 4U33A 4DUXA 4NZFA 1K9TA 3OLDA 1E0XA 1E4LA 3AROA 2VRJA 2VX5A 3UERA 7CGTA 1QHOA 4J3SA 2YBUA 5E70A 2PWFA 2DT2A 3GH5A 5AYIA 1HJUA 2GSJA 1V0NA 3N17A 5IFTA 2YIHA 1MW0A 4J27A 1HF6A 1J10A
chains in the Genus database with same CATH superfamily
1T40A 2PDUA 1PE1A 2X0YA 1P53A 1NLBH 4JRYB 2VP8A 4RDYA 1NEZG 3J7HA 2L4OA 2EJAA 1EL3A 3T0EC 3GMRB 3WKPA 3OHXB 5MP6H 4QRRA 5DMLA 1BGGA 4CN4A 4QGYA 1RQBA 2Y7QA 2FJHB 1IKOP 2YD2A 1BVNP 4OLXL 1GVOA 2VR6A 1VFAB 4GINA 3ZIYA 1S1RA 5EO9B 3VFUA 3T3ME 3GHBL 1NBQA 3VD3A 3Q2WA 4PAZA 5GNXA 4YDVA 4EACA 4I2XA 4I1RA 2MCPL 1NF0A 2CRZA 4HIBA 3ET9F 6A3HA 3MGTB 3QUXB 1DVZA 3X1GA 4IF2A 4PUKA 1KGWA 4MDIB 1T7WA 1P7QD 4D6FA 4TNFA 5EU3B 4BZ2A 2IPGA 3TA3D 3IV3A 1RJCA 3W22A 3FNDA 3DSNA 4FYRA 3P0YL 5DT1L 1MQRA 5F1SA 1TJHH 4BA0A 3G0SA 4H8UA 4CSTA 4KNUA 1PWLA 3ANUA 5JBDA 1CLZL 3G22A 2JQMA 2VLRE 3GRWH 1IIKA 3BGGA 5I3FA 1EFXA 3QZWA 2JF7A 1OOWA 1FKWA 5CG0A 4CQ8A 3IIXA 1T1ZB 4QXUL 3E0LA 3PNRB 1BM7A 2G5BB 2PR4L 2VDLB 2X4QB 3MUIA 5LZLA 5CZJA 4LOVA 4S1QL 4N6RA 4DK5A 4HJWA 1SUJA 2A38A 5LSMA 3MI2A 2FMNA 4XO6A 3SOTA 2DW6A 3R4RA 3BN9C 3CX2A 2PLKA 2XN9D 4P46B 4J8RA 1SHXA 4L61A 2I9LB 4GO8A 4NM8H 4UMSA 2X30A 1V3LA 2ENPA 2CPUA 1FA2A 1XIFA 5C3LD 3CV1A 1SBSH 4XCYA 5CMAB 1TVNA 3NDZA 5HMFA 1EIXA 2HXUA 2EXWC 3O9WD 3WTTA 3FCUB 4Z1AA 3SCVA 1WV2A 4X6FA 1LE9A 3OX8B 4X7TA 1HO1A 3O11B 3OBEA 3V7AG 1VHCA 3L1FA 4YSTA 1JGEA 3DSFH 5ICXA 1WC7A 3VRJA 1XGUA 4YHYB 3KZPA 2WP3T 3QQ9C 5IP4A 3TA9A 1P0SE 1KJVA 3HI5H 2YJQA 4LSSL 1QQDA 4Y4HD 4M51A 5D7JA 4QAMB 1I45A 4NUWA 3KXFE 1NU5A 2OEJA 1A5AA 5GGRY 4XN4A 4E9QA 3SDCB 4ETQB 5ICYB 1P7HL 2QADD 1J9RA 5GS3A 3SCMD 3SGKA 1G9MH 2XQBH 1TJ0A 3GEFA 4M8QB 5C2BH 2HCVA 2R1YB 2WMPB 3B3BA 4CMMB 2F54E 5HBFA 4JAWA 1UUNA 3VKKA 1OF2A 2UX6A 2X2UA 1NIBA 2WXQA 3KYMB 1D5RA 4BKLA 1QFEA 4HWZA 2PYEE 3LM3A 5BNKA 2VM3A 2XPGB 1FWHC 5JDSB 4ADUA 2IAAC 3MGOB 3G6JF 3MRJB 3QDGA 3MBEC 3QDMD 4FN0A 2HFGL 2WWMC 3IU4H 1IAIM 4NP9A 4B5ZA 4PJIA 2C1PA 3DOSB 4LRIA 4ZAKA 1BMZA 2WWNA 4LALA 2D31B 4NNCA 1U8IA 1V54B 1I9CB 3MRPA 5EOQL 1TPUA 2O9OA 1K3IA 1UYWH 3H9SE 3QQDA 3QRHA 4FC3E 3AS0A 4D7BA 4FG0A 3BE1L 4WZHA 3G04A 5DO8A 2ATKB 1ZNNA 2B2XH 3L3OC 4U3SB 2CERA 1ME7A 5L0QB 3SBPA 4AMAA 1QBAA 1IGTA 4LKXA 3G1SA 1AS8A 3MBEA 4XNMA 3CEUA 3CSYB 5DHXB 4M24A 3KW8A 4A2LA 1AW1A 1EAPB 1XR8B 3D5OF 1F58L 4O0KA 2I1OA 5AAMC 4JFHD 4BSWA 1VQTA 2R0LH 2WHMA 4GUPA 4JRWA 4U3HA 2PXYB 4ZFGH 4AGLA 3DBXA 5EA0H 1G1YA 5JQ6H 4QS5A 4F0LA 5GGVL 3EO9L 4FLRA 2YR3A 1JXFA 2UXVA 1HKIA 3MNWB 4MRCA 1FH7A 3F4CA 1ZIBA 2X05A 3KPSD 3TX4A 2KBGA 2B81A 2VOMA 3GYEA 3PZTA 4IM4A 4LCVA 4YNGA 4ODXB 2ED6A 1RCQA 3R8QA 43C9A 4FF9A 4AQOA 1O94A 4G6JH 2ZQ0A 3IJLA 4PL1A 2X10A 4TUFA 3MUHL 3EA1A 4PCKA 2OKMA 3B04A 4NG3A 4UMBA 3GSNB 5AVQB 2IQ9H 3PF3A 3NOYA 1F2XK 2FDBP 3KDOA 4NLHA 3JVGA 5HI3D 4NZCA 3E5PA 4FZIA 1RV8A 1L9RA 3PP4H 2CKBB 4WIWA 4GIRA 2W07B 4AGOA 3GNMH 1UA3A 4U2YA 4JCWA 1QNQA 1SR0A 1Q0EA 1CECA 1CMOA 5TFSL 4IP7A 4YTUA 5T1DL 4HNCA 3U9UA 1MFDL 1TQTA 3T2NL 4IGMA 3FQ4A 1PCXA 2WZPA 2AI0H 4I1PA 2OCZA 1Y0LB 2MCG1 1PNDA 3ARFB 4ORGA 4C4KO 1CDIA 1ICQA 2QF8A 1M5WA 2W9EL 2Z31C 4MD4B 3KBPA 3RJXA 3QTGA 1K7EA 1KSRA 2V5DA 3T0DA 1OT4A 1NIEA 2BHUA 2ZG1A 3C8FA 5I19L 3TO2B 2NXZB 3ICJA 4H8QA 3VAVA 1ECYA 1I1RA 3MCKA 3RX8A 4MLIA 1EXBA 2FZDA 2I5GA 1VSCA 4TTDD 3OPZL 3DTXB 2YUZA 5ABAA 4AENB 4EI6A 5IEKA 2ZXQA 4PY8J 5JUEH 1A6WL 4HEME 2G4GA 3R10A 3D4YA 3GJEB 4OU3A 3HUJF 4Q9RL 1BLNA 4ODVH 1QI0A 1S4IA 3BP4B 3O6LL 3CPLB 1HL8A 4GNKB 1W1B1 2CHRA 1I7TA 4WKAA 1URIA 1MI5E 2WYZA 2OZ4H 4LIQL 3A9IA 4YLQT 1LLAA 1ME9A 3ARFA 4HU8A 4AHPA 2NY1C 2VDRB 4I13B 2O55A 1BD2D 3TURA 1YQVH 3MHFA 5GJSL 4A8LA 1XKYA 4B5NA 3AITA 2J25A 4QXVA 1F5ZA 1RVKA 3IK2A 2AV7A 3FF7A 2PDFA 4PREA 3DVNA 4HBKA 1FHGA 3A3YB 1JVNA 4LU5H 3G1VA 2IXUA 4MJJA 1ZLVH 2E9BA 5GJTH 2OYKA 3VSVA 4C56B 1A4LA 3GE7A 2GJ6D 4MFEA 4MCZA 1FSKB 4QRPA 5IWLA 1TIUA 5H2BB 2D7PA 1RFDH 4P59L 5HHNA 2ZZ3A 5D1QD 4JPQA 3VD5A 3BUYA 4XNZB 3E2HB 4BZ2L 3PAJA 1CC3A 3WL0A 4KEZA 3FN9A 2HT3D 4G59C 1F3JB 1F97A 5LG1A 1UR4A 2Y07H 1UIOA 5AFDA 2GVGA 4XBJA 1RZGA 2ZWZA 4Q4EA 3QUZB 4XVJL 3NXFA 5IMKB 1XRVA 1K85A 3H2AA 3GIZL 2YPVL 4M81A 1KV8A 2Y6SC 2KZBA 3B5TA 2BMBA 1V7AA 3P0YH 3AIBA 3UPWA 3UVAA 3QWQB 3H7BB 4ES8A 3NWRA 4B50A 9RUBA 4LCYA 4P2AA 4P5SA 4W9EC 1LL4A 5KSBA 1IU1A 2R2HB 3N43F 5KVEH 4M4RA 1QPPA 1PZSA 4Q8OA 3IJYB 4LQFL 1JXKA 3B37A 1IR1A 5KW9L 3IMRA 5IVXA 3DURB 3O0KA 2A5UA 4S1QH 1PKMA 1KTDA 4FX8A 5I78A 3LI1A 3ESVF 3WOVA 3DGGB 2AK1H 4KRNA 1J1PH 4QSHA 4OCRH 2WQVA 5AVRB 5GGUA 1YPZA 1CI5A 4CNUA 1VGEL 3VCRA 3QLDA 1CR9L 4RAVB 3QYNA 2HE8A 1EGJH 3EJTA 3QW3A 4YWIA 1LP9B 3AUOA 2J13A 2VL5B 5M03A 1DLFL 2W27A 2BJMH 4YHEA 5FJJA 4G42B 3BP6A 2DUZA 1XG4A 4Z2HA 1XMWA 2DI9A 1SO4A 1YPIA 2NX9A 4IXHA 2G5WA 5A6AA 3VXPB 1VZHA 2QPDB 3DSNB 1F73A 3WEAA 4DYEA 4Z23A 2VM4A 2O5ZL 4UZGA 2BV9A 4RH4A 3N4EA 3SDAB 5IDZA 5IOBA 2DL2A 3M0YA 4OLZL 1A4CA 1E6ZA 2B8OT 2HT4D 1YXCA 4AQ8C 3SQSA 2AABL 4KVNL 1QTPA 4N9OB 2C0AA 4C6FA 1MMFA 3DGGA 1YE4A 3MSPA 5D2LE 3BAWA 4F7TA 1BYCA 1TVDA 2O72A 1D8CA 1JUBA 1Q5MA 2XX0A 1G7VA 3EOOA 1RR2A 1TPXB 4HXAH 2OOGA 3EDKA 4QG9A 1J5DA 3BWUC 3LHUA 2X1SA 1R3IL 1HCFX 3LLFA 4IIGA 3U2EA 5L4JA 1NGYB 1XG3A 3DETD 1P7QB 5AVWB 1FWJC 2R8WA 3MWAA 3DFQA 2A3LA 5DCBA 4JM0A 1NIAA 1NCHA 5IESL 4GRMB 3F5WA 3WMLA 1WCBB 1QG3A 4MSSA 4BS0A 4TNWF 3F7QA 1INQB 3A6OA 2N59A 4MHHI 2HK0A 3VX0A 1ADQA 2YW3A 4U1SB 4WX2A 1FWGC 5DUML 1LP9A 3V5HA 1AD4A 1IQWL 2AJYL 1L9OA 1OQOA 3O8XD 5K69A 4C65A 1EANA 2WLMA 5LG6A 3VI4A 4GP5B 4OCXL 4Y2NA 5C8JA 1FLRH 3II3A 1M7JA 1OL0A 3FTZA 4NIRA 3HG1E 3RPDA 1N7KA 3RX2A 4QXTA 3H55A 4G6ML 2EZ0D 3EFOB 1P7BA 1XB8A 3QCUH 1QBLH 5T1LA 4UT6L 4M6OL 5ADOL 2J77A 1JNNL 3OQ3B 1DQML 1ITCA 5DURB 4V1DE 5EB9A 4JN2A 4LGRB 1AG1O 2J78A 3V4BA 1X8FA 2XT1B 2E40A 4HIJB 4IQEA 2AQ2A 3SQMA 1U3HA 4OZFA 2VCBA 4BI7A 5D04C 1C08A 1U33A 3L5MA 2YAPA 4ZFOB 4J3ZA 5KYYB 3HUJA 5HWNA 3W7MA 5I07A 2GVYA 5J1AA 1LQ2A 2QCLA 2X1IA 4UIKL 1T66D 1U6AH 3LYRA 1E51A 1HT6A 3G08B 2ZG2A 1V6WA 1BFOA 5C0RH 4JDEA 1G6RB 4PQXA 3BUVA 3RU8X 5AC8A 1SZGA 1OGAB 4G6CA 4IJBA 1XGDA 1FVCA 1MIML 2WLKA 3H21A 4AWUA 4U1IA 2PDBA 3DAQA 2NY0C 3KJ4B 1FFTB 1I8JA 1D7FA 1FNAA 5HQLA 3V0SA 2GJPA 4IMKC 2EXSA 3RUGA 4DP5X 4WUIA 5BQ7A 3U2SA 3OYZA 3E49A 2VAAB 3P3YA 2FZ8A 3G5XA 3Q8BA 4H26A 4XPHH 2YPKB 1SVZA 2JBMA 5DZJA 3PV7A 5EU5A 2W65A 2WZEA 3R2GA 4K7PH 2ZCHL 2XGIA 3MZTA 1Q9KA 2BWQA 1IBFA 3WLHA 3RX4A 4Z18A 2QAPA 2Z6JA 3QZMA 5EO0A 4HCHA 2LVCA 2VJXA 5IW1A 4H19A 1VACB 4OLUL 2GJLA 1BM3L 1NEZB 3PQYA 4JFDD 4UQAA 5C0BA 5J6GA 5MKGA 5HI4D 3NRQA 4HHWA 4GRWB 3TCSA 2Y61A 1BF2A 3NJ3A 4J1UA 5F1IA 4TSCH 5KAQF 2P10A 2JIXB 2B1HH 3MROA 4OD3H 1WWCA 3V18A 4S11A 2B31A 3U0PB 4JIIX 1DPMA 4L48A 1GYVA 3V7AE 2JI1A 3HE6A 2NY7H 3RY6A 1RZ8A 1UB6A 2DZTA 2PAJA 3G1XA 4GMSL 6FABH 4YDKL 4HS8H 1AQDB 4GB9A 3I6TA 4Q8UA 4GVIA 1YDVA 3RIAK 3SRHA 4DQWA 2GC4C 4PJ7A 3JR2A 3T6WA 2Z31A 1PS9A 5JHAA 1JZ4A 2VSKB 5A8OA 1JBJA 3BX7C 8RUCA 3AHXA 3Q5TA 4BIKA 2P0IA 1C8VA 2EDWA 3QY6A 4DF0A 2XIBA 5C0AA 3GYRA 1BFVL 1TWSA 4JPWH 4D0BB 2WJZA 1S8DA 4FFYH 3U36A 2VKXA 4PWEA 2PCQA 2Y36L 4M7KL 4QWWC 4JIPA 4Z7NF 1S5IH 3Q8FA 4QF1A 5IB3A 5FLVA 2OXNA 1UQYA 5CM1A 4WK2B 2F1AA 1JCJA 2YQGA 5EZIH 4ZXBA 2GPTA 2DJUA 4E4PA 1RY7B 4OZGF 3ZDYF 4WRHA 4YZFE 5I9QC 4OLYH 4JTUA 3MKVA 5FSEC 4PVLA 3ROOB 3T2OA 1NP2A 4HHHA 4HJUA 4CNPA 2BX7A 3FEQA 1V6TA 1OC6A 1E67A 4PMEA 4JE4B 3X3GH 4BKTC 5HGHB 2FE0A 5FM8A 3U6RA 2O6PA 3AC0A 3OF6A 3KX6A 3MLRH 4KI1A 3VOJA 3C60A 4KI5C 1XIEA 3WBXA 1PVHA 4LEEA 4HG4K 2PDPA 3EB2A 2ADYA 3WLLA 4E4FA 1KRBC 4Q8TA 3L3DB 5KBDA 2OFQA 3V0EA 4NGHL 4L4VD 4PLJC 3BD4A 3MA8A 1LO2H 3B6SA 1T96A 5J6SA 4WK0B 1FDLL 2A73B 3PFQA 3JZYA 4EN2A 3SDCA 4MGGA 1KBVA 1T83A 3QAZC 4MJIE 4RMTA 1QCWA 1ZLVK 2E56A 2VC7A 3GSUA 3R4DA 4LVOC 4AEFA 1J8HE 1NKOA 3CFJB 5FYKL 3TBTB 5DJ8A 3K4DA 5J56B 3PUEA 1MW2A 3D0VB 4UOJA 4PJCF 2P5WA 3UPAA 3R1GL 3MLXH 5DRXA 1T1XA 3DX7A 3IT8D 2CDFA 2Z92B 4FQXA 4NKOB 2YZ1A 4NM4H 2IBBA 5EUOB 1LBLA 1VKFA 4RNRA 2X1TA 5M1TA 2F8VA 3FO0H 2BIHA 4U6XB 3IGAA 5CZTA 2VZUA 4RGNB 4Q8QA 3EDFA 1GGCL 4WWPA 4HK5A 3GHEH 2XWCA 4F9PA 1KTDB 1PG7H 5GZOD 3LKQB 4NC1C 2GJNA 2K8MA 4HH9B 3U7WH 1FGNL 1S2TA 3TN3A 3AS2A 4BCYA 1W1ZA 3EH4B 3NL3A 3B2UC 3QK0A 5KTLA 5AVSB 4FXKC 3TJ4A 3KLAA 2V2XA 3ZMRA 5FOOA 1BP3B 1XDMA 1LDPL 4JFQA 5KJRH 2HH0H 1W1PA 3WQ5A 4AD0A 5H35A 3KPPB 2DVUA 3TN0C 2XZAL 4HC1L 4KRPB 5BRBA 5LXEA 4M43H 1IZJA 4HYRA 1OP9A 2B9AA 2ZYSA 1EJXC 1XQLA 3M47A 3TYAA 3R8RA 3WLWD 4NJAL 4LSRL 2BH0A 4PJ8B 2GUYA 1JPGB 1ISVA 2PD5A 3THMH 5F2LA 1AVAA 4W9IC 4X5XA 2YXMA 3PHOA 1PSKH 4FQ2L 3D52A 4J3XA 5KOMC 4QCIB 4ZMTA 1FWBC 1GRWA 2W0PA 3BPLB 2BASA 2UY4A 4AWEA 3OKLB 4ONVA 3N44B 4R7JA 4Y5XB 1HHHA 2Q8ZA 2DDQL 3VFNB 3WKML 4P8WA 5I71B 5BVPH 4NYYA 4PJGE 4KS0A 3KOZA 3JUYA 1NMBL 3CQJA 2ZYHA 5A2JH 1QNZH 2KZ1B 3VA6A 2VOTA 4UQDA 5FM5O 2FZNA 5AQ0A 4ZR8A 2OMTB 4PRID 4XWOC 5LCVA 1ZHKB 3CPRA 3UZEA 3BDXA 1LD9B 3KLAB 5FECA 2YJLA 5LQBH 3TF7C 1NFPA 2YXVA 1RMFL 5HSFA 1HH6A 1TYEB 5DJXA 2MH4A 2J8GA 2HISA 2VDKB 3U4BL 1H7PA 4X2UA 2Z35B 4OFDA 5B1BB 2WBJA 4A7GF 5BS0B 4JHAH 4JTIA 2YSSA 3BT0A 3VFGH 4DGIL 4PTNA 1XTLA 1V08A 3NJXA 3L3IA 2PBOA 5HJGA 1WS7A 3VAEA 3NG5A 3AZSA 1UENA 3IMBA 2FIRT 1KDIA 4W87A 2R1WA 3DUHA 3MXVL 4NYLB 1KKRA 3NFPB 3BSZA 4DK6A 4N2FA 2QELA 1T4WA 5KBKA 1K2DA 3K6OA 1DJXA 5C08D 4Y9AA 3HNVH 1T5XB 1A6TB 2OMVA 4Z2LA 1JUKA 3IS4A 4AZBA 3PE9A 5D7JD 4F9LA 4YTRA 5D7LB 1F6LL 2GIMA 1A9VA 1EBAA 4K3DL 2OLHA 2C3ZA 3O6MH 5E2UL 2QQLH 5GZND 3QRGL 3O63A 4K3JH 3L6FA 3NDOA 5EB8A 2G37A 4TMBA 3H7RA 2PB1A 4Z1DA 4ZK8A 3RWDA 2CBTA 1TJIL 5I5MA 3SBQA 1I9EA 1R47A 1KCVH 3NFPA 4DP6X 3WNMA 3H1ZA 2G75B 3T6QC 5MEPB 1SM9A 2A0NA 2XYLA 2DKMA 1NGWA 5FHAH 3CAKA 3VFTA 3K5XA 3MUAA 4C1NB 4HZ6A 3X3FL 1PMYA 3A6CL 1GZ1A 5EBUA 2E6AA 4UMAA 4DJFD 4NC1E 2W94A 1PO9A 1R7OA 3NQ6A 2CR3A 1AKJB 1S7TB 5I1HL 3DK0A 1MFBL 1DUZA 1JV5A 1TTRA 2GBUA 3HE7D 4PEKA 5F3BA 3LB0A 3AABA 2ETWA 2X41A 4B5XA 4N25A 3GXUB 1UZ6F 1FG2B 2RALA 4IOIB 2ENJA 1ORSA 5K9DA 4UT6A 1EFXD 4UOW1 3D0AA 2NV9A 1N6VA 4NZ3A 1MJJB 5T8IA 4IG2B 4PD4J 3DUUB 4OKVA 2GLKA 4XTDA 5MEPA 1J87A 5A16A 3FO9B 1JTPA 3AXIA 5HQMA 5LWYL 4TULL 5JQ9A 1IGIL 4O1AA 3HE7B 5I76A 1QOQA 4RIRA 2E8ZA 5EZIL 1JYXA 1QEXA 1PLGH 2XPYA 4U1NB 5A2AA 1TX0A 4IIZA 4MZYA 4QLLA 3GM0A 4AG4L 3IKCA 3ZK0A 1VLIA 5FSDC 4FTVA 2ZTKA 1A5FH 1SY6H 3NYDA 1FORH 3D25B 5H35B 2ZCZA 5DZ9A 5LCVH 1S8DB 1ZCOA 3EPNA 4LPCA 1HP4A 1D9EA 2YC1A 4KKCC 4OZHF 2RGSA 5CGYC 3SGUA 3JTBA 5IM7B 2PPAA 3MJWA 1UJ3A 2XQYK 2WJDA 3PFMA 3P2BA 1CGSL 1W80A 2AK1L 4QHMA 3DX0A 1XF0A 3MOAH 1ACYH 8TIMA 2ZADA 5EZJA 3K6DA 4R96A 3BT2H 1NLDL 3JV4A 4MBOA 1JZ8A 1UBSA 4LLYA 4JJ5B 3L2LA 1MNZA 2G41A 4IJRA 1KBIA 1FVEB 1QRNE 3BPCA 4K7FB 2HVJB 1DJWA 4P5RA 1S5WA 2G60H 1SOSA 3VGGA 4MLJA 2GL5A 4Q4QA 4U31A 3SUUA 1VZGA 1E8WA 2B4GA 3MJ9L 1LCOA 3O4LE 1PG7W 1NUNB 3GSOA 4Z7QE 2NY6C 1XH1A 1U5JA 3EWWA 1J0YA 1SGKA 1P1XA 1QJWA 3UXAA 1QW9A 3RBSA 4R7VA 1GVQA 1FFRA 5ABFA 1NAMH 2BC4B 1PZ5A 2IOMA 4JO4H 1FX6A 2P8MB 3WFAA 3MI6A 5F2MA 7REQB 1XSKA 4JO5A 3ZTCC 1ALDA 3VKAA 2QPFA 5I6PA 2DLHA 1JZ2A 3T6XA 1A7OL 3LK6A 3M17A 1NCUA 3KDPB 3UYRH 2MANA 4CNOA 3D25A 3V0WL 2IUZA 3BG9A 4W9LC 4I9WE 5EIVA 4XZNX 3T9PA 2BO0A 3EYQC 1GGIL 3T05A 4JG0L 3RPMA 4WY0B 3AT8A 3FTXA 5B8CB 3B3DA 1OAXH 4JFEA 4XVSL 4HCFA 1G0XA 2VERA 4UV4L 4K5NA 4GX8A 1UZ8B 1ZVSA 1FZOA 4KXDA 3LGDA 1B9ZA 3FNKA 3HB3D 2OQLA 4LIQE 3TYEA 1SQMA 2ARJB 2ZD0A 4Q3MA 2K7PA 5FKAB 4Q4PA 4LFHD 4R83A 3WI9A 2CM6A 1A3HA 2DN7A 3R58A 2VXSH 4EVZA 4JVUA 1QA9A 1A6ZA 2Z4QB 1H5YA 4EF8A 1A4JA 4OF8A 1A3XA 2IJ0C 2FDSA 2H9AA 4F2BA 3RNKB 2QR0A 4L3CA 4DVOA 4ONGH 1P69B 2CO1A 2XLLA 3EOAB 5C07B 4YHNB 1M68A 3UWEA 1QVOB 3S37H 4EI5C 2X1PA 1EDYA 2IBZY 1PY9A 5DD6B 1N8IA 1NY1A 2J7CA 1NUDA 3EYOB 5JR1H 4JYDA 1UUOA 2IO5A 1OG6A 3RCMA 4KEUA 3VGAC 3MJ8B 1FV1A 1JDAA 4BRJA 3MBXL 5IV2B 4EIBA 3CQKA 5D5MB 3TN0A 3NPWA 1W0YT 4P23C 4DZBB 2G4JA 1WE5A 3TBSB 4UAOC 5KVGL 4JFDB 4QO1B 4EN3B 1LORA 1KA9F 5IFHL 1N82A 3BHBA 4Q6YA 3WKQA 2AQQA 4GBXD 2XJLA 4GIEA 1DQXA 3L3JB 5LIKX 4JFFD 4M29A 3BYTA 1PQZB 2JKEA 4JTTA 1GOFA 2DKUA 2EDNA 2L7EA 1UUSA 3P2DA 1LL7A 2AGJL 2OJEB 4CQCA 3WNLA 4FQIH 4IIQA 4R2GC 4XO3A 3CAQA 1KEMH 1L8PA 2Q3OA 2QQNH 3MBWB 2VDQH 2KKQA 1IB5A 1FNEA 3NA9H 2PDJA 1UT2A 2Y7DA 2WBJD 3CSBA 3DX9B 3FRPA 5F2FA 1U8LA 4ALAC 3DX6B 4ZNEE 3F5KA 3D47A 3HGJA 4XPHL 1P5BA 1FVDA 1SUHA 5I3JA 4J1UB 5F1IB 3E80A 4ZJ9A 4GMTH 1RZ7H 4L4JA 5I8OL 2OK0L 3M5YA 2GSGB 3MLSH 5JHBA 1AL7A 3LQLA 2VXVL 4HWBH 1NMCC 3O6LH 2COQA 1BYOA 3WEXB 4MX7A 3RWHA 3UMNA 1FZJB 3OXRA 3SKOA 3NM1A 4RRPG 3SHSA 1UPMB 4FA3A 3UWYA 3RRXA 3OG4B 4DUVA 4J3OG 4UAHA 5C71A 4UB9A 2BY3A 4JDTH 3PDGA 1AO7E 4D3CH 5KZCB 1B31A 5T9CE 4CD6A 4MXWL 4XH2A 1YNTF 4X5WB 4FXTA 2AJ3A 1OXYA 5TK2A 4B60A 1GG0A 3AICA 3LCLA 2PLCA 2AJZB 3NCJL 4NVTA 1N6QL 1PIGA 2WWMD 3K0WA 3BK0A 1HILB 2OBGA 4RJEA 4KROD 5ICZB 1T21B 2X4TB 5HVFB 2AKZA 4Q4OA 3VZYA 2FX7L 4HBCH 5IB3B 4LKCB 5J6HB 1L2UA 2ZTJA 5HWMA 1F6KA 4AJVA 1ASQA 3QPQD 4FQXC 1K6QL 4UT9L 5EORL 5IMKA 4V1XA 3UA4A 2BHYA 2NUTB 3SDXE 3KM1A 5I73C 1FNSH 2F54A 4JMXA 3QOMA 3MP4A 3MCYA 1G0YR 1W5OA 2HFEB 4LB8A 4OQTA 4HIJA 4NENB 4HIIA 2ENQA 4NNXA 3KVLA 3W7PA 1HXYA 2J20A 1X4XA 1AXTH 2G8ZA 3S0CA 1C1EL 4F15B 3L12A 3TJXA 3KNBA 3NZRA 4HIPA 3VB9A 4FQJH 3FB5A 1FBAA 4AZIA 4D8LA 3SUTA 4WU7B 4Z3GA 3SCMB 3C5ZC 4GX9A 1VF8A 3N13A 4ZBCA 3UTQA 4PY8I 1FL6A 3NABL 2TODA 1CNVA 1GPFA 1ETZA 1FO0H 1S5TA 2DMBA 3FU7B 4H9MA 1QWNA 2DQHH 4FJ6A 3KWWB 2EPOA 3AHZA 3NTCL 3LKSB 2VR7A 1PJ9A 4LPTA 3DFSA 3RHGA 2YYUA 3BUBA 2QPEB 4KKRA 2XSKA 3BH9B 3DHFA 3OIXA 2BMKA 3WDHA 1E9YB 4B5TA 2RJHA 1O60A 1FJ1A 2P5WD 3W73A 2LOEA 4TXEA 4TL5A 3DV4B 1A3LH 2EP6A 3RZCB 1SBSL 1J1OH 4AVIA 3ITCA 4DZ8A 3AGWA 2ZP0T 2Y7GA 3T65A 4AVNA 2EILB 2MSPA 1T0NB 1OGAD 4HWUA 3VK5A 2J88A 2QCCA 3GC5A 2ZXDA 4J4KA 1EH9A 5K9OA 4WDUA 5IBTH 3G1HA 3F62A 1DQWA 3GZPA 4R33A 3FFCB 4HKZA 2UVEA 1TZIB 2OJZL 3TL5A 3MA7B 4H5SB 1UQZA 4GLRH 3MRDA 3CYJA 5BRPA 4F2MA 1JZDC 1EUUA 1TZHA 2IDFA 1UR3M 2AP2A 4N0CC 5C0FA 1X9QA 1K4HA 2NWRA 3DIDA 3DX3A 2FB3A 3HQPA 1FL6B 4XOEA 4CVUA 5D5MA 3TN0B 2DWYA 3F4WA 3LZ5A 2R0ZL 2VDOL 2O56A 4DP0X 1RZJL 5F6HJ 5CCKL 2BOEX 2SEBA 3VABA 4L4VE 2VDLH 2ACSA 3FFCD 2G3XA 4E5XG 1A21A 1KFAL 5B7FA 1EXHA 2PTXA 4XBPB 4KWVA 3UP8A 3QORA 3S48A 3RB5A 4GQQA 4LBEB 5ISZA 1RLBA 4YSOA 2VDIA 4Q2ZA 1FJ1B 2CHXA 2BZCA 1WTLA 4DM1A 2CMRH 3ZVHA 3IDYB 4AGNA 2HWZH 4ENED 3QQ3B 4OQ1A 4MHBA 4DLMA 3GY1A 2A83A 3W4RA 2E47A 1OK8A 3UJIL 4A7TA 1OTUD 4B6ZA 2AK4B 5GGVH 5M95B 1KM1A 1MFCL 2F15A 2YCJA 3B03A 4H4IA 1MVUA 3ME0A 3B8TA 4Q8PA 3JTTA 1Z5LA 1OX6A 2G3IA 4M4RB 3MS8A 4WWKD 3UBXA 5G4EA 1W72H 1UH4A 2DZBA 4L05A 4PJ9A 3M1ZA 3ARDC 3VIKA 4URIA 4DWSD 1RHHA 3ESMA 4D94A 1YADA 3NIFF 2F6AA 3OJGA 1O6SA 2WZ6A 3QPZA 1W32A 5AUMB 4MY1A 4CEUC 3NZ8B 3Q6FB 1IEWA 1CT8A 2JEPA 1YEJL 1MJ7L 4EI5D 2D9CA 3W81A 3LTVA 1H1NA 4PJ9C 4AE1A 5T1DH 3IDIB 3ABQA 3T1FA 4D8PA 8XIAA 1WBXB 5DJ0A 3ZHNA 4HVBA 2QV4A 4M3KB 5U4NA 1BBJB 3S3CB 4FX7A 4LJ3A 4RAUB 4L9DA 3B8IA 5BXRA 3BIBX 4TSAH 5GPRA 4OJFL 2PPEA 3CU1A 4JOMA 5IY5B 1U1JA 5ICYA 3MQIA 5C2UB 3BISA 4GNJA 5HYFA 1YEWA 5F7KC 4RETB 4RX0A 1OAUH 2C1PB 2HLAA 4JFEE 4L8BA 2X3CA 4OW6A 4XBEH 5CIPH 2GABA 1RUPH 4NO2B 2R2BB 5TDPA 3LHYA 3O1NA 3OPSA 1DYSA 4M4PA 3FQRB 4YU1A 1OO2A 2OTWB 4JAMA 1OM3H 4LUSB 4DJFC 1RZKL 3ZT6A 1FIGL 4WI6A 4EI5A 5CSUA 1EF2A 4DKDC 1E40A 1WA2X 1JVKA 1M3IA 3LQZB 3QFJD 5AYQA 2VLMD 1ACZA 1I6NA 3BWUF 4E2OA 2BOFX 5IVXF 3TOYA 4JY8A 4F2TA 4IBWA 3QC6X 4OLUH 1ZOXA 5DA0B 2EEFA 5BZZA 4BFIA 2VLRA 2OAAA 1Q6CA 5E8EB 1R3QA 2XINA 3NVDA 1C7SA 1Y5XA 2Y5QA 1RHHB 3JWNH 2PYED 3HA0A 3MP5A 4PJ9D 5KSAB 4IBLT 2NLYA 2JQAA 4L9XA 1OD8A 2B1HL 3DX1A 3ZE1E 4Z95H 1O4UA 3VXRE 4W84A 2YQBA 2MPAH 4JN2B 3ELQA 3EYUL 3FTYA 3MBWA 4PWIA 1X38A 2C15A 1CE1L 1QI3A 2Q7AA 2CO7A 3S36L 3WCYA 1QDSA 4FI4A 2J6XA 6FABL 3MA9H 3OZ9H 3AU1B 1P4IH 1YPFA 5JH2A 4B53A 3GNDA 1HKJA 1AYOA 2F5AL 4D3CL 2E5EA 1XF5B 1PQZA 4ZOCA 4FNRA 4Q6IB 4K3EH 3PL6D 4KQ3L 4DWSB 4MNQA 1YYML 5AW4B 1YY9D 1K9EA 3D2TA 1NSNH 3CEPA 5ISZD 4D6DA 3QFDB 3UA3A 2D9QB 4TOYH 4J3TA 5ICUA 3TZVA 3W85A 1A1MB 1SMAA 3FC8A 2XKNB 3VD1A 1T6MA 1OP3H 2X3AA 4Q7NA 2XPZA 4X2PA 1TJHL 3QJRB 2BOBA 4I5UA 1S5NA 1DZ0A 4N85A 5CPSA 4KZEL 4QRFA 3HOGA 3WIJA 1J0KA 2ZUWA 3LQZA 2DPEA 2QZ5A 3NFNB 2WVTA 5JHLH 3EMCA 4P7OA 1U8HB 2J71A 1AXTL 5IQLA 3QHTC 1ONXA 4X6EA 4US6A 4KK5D 4BSVA 4KV5E 4Z7VA 4CA4A 2HDJA 4PU2A 5I79A 4J5VA 1ET5A 4NI8A 4N4YB 1E28A 4YO0B 4POYA 3SFKA 1ADQL 3PWPD 4NUGL 2V5MA 4TM9A 4BCEA 2CALA 1ZAHA 2SEBB 1BWVA 4QHNA 3ARQA 1H4PA 3TNOA 1X97A 5MHBA 4IBVA 4JTAA 3Q1EA 2EDKA 4GQPH 4M8QA 4V11A 1OFRA 2N1TE 3DMMA 5EYWA 4YDZA 1UM6H 1AFVL 3QSTA 1B4LA 1YUHA 4H7CA 5DJZB 2EVFA 2YCEA 2PP9A 4G6FD 2ILLA 1I1FA 2N1KA 3AG4B 2DLFH 4FXLA 1ZBCA 2XH0A 1IC1A 3TO2A 2XZQH 1UEMA 4HWZB 1R3SA 4QNPF 4S1RH 4V1DB 3MVTA 4YE4L 4X80H 3SI9A 4M9OA 4YFDB 5CU9A 1B0WA 3R11A 1BZQK 4HGXA 3HG0A 3ABMB 3PYCA 3FOMB 5KANG 2WXDM 1NAL1 1NGQL 7PTDA 1I7TB 3T44A 2GFTA 4OJYA 5E99H 4V28A 3QULA 4FSAA 5K9KB 4OTKA 3KLLA 5A8QA 2O7SA 3K2IA 3GBMH 1MRCL 1M1XA 3FYEB 3H42L 2ZBTA 1KFCA 3QWNA 3SYCA 3M1OA 1XGRB 4BZ1H 2Z1XA 4MQ7A 5C7XL 4WI7A 4W8LA 1W0VB 1R3IH 4PJBE 4N90D 1XLGA 4QSFA 3BKJL 3TYCA 2QSCL 1G4MA 4LLAA 5CS7A 4ZZKA 2KDYA 2PDCA 5DYOA 2OTPA 1GVYA 1VPQA 3B9NA 1MCOH 4NQXB 5CFAA 4DN1A 3KWWA 2XY2A 1XAKA 1MHCA 5D7KD 5HDQH 3RPBA 3X1BA 3T3PE 1A5MC 1BG4A 3UIYA 4XWUA 4ZMPA 1OB0A 2BVYA 4JFYA 1D2PA 3KZ8A 1P6CA 2YN3A 3NP3A 4RISL 4C6CA 4MZRA 3QXAA 1E6OH 2HRGA 1ORSB 4QTHB 3VXMD 4ONHA 2PC4A 3WLKX 3MV8E 3R8BB 2AEOA 3CH8A 1BXCA 1Y5WA 3UJRA 2NQ3A 2GJ6A 2YB4A 2EH8H 4M6OH 5ADOH 1TTIA 3QI9B 3H6OA 4QM1A 4PWKA 3JRKA 3H24A 3W1TA 2W9DL 4ZG1A 3LTPA 4JEQA 4O4YL 1X5AA 2V6HA 1FLRL 3KPQA 1REQB 2AMXA 1J05B 2W62A 5DRNB 2KAUC 1P4LA 3QJSB 4AZ8A 5INCB 2QULA 1E9PB 3SDDA 3AI0A 5AD0A 2BSRA 1GT8A 1CLOL 4S1DD 4F8LA 4BGDA 1POJA 4G6FB 3ABGA 2OMYA 4H0HB 3OVRA 4BFFA 5A3HA 3WEZA 3I2CL 3MHGA 3EGSA 4HSHA 1LLWA 1EUAA 2VLKE 3WD3A 3V1HA 5EBMB 2KZHA 1NMAL 2CXGA 3V52H 4W5UA 3DROB 1SYSA 3TVMC 3RM4A 1C93A 4DI8A 2HMCA 1KCSH 4KXBA 4HCIA 4WXZA 4PUWA 3N50A 1Z7JA 4JJ5A 4HH9A 1RJRA 3TSDA 3VFWB 4POZC 4R3SA 5TQ2L 3W0WE 2P3YA 4XIAA 3V4PH 2Z91A 3WMQA 4F7PB 1UTDA 1O7VA 2YGOA 3OBKA 1J0HA 5D1ZD 4U6XA 3PNWA 3KJ6H 3ZKMC 3AXHA 1F90L 3D9AL 3JT2A 2R1PA 1GW1A 2FVKA 2V3DA 2G0WA 2Y7QB 3MLYH 5DYFA 3RMEA 3EBGA 2RB8A 3LXAA 4JCLA 4N0RA 1TETL 1WAWA 3A24A 4PJAF 3HPSA 3FULA 3ULUC 3U4AA 4HU2A 3GI8L 4RGND 3C8NA 4LZKA 1S9XA 3CFEA 2OSXA 5E6UB 3DXAA 3TN0D 5B38B 2QT3A 4R27A 4B3LA 1CYGA 1I82A 5AKRA 3U1SH 2XVPA 4GH1A 3BWSA 3BG5A 4PJEE 3PREA 3EYFA 2CZDA 1XBYA 4EBQH 4N8PA 3SCUA 1FWIC 3IU3A 4L3ED 5C07E 5TH2B 1VEMA 5I6XB 4HPGA 1R5IA 5DSCB 4N5ED 2VCCA 3ZJ7A 2X70A 3P2VA 3CWHA 3AFLA 1KCKA 1WBYB 4PJ5E 3TBSA 2NXZC 1OX4A 4FERA 1FZMB 1OANA 4MJ5A 4JM2B 5FAAA 2HJKA 2OYPA 2EC9T 2ZIDA 3O15A 1A47A 5LXGH 2R4RL 5ADPL 1UOWA 4JFZL 1T7YA 2NUWA 1E6JH 5LGHL 3A4WA 1G67A 3LV3B 1TCRA 1YPZE 3KL0A 4NKQB 4W9GC 3EZ8A 5HY9A 5I8CB 1JYNA 1R0MA 1KGCE 3MNWA 5HGAB 2F7IA 1RZIA 3ZX1A 4A6YA 3CL6A 2HAZA 3M44A 4PUUA 2XN2A 1X7QB 1HSAB 3HIZA 5D9SB 2GUBA 2HT2D 4ZE4A 1SOKA 1C5CH 1BVKB 4AJ0A 1WDPA 3BICA 3DRTA 3ESPA 4JFOA 1IX2A 1BXNA 1OFOA 2Y5EA 3Q43A 3PN8A 3ZLFA 1WBYA 4OGXH 5L6YL 2AL1A 4ALAH 1MF2H 5KSBE 4L0YA 3SDYL 3L2NA 4JKLA 5F7DB 1QWUA 5EMMA 4G6KL 2CO2A 4HCDA 4MMZC 1SVDA 5F9OH 3EYFB 2ZRUA 2C7UA 2YPLB 1M7PA 3ONCA 4RFEB 4Y1TA 2V5RA 1AAJA 1A3ZA 1PAZA 1YG9A 2CJ3A 2F74A 4TRPL 5D7IF 1LP6A 1R7AA 4WJXA 1EXPA 4FB7A 2CIKB 4ZYKA 3GIQA 3BW9B 5AENA 2W5FA 3G1AA 1BQKA 4PUEA 5I09A 4WW1A 5AOKA 1NEZA 3PQYB 5J6GB 4AJWA 1XLKA 4J7RA 4RA3A 1VBHA 1BZ9A 3K80A 3N55A 1AO7B 3I9IA 1KEGH 1IO4C 1JPST 1E70M 1FXQA 1TV2A 4JS7A 1XICA 3WFEH 5CP7B 1OF2B 3RAOA 3Q44A 5CP3H 3MOAL 4GWEA 4HUWB 4M7ZB 4PYGA 1EGJL 3VFMB 4ATTA 1PHQA 4MAVA 4MADA 2BHFA 3VOGA 1XF4B 1UR1A 4PJGB 1B2YA 1DHKA 4N87A 4OFVA 4O2FB 4AUBA 3B83A 4JG9A 1ITXA 4WOQA 1MCEA 5EU4A 2J66A 2R1LA 1INDH 4Q7BA 4DP1X 4FQQA 3Q2VA 3JZ7A 1FH9A 3W7IA 4M9PA 3EDEA 3R1GH 2O93L 2VEGA 2OPCA 5J12B 5DELA 4I18B 5FUZH 1ZRUA 5AD0B 4B5SA 3V5KA 4IRZA 5DC0A 3CH1A 4ZA0A 4GO9A 5TE6L 4Y4KA 4GXVH 3RM9A 1KM4A 4A67A 4AVHA 1I1FB 3OA5A 4M5ZL 2AKRB 5DHEA 3ISYA 2YPLE 3QZNA 1K7FA 4MWAE 4NQDD 2FHCA 1XGEA 3QJQB 2VLME 4XPTL 5AZ2L 2E9MA 4KJWD 3VG9C 1MHPL 3US0A 3ZYIA 2WVSA 3MMUA 4P5UA 5AW5B 3N1FC 2AJVH 1E65A 2VDLL 4UILH 5GISH 4A4AA 1LDPH 5KJRL 4XX1E 1DBKH 2PSNA 4B90A 1YUHB 1WD9A 4IOIA 1CCZA 1JNEA 3L5XL 3PDOB 2GOKA 1QD0A 4HCLA 1BZDA 4Y7EA 3SECA 3SW6A 1DQUA 1ZANH 3AQYA 5CJXA 4H8WC 4BEQA 4DJFA 5DZLA 2C1HA 5D55A 4ES4A 4JHBA 4NNBA 4U5IA 1NDVA 3BZGA 1QZ1A 3WKMH 2JV6A 3BDYH 1Q65A 3LKOB 2HJPA 2XSBA 1Q63A 4DKEH 1FAIL 4YSAA 3K7UA 4HGWA 2KDGA 4LSDA 15C8H 3TC9A 1KYUA 5B1JA 4CNNA 3DK2A 1QNZL 2QGDA 4O2EB 3PWPB 1QW7A 4O15A 3TTYA 1EJUC 1GYCA 5ABEA 4JNXA 2O26U 4YSDA 3PUOA 4XN5A 1KIUB 1GHSA 1B0GA 2R29H 3DH7A 1L6SA 2Q71A 5CPMA 4FA8A 4M6QA 3G1RA 2ZP9A 2RFGA 3KPOA 4ZMAT 2IV8A 1EZWA 3E2RA 4LVEA 2NX3A 2OR9L 4O1FA 2DQJH 4U3CA 2FWUA 4V1DD 1A0EA 3CFJA 3TBTA 3ILQD 4A2DA 4XZ4A 4W81A 4KKLD 1VADB 3HR6A 2FJUB 4C6LA 4HK7A 3ETBJ 1SF3A 3GXNA 5FYLD 1HE7A 1HJQA 1V0KA 1FF5A 1DWAM 4HIHB 4H3DA 1WFIA 3KPMB 4UIMB 1W3IA 3VXNA 3SDAA 1XXXA 1EJOH 4DNMA 3EX2A 4Y90A 2V4LA 2VDNH 2A0LD 3CHQA 5AHEA 4CW1A 5G1TA 4QXIA 3ZKSD 3V4PL 5CSSA 4GYJA 3QUYB 5CLTA 2ODHA 3J2PA 5D6CA 3RWIB 4F37F 1TV8A 1W3HA 3FOKA 4GT7A 2WB7A 1WHOA 3BQUA 2XFWA 1IC0A 1WBZB 1ZHBB 4U4IA 4PV1C 1CU4H 4X6DE 2ARJQ 1BHGA 3LNIA 1V27A 4M43L 2MCMA 4R34A 1L7TL 1MDLA 3RNQB 3PGCB 3WNKA 4OVVA 3IANA 3IIZA 3FQWB 3WY1A 3KBNA 1S9WB 3SPJA 3VXOA 4G8EB 1JZ3A 4AIZA 4DN4L 3V5CA 4RGMB 3L0GA 3UR5A 2DDXA 2XUCA 2EH7H 5DQ9B 3CQHA 3UJ2A 2CHZA 3TC6A 3L5HA 3W26A 3Q45A 3CXHK 3PZIA 1O6IA 4I90A 3GXIA 5FEXA 1T7ZA 1UACH 2R0LL 5E8NB 3BLKA 3KGSA 4YNYA 1J6PA 4CNTA 5DMIL 5F6HI 2E68A 1OGTB 4C6IA 3WJYA 4N8VG 2H9GA 2YGVA 5TD4A 4BUGA 4P99A 2XVKA 4RAUA 3C2AH 1Q6OA 4GJ1A 5J1AB 1B57A 1KV3A 1K6QH 2C26A 5EORH 4AH2A 1GOQA 4AX7A 4RNFA 3ES6B 1S38A 3ZZSA 4CC1A 1HVQA 3KGUA 4QEHA 2ICEA 3WSQL 3QUYC 2O5NA 4AXWB 1EJ6A 1UXWB 2ZT9C 5AYTA 1A9EB 1EO8H 3GI9H 1AW5A 1GJPA 1UJQA 4Z2IA 2CK0H 5AOLA 2X5PA 2P7TA 1OE3A 4FXGA 3WELA 3ALFA 1R3HA 1MG3C 1A8JH 3HUJB 4WVRA 2EIBA 5KVDL 3ROLA 1YEHL 3MLWH 3VNLA 3CFEB 5B38A 1O75A 4TNGA 4TLSA 5E8NA 4ATLA 3IJEA 3RAJH 3MT1A 1ET8A 1CXKA 3L9RB 4UDTB 5E4IA 4UTIA 1AHWA 1T1YA 1XIWB 2J1YA 4S23A 4X6CA 1Q9KB 1AC0A 3HI6L 9XIMA 5IFJB 2XV0A 2X2IA 1AQFA 3N1MC 1DXEA 4LCWA 3AREB 1WYIA 3NTCH 4ROQA 1U22A 5FYLH 3GK0A 3WMSA 2HG5B 2J55A 3U2SB 4JB9H 4L6DA 2IOIA 1QHPA 4NRXA 2Z1WA 1MUCA 1ZHNA 2KERA 1W0WB 1Q9OB 2DW5A 1ONEA 5CILH 3HIJA 2OK0H 2QVMA 4MHHG 1HEJC 4JY4A 5D1QE 4LHQB 4AQEB 1OF6A 3FU6A 3MA7A 3C5XA 5B21A 3CSFA 3T4AB 1CS6A 3U8GA 1W2KT 3HHMA 3YPIA 2JLPA 4F9DA 2NQLA 4E41D 2R56H 3IFPB 3PY2A 3FT3A 3H3KA 3KPRB 1OD9A 4ZI8A 2PO6B 4H0IA 4UTWA 4NIYE 4L4TB 1U92B 1UIPA 1IGJA 2H41A 3GG1A 1T7LA 4BKNA 4A68A 3GEWB 3UGUA 2IFFH 4G9FD 3QRFM 3GKWH 4MPKA 2R7EB 3LD8C 1CFNA 1MEHA 1W0WA 2OMAA 3E2QA 4W7VA 4UDUB 4K6AA 1EZUA 1VS1A 5D7LD 1XB3A 3WKZA 1O7SA 4G1EB 4DBSA 3N14A 4DZHA 2VXNA 4JKNA 2CGYA 5CAKA 5SWZE 2DMGA 2YHGA 2CPCA 4JQ3A 4QT5A 2DEPA 1X5HA 2A83B 2MWCA 4LSVL 2ISWA 5LVEA 5A6BA 1CZ1A 3UAEA 4Y8FA 1E9ZB 4G6AD 4HDIA 3V0FA 3K91A 5A2CA 4I7VA 2XKNA 4UV4H 3S8WA 3HB9A 2AJYH 2EXTA 3RQ3A 1I4FA 1UCTA 4ICCX 5CLYA 4AZ7A 3OMAB 5TAOA 3OKNB 4PBGA 4L3AA 1HWHB 3FB5B 1RZKC 3P4LA 4AZ5A 2BCKB 4GLRI 2NSXA 4FG6D 2VJ0A 1RY0A 1U5HA 2ITFA 3OKKB 2V5SA 3QCUL 3AIWA 1AGFB 3VH8A 1CDBA 1PF3A 1EWHA 1F6FB 5I1DA 4NN7B 5D8ZA 4IMCA 1RK1A 2AQ3A 3SJVE 2HFFA 4U3SA 3SO5A 5FGCE 2JJSA 4MJZA 5I03A 1XGYL 2NXYD 3Q2LA 1J1PL 3LPPA 1F3XA 4IQHA 2ANUA 3OXSA 4Q0XH 4O9HL 4OLEA 5JW3L 3BZ4A 3T6CA 4HVXA 4YHKH 2ZYIA 1QWKA 4HOMA 3CB3A 4QQ3A 2OMXA 2E4FA 3PQYD 4NPYA 3UXFA 1F45A 4FQXB 4NKOA 2CM5A 4KI5E 4M5YH 4WNJA 2Q8AL 4ATWA 4J6IA 1ANUA 1HL4A 3IXAA 3MRCA 1WIOA 4IOSD 5IB5A 2AABH 1Q6QA 3SE9L 3KHJA 3RLSA 2JJSC 5BRZA 3KPSE 1ZEAH 1JRBA 4WNQA 3GHPA 1JXJA 4Q7IA 1FCUA 2Y5TA 4PTUB 2EKCA 4N90E 4ICNA 3OQ8A 2PI6A 3TXVA 4NWUL 3H54A 3SJVA 3KDNA 5KVGE 5L9DH 1KFKA 3H12A 4KX8A 5L8KB 5I00A 3W1NA 5KYXA 5FXCH 5B39A 4HUUB 1L8NA 2C16A 2E5CA 1QYGL 1D9KA 3O2DH 1XFBA 4NL1A 2P3EA 4C5ZA 4DBDA 1TT6A 5GHWH 3UABA 4G42A 4P5TD 1HYSD 1HHIB 3DURA 4XVDA 1JAKA 5EEVA 1K5WA 4YMPA 1JRHH 1WTGT 2VZTA 2I32A 3GBDA 5AOJA 1RLWA 2YRPA 4QRTB 5B39G 5LDSA 1H6FA 3PPFA 1DTUA 5GGUB 4DPCX 1NWRA 3UTTE 4GP8B 4C54A 5JIIA 3BD5A 4PB0H 3DG6A 5FGCB 4HNNA 1BEXA 4J35A 4HX1B 4R7DB 4MWAC 1S3RA 1SGJA 2QJJA 1T1YB 1XIWA 5TDOA 3NEXA 1SU5A 1KYFA 3BLEA 5KN5A 1KC5H 3F3HA 3BUIA 4PJAB 4R90H 1AE6H 2BVOB 5GGSY 3AMKA 3Q67A 3BGFC 2AERT 2HE5A 4R8WH 2DB8A 1R46A 5D7HA 3S36H 3LB6C 1K3UA 4ZUTA 4X98A 5C6WH 1AJ0A 3WD5H 1WOAA 5KANI 2MKLC 2NQZA 4LEQA 3WNPA 4PP1D 4NAEB 3WBAA 1D7BA 2D3LA 5KYYA 3NM3A 5DQJB 2PDNA 4Q8MA 3N34A 4MNKA 3OZKA 4DP8X 3O8XA 3HMXH 4JQVC 1SFLA 4O14A 1K4DB 3LKNA 3V4VA 5D09A 2HVBA 1TJPA 5ANME 5KOVC 3KBMA 4X0KA 4B9KC 4IRZH 3MLZL 2Q76B 3ZUNC 1SFJA 5DUBA 4KHTH 2YAQA 3B9KA 5FC9A 3TASA 4DOHE 1QXLA 2IIJA 3M4HA 3EOTL 1E4KC 1KXQA 4GW4A 4U1GC 5D2NB 5BPPA 3CFCL 3UG3A 2DVXA 2JCCE 2J8UA 3R89A 3O8XC 1AC6A 5F4SA 4ADGA 1OCRB 4Z77B 5EU7E 1QNRA 5HANA 5E5RB 1WT5C 5JPMC 1RXLA 2VR8A 3FQTA 1K5NB 3V5HB 2CK0L 5I5JA 4NZRH 3I6RA 1TIMA 1WAAE 3MBEB 5H37H 2DSZA 2W38A 2DQCH 2VR5A 1AGCB 1S9WA 1LK3L 2W65B 1Q0XL 3AWGA 4OJFH 5EO1A 3TV3L 1K9DA 1KKOA 1Q72L 2VDPH 3S1WA 3GBNH 4BSWB 1QFWL 1Y6NR 1FCVA 3L16A 1T04B 2ED7A 4RGNC 1H62A 2R1XA 1Z3GH 4G7EA 2CIIA 3SGKC 4FTDA 3VGHA 1SQ2N 3FKUS 3AMGA 5K9OB 2WQRA 3VXSD 1DVFD 4LSTL 3DPDA 1GVRA 3LVEA 1LRTA 1OEPA 1YECL 1G1CA 1I53A 3WS3B 1OYAA 4K36A 2B5IC 5F1VA 2W95A 5AZEH 1DQKA 3GUTB 1ZD6A 4MAYB 1MEXL 2RACA 5ID0B 3OZMA 3DO4A 5T3XE 1F3TA 1EHKB 1YMME 3CIAA 4HKBB 2CBUA 3MO7A 1P4UA 2ICSA 4DEPB 3ENLA 4XBGB 3X3FH 1T0PB 1YPZB 5CJQH 5E5LA 5I30H 1MW1A 1U8CA 1AXSA 2R23A 1NP0A 4N9BA 4RMBA 4PSRA 5M94B 1US3A 4G1MA 1DVTA 2FO4A 9CGTA 1P1MA 1AZZC 4JBSA 4RZ5A 1LDSA 4TS6A 1ACCA 1P6AB 1KFJA 3KZSA 2XY1A 3LRSA 1JNLH 4TVPL 3FN3A 1MJUH 5T1KD 5A7BA 1EPVA 3T8VA 1GYNA 1K9FA 1TCDA 1NCDL 5JW4N 2CKSA 2R0ZH 1JJUA 1N0LB 4HPNA 4O53A 1SEQH 1NPJA 1LO5A 5FUOL 1NIUA 4ZS7H 2YQ2A 4UIOA 5LNVA 5FF4A 2JNZA 1KN2L 4F9PC 2PTZA 1JI1A 4JN6A 3ARUA 4OCLC 4KDVA 1HJBC 2DFAA 2WXJA 5HDOA 1P6FA 2PP1A 2QR0B 4L3CB 3KHQA 4PRHD 1QO2A 2BVDA 3U0WL 2UZIH 4XPTH 5AZ2H 5T3XL 3P84A 2B1AH 5F6IB 2V2TA 3QQNA 3NZGA 1A7PH 2IGFL 1QRNA 3MDJA 3MJ9A 5DS2A 2BTMA 4NJKA 1EDTA 1OWRM 3ITOA 3NR0A 1ES0B 2M1KA 3IFNH 1OZQA 5D9MA 2BVWA 4B4FA 2Y7NA 5GRJH 2F53B 3FQYA 2YMTA 3EUDA 3KNBB 4NHCL 3P67A 4IZGA 3H0TB 2E6FA 3HMXA 2WGXA 4NFCA 4Z3HA 2BP1A 2HTMA 2R7EA 3E0WA 1RPKA 1XF3B 1XR9B 2BXZA 3DGDA 4IFKA 4RW5A 4N26A 3UXKA 1PYWB 4Z7WA 1W16A 3GR4A 2IPKB 3KW3A 1GJIA 3TLLA 5G55A 4GRLA 2EDJA 4I0PD 2Z0UA 2CRIA 3L45A 4PREB 2ZRXA 4OQVA 1EZSA 1XCQB 3FT3B 3KPRA 4JDVB 5DWPA 1QFUL 4JHMA 1XFCA 3KLQA 4MWAD 5K4ZA 2V0TA 3V6ZA 4XZUB 1O5KA 1BDYA 2WO3B 3GLEA 1AOZA 4U28A 4UM9A 5IVOA 1I2PA 4MDIA 3SURA 1DL7H 2G2RB 3P0GB 4WENB 1ZBWA 3X11A 3FUFA 4J2QA 5FIEA 1Q9LB 4W9DC 1GPWA 2GTZB 1MFVA 2NY4B 5FYJH 3TBYA 2FMOA 4I9JA 5AHFA 5FJPA 2KLTA 4KIRA 2VH5H 3M5XA 4JTQA 1CLYH 3WH5A 3LGEA 1MPAH 3JV4B 3LJ3A 4Q4SA 1F3EA 1AO7D 2BGSA 3TFKD 2C3VB 3GC4A 2W60B 5C0EA 1LUCB 2NQJA 3U5UA 4XQ6A 1LO3H 3FK4A 3BPCB 2L04A 3F58H 1PG7L 1TTAA 2DH2A 3LXUX 1KB9J 3DI2B 2WQUA 2WKGA 1KIRA 2FO1A 3P3RA 2AGJH