3VM5A

Recombinant medaka fish alpha-amylase expressed in yeast pichia pastoris
Total Genus 173
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
173
sequence length
499
structure length
499
Chain Sequence
b'QHNPNTRDGRTAIVHLFEWRWADIAAECERFLGPKGFAGVQISPPNEHILVSSPWRPWWQRYQPISYNLCSRSGGENELRDMITRCNNVGVNVYVDAVINHMCGAGGGEGTHSSCGSWFNANNKDFPSVPYSNLDFNDGKCKTGSGNIENYGDPYQVRDCRLVGLLDLALEKDYVRGKVADFMNKLIDMGVAGFRVDACKHMWPGDLDNVYRRLNNLNTKWFPGGSRPFIFQEVIDLGGEPITTGEYVGLGRVTEFKYGARLGELFRKWNGQKLSYTKNWGEGWGFMADGNAVVFTDNHDNQRGHGAGGASILTFWDPRLYKMAVGYMLAHPYGFTRVMSSYSWDRNFVNGKDENDWIGPPSNGDGSTKPVPINPDQTCGDGWVCEHRWRQIMNMVQFRNVVNGQPHANWWDNGNNQVAFGRGNRGFIVFNNDDWALDVTLNTGLPGGTYCDVISGNKDGGSCTGKQITVGGDGRAHFYINNSEEDPFIAIHADSKLHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords alpha-amylase
publication title Structural and functional characterization of recombinant medaka fish alpha-amylase expressed in yeast Pichia pastoris.
pubmed doi rcsb
source organism Oryzias latipes
molecule tags Hydrolase
total genus 173
structure length 499
sequence length 499
ec nomenclature
pdb deposition date 2011-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vm5A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vm5A01
3SURA 4OOUA 2WVUA 4MAZA 2VX5A 3VGDA 4JIEA 2TAAA 1ISZA 1QHPA 2YDSA 3AS2A 3SUVA 3WD1A 1PBGA 1HTYA 1VJSA 3VM5A 6TAAA 4DWSB 2F18A 1KTBA 3AICA 3AZTA 2CBJA 2W62A 3A4WA 1HNYA 1UD2A 3U5UA 5AC4A 2WMFA 3W38A 2WMIA 2QV4A 3SCNA 3VM7A 3HG4A 2D2OA 2Y8VA 1A3HA 4B3KA 5HPCA 1MW3A 3PZIA 3RCNA 2O9PA 1TQTA 1H0GA 3SUSA 4NZFA 5CPTA 1CENA 4Z2KA 4BQ4A 1ZJAA 2YBUA 3LPGA 1XSJA 2D1ZA 3PZMA 3PBGA 2OWXA 4W89A 1JDCA 3WY2A 1LL6A 4FLOA 4AMXA 4D1IA 2DDXA 1C8YA 3N15A 1CYGA 2A3AA 1TMQA 3CH9A 3MSDA 3ARVA 2UY3A 3DHUA 1Q6GA 2BFGA 3EBVA 4EANA 3A22A 4K68A 2WLYA 2BV9A 2IXUA 3CIVA 2F7RA 3PTKA 1OT2A 2EPNA 4CN6A 4HZ6A 1QX1A 4V2XA 3WNPA 2WWCA 2VNCA 3I3EA 2YA0A 2XIBA 1GPFA 4J27A 2Y5EA 3PZ9A 4LQ1A 5E9AA 3DX1A 2BNJA 3PZNA 5CXPA 3ARTA 3NSNA 2VL4A 1GHRA 1JYVA 3ZJKA 4NXKA 3ZO9A 4WKAA 3GH7A 4HMCA 1JF6A 4AY1A 3K46A 1XCXA 4UZSA 1F4AA 3CZJA 1ZBWA 3AS3A 3VIKA 4GINA 4GKLA 3D3AA 4U3CA 3EJRA 3LRMA 1JNEA 1HL9A 3WNOA 3L4TA 3DX4A 2E9BA 4U5KA 5A6BD 2GDVA 1VEMA 5A8QA 3TONA 2J74A 2EXOA 3MMWA 1EHAA 4M81A 1V02A 1R87A 4JFUA 1MXGA 4PMNA 1E0XA 1ESWA 1UQYA 5IHSA 2YJQA 1VB9A 3SIMA 1R47A 1GQKA 3OGSA 1JAKA 4W86A 4X9YA 3J7HA 4B9ZA 4U2YA 4NI3A 1PPIA 3EJQA 4W8AA 4W7VA 3TTYA 3G6MA 3B8SA 5I79A 1VFUA 1LLOA 4BQ3A 4HOZA 5A6KA 5E1QA 2CBIA 4PSRA 2C0HA 5HNNA 5GNXA 1VIWA 3EJTA 3ZT5A 1MQPA 2DSZA 2WVSA 1R33A 2J79A 4TVUA 4P7OA 1WO2A 2WNWA 2WSPA 1RP9A 4DO5A 4F9JA 2FGLA 3W26A 1DWHM 2E3ZA 3POCA 4NZCA 1UWQA 5HBFA 1HJXA 1W3LA 5A6LA 1JYWA 1JZ3A 1OIMA 2BHYA 2W5FA 3OLEA 3QOKA 2W4XA 4CN4A 3DX2A 4V27A 3BAIA 2Z1SA 1H4PA 3A23A 3EDKA 1O6IA 4MNMA 1E6PA 3AFBA 4LGXA 2ZUMA 3VILA 4GIAA 3GXDA 1KTCA 2G3NA 1JD9A 1TCMA 2J75A 3NYDA 2BXYA 1E0VA 1KR1A 1P6WA 3D4ZA 4NXSA 5BXRA 2NSXA 4CVUA 4GZEA 1O7AA 3BAWA 4AYSA 5A6AA 1K9TA 3W0KA 3ALFA 1TFVA 1LQ0A 4PTVA 3VKKA 8A3HA 2E8ZA 3I3BA 1VEOA 4Y7EA 5JIWA 2ZE0A 2WANA 4UOJA 1HX0A 4TOQA 3ZJ6A 2GK1A 1NOUA 3N13A 3AXHA 5D9PA 2X8RA 2ZX5A 1X1NA 4C7GA 3GXNA 1J12A 4FNPA 2XSBA 1M7XA 1NWTA 2J7EA 1M04A 1Q6CA 2CKSA 1PX4A 4XZWA 2CITA 1UH2A 3PZUA 4F79A 5BXSA 4JCLA 2XPKA 1MW0A 4A3HA 4HPGA 4AXNA 3E1F1 3SCSA 2F1AA 3TP4A 2WMIB 3OGRA 4WF7A 1YHTA 2JE8A 3WL1A 4JAWA 5EMYA 3FW6A 3DDFA 3MV11 1PZ2A 1KWKA 4OUEA 4PUDA 4F66A 3TTOA 1R7OA 2WKGA 1W91A 3VIMA 3WQ6A 5CSUA 3VSTA 3F4VA 1GQLA 4D6JA 3GXTA 5EFDA 2AMGA 4BCEA 2PC8A 3GDBA 4LYRA 3BAKA 3A4XA 4WJXA 1E0WA 1RP8A 1V3JA 1B2YA 1SMDA 3MUAA 2YLAA 4D6CA 3GXPA 3TTSA 2VURA 3MU7A 1C7TA 3WKZA 3AYSA 3ZR6A 1W2VA 2HISA 4R27A 3EMQA 4B3LA 2DT2A 3WDJA 4M8UA 1BVNP 1M01A 1TE1A 3ALGA 4D6DA 1QBBA 3CZEA 4UQEA 4CUCA 4DM2A 3LMYA 4U5IA 2D73A 4JHOA 3VMPA 3CTTA 1CTNA 1JZ4A 1W9UA 1PIFA 2G41A 1HL8A 1PX3A 4GZIA 2YIHA 1DEDA 4IUGA 1UD5A 2EBNA 2X09A 2E40A 2DT0A 2XM2A 2ZUVA 4JL2A 1E4LA 2WAGA 1V3LA 1HJSA 1EHNA 2VX7A 1ZS2A 3CZSA 1QI0A 5ABEA 5HXMA 1TG7A 4P7RA 4JCMA 2WM0A 2DT3A 2XFYA 3TOPA 1BFNA 4LX4A 1D3CA 3WNLA 3UETA 2O9RA 3D5HA 1CNVA 2XN1A 1UWSA 2VVSA 5E09A 1XH2A 4ZXLA 1KGXA 4OGZA 1QBAA 2FYVA 3D4YA 4AW7A 5D9MA 4FNRA 4PMZA 3BVVA 2YOCA 3D51A 5D9NA 2C8NA 2JEPA 1GQJA 1Q6DA 3WSUA 2Y8KA 3H53A 3WH6A 2J7DA 3NIYA 4CD6A 2ZXAA 3KZSA 4D6HA 2D24A 4OIFA 3AOFA 3WELA 1FFQA 3WMSA 4TTGA 2HVMA 2BHUA 3N12A 5FL1A 1OM0A 3BLKA 4B15A 2Y2WA 1WDRA 3ZM8A 1QI3A 4QCEA 1JAEA 1EDGA 2WPGA 1DWFM 3AYRA 2OYLA 1F4HA 1QNPA 1UKOA 3PHAA 3EDFA 3VD9A 1B3YA 1JZ8A 3FHAA 4BQ5A 4B9YA 1UWIA 3OZOA 1JNDA 4PTXA 1DWJM 4FMVA 1E5JA 5A6BA 3UEQA 2VR4A 4OZOA 5A2AA 4H8VA 3KE0A 1V6UA 4UZUA 2IGTA 4PYSA 2WMKA 1GVYA 1UG6A 2EEXA 2G4FA 4AIOA 2PWFA 4JFSA 1RH9A 1UA7A 3WF3A 5IFPA 5FCZA 2X05A 3SCUA 3IGUA 1LWJA 1SR0A 4JKLA 1K6AA 1R34A 2E9MA 2CBUA 1QI2A 4PMYA 5DF0A 4AMCA 5E6YA 4KRUA 2WWDA 4HOWA 4Z2IA 1BAGA 3WL0A 2ZUTA 2BVDA 5DMYA 2X2JA 3F5KA 3W82A 1KCLA 2GK1B 1R46A 1V08A 2WMGA 1JXJA 1E4NA 3UR7A 4FNUA 3BMVA 3RJXA 3O9NA 1TQWA 2VZSA 3PZQA 1J0ZA 4AZHA 1BGAA 4QFUA 4AEEA 1LL4A 3ARRA 1FHDA 2VZTA 1MW2A 2XM1A 1CXHA 3QR3A 2CXGA 3WNNA 4QDMA 4FLQA 1FH8A 1LWHA 3WBAA 9CGTA 1DHKA 1HJWA 3GBEA 4AD4A 1UYQA 5ECUA 4AD2A 1US3A 2X0HA 3CHEA 3BVUA 4U3AA 4L4PA 1V3MA 2ZX7A 5GQBA 4HZ7A 2VMFA 4JFWA 1Y7VA 4UFLA 5CLTA 3N04A 3OGVA 1W32A 4MNKA 1EIBA 1UKTA 3VGFA 5IXEA 3UG3A 1DWGM 2CERA 3M6DA 5D8WA 4MB4A 3VTRA 3L4VA 1PZ3A 1XYFA 5CGMA 3MUIA 5I5RA 2EPKX 4N0RA 1H3GA 5ABHA 4MB1A 3W28A 4E8DA 4YPJA 1J01A 1H09A 2NT0A 3ZQ9A 4ATWA 1PEZA 2FHCA 1EDTA 3SCVA 1U30A 1K9DA 2WBGA 5JIPA 3VU2A 3RM9A 3AHYA 4M80A 2VX6A 4QLKA 3RJYA 3BUDA 3MV01 1UWTA 2XFRA 5DT7A 3SUWA 4TVCA 1FP8A 1J9YA 1WE5A 1B3WA 4PMQA 1W9DM 5FKYA 3TA9A 1TZ7A 1E4IA 1H5VA 1EOMA 3CO4A 1NH6A 4WSJA 3N1AA 4HP5A 3UCQA 4CCCA 5HDRA 1CGTA 4ACYA 3IAPA 3FXYA 1KXTA 5BXTA 5I2UA 1RPKA 1ZJBA 4A4AA 5E6ZA 2BVTA 1CGYA 3KLKA 3BUQA 3TTQA 1NP0A 1H11A 3VIOA 2VRQA 7A3HA 4AZCA 3CHCA 3WEOA 4PN2A 1M03A 1WP6A 5LA1A 1KQYA 2WCGA 5BRPA 4P7NA 2VJXA 2EJ1A 3WY3A 4KH2A 5I23A 3CHDA 2D23A 5BWFA 3AROA 3AIUA 1E55A 1BLIA 1CPUA 3EMZA 3U5YA 4AZ6A 2GJPA 2D0HA 2CBVA 1E43A 1OIFA 1HVQA 1W1YA 2PB1A 3A3HA 4JFTA 1QHZA 4ACZA 4DUVA 1EO5A 5D8ZA 1E9LA 3VIIA 5JBEA 1E6XM 4W7WA 3VD5A 3VX0A 4MTVA 3LRKA 4XB3A 2EO7A 1SYTA 1V0NA 3IJ8A 3BAYA 4HA3A 1NWUA 3KLLA 2BVYA 1BSIA 1UWUA 3T08A 5HPOA 3EDJA 5E0FA 1BGGA 2VQTA 2DPEA 2FH8A 4AIEA 1BG4A 3N18A 3CUFA 1RD6A 1B9ZA 2ZWYA 1V6XA 5BRQA 1X6NA 4UQDA 2BY1A 1UR9A 1XH0A 1EDQA 1V0MA 3BVTA 4MDPA 1MQRA 2YDQA 1B3XA 3L4WA 2IXVA 3AXIA 1IZKA 1ISXA 1Q4NX 4DWSD 3VIHA 1PX8A 1TVNA 4CD8A 4W7UA 3BSGA 4UQ9A 2CHOA 1UHVA 1CIUA 1KGWA 1GONA 5HOSA 4AZIA 3AHTA 3CBWA 1MFUA 3AISA 4CCDA 1NWRA 2VQUA 3NCOA 3HG2A 1PAMA 4S3JA 4BQ2A 4Z2GA 2XGBA 4BS0A 3IJ7A 3AMLA 3PZTA 3VPLA 2V3EA 1NQ6A 1XCWA 2GJXA 4XUYA 2FHBA 4PTMA 2J4GA 2FDMA 1CWYA 4UCFA 1AVAA 4AD5A 4AZGA 3T2PA 3WIJA 2G3IA 3EJPA 3GXMA 5EB8A 1Z32X 1XH1A 1EOKA 1LJYA 3BH4A 2FGZA 3II1A 4DUXA 2MANA 5LA2A 4OJYA 3DYMA 3ZSTA 2FHFA 3AZSA 1MW1A 1E40A 3CZNA 5DFAA 4AISA 4NSBA 5AY7A 1HVXA 1M53A 4IM4A 3T2OA 4NX0A 3WF2A 2D0FA 2XN0A 1W1VA 2XJ7A 1WDQA 1HKMA 3BSHA 3ZR5A 4AMWA 4GO9A 3WDHA 2CIPA 1BVZA 3THDA 1IT0A 3VIGA 1LG2A 5A2CA 4UQCA 3F5JA 2YA2A 4MJ2A 2EPOA 3WDIA 4D6GA 3LPFA 4HU0A 3BUPA 2WMHA 2E0PA 4HOXA 2ZUNA 3PN8A 5M03A 3RDKA 2QF8A 3T09A 2WHLA 1UQZA 2DEPA 1E71M 1ISYA 3W4RA 1JG9A 5FL0A 1QWNA 3VIFA 2EPLX 3ZT6A 2ZXBA 4J7RA 4LYPA 4FNTA 4UFMA 2QMKA 5I24A 2X2YA 3WH8A 3RILA 4QCFA 2J25A 1TUXA 3EJUA 4JL1A 1B90A 5DT5A 2ZXQA 1L8NA 3DYPA 1OSEA 4UOZA 4E2OA 4TUFA 1UD4A 5A6MA 1E70M 2ZIDA 3VUPA 1W3HA 2WB5A 1R75A 4P7LA 3UR8A 3VIPA 3WD3A 2YLLA 1PS3A 4C7FA 1W1TA 1QNRA 2WZEA 4D6IA 5JBDA 1R85A 1V0KA 1J0JA 1OD8A 2Y4SA 3LPOA 3BC9A 1NM9A 3AHXA 3ARYA 1PJ9A 3ARWA 3QHNA 5A8PA 6CGTA 1NARA 3O2LA 5EBAA 4AZCB 2BY3A 2G8ZA 4P8WA 4HA1A 3WDQA 1XV8A 2ZX8A 2YL6A 2J62A 3A6OA 1V02E 3ZMRA 1LF1A 3MMUA 3RPMA 2F7PA 3N9KA 3WY1A 1HWWA 2PWDA 3IJ9A 1JI2A 4ACZB 4D6FA 4ZEPA 4PSPA 3NDZA 1TA3A 4XX6A 1B30A 3H54A 5A2BA 5FIPA 5A6JA 2XG9A 2UY5A 1VENA 3OLDA 4GZJA 4PMRA 2VR5A 4CU7A 4UOQA 4TTUA 4H8HA 2J7BA 5D4YA 3BCDA 1W3KA 3VGGA 5F7UA 5LYRA 4KRTA 1UH3A 3VX1A 2DGAA 3O6AA 1NOFA 2XVNA 1BYDA 4HMDA 3PTMA 5I0DA 2PBGA 3WD0A 3WUEA 1ZU8A 2XUCA 3K8MA 1XD0A 2WC3A 1GW1A 3T0DA 1QI4A 3WMCA 1VEPA 3AXXA 3ZSSA 4ZFMA 1W9PA 3PZOA 1HP5A 1CGWA 3AIQA 1KBBA 2DT1A 4P8VA 3OZPA 4DUWA 2XTKA 1JIBA 4PTWA 1H1NA 2XFFA 5CQ1A 3GZAA 3U7BA 2WVVA 3L2LA 1HJVA 2F7QA 3VD4A 1HJQA 4PMVA 4AWEA 3BCFA 2DH3A 2GJXB 3CC1A 4MADA 3NSMA 3WH9A 1H49A 2UWFA 1V3IA 4NRSA 3MO4A 3WUFA 4A3YA 1CECA 4W85A 1K9EA 2V38A 3W53A 3A4AA 3VSVA 1US2A 1UZ4A 4L4OA 3OIHA 3CUIA 5FOOA 4KGJA 2F61A 1GOMA 2A3EA 2J77A 1IV8A 5CPSA 2F7OA 1C92A 3OLGA 1CGVA 2ZWZA 2YL5A 4YHGA 2V5DA 3CZKA 3ZJ7A 2D22A 3VNYA 5KEZA 2D20A 3DDGA 5A8NA 4OKDA 3VDHA 1E3XA 1FFRA 1I1WA 1V3HA 3LXBA 1OWQA 3W81A 1JXKA 2F1BA 2WMJA 5E70A 2BS9A 1B3VA 4FNSA 4E4PA 5DO8A 1ITXA 4CN1A 1JYXA 4DO4A 1UR8A 3FNDA 4PCTA 4BZYA 1C7SA 2CKRA 1QNOA 1JI1A 4WLCA 3GNOA 6A3HA 4U2ZA 1JZ7A 3LRLA 5A69A 4RE2A 3RIKA 4AYGA 3SCRA 4W88A 5M17A 1GZJA 1NWSA 2A3HA 3ZIZA 2O9OA 3AMGA 3QHOA 2XSAA 1WZAA 2E8YA 1HXJA 1C8QA 1HN1A 2JF6A 2F2HA 1CXIA 1TQVA 2WC7A 1WPCA 4M24A 4AD1A 1L0PA 4CD4A 5TD4A 2A3BA 2OWWA 3HZ3A 1E1FA 3QGVA 1UR0A 1Q6FA 4J3SA 1BF2A 2VZOA 1R7AA 1X6LA 3CZ8A 1GCYA 4NF7A 3L4ZA 3A5VA 1KBKA 2VRKA 1B1YA 5ABFA 3MSGA 3VNZA 3ECQA 4IPNB 1UD3A 1NP2A 3K4DA 3FY1A 4GI8A 1GJWA 2Y24A 5BXPA 2JF7A 4NZJA 1WZKA 4GI9A 4J3XA 1KWGA 3AI0A 1JZ5A 2J47A 2WW5A 4UQBA 3WN6A 1D2KA 3A47A 1FHLA 1OBAA 4CKQA 2RGMA 2JEQA 3WENA 3WD2A 2VVNA 3WBEA 4AC1X 4N42A 4UFIA 1ZBVA 3WD4A 3UESA 3IK2A 1G9HA 1CEOA 1TA3B 1C3FA 4WKFA 1FOBA 4Q22A 2ZUSA 4F9DA 3U7VA 4AD0A 3ZT7A 3OLIA 2W61A 1CDGA 1XSIA 2YL9A 3H55A 1Q6EA 4TVDA 1V6WA 1QW9A 2X0YA 3CHFA 4UR9A 3AIRA 3L4XA 2W63A 2XVLA 2WCSA 2OW6A 3QHMA 4PRWA 1GOKA 2CPUA 3ARQA 4FK9A 2OSXA 3VINA 2J7FA 3QOMA 3A21A 1E5NA 2OLHA 4UFHA 2D0GA 4W8LA 4D72A 5BROA 3M7SA 4X0VA 2J7CA 4DWSC 1W9VA 3OG2A 1QW8A 4QAWA 3VMNA 3HU7A 3JUGA 2O9TA 4QLJA 3BMWA 2DSKA 4Z2HA 1TQSA 1GNXA 3DC0A 5D9OA 3EJSA 2BY2A 4D1JA 3IAQA 3GH4A 4J28A 2J7GA 1SZNA 3ARPA 4M1RA 5M5DA 1EGZA 2VTFA 3CMGA 4PUEA 3BLPX 3CUHA 1MWOA 2YDRA 4NRRA 1MXDA 3AMCA 2WVVB 1BHGA 3OB8A 4HTYA 1E4MM 3KL0A 1G01A 1TQUA 4BF7A 1JL8A 2PI6A 2F8QA 4ML4A 2WZHA 2QPSA 2VCAA 3LX9A 1LG1A 3VD7A 2ZXDA 2WVTA 2YKKA 3UERA 1XYZA 2OYMA 4GXPA 3APGA 4OBSA 2GDUA 3DX3A 1AQMA 4MAVA 4B16A 3THCA 3PTQA 3WFLA 5DEZA 1E6RA 5BYWA 5CG0A 1UKPA 2WXDM 4H2CA 1ITCA 4CD5A 4MB3A 1VBRA 3HG3A 2VO5A 2BXZA 2YL8A 1XHGA 3SEPA 1SMAA 1WNOA 1KXHA 3SCWA 2CESA 1UKQA 2GJRA 1CLXA 1QNSA 1BYCA 4UFKA 2XVPA 1J0HA 3VMOA 1GHSA 4RL3A 1HJUA 1WZLA 3WDPP 2B31A 1QHOA 5ABGA 3CZLA 1MQQA 5GNZA 3I3DA 5GPRA 3LXCA 3L4UA 3ARXA 1E6QM 4R5EA 1EO7A 1HKJA 2V3GA 1J18A 3NSXA 1QWUA 3CMJA 4PMUA 4OOZA 3ARZA 2YFNA 3GBDA 3K8LA 3WH7A 2JIWA 3MMDA 3AIBA 1O7DC 3PZGA 3D52A 1E72M 1E56A 1TVPA 1E6NA 3CUGA 2OWCA 1E1EA 2IUZA 1HKIA 3BXWA 3VDAA 1XSKA 2WBKA 1T0OA 4J3UA 3S5ZA 5A95A 1QVBA 1DWAM 3BVXA 3ARUA 4W5ZA 4CU8A 1WDPA 2DSWA 3BVWA 1CBGA 1U2YA 4MJ4A 2VI0A 2XYLA 1MFVA 2XHYA 3S2CA 1ZBCA 4ATLA 1UD6A 1C91A 4AD3A 2NW0A 2Q8XA 1DP0A 4YHEA 2XWDA 1UKSA 3G6LA 1JDDA 2AAAA 5A6SA 5A1AA 3SUTA 4Q7NA 1WCGA 1E15A 4TX6A 4UQAA 3DYOA 1ZL1A 2V3DA 3NUKA 2XVKA 5ABFB 1R86A 4P7QA 2CNCA 1ODUA 3AIEA 4H04A 2EACA 1J0YA 1W3JA 5I78A 1JZ6A 3VDBA 3AIVA 3SCOA 1WZMA 3AMKA 5FD0A 3VSUA 3SCPA 4ZXOA 4HPHA 3FAXA 3ZJ8A 2X1IA 3T2QA 2EQDA 1DWIM 3UG5A 1OT1A 4PBGA 5JUVA 4URIA 2E9LA 4X0NA 3WEMA 1JF5A 4D6EA 3WNKA 2CEQA 4E8CA 1HIZA 4EAMA 3ARSA 3SUUA 2DIJA 1KXQA 2FE0A 4LPCA 4KMQA 1EH9A 1OGGA 3SCTA 4MNJA 1FA2A 1GVIA 1W1PA 7TAAA 1CLVA 2J8FA 1XGZA 2G3MA 2VOTA 1JYNA 3BLBA 3BUIA 4V28A 3AIWA 1CXEA 4FLSA 2DQXA 1J10A 3W6MA 1W2PA 1HKKA 5JBFA 4BA0A 4EK7A 1XC6A 2W91A 3T0BA 2E4TA 5KZ6A 1CGXA 1OINA 3MKKA 3AS1A 1AMYA 3WFZA 1VBUA 2PWGA 3DHPA 3MUY1 2D3LA 4H7VA 1OGSA 2VC9A 4MB5A 4PCSA 4HZ8A 3AZRA 3PZVA 2FH6A 3K4AA 1U33A 2JALA 2EADA 2VX4A 3CUJA 4WIWA 1ISVA 3OBAA 4TXEA 2VUYA 1BG9A 4MDOA 1VF8A 1EA9C 3CV5A 4CD7A 2UY4A 1B3ZA 4F8XA 2WSKA 4MNLA 2XIIA 4RE4A 1BYBA 5BCAA 4W87A 3VDCA 4J3TA 2OSWA 1VJZA 4PMXA 3CZGA 3WDRA 1UOKA 1G5AA 1K9FA 1B0IA 1BQCA 1C90A 4J3WA 3AHVA 1JZ2A 3VD3A 2UY2A 2G3JA 1CXLA 3KL5A 1JFXA 2GSJA 2W66A 3WF4A 2Z1KA 2WZIA 3D50A 2OYKA 4KGLA 3RM4A 2VRJA 4GPNA 4AZBA 4WSKA 3DX0A 3AS0A 1LL7A 4ZE4A 2CHNA 3LXAA 2YA1A 1AQHA 4M56A 1FH9A 3W6LA 3EYPA 1TR1A 1BPLB 1VFFA 1J11A 3RMEA 1JGIA 4UFJA 1CXKA 1C8XA 5IDIA 5IFTA 3KL3A 3KWXA 1XRVA 2WHKA 2WCAA 1OCQA 1HT6A 2J7HA 3WUBA 3HMCA 3WEZA 1WAWA 3EDDA 1V6VA 2ZX6A 1GORA 4FNQA 1MYRA 3BAJA 3FAWA 4W84A 2CCRA 1OGBA 1S46A 4Z2JA 4HU8A 2QLYA 1ZB5A 3HJEA 5CSYA 1W9BM 3WQ8A 1H2JA 4JKKA 7CGTA 2WK2A 3W37A 3UG4A 3HN3A 3RO8A 4P8UA 1V03A 3NDYA 2AOSA 4ZENA 2PWEA 1FH7A 4W93A 1C93A 1KB3A 4J3VA 4CU6A 4PEEA 3GXIA 5I6SA 3GH5A 5IHRA 1GJUA 2WC4A 4KWUA 4EE9A 1GQIA 2J78A 2VZVA 1E73M 1G94A 4QP0A 2A3CA 5AC5A 4XZBA 5C71A 1V3KA 3MI6A 2W92A 5A8OA 5A8MA 2RGLA 3TV8A 1QOXA 3B9EA 4HA4A 3W24A 3MUZ1 3GYCA 5C70A 2W67A 2PF0A 3MANA 4WK9A 3L2MA 3BUBA 4LYQA 4RE3A 2J8GA 2V3FA 2DSVA 3VO0A 4W8BA 1VFOA 1QNQA 1UD8A 1BYAA 1ODZA 1W9XA 1J0IA 2X2IA 2JIEA 4JZ5A 4OBRA 4ZE5A 1UR2A 4PMOA 2VZUA 5LA0A 3WF0A 2YBTA 1VAHA 3KEHA 1N82A 3WQ4A 2X2HA 1OB0A 4QLLA 1G1YA 3VVGA 4FLRA 4AZ5A 1R8LA 1GOOA 3WQ5A 2ZUUA 2ZICA 4ATDA 4DWSA 3T0AA 2ZX9A 4GQQA 1B31A 4AZ7A 3GXFA 4U33A 1HF6A 1QI5A 2XVGA 2DSUA 3WUGA 1KR0A 3F5LA 4UTFA 3LPPA 4H41A 4TX8A 1UR4A 5A3HA 5AYBA 4JHZA 4IPLA 3VGHA 2OW7A 3B9DA 4CGTA 1EQPA 1PIGA 1UH4A 2GUYA 1I1XA 3VIJA 1E3ZA 3POHA 1DTUA 2PBOA 8CGTA 4H8UA 2GFTA 3AHZA 3SCQA 3W27A 4LXFA 2VCCA 4U31A 5I77A 2XWEA 1J0KA 2CETA 1IZJA 1OD0A 4AEFA 2VCBA 3GM8A 3B9AA 1BTCA 3VGBA 1GOQA 1KFWA 3MS8A 4HMEA 4UNIA 2GVYA 4GI6A 5AYIA 3AJ7A 3BGAA 2PWHA 5A94A 1H41A 1ISWA 4MPKA 1GOIA 3N11A 3WY4A 2EAEA 1NOWA 3EMCA 4IISA 5I3DA 1JD7A 2ESCA 1D7FA 1UZ1A 4GO8A 1KQZA 1ECEA 3A24A 3M07A 2NT1A 2QHAA 3NJ3A 5CPQA 1UWRA 5E0CA 1G0CA 2XGIA 2V5CA 5CGTA 3WNMA 1SFSA 3EDEA 2VT0A 1MVYA 1JFHA 2WHJA 4M82A 2DH2A 2ZOXA 1HXKA 4M29A 3FHQA 1GOWA 2EABA 2C7FA 1QPKA 1EQCA 3WQVA 2YFOA 4XV0A 1KCKA 3RM8A 5CJ5A 2ALWA 4S3KA 3DECA 2O92A 1UASA 1WB0A 4D71A 1A47A 1FP9A 3CLWA 3HG5A 1HP4A 2JFEX 1WKYA 3GNPA 4P8XA 3M46A 3WQWA 1V0LA 2WYSA 2EPMX 3WMBA 3S6TA 1VRXA 5C8BB 3IANA 1H0IA 1CXFA 1YQ2A 4EKJA 2QPUA 3S5YA 3U57A 4YN5A 4FF5A 3CGTA 5CLWA 1KGUA 3AQUA 2WKLA 2DIEA 2OSYA 1GUVA 3CPUA 1UA3A 3BAXA 1KXVA 2QMJA 1EXPA 4PMDA 1AQ0A 4CCEA 4JKMA 2XN2A 1UUQA 2CYGA 1WDSA 3N17A 3W25A 3K1DA 3WF1A 4DM1A 3VGEA 1E6ZA 3OA5A 4C7DA 4CVWA 4Z2LA 4AIUA 5EFFA 1JDAA 3ZOAA 2D3NA 1V6YA 3GNRA 3GTNA 5CZKA 3L4YA 3WH5A 4GQRA 1UR1A 1VFMA 2BY0A 1XD1A 1CGUA 3K8KA 4DO6A 2WLZA 2ZUWA 3VOCA 5M3WA 4W5UA 1I75A 2BHZA 1CZ1A 3W29A 3AMDA 4WKHA 5GNYA 2WHMA 1ZBKA 4JFVA 3FN9A 1E6SM
chains in the Genus database with same CATH superfamily
3Q45A 3E0VA 2WVUA 2V5KA 2PGRA 5LXEA 4G7FA 4U1GB 3SUVA 5I1GH 3PFMA 6TAAA 1NFBA 3AZTA 2ZA2A 3C2YA 3D3VD 2P5WA 1JGLL 3FCTB 1LGVA 4HPYL 3QXUA 3SCNA 2CHXA 2BCKB 1XLBA 1WUEA 3IE4A 3SUSA 4NFBA 3RQ3A 5CN1A 5GISH 4NAJA 4TSBL 3QYCA 3LZ5A 4QTHA 5I03A 2DQTL 1NOAA 4BBWA 2HLFC 3ULSB 1HFUA 2B9AA 4ZK8A 3T6WA 1IO4C 3NZ1A 1JCXA 5DY3A 3A22A 1NLDH 1SRDA 2V2WB 2XZ7A 1TJRA 2E6JA 3OM3B 1FO0H 1TMCB 2IFGA 4NYUA 2BNJA 2A5HA 4YZWA 2R56H 9PCYA 1E9OB 1YMMB 1FWEC 1I4FB 1U95B 1DJIA 3E9UA 3O45B 4LCUA 3APDA 1FNFA 5DEJA 1MZYA 1GW0A 2HZGA 4XTRC 2Z31A 2QDGA 2AANA 1IMHC 3CJPA 2EXOA 1R87A 4JFHD 4JANB 4QBXA 3M5VA 1KV8A 4ACTA 2JB5L 2F7IA 4U2YA 5C09D 2FZBA 2NY4D 4NI3A 1VQTA 1MFMA 2APTA 4GWEA 1LLOA 3SBQA 2RALA 1D5BB 3E0GA 5J6SA 2GGGA 2C0HA 3HG1E 3QXAA 3BZEA 5JHLA 3TQVA 2JGQA 5D1ZA 1N5YH 4XN9A 1T2QH 3IFPB 4MS6A 1S9YB 3MN8A 1WITA 2DUXA 2WZAA 4DZHA 1PW3A 1NCTA 1NCGA 4TUOB 2R1WA 3A23A 2A85A 2BOCA 4NBXB 1D3GA 4U1NA 2LR4A 1WGVA 1WTGT 5IJCC 1S3KL 3UTTA 1P6WA 4NXSA 4WJ8A 4CVUA 1SJCA 2J6EH 3WTTA 1JHLL 2E8ZA 2ZE0A 2WANA 1MLBB 3GEFA 5B7YA 2HE5A 4ILSA 2PDUA 2GJ6A 2CGRH 4C7GA 4K94L 3H2QA 2I14A 2OEJA 4HNCA 3FO2B 4RRPM 2H9AA 5JW5A 2XA8L 4NN6B 1VADB 4PJ5E 3I84A 3W7LA 1DDHB 1C29A 3LRGA 3TWBA 3FW6A 5HJYA 4F66A 3VKDA 1WC7B 2HVKA 4BCEA 3INUL 2H2PC 3STLA 1AD0B 4QE1A 4APQB 3DXIA 2EYSB 1ZSDA 4TOYL 1Z2KA 4DM2A 1WFMA 2VM3A 4OFYA 4M4RA 3HFYA 3FSOA 5KITA 2OK0H 1EGJH 3ARDB 4KVPA 1ZS2A 4TNFA 3UETA 4IJBA 32C2A 2OMTB 1UUOA 2FJHA 3A0OA 5LVEA 1Z69A 1DUYA 4FGMA 4H7CA 4URTB 2R1PA 1CB7B 2PDXA 1OTSD 3AU1A 5ESQB 2C8NA 1GQJA 3CQHA 5BS0A 4L8SA 5HY9B 3FNKA 2H32H 2EVHA 2PNDA 4I13B 3AOFA 4IHOA 3VI3F 3BP4B 3WMSA 5HBBA 3CH1A 1GGOA 2POZA 5FL1A 3FGCA 4JEQA 2WXNA 3OD3A 5C6TH 5DMMA 5D4QA 1XEUA 3F3HA 2R7EB 4O0KA 4ZFOL 4NO0B 4NP4H 1KIRB 4YHIB 1P84J 4QM1A 5A2AA 2E86A 2YXVA 3DNKA 3VNIA 1HH6A 4DK5A 4LCYA 1OP9A 3T3PB 2Q8AH 4JKLA 3SQRA 4EQ2A 3PIQA 2R91A 1JGUH 4AMCA 3HA0A 1XM3A 4X4MA 5IVXA 4XP1H 3CEUA 4ETQB 3WJJC 5IHZA 3RJXA 3O9NA 5C7XH 1ACCA 4OKVA 3T1WA 4HKPA 1A3XA 1F1AA 5FM8A 4HJGB 4PRAB 1Q5MA 4ZMYA 4YNYB 2BWQA 3RWEA 3W9EA 3WBAA 3QWRA 4WCYL 3FSTA 4MQ7B 2ZX7A 5PTDA 3ONBA 2XG5B 4QISA 2QJMA 4ZMQA 4RFOL 2WKOF 2AXGA 2MCG1 5HI5C 4EUPG 3BIAX 1WCBA 8FABA 3SYQA 4MCZB 4S10A 2I7SA 5G4NA 1HDMA 4YPJA 3DX6B 4PRHB 1UQSB 4CMMB 3SCVA 2A83B 4DCQB 3G5XA 1WBJA 3SGGA 4KK6C 2X4RA 3QUMH 5DZAA 3TBTB 4WV1C 1A5LC 4P2QA 3DG6A 1TZ7A 4DLFA 3CO4A 5KJRL 3EJCA 4EZKA 3QZWA 4LCCC 1EQWA 5FO9B 5IQ9B 3LENA 1T21B 1KJ2A 1YMME 1CFTB 5F3BA 1TR7A 3G1VA 4A4AA 2QTVA 3TTQA 1NAMB 4C8XA 4KROC 1UIOA 3WEOA 4PN2A 2P8LA 4Y4KC 1RHFA 5F72S 1BRLB 1X3DA 1PZ5B 5BWFA 2ENQA 1BQUA 1HVQA 3PL6D 1BOGA 3PSVA 4DUVA 1D9KD 4RCXA 4W7WA 4G3YH 1YAZA 4IOIB 1JV2B 3R1ZA 3DPBA 1RPUA 3Q67A 5IW6B 4QYOB 2B4CH 1BXUA 4LVNB 1PTGA 2VQTA 3QGAC 1F11A 5DMIH 1RK5A 2ADFH 3FQXA 4Z7AA 2K4AA 3W7KA 1EDQA 2ATKB 2J6VA 3BVTA 4ZPTB 2YDQA 2B1HL 1B3XA 3EA3A 2NVCA 1IZKA 3UTSA 1XGTB 1F18A 1BQLL 4QOKB 5C0GB 3T0ED 1WV2A 1ML1A 2P7TA 3O3DA 3NZGA 2X88A 3CN3A 3PS6A 3KPPA 3IJ7A 4CC4C 3PZTA 3M0KA 3HR6A 1LORA 4NNBA 4H8WC 1FG9C 2OG9A 1N7MH 1RI8A 1JPMA 1O6SA 4S3AA 4GUGA 4WHTB 2MANA 4ZQPA 3AZSA 3GMRB 1LCOA 5KVMC 5H8DA 5L9DH 2WSDA 2FVNA 5CPLA 3T2OA 2V7NA 1BM3H 4ALAH 1BX2A 1NAL1 3ZR5A 1ORQA 4JNMA 1BVZA 5ERWB 1P6FA 1EO8L 3DXAA 4XX5A 4HU0A 5IUSA 1UADC 3ARBD 3APFA 2OODA 1X9QA 4WW2B 4XG1A 3N43B 1A7BA 1N59B 1U91B 2QF8A 1L3WA 3TVMC 3BESR 1RLCL 3TIDA 4JQ4A 1H8OA 4UFMA 3Q1SL 4ZFOA 4N26A 3BEVB 2LAGB 1H5BC 3DHDA 5CF3A 2APWA 1DJXA 3N41F 5KUMA 1XGRA 3II3A 1R75A 3HZVB 1D6EA 1M65A 1NM9A 2H0PA 3QHNA 2WXLA 1A7RL 2R0KL 2G8ZA 4Y9FA 4S3DA 4OU3A 3A6CL 2YL6A 3WFHA 5AZEL 2F7PA 1QFWL 1MUMA 3MHFA 1KPRB 3QR2A 3E6EA 2ZQKA 4JTTA 5DHYB 3TR2A 4YL9A 4S3EA 3FULA 5HR7A 4U1JA 1WAUA 5I1DB 4WI6A 2MQCA 4R3UA 3GB6A 1L6ZA 3OLDA 4AQAA 4PJXF 4BFOA 1VKXB 3HCVA 2J7BA 4L1LA 5ITFA 3VXRD 1W0VA 1TJGH 3OPZH 3W70A 3V4BA 5D8JL 2YKLH 2J6XA 4PUUA 5JO5B 1P43A 3E38A 4NM8L 1GRWA 2BVOA 4YEEA 1ET5A 2UYLB 4P57B 3T3PE 3VXOB 3I6GB 3JR2A 3GZAA 4UTIA 3VD4A 2EDQA 3PGCA 1KN4L 5D7LE 2FBRA 3E6HA 2IPKB 3X2QB 4E2DA 3V1PA 3EYOA 1ICTA 4DF9A 5LG1A 3FH5A 2OAAA 3TO4B 3TA3A 2XOTA 1KC7A 5F6IC 4EN3C 4QAMB 3RL2B 4HWEL 1RIHH 2CGYA 5IOBA 1A14H 5H8MA 3SBPA 5FJIA 4A8NA 3QEGH 4ZFGH 3FIGA 1T8XA 3RNDA 2OTDA 1T22A 5KZDA 4MD5A 2CJUL 5GS1C 3P77B 2C91A 3V95A 4S1SL 3QC0A 5M17A 4J40A 2B20A 2G4GA 3DK2A 1ADQH 1IM9B 2J8TA 5J7CC 3W39A 1GGCH 1U21A 3SDDC 1LMKA 1GAFL 2X41A 3ZTJG 5EBGA 3C3NA 2Z7KA 3LTVA 3C5ZB 4P3WA 2VZOA 3ELQA 5FF6B 3F7KA 1TPC1 4XBJA 4XPBH 3PABA 2JI1A 4JBRA 2I17A 2CHZA 1L7TL 4X42A 1DQDL 3WFEL 5CSSA 2E7FA 3DFYA 4AC1X 2NY3D 1NF7A 5HNUA 3W0WB 1VZIA 2CRIA 4LRTA 1XL9A 4Z6AT 5TH2B 3FFCD 3FTXA 5AVSB 3QIBD 1Y6NR 1GMIA 3H55A 1V6WA 3HAEG 3CHFA 4PTUB 4UR9A 3D30A 3B9VA 4JY5H 3GSUA 2J7FA 2FO8A 1EXBA 1KIUA 2EIMB 4UFHA 1K5NA 4XN4A 1FFTB 1NCAL 4FADA 3KVLA 2GTWA 2BW4A 4MM1A 4D0DA 1OTUD 3W1NA 3SE4A 4J28A 5I1LB 5AW5B 3HOGA 3FT1A 2VN6A 1CZ8H 4HIIA 4NRRA 3B7UX 3UYRH 3N1QC 3KNBB 4QOKE 3KH4A 1GZQB 2QPSA 2I5QA 1OSYA 3KDOA 4GHRA 5B1AB 4LLWA 1JNLH 5EC1A 1BXVA 5E5MA 4JAMB 4F8LA 5EHFA 5AVUB 1H3UA 1FNHA 4JTSA 4QRBA 4LLVA 2ODIA 1MFAH 3FZUD 4NCDA 2ZWSA 4JO2H 3R19A 3EOYG 1BJ1J 1R5YA 4PU2A 5AC8A 5F70A 4QDPA 1X5AA 3ZTDC 1DE5A 1EO7A 1OK0A 1MNNA 4L9DA 4XAZA 2XKUA 3S3CB 1E72M 3QI9C 4Q9CA 3CB8A 1YBQA 5CG7A 3WJSA 4WENB 4LBEA 4RV8A 4B2DA 3S2CA 3MDUA 1NC2A 1P1VA 4NASA 4O02H 3RUGE 1PL3A 3MRMB 1P7QD 1X5IA 35C8H 5I73C 3SCOA 3GFXA 2YB4A 2F54A 4XCFL 2ZZ5A 1OT1A 2DJ4A 4ECLA 3RAOA 1TWZA 1WBZB 3O6KL 5E4IA 3CK0L 5IFAH 2IPWA 2FE0A 1LEGB 3AC0A 1K8XA 4YSAA 3DPDA 4HUVB 5FYJH 4QGYA 5JXAL 5ALCL 1I9CB 1UUMA 5IK3A 4O54A 2EDFA 3TUUA 1NCJA 4O28A 3ZRFC 2HXTA 3CVHA 4Y16B 4YWGH 3K4ZA 4NJKA 2GIXA 3MRIA 1LE9B 2IOMA 3KVDD 3N42B 3O6FC 4FXFA 3TEUA 3WFCH 1W72A 3Q3GB 2FH6A 3D2UB 4PN6A 1XPYA 4IPPA 1KCSL 5CD5D 3HMWH 3I2CH 4I0PA 1H6UA 1GTFA 4G5ZH 4ZFZA 4F8XA 1XLAA 4GG8A 3M6YA 5DA4A 2OSWA 3PGFL 4MHHG 4OGAC 1UZ8A 4F2MA 2DTMH 3QAZB 1GYWA 3F83A 4DKTA 4KKZA 3H24A 1UWXH 4N6RA 4ETYA 1H3TA 2NQ9A 4XAWH 2Z1KA 3SPJA 4BH8B 1CL7I 3AS0A 1MUCA 4OJAA 4JN2A 3ATFA 3VFRB 3ABGA 2DZEA 5FS5A 1FH9A 3W6LA 1E9PB 5L88L 2DD8L 3JZUA 2OR8A 2ATPB 1J11A 4PLOB 2OKTA 5BZWB 3UU0A 4IT1A 4M1DL 1ZT1A 2EDHA 3SQSA 1WAWA 1PQZA 1N67A 2NXYB 1JZIA 4WHDA 3BAJA 2CCRA 1HC1A 1MWAA 1SXCA 3DFNA 5HVFB 4HETA 3W87A 1XGYH 1Q1JL 3W37A 4AFYA 2L4OA 4MTMA 3KPSD 3O9WB 1SDAB 2G75B 3IACA 3NQBA 5C9ZA 2QJIA 4MS8C 4IOSA 5I6SA 4GAYA 3VZYA 4EE9A 4OQTL 4PB4A 1E73M 1K85A 4QP0A 4QXUH 3L5XH 4XI5C 1ZDSA 2VW6A 3MOBL 3IAGC 2NY7L 2AK4B 1IC5L 2PF0A 1ZXQA 2ICSA 3ARGC 4P9HC 3AAZB 4N86A 2NY6D 3F64A 1BGXL 3A6BL 1AJ0A 4X6FB 4G8GA 3VRJB 4NOFA 1O95A 1O7SA 4CGUB 2HTMA 1CO1A 4K73A 3I68A 3FCSB 4O58H 4HUUA 4DEFA 2V2HA 1JWUA 5CO1A 2H3KA 3W0WE 4DWSA 4K8RD 2FTWA 2YGPA 4L3ED 2XVGA 3P9MB 4AXWB 5E8DL 5F7KC 2YMXL 1YEEL 5D02A 4C55A 1YEFL 3GMLB 1ACYL 2B7DT 1RLBA 3GIVA 4EDXB 3U7YL 1D7CA 5KTEL 3BV7A 4YSSA 5EZOL 4WUUB 1JRHL 1MI3A 3U79A 4U31A 3QO0A 3BWAA 2IAMA 1Z9SB 4UNIA 5FJPA 4GI6A 3O8AA 4FCAA 1WFUA 3PVFA 4M8QB 4LUTB 1VC4A 4I5UA 2HS6A 2NT1A 5I30L 4R90H 1UB6A 3U3HA 1NCOA 5IF0A 3C3UA 1DBKH 1QPKA 4B92A 4FD0A 3VCNA 4DVBA 3MRFA 4JZJC 3PAVA 4NNYB 1J86A 3BQUD 3M0JA 1E4JA 3S8FB 2MMXA 3M46A 5ILTL 5T1DH 9XIAA 1ZV2A 4MCYA 2OL3B 1F8TH 4FTVA 4AIZB 2WKLA 4FQJH 3LZOA 1QLRA 4A7SA 2FQFA 2HKHL 5HJXA 1RK1B 2QMJA 5EBMA 2VITB 4PMDA 2C9QA 2WLNA 4O5LL 1UUQA 4L8DB 4Z7UA 3HR5A 3H1ZA 2L7EA 1R3HB 2YYUA 5JLZA 2ZOOA 2LVCA 1TETL 3WLWC 2R2EB 1L9OA 3UZ5A 1AMXA 4K7VA 1QACA 1MG3C 2BY0A 2X28A 1TQCC 4IIFA 3NM1A 2G9HA 1IGJB 4H7ZA 3NFNA 4KKLC 4OIIL 3MX0B 1I0BA 3FN0L 2SEBB 3LEYH 3BL3A 1RFDL 3NABL 4P06A 2K0RA 3IGFA 5AHNA 5HHOA 2B5IC 5D7IE 4LOCA 2NTFB 1MCIA 1QFUL 1VGEL 3PWLB 3RCNA 2W65B 4WU7A 4NZFA 2K6WA 1CENA 2XXCB 5SX4I 5JHAA 4HUWA 3VVWA 2OMXA 1F6YA 1X8CA 1B4LA 4XWOD 3DENA 3DHUA 2ZZ2A 2BFGA 3DFQA 3IKCA 2GQ9A 1XS2A 3BO8A 1OCOB 4QHNA 2ZG2A 1CDCA 2GHZA 4HWBL 4AKPA 3I3EA 4JPIB 5LAPA 2P42B 4N2KA 1J1PL 3HE7D 2VDRH 3GJFK 4NXKA 2UUDK 2UZYB 4OQTA 2OXGB 2XG4A 4DJDD 1AJZA 1XCXA 4MWAB 4PJ9A 3QZWG 1RL1A 1SYSA 4U3CA 4KU1A 5MEPB 4M6PA 2GDVA 4LF2A 3RRXA 3IVKB 2XFWA 2G5BB 1U3HD 2CE6A 3R8RA 4WY7L 3WIHH 3SYOA 2OEMA 3C87A 1E0XA 1DORA 3IUHA 1JAKA 4GKOA 4FXTA 2CBTA 4C60A 4CJ1A 1QK0A 3JVGC 3BD5A 4E9RA 5AYTA 4CAGA 1VFUA 1NDWA 1F90L 5GNXA 3U9PH 1MQPA 5EZPA 3L5HA 1DEEA 2J88A 2QGDA 1X7SA 3L2IA 4RNFA 3EKZA 1HWGB 5HBFA 1W3LA 3GTVA 5IVZA 4OIBA 1C5CL 5TK2A 4GQ0A 2QBWA 1SBBA 2HLFD 1PZBA 3NVTA 1Y0EA 3ZE1E 1FNSL 3KJ4C 1TCMA 3WLNA 4CSPA 1Q7MA 3M17B 5BXRA 3D4ZA 3DUGA 4Q8QA 2AK4E 5HYSB 4E42B 2ENYA 4DWDA 2YWYA 4KPLA 4ZXBB 3IM1A 1XYAA 1WJ3A 4DBSA 5D9PA 5BUGA 1T0NB 4R7WA 1I9IL 2LQRA 1K4CB 3TLQA 4V1XA 4LOFA 2CKSA 1OQXA 1EANA 5D1QB 4F79A 1FGNL 4AUYA 3FONB 5D2XA 3AGWA 3NR0A 4XTRD 3UAFA 1W91A 2QEZA 3R4DA 1J5CA 1ZPTA 3IU4H 1RP8A 2KPWA 1KGIA 3SE9H 3QNZB 4B3LA 1TKWB 1A1OB 4F7PB 4YSQA 4DAGL 3ALGA 3C2RA 3SYAA 3NPSC 1WWWX 4I7WA 3HGRA 2VQ4A 4QRSA 3IGAB 2H1LM 5EOCH 2HT4D 3MHZA 2ALRA 2BB0A 2X09A 3C6SA 3PANA 5EU7C 5RUBA 5DJCA 1HJSA 5HI4D 3NSYA 1JNNL 4JRWA 1BFNA 5F6HJ 4LX4A 1A1MB 1OM3H 3IUDA 2YC1A 5LNGA 4FL4C 4ZYKA 2WN3A 5CZRA 4MBOA 4LVHC 4ZOAA 3HW7A 1EBAA 1TZIA 2R8SL 2DQGL 2BIPA 3BVVA 2PE4A 1PDKA 3BPCB 1JCKA 3BDKA 1PKYA 2HKFH 4RDBA 4HJTA 1AIZA 2DQJH 3QUZA 2VZ1A 1Q9OB 4EUPA 1TEYA 2Z91B 3NZUA 4UDUB 1FVEB 2DL9A 2HG5A 3CZFB 2ZXWB 3TT1L 1ZSHA 1I8LC 1QNPA 3VNDA 3VB8A 3BPOB 6PAZA 2KMWA 1U8KB 3OXRA 2B7NA 3VZZA 4NIYE 3UEQA 2H2PD 4WI2A 3MXWH 4I3GA 3CLEL 3RIFF 2IGTA 4IMCA 3OR6A 5HHNA 4MXQD 3RY6C 4CBPA 1RVFL 2E9MA 5LAXB 3KW7A 5GGQH 2PDIA 5C97A 4XP6H 4WWKA 2X2JA 1KCLA 3O3AB 1JMZA 2VC6A 4NRZB 1TQWA 1XR9B 3PZQA 3JWNE 4PB5A 1CXHA 3RR1A 1NDGB 4PJBA 3FJTA 5GGTH 5EU6B 2GFBB 4L4PA 3SJVE 4D0BA 3FSVA 4WZ9A 2FX7L 4JM4L 1QUMA 4KBXA 1PZ3A 1FXQA 1K8IA 4G6CA 1J9CT 3TAOA 4R85A 1ML0A 2Y61A 1K3ZA 2D31B 2BNQD 5CWSB 5B1BB 3VTMA 3M0XA 4DZ8A 4X5WA 4L2YA 3EYVA 3P80A 1KKRA 4NZUH 3F2BA 3R06A 3PHQA 3PREA 2X40A 2ITCA 1UXLA 2PZ0A 3IAPA 4F7CB 1KXTA 2IXQB 1EYEA 3RPDA 4MWAE 2AEPL 2ESVB 4WKZB 3JRKA 4YIWA 3T65A 3CAQA 1QZNA 1A7NL 4FZ8H 5MERB 1TPWA 2VM9A 5AAWC 2O30A 2KPNA 2PB1A 3MVTA 4F57L 2YD0A 4ACZA 4OLWL 5FYLE 1YYMH 2IJ0C 4IBTA 3RVUC 2P10A 3WJZA 4HD9A 3N2XA 2P80D 4IOTA 5IOPB 4NYYA 1P7KA 2GPZA 3T04D 3RTQC 2Z26A 3OEXA 3HS0B 3UCCA 2ONEA 1BGGA 3N18A 3F7YB 4POZD 5HI5D 4JREB 2VXUH 4UQDA 1UR9A 1YPZA 1SGJA 3MROA 1LLAA 3KBSA 4NUMA 2GSIA 1L9TA 4CD8A 5KSAA 1QTWA 2HNEA 2IANB 2VM8A 3Q9QA 4H2AA 1BTMA 4BQ2A 4LRNL 1ERNA 2AABL 4Y90A 1A7QH 2B39A 3KPRD 2NVAA 2Y63A 4O2EA 3REVA 3T2PA 4ZX4A 4P5TB 4Y2LA 1NPJA 1I8AA 3JWOH 3RCMA 4JTQA 3CL6A 5D1QE 2A7BA 2Y25A 4I5XA 2INFA 2BZDA 3WNJA 1CIDA 4KROD 3ZHDA 2D0FA 3BSHA 4FDWA 1SEBA 1OFAA 3V6FA 3EYUL 1XCTA 1U5HA 5EL1A 4PAZA 2NOYA 1J9SA 4M5SA 1OAJA 3IMBA 2EDJA 2FL5A 2TSYA 4O1FA 4R7XA 5JXEA 1NLBH 1RBAA 2QCFA 4ERSL 3ZT6A 4FNTA 5FJTA 4PMEA 1D5RA 3QEUA 1TOXA 4GSDL 5KYYB 4D3CL 1S7SB 1QT1A 2ENPA 3EAUA 3KXFB 3FB6A 4C91A 3Q65A 5JHDA 2K6YA 4OJCA 3T8VA 3RZCB 3AWOA 5I1AB 2EUVA 3GPSA 1EBPA 5L2JA 5GZOA 1DVYA 5ES4B 2O0TA 2VR9A 3GZKA 5LJYH 2OZNA 4AITA 3O16A 4Q58C 3SO3C 5JNYB 1VCFA 3ITGA 2PWDA 5FV2A 2H47C 3I9IA 1KULA 3VC6A 3NOIA 4M6VA 4A68A 4H0GA 5ISZD 2BIIA 1SYVB 2KQMA 4TTUA 1XFCA 3OTRA 3SBWA 4B0MM 4DEPB 1JZGA 3TNNB 5CS7A 4YDLB 5F7UA 2I5IA 3GSNL 3RKDC 5CZVH 4LF3A 2DLFL 5FUCE 1GJIA 3CDYA 1ITQA 4AMKH 3H9SD 3D3VA 5I6MA 2VQ1B 5AG8A 1MCKA 2VDQL 3MRHB 2MQ3A 1DBTA 1R9ZA 5HGBB 4PTWA 2VSCA 5IKCB 5FM5M 1IQWL 2DQIL 1QO5A 4QRUB 1QUNA 5CHNB 1S2EA 4AK2A 1AZRA 3ONCA 2BOFX 4R3SB 2PGEA 2JKXA 5KZEA 3ZDYB 1V51A 1US2A 3PQYD 1F6PA 2XWTB 4JFXB 5H91A 4DJEC 1EMTL 4DZBA 3ICJA 2ZWZA 5EU6E 4F8QA 5K2ZA 4OKDA 2VLME 3HAEA 4GUCA 1L6GA 1KEML 1G1CA 1DN0B 5FKAA 1M7JA 1T20A 1BLNB 5IB2A 4LC6A 1B3VA 2J5LB 3TZVB 3ZTEA 1BG1A 1Y6KR 5D7JB 3ULUF 1QNOA 3N6JA 4Q7BA 1KJVB 5EBLA 4DF2A 3G6JB 4DKEL 4AYGA 1VRSA 1NCHA 2HG0A 5IHBA 5J3HD 2A3HA 2VGBA 4TR9A 1IXOA 3JU2A 1MEWA 4S1DC 5D5MB 4M61A 2AQ3A 5C09A 1DQTA 3GI9L 5TD4A 2ETWA 1K5WA 3L4ZA 2VGIA 2XYCA 3U1SL 2J8UB 5J6HA 3GO1H 5T3ZH 2ESVE 2W0PA 4GI9A 4PUMA 3NAAL 1PDYA 2J47A 2EDYA 2ZAGA 2XPGA 2IS7A 1KPUB 1FRBA 4EPBC 1T66C 3NQKA 2VVNA 4Y4FC 1F6AA 2DWYA 3CXDL 4MAYC 1Q6QA 2HRGA 1AR2A 1WSST 3D39E 3DMMB 3U7VA 4LOUC 1A53A 1OAXH 3BKYL 2O4QA 3CFBB 2D0GA 3MBEC 2OPJA 4D72A 3M7SA 2H8PB 2ED6A 1IL1B 5EU3A 2V8ZA 1K7EA 4YO0A 5AW9B 1TREA 1PVNA 1VD6A 1GNXA 4KJPD 5EF3A 5EB9A 5EA9A 2H3NB 1CLOH 4N0FB 2P24B 1EERB 5AWNH 4KQ4L 1IGMH 3D07A 2XACC 1U2CA 3D33A 3FF8A 1DVFC 2NQLA 4DWHA 3SDDD 4CQDA 3IMWA 3BLOA 3CYVA 2ZXDA 3CUXA 3MRRA 1JEZA 3RWJA 5E94A 1CF8H 1SOSA 3WLSA 2I9LA 3QC5X 4G7YL 4ZFQA 1VBRA 4QRQA 3HG3A 2Y0SA 1TUFA 4MJIB 3SCWA 4R96A 4ZFCA 1RULL 1UKQA 1J2BA 2J6WA 1TMLA 4G7VL 4ZOCA 4UQIM 1J0HA 1WZLA 2C9AA 2B31A 3K72A 4N22A 1MQQA 2XKNB 4C65A 2CG9X 4XMZA 5I1HL 2UY7B 5M1TA 4PMUA 3GBDA 3E12A 3MMDA 4TVPE 1ZP3A 2IUZA 4HV8A 3RX4A 4Y19B 2A6NA 4X50A 3PNWA 5CU5A 3TL5A 2WO5A 3TX4A 5DQJA 2ZSVA 4LP4A 3SGZA 5C6PB 2XYLA 4AD3A 3GSNA 2ZOLA 5EOTA 5IMOA 2R23A 4G1KA 2WINA 1FBIH 4XVJH 4O4YL 3JTSB 5AAMC 4UM8B 1FNEB 3V79C 3QPKA 4OD3L 3QZEA 3C86A 2JKEA 3ECBA 4XHJC 2F7FA 2F74A 5SV4A 4QXGH 4BGDA 3GZOA 3WNKA 4IIZA 3A5FA 1W31A 2IDTA 4LPCA 3UJEA 1GVIA 4YC2B 1CLVA 4UTMA 4X61A 3T4AA 2XDHA 1XGUA 3BLBA 1RV8A 4K5OA 1IBZA 5KWYC 5I66B 4PJ7A 3MODH 3DHPA 4UINL 2D3LA 3WD5L 1OGSA 2FLIA 4J6IA 1FNLA 1KTJA 4L9YA 2W0KA 4NN6C 3DOSA 5FK9A 2C3VA 2O6PA 2WXIA 3KBFA 2TODA 5K33A 1QFHA 2PDLA 1PO9A 4RZCA 1KJ2L 1I8IA 2ZCLL 1B0IA 5C0CB 2DAVA 2F53B 4CW1B 1A1NA 5B39A 4ODSH 3P30H 5TGBB 5DVMA 1I3RA 2FFIA 1KJ3H 5B8CB 3R0KA 1AZNA 5DWUL 3QB7C 2K1MA 4OCRL 3X1GA 2DUAA 4D8PA 4Z7NE 5BNKA 4AEIH 2BIOA 4J2XA 2DP3A 1JHKH 4ZDHA 2DMCA 4NJAH 1FL6A 1UEMA 1N2RA 3WEZA 3ZLGA 3D18A 3EO0A 1GORA 2CHDA 1RA0A 1MYRA 1OIOA 4DUOA 3N2TA 3NGFA 2P48B 3KWTA 2VDIA 3IWPA 5K9OB 4JKKA 2NX5B 4REQA 3G6JE 3NDYA 4XODA 3BURA 2K8MA 3DEQA 1U93A 1WK0A 1E0OB 3O6FD 1GK8A 3P3BA 4ZR8A 5IHRA 3W84A 2ZJSH 5CGYC 5D5ME 3T2LA 3PL6A 2O7SA 1D9KA 5JW3L 3NO3A 3LHPL 3UGVA 5A8MA 5D7EA 3GSXA 1PY0A 4B3EA 3BSMA 2K3TA 5DRZB 1TJHH 4GW1A 1BYAA 1NCCH 2J8UE 1ODZA 2N7BA 4BK4A 2OP4L 1LO5A 2PP8A 1OABA 3TYZA 5AW2B 4JB9H 4R53A 2QYGA 5G2WA 2QVIA 4KK8C 1ZCCA 3DFOA 1EAQA 1XG3A 3GI8H 4GQQA 2EICA 3QUYD 5BOPA 4AVHA 1NAKL 3T0EA 4S2SB 1I7RA 2YS4A 1DLFH 2AW2A 2OMNA 3P7YA 4ANVA 3TXZA 3I6KA 3VXUD 3GAKA 4F2FA 4EXAA 3ZVVA 4FG4A 4Y5YB 4YHMH 4Q9RL 3OKKB 1YEHH 2ENSA 2YD3A 2YAQA 4FJZA 4KHTH 2Y1VA 1T8QA 2QT6A 2DLGA 2Z0BA 3UJIH 2FSEB 1GJPA 2O6FA 3GHSA 3ARBA 5CPQA 1GQNA 1UWRA 1G0CA 4YHLL 1RY8A 2ZOXA 2DM3A 4ZO7A 1GGBL 4F5CA 4XV0A 1KB9J 3Q43A 3SECA 3TAKA 1P5UB 1J96A 3APNA 4H25A 3W1XA 4X5PA 4K9EH 3CLFL 5B3JE 5C2BL 4JY4A 4CEXC 3VXNB 4IIQA 4XMTA 5DLML 4P8XA 1V0LA 1OLZA 2DQCL 2NQZA 1OEPA 3SE6A 1CXFA 4XZNX 2YGOA 5D4IA 4B5UA 3Q5TA 1H5YA 3ABMB 4PV9A 5GRZA 1OX4B 5E99L 3GJFB 4MSWB 2YB1A 1QWGA 5CLZA 2VXTH 3O11B 4Y19E 4NZ3A 1FC1A 4O12A 4Z78B 5FA4B 4W9JC 5AOMA 3BW4A 4WJ5A 5IZ7A 4WNQA 4LVNC 3VWKD 4AGLA 4KK9D 1TPH1 2WV8A 5HMDA 2VXVH 1VCBC 4PJGA 1S3TC 2FVLA 4ZOEA 5M3WA 4RDQG 2AXWA 3JWDL 1L6FA 3L21A 5EF2A 3TZFA 4FA8A 2W07A 2AQWA 3OB0H 1M9SA 5K59F 2F18A 3DTUB 3PE9A 3AICA 3IVSA 1OHQA 4DK3A 3F62A 1YUKB 3U5UA 1T04B 3TZNA 3UZWA 2CLVA 4GKSA 2DBLH 1L9QA 2O9PA 1URLA 2WLLB 2BDNL 4O1AA 4PRTA 1S78C 1BBDL 3FV9A 4FQ1H 3VNMA 1JDCA 2E9GA 4OZGB 3WFDL 5U4NA 4GUPB 3TMQA 1TMQA 1RBOB 3TPKA 3NCWA 4OM0L 4XPGL 2JH2A 3F6LA 4LSBA 2MKLC 5FSDC 3O2WL 1OT2A 2XQYK 4BZ2H 1J8SA 3KWUA 2YXOA 1FG2B 4C56D 1CWVA 3MXVL 1GTHA 4U6XB 4W6XB 3ZRCC 1U8CB 3ZO9A 2AK1H 4OH2A 4WKAA 1U1HA 4HMCA 3GS0A 3KPTA 3FCPA 3WLWD 4EPSA 3VIKA 4PJFA 5I76A 1MCOL 4AENA 2CO7B 1HL9A 1JVKA 2DWEA 4NO2A 3N6HA 4B9KC 5A8QA 3QYMA 3TCXA 4IQLA 3LEVH 3IXTB 4E0RB 2YSTA 3W6YA 2V6HA 4KKLD 1HCYA 3QIWB 3ZL2A 4X9YA 2X9XA 4WTWA 4FC3E 3L1EA 4NRYB 3V5KB 3A9BA 4W7VA 3UA4A 3QLDA 4GYFA 3CQKA 1I1YA 3MJ8A 5DD5L 3APCA 4GMEA 1MCRA 3QRLA 3HURA 1S9XA 3RIAF 3BGJA 1TLKA 4NWUL 4ZB5A 4HCIA 5B38A 1KNOB 5I0WA 1BAFH 2C1OB 3JUZA 3BZ4A 5AYQA 1OIMA 3LGGA 4KRPB 4OVVA 1N5AA 5DRNB 2Z1SA 4MNMA 5D70H 3GXDA 3QIBA 1JD9A 1URZA 5F7BA 3WK1A 1R24A 3H2MA 2P5EB 1A2YB 4ZMGA 3DJZA 3EBHA 3S3JA 4ML9A 4JBSA 4Y7EA 4BFEA 3MJYA 5G1MA 2CZDA 2WV3A 3OQ8A 5A2FA 2PO6D 2QDWA 5D2LB 3TU9A 3DROA 1WAAE 1MSSA 1X1NA 3R7RA 1SN0A 4Q4QA 2AEQL 4L3CB 4TU1A 5KTLA 3GDKA 3KBMA 3IS1X 1MFEL 2XPKA 1IVLA 4F20A 4L2LA 3LBMA 4FQLL 1PUDA 3GK8H 1JZJA 3BH9A 5C8JB 3VIMA 2ARJA 3F4VA 4L4MA 4BD4A 2PC8A 4W70A 4KFOA 3NH7L 4B91A 1T83A 3G3LA 2CNYA 3TO4C 3CV1A 3MUAA 3IRSA 5JH1A 2CUIA 3TFKC 1KB5H 5HGHB 2A9BA 3EOBA 2FEDC 4JEJA 2K4WA 2A77L 2IBBA 1TVBB 1W1IE 1XRFA 1T4KA 2NY5C 3WUWB 1UD5A 2VSMB 2DT0A 2ZUVA 4XKYA 3VCLA 1VLWA 5H94A 1D7DA 5HXMA 2MTPA 2XY1A 4GSRA 3DSNA 3VOGA 4NQXB 1D3CA 1TXKA 1NFIA 3ZUCA 1Q72H 4MWFB 3R13A 3IJEB 1FZJB 1INQB 4ZXLA 2G95A 1X5ZA 4ZUSB 4AW7A 4BKTC 1EJXC 1ADWA 3C5ZC 4MA7H 3CVHL 2W9LA 5I16B 2ZXAA 3UTOA 3E96A 1NELA 3ATYA 3WELA 2PR4L 1P7QA 3O05A 4D0CB 1W72L 5IMMB 4B95C 4PG2C 2EPHA 3NEVA 1N0LB 3AYRA 4LSUL 1HQ4B 3BH8B 5G1TA 4PRHE 3BJFA 4A7QA 4KEZA 1DWJM 4OZOA 3N40P 2Y5TA 1JGDB 4XC1L 4W9IC 5ID1B 4P3DB 3RI5F 4PWFA 3WF3A 3TROA 4TNVF 4PMYA 1AGEA 4Z2IA 3IDUA 3M44A 1SJMA 4BWWA 3TA6A 1XXXA 2YAMA 4F7EB 2IOOA 2JCCF 3IN2A 3EWYA 1LL4A 1RD5A 1EEXA 2CDFB 4K7FB 3QFEA 3MRJA 1FL3A 1D2OA 2X0HA 3CHEA 1ME8A 1KW1A 3LZLA 3RDJA 2QQKH 3L1OH 1MWAL 1A6AA 2E7LA 1VERA 4M7SA 4EVNA 3UPMA 1U8OB 1IXPA 2CERA 1CGSL 5CEYB 2EJAA 2AJ3B 4CQ9A 4OCLC 4UV7L 2VE6B 4NPJA 1EGMA 1B4RA 4OZGE 1U30A 3PJTA 3RM9A 3BZGA 3AHYA 3UJJL 5DT7A 4AE0A 1F86A 4RWYL 1UA6L 4L1GA 3MLSL 3V9FA 3WU1A 5FKYA 4KZDH 1SFTA 1NBZA 4TSCH 1NH6A 1FGVL 1A3LH 4XMPH 3CDZB 2WSRA 1KM5A 1P69B 2FEEL 3LH2H 4MUZA 1RUPL 1M42A 3MGOA 4RNRA 4JQIL 5JPMB 3UC0H 3KPSA 5EYWA 1V27A 3CFCL 4HA0A 4KH2A 3AIUA 1FVDA 3EYSL 4AZ6A 3U36B 1G9EA 5D7KD 4O14A 1QHZA 3ZVHA 4TM9A 5DANA 3HC3L 2BSLA 4AC4A 1MCCA 1YNKH 5I0YA 3A67L 2Z1PA 3GYRA 1ME9A 4YXKH 3PC0A 5G5DB 2OM5A 4R0LC 1BZ7A 1ZY9A 2XRAH 2AKRB 4N8VG 3V0FA 1H3PH 4MF4A 4HFUH 1D3HA 4NKMB 3PHOB 3FRUA 5EPDA 4LNRA 1BVNT 1K7XA 4L3EA 2N1KA 3SKUD 2BBFA 4FTDA 4Z3TA 3PNUA 2P5EE 3MC5A 2CDEA 4S1RL 3AHTA 4GOSA 2Q01A 1ZLUK 3CCHA 3BE1H 2FWOB 3KVPA 1Y6MR 5FOBB 3UTQA 5DRXA 1HKLH 2EE3A 4QRPD 1EZLA 1Z3GL 1W80A 2VMCA 5IBTL 1R5VA 1D6VL 1NIFA 1Z32X 4N4QA 2FGZA 2RIKA 3ZSTA 5LNDA 3C8DA 5DFAA 1E51A 2PDHA 4AISA 1IGYB 3S3SA 3AALA 4DRSA 3TEYA 4ZTYA 4GGHA 4IJRA 5J1AB 5A2CA 3NCBB 1WBYA 4MJ2A 3OKDA 1FNGA 5FFGA 4MNHA 3DX9A 3RVUD 3ALXA 3ECWA 1E71M 4KJYA 2EPLX 4Q4OA 2BIQA 4ALDA 5KYWB 3THML 4M7LL 4L7ZA 3BQUA 5ENWB 3KPNA 3B56A 3DYPA 3OKMA 3GHEH 1OSEA 4HIJB 2WBXA 1E70M 2J44A 4JMXA 4N9GB 3IVTA 2CO3A 4LOVA 1DBBH 3O9WC 2JJWA 4KV5E 4IH3A 4UNKA 4EQ3A 3NSCA 1YMHA 4Q32A 3BC9A 1QA9B 4GQZA 4UMSA 4YU1A 5ID0B 3AHXA 1PTAA 4GAGH 2XWZA 1IEAA 2F0CA 4GXVH 1MCNA 2APVA 5EWIL 2O6EA 1PAZA 3MMUA 2NUXA 4KT2A 1EJ8A 5E5RB 5E5UB 5EDSA 1I8MB 4M43H 2I7GA 3MAWA 2NSMA 4R33A 1YLVA 3GKAA 5IQ7L 4GGBA 1XLKA 4CU7A 3UXAA 3FFOA 1P6CA 4DTGL 2VGFA 3WFAA 1HHKB 4KEVA 2APBA 3PWJA 4E9VA 5DY2A 4P5RA 4ELKA 3K6SB 1T5KA 1RJRA 4YE4L 3KWWB 2VC2H 1RK0A 3L3OA 4U4BA 1UZ6E 3U4FA 3I6LE 2IDQA 4XCNB 3W75A 3HG1D 4PRNA 5KYUA 4MJ6A 4QMEA 5B39G 4L4OA 4W4OC 1HJCA 2Q76A 2J77A 1F1GA 4XZ9A 3MOAH 4Y9OA 4ZD3H 4MZ8A 4F0LA 4JQIA 2E46A 1QO3A 1CLZH 2GUBA 3HE7A 4YX2H 3PGDA 3B9KC 2J88L 4N3UA 1WAPA 3CBRA 4DJDA 4QRFA 3B0PA 4PCTA 2VENA 1RJYB 4YDJA 3VKBA 4P5UA 5KJ4A 2G30A 2VMEA 1ZK9A 3B40A 3MFFA 3RIKA 5CJMA 3UY8A 5SWZA 1JCTA 4JFYB 3LY0A 5ANMB 2HROA 5TFSH 3UPBA 3ZIZA 1EGVA 3RCYA 1G7IB 4M1GL 1WZAA 3CFTA 1U3HA 3U0WH 4N9DA 3VI3B 1JXDA 1RAKA 2VDLL 5CR1A 3QHFH 4DYEA 5H2BB 1LEIA 4M62L 4DW2L 5E4EC 1QPPA 3RKDD 3H2EA 4E2VA 3RGBA 3TJXA 1L5GB 3LQMA 3U6WA 3OSKA 2ZADA 2PPFA 3A5VA 3MRGA 5F1NB 1Y5VA 5I3JA 3MA9L 2FJFB 2CMRH 2XZCL 4LDEB 4PG9A 3U6RB 4FQXB 5A2KH 1JZ5A 2HUHA 1GCFA 3RB7A 3HZMB 3FJLA 5F88A 2VR7A 4CKQA 1KLZA 1H63A 5FUOL 3LGDA 4LAJH 1S4IA 1ZLPA 4LZKA 3UESA 1ID2A 4PTNA 5KJ7E 3CVDA 2DW6A 4MCNA 1DN2A 1V7NH 2I27N 3AIRA 2OW6A 2GBAA 3JWNC 2NCMA 5AYYA 4KCWA 3O0KA 4H20H 1EWHA 4CLMA 5TDPA 1KYOJ 5AVNA 3L5AA 1YO4A 2C9XA 3GU1A 1M7OA 1A4KB 4LT7A 1PSCA 4Z7OF 3SGUA 5DR5L 4L5ZA 3CMGA 4XMKL 1Z7AA 3BLPX 3KBWA 1G9MC 3I9GH 3AQDA 1BEYH 4NQDB 5DS1A 3N1MC 1IGFH 1B57A 4JDVB 4NO3A 4KPHL 1LO0H 5F1UA 3R43A 4IBSA 4CNUA 2VH5H 4ORIA 1ZVYA 3OIXA 4OGXH 3LCLA 5I5IA 1W6WA 3D06A 1RA5A 4LLDB 4ESKA 4MAVA 4NQVA 4KQ0A 2N0KA 2WXDM 2BRQA 3OKOB 1L7IH 2VO5A 1FN4A 3SEPA 3FTVA 4ICCX 2FX8L 4MWAC 1BYCA 3DUSA 3RHGA 1OG0A 4Y4FD 1HJUA 5AHEA 3CZLA 3HI1B 4XPAL 4AK1A 4MAYD 4FYRA 2APFA 4LOUD 7PAZA 4P2OC 1LE5B 1IC7H 3ZTJH 1W8SA 4IMEA 2AKMA 4Y5XB 4WGXA 1ZQ5A 2ZKHL 3P73B 5JZ7C 3BXWA 2WBKA 5A95A 3OGCA 3AY4C 2PLKA 3ARUA 3I50L 5F9JB 4F0RA 3W2KA 2MRYA 3MBED 3IE9A 2JKLA 1BZDA 3E8UH 3B5HA 3P5ZA 3QXBA 3F2LA 5HHPB 2NW0A 2UVEA 2JKJA 1QFWM 2R6OA 5F1IB 4P7QA 4G80A 3QQ9C 1P6AB 4F0KA 1WZMA 1UBSA 4RGOH 4RBPK 1B0GB 2MQ0A 2AHIA 1DVFD 5MHSD 1ZHKB 4X3ZA 1MOEA 2C3XA 12E8L 4ZMZA 2ZA1A 5JIIA 4LARH 2C34A 1CCWB 1V54B 1W1PA 2IALB 3UGEA 1JYNA 3UZZA 1CE6A 3IDXL 1H51A 2H7WA 4BA0A 4MG4A 4XNQB 3RGHA 4JICA 2E4TA 5AFAA 1SLUA 2HFGL 4JW3A 4PMFA 3MUY1 1YMMD 4YXLL 4NVTA 3LKNA 1AZCA 5F7EL 1NIEA 3MRQB 4WIWA 1I1AC 3M7OA 3T44A 2VUYA 4MDOA 3QUXC 2R4RH 3WFBH 4M19A 1XIWC 5AALA 1P4LA 4J8RA 2UY4A 4P5SA 5KZCB 3T77A 4LCQA 3VDCA 2K70A 4QRRD 3X11B 1HG3A 2DQMA 4XT1C 1BQCA 5IB5B 2ZPKH 3AHVA 2ZXGA 3VD3A 2G3JA 4FXKA 4M3HA 3FF7A 3S5LB 2HN7B 1I1CA 1PZCA 5FEZA 2BNQA 3L66A 2PTVA 4WSKA 4HG4J 4LUJA 3CHQA 3N41B 4AM0B 3CDGA 4WX2A 4Y2OA 3V0TA 4IHBA 5CIPA 4IRJC 4L0ZA 1U8MB 3S8HA 3OAUL 3T6CA 4HPOH 1TR9A 1JSYA 1I7UA 3DRTB 4HLJA 4FXJA 5H8PA 1JPSH 2ZX6A 3W9ZA 1X5FA 2EH7H 4MDIB 4Q0XL 1TTIA 1ZB5A 4UI2A 3QEQB 3TWCL 1G7PA 1THAA 5ANME 1O9ZA 4OGYL 5B38G 4PGCA 2XHNA 3WJJA 4WUUE 3VI3E 3TBCA 3NXLA 3ML8A 1JFQH 3QQ4B 4XUGA 4PJXB 4MQSB 3VACA 3QJHB 3BVNB 4KDWA 4LE8A 1P7HL 1AG0A 3MLVH 3QNFA 2W67A 2VOMA 4BHUA 3L9CA 1MJ7L 3BO9A 1S2AA 4A2EA 5FUCC 1VFSA 4H5SA 2EDMA 2JBMA 4R97C 4V1YA 3AWGA 3JYCA 3DVGA 4ZE5A 4JFZL 1YN6A 2YPLB 1TCDA 5F7DB 3PAZA 2P9RA 3CN4A 3V4UL 3I65A 2IH1B 3NZPA 5FCUL 1GOOA 4M6OH 4YSEA 3W83A 5F6HI 4K7PH 1N3NB 3BRDA 1K8DB 2ABAA 3X12A 3F5LA 1SUJA 2GAZB 2YLHA 5A3HA 3DG3A 1R19A 1PIGA 3KPRA 3U0PB 3VIJA 1JZDC 3N0PB 4LCCA 2R1XB 1RZJC 5DUMH 4D9LH 4R26H 2BVUA 4JPSA 1E6JL 3MBWA 4Y1AB 3DDMA 4NAFB 3MRPB 4I18B 5I77A 3P0XA 1KF9B 4L4VD 2VCBA 2EILB 2P44B 4X4KA 3I9AA 4WI4A 3HMXH 1I8KB 5AYIA 5A94A 4PWJA 1XDJA 2WW8A 3N11A 5CGYD 4JG9A 2Q5BA 1VA9A 1R2TA 1QATA 1SQMA 4NN7B 2AKZA 1J1OH 1V05A 1YNQA 1KMGA 5CGTA 4HXAL 3SKJL 3MSYA 3H7BB 2DH2A 4BFJA 2XV0A 1CFVL 1FLRL 1WXZA 2ALWA 5ALBH 1NUGA 4ZODA 1PV8A 1WB0A 3UVIA 3CLWA 1HP4A 3QDJD 1NANI 2PTDA 5JHLH 4CDGC 1NGZB 5HUPA 4M6MH 3CU7A 4RSVA 5BO1L 5D7LD 3K71A 3P82A 2L0DA 4XP5H 4PS4H 1ZHNA 2ADGA 4B4FA 5J8OA 4FFYH 4EDWL 5J5EA 3WF1A 2XBTA 2QHRH 4UB0H 3CBKB 3WEBA 3IN0A 3WIFA 4ZVJA 1FHNA 1OARL 4FFWC 1DVTA 2X42A 1ZT7A 1VGKB 5ISZA 3SE8H 2ZC1A 1L9WA 1OG6A 5EF1A 3HPAA 1P1XA 4QEHA 7REQB 4C1NA 5CU9A 4EWND 1CGUA 4BKLB 3VOCA 2YCEA 5C0AA 3MRNB 2BHZA 4JX6A 2JLLA 2GTZB 5AVXB 4Z7WA 1ZBKA 3I75A 3CN2A 1SDDB 5A16A 4L5FE 4FHKA 2VX5A 1LP9A 1J5OL 3Q8CA 2DZSA 4NHUA 1FAIH 4U10A 3SKMA 3L5WA 3H9SA 2PCXA 3GQFA 4LU5L 4QKXB 4GAJL 3GUGA 2BGSA 3A4WA 5FO7A 3IGXA 1UD2A 3MSPA 3FU3A 2FBJH 4XBGA 1A25A 5J89A 2O61A 4QY8B 4P5TC 3PS7A 2FRGP 5ICYB 4C6CA 3FN3A 3PQYA 3W1LA 4C6DA 1T1YA 2DKMA 1CFNB 3OZ9H 1WEJH 2VFDA 4PGEB 2F7RA 3LK6A 1P1ZB 2EPNA 4LB3A 3FXIC 3QGKC 3M7WA 5CXPA 4KK6D 1DTNA 3O06A 3L0GA 1HI6B 3ZMEA 3K46A 2NSOA 3DX7A 2Z27A 5LNUA 2IOIA 3AY2A 4IGMA 5AD0A 3LB6C 3PWGA 3LRMA 1CN4A 2UWEA 4JPWL 5C7VA 3MCLH 1TJIL 5TF0A 3PV6B 1XF2A 2O5ZL 1BREA 3MMWA 1B88A 3LIUA 4WQOA 2YJQA 2PYFB 2V6AA 3TCLA 2DQEL 5I06A 2QCGA 4PVNA 3G6MA 5I79A 3GSOA 1JGLH 4HOZA 4Y4KD 2AFNA 4HPYH 1M3IA 3V0WL 4UR7A 2X5PA 4XGZA 1MDAA 3QQDB 4FXGC 4I4WA 2JV6A 3QEQE 4TSBH 2CIIA 2VXQL 4QHLB 1S78D 2DQTH 3MPGA 3PAOA 4UTAL 3H4FA 2DIBA 3I7SA 3NFPB 4IM8A 1CS6A 5E6IA 3V6ZA 3GU9A 4A2SA 2DI9A 1KTDB 3IMVA 2J57A 3GIZL 3B0YA 3WHXB 4XVEA 2FZ3B 4R4NC 1U8IB 1JPEA 2YUXA 2L8AA 3LDBB 3ITYA 3DAQA 3AXHA 4MZ1A 4HBQA 2YPLE 3NPWA 2X1WL 3GXNA 1KXQE 4WEUD 2FIKA 4FNPA 5EU5B 4Z0BL 4HU2A 3GVWA 2BWGA 5GIRA 4IS6A 2PLTA 1FYTD 3T9WA 2VHLA 2WIIA 2Q02A 5E93A 5HGGS 3CYJA 1R5IA 1O68A 3FU7A 3SDDA 2JB5H 1EEQA 4D6JA 4KXZH 1B6UA 1R3TA 2AL1A 2IBGA 1SLVA 1E0WA 3NQCA 4TXVB 3MU7A 4N8UA 4ZGYA 3WKZA 1IYXA 3HQNA 3FCGA 1A49A 2DT2A 4PFMA 3FJ4A 1DFBL 2ADJB 1HJBC 1M01A 4Y1AE 3C2AH 3GR4A 5DT1L 2PXYC 5IGXL 5FFLA 3TZVC 4BELD 4J3OF 1PX3A 3NCCB 2AXFB 3Q5YA 3SY0B 5D7JC 3ABRA 4U28A 3V4VL 1WFOA 4U1HB 3TVMD 4P2YA 3NYZA 3MLWL 4LUIA 1Q9LB 2VX7A 1S3KH 4P7RA 5GSRB 3EEZA 3NN8B 4WWPA 3TBVB 2DT3A 1JHLH 4WR3A 3O2VL 3NEXA 4HNTA 4CC0A 1KGXA 1YYAA 1KGCE 1QBAA 5JMUA 1ZE3C 1NGYA 1U8LB 4PLNC 4CILA 4H1LA 4K94H 5FECA 2DQ6A 2DJMA 3OG4B 5FJOA 3SQOL 3LCIA 4CBZA 2XA8H 1RQHA 4PRBA 4OIFA 3AREB 5JORA 2ZWLT 3PWPB 2BHUA 1QEWB 2BVQB 1WBXA 4LNCA 3INUH 1PKQB 2OOGA 3L95B 4ANWA 5HDBF 4TIMA 1A4JB 1HS6A 3DMMC 5G4EA 6FABL 4UTHA 1OX6A 5DJZA 2G4FA 4XX1G 3BWUF 4TOYH 3TFKD 1Q0EA 2X4UA 1GHFL 3LNFA 5IFPA 1LWJA 4Q8WA 1L0XA 3G08A 4NZ8A 3PPFA 4MSSA 2FEDD 2YK1L 3CSYB 4A6YB 1MCHA 2DYPD 2Q86A 2GK1B 3L3DA 3CQ0A 2R9RA 5IREA 4AZHA 3FO1A 2EAWA 3H3PL 3P11L 1RERA 1IWPA 5EBWB 1ZGLB 1CDJA 2F9BT 2PA6A 1HJWA 4R5XA 5C0NC 3IJHA 1ZTXE 2ZRXA 5JQIB 4UFLA 4YDVA 4M9OA 3FTUA 4PLKC 1K77A 3NK4A 4P59L 1TPB1 4EN3D 3TCEA 1XLJA 3ESMA 3CSGA 5ABHA 5HHMB 4L8CA 4U1GC 3IMTA 3MO1A 4N8VA 1P9MC 2ZSWB 1SJVA 4B41A 5J0BA 3MV01 1UWTA 2A9ML 1XWVA 1YY9C 1FP8A 1W17A 2DKUA 4W4QA 2VXQA 4Y8EA 1W9DM 1AHMA 4DKFL 1JXFA 1SGKA 4UTAA 2AGJL 1KT2A 3O3RA 3R25A 5MI0B 3DIFB 2IANE 1ZDQA 3HHSB 3HPZA 3QHTC 2Y85A 2Q0ZX 2I9TB 5C07B 2SODB 3FEMA 3O6FA 5HUOA 2WCGA 4IJ3B 4TV6A 3DTDA 1BOYA 5I6KA 2YZ8A 4ODWB 5CJOL 1L6WA 3LYRA 4JFTA 4K15A 1HZHL 3VIIA 4WCYH 1ZWIA 3IJQA 3VFMB 3U2SB 2F8XC 2LV4A 2YBRB 4XH2B 1OPGL 2R27A 3WXVL 4YC2C 1U8HA 4NZDA 5T1MB 3ISWA 1PBYA 2VERA 2GGEA 4Y2WA 1OANA 2JQXA 4G9DB 4LHUD 4NEHB 4I8YA 3QFWA 3LRSA 3PV7A 4UTKA 1MQRA 2QNEA 4IIDA 3QUYA 2A6DB 1ISXA 1YRKA 1TVNA 5HHXL 4HDIB 4UQ9A 2CHOA 4QHMA 3KOZA 3O2DL 3KXFE 2X16A 5KJRH 1MIEL 2D2GA 4BS0A 3VFSA 4Z3FA 3GMPA 3V4VA 2OJEB 4MQXC 1CWYA 4GW4B 3HIZA 3VXUA 3L3JB 4ZQRA 1XH1A 3GHUA 3NVDA 4X80L 1KLUB 5CEWA 3DYMA 3CZNA 2WTRB 1JPTL 1AJ7L 3W7DA 3GLEA 3KYKL 3H2FA 4JPGA 1XF4B 1QR7A 3S9ZA 2VLLA 3U25A 3VYNA 5T5NF 3TIEA 2PRMA 4TV5A 3WOVA 5EIIA 5IBUG 3UTZA 3M0IA 2WMHA 2ZF8A 3NQ2A 5K9KA 1JPKA 2CGZA 1HWHB 3UYPB 3VE9A 3SPIA 4LYPA 3S46A 1ELSA 1YLBB 5CUSL 3SKOA 1YPXA 3MBXL 3QI9D 4UOZA 2Y36L 2B1HH 2XA3A 4KS0A 5CP3H 4R5TA 2EGZA 1I7ZB 2OMZB 4YDMA 1EC8A 2WZEA 3TLLA 1BQLH 1SMOA 4APQC 1TRDA 3LPOA 3HKFA 2KC0A 3NIGF 1OHLA 1RZGA 3RLHA 1Q9KB 2ED9A 2BY3A 4MFDA 2NNRA 1YNTA 3ZDYE 1VZHA 3OMAB 3H4WA 1LF1A 1T7YA 4PL1A 3LEXB 1YDPB 3N9KA 5KVGL 4FQIL 2UZXB 1QXLA 4PSPA 3RVTC 3VWKA 3ARDC 1KJMA 3MLZL 4ZQTA 4PVBA 5T1LB 3PWPE 4PWKA 1R3IL 4F91B 3HRZB 4EOUA 1EO8H 1PKQE 1YVLA 5HHQB 1BQRA 3VX1A 4AF0A 3RFZB 2XVNA 1BD2D 3PTMA 3HQ1A 2YUVA 1XR2A 3TYCA 3T0DA 5CFHA