3VMPA

Crystal structure of dextranase from streptococcus mutans in complex with 4,5-epoxypentyl alpha-d-glucopyranoside
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
632
structure length
632
Chain Sequence
GNMINLTTDKAVYQAGEAVHLNLTLNNTTSLAQNITATAEVYSLENKLKTLQYTKYLLPNESYTTQKGEFVIPANSLANNRGYLLKVNISDSQNNILEQGNRAIAVEDDWRTFPRYAAIGGSQKDNNSVLTKNLPDYYRELEQMKNMNINSYFFYDVYKSATNPFPNVPKFDQSWNWWSHSQVETDAVKALVNRVHQTGAVAMLYNMILAQNANETAVLPDTEYIYNYETGGYGQNGQVMTYSIDDKPLQYYYNPLSKSWQNYISNAMAQAMKNGGFDGWQGDTIGDNRVLSHNQKDSRDIAHSFMLSDVYAEFLNKMKEKLPQYYLTLNDVNGENISKLANSKQDVIYNELWPFGTSALGNRPQESYGDLKARVDQVRQATGKSLIVGAYMEEPKFDDNRIPLNGAARDVLASATYQTDAVLLTTAAIAAAGGYHMSLAALANPNDGGGVGVLETAYYPTQSLKVSKELNRKNYHYQQFITAYENLLRDKVENDSAEPQTFTANGRQLSQDALGINGDQVWTYAKKGNDFRTIQLLNLMGITSDWKNEDGYENNKTPDEQTNLLVTYPLTGVSMAEADRIAKQVYLTSPDDWLQSSMISLATQVKTNENGDPVLYIQVPRLTLWDMIYILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dextranase
publication title Structural elucidation of dextran degradation mechanism by streptococcus mutans dextranase belonging to glycoside hydrolase family 66
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 216
structure length 632
sequence length 632
ec nomenclature ec 3.2.1.11: Dextranase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13199 Glyco_hydro_66 Glycosyl hydrolase family 66
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vmpA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vmpA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vmpA02
2D3NA 4YBQC 3CC5A 2E27L 1TTFA 5ICXA 5F6IB 2VXQL 4I4WA 4NWTH 2R0ZL 3VE0B 1UOKA 4XXCC 1NAML 2E6PA 3V6ZA 3IDUA 1QLEL 4HC1H 1EO5A 5J6HA 3HZKB 5KAQF 4HUVB 1YEEH 4G8IA 5T3ZL 2ZX7A 4WLCA 3RU8L 1HHGB 2OM5A 1J10A 2FX8L 4OCRL 1CFSB 4LEOA 2VC2L 2G5BA 3DRQB 3VDAA 2A3AA 3C9NB 4JRXB 1CPUA 2P49B 1M71A 4B15A 1N2RA 1HQRA 2VDKL 5DMYA 1JPGB 7FABL 4MNHB 2GTWB 3H3PH 1NC2B 35C8H 1AJ7L 3LHPH 3BGFB 3VXSD 4L3CA 1OPGL 2V2XB 3ARQA 1HHIA 4ELMF 2HTLD 4GLRI 1UH2A 3DX7A 1U33A 2A6KB 1DEDA 1FAIL 4UINL 4KJYA 2O61A 4ZTOL 3DHMA 5T1DL 3ROOA 4OIBA 1AGBA 4NNXA 1WCGA 4HQQL 3KPLA 1GGCL 1QOKA 4YE4H 2HN7A 4JZOB 3IRZA 4H88L 5EORH 1I8IA 1ZJAA 4HAFA 4NQDA 4WUUD 5F6HJ 2XVKA 5E2TL 1FL6B 5L88H 5A6KA 2PCPB 4U1LA 3RI5K 2P5EB 3CSGA 1S9KC 4M8QA 1NOWA 1BX2A 1KCUH 5B39G 2AXGB 5J9PA 1YA5A 3DMMD 1QNRA 1P7KB 1FNGB 2QQLL 4KQ4L 3U7YH 5I19L 4QNPE 2DSWA 2Z1KA 2CCRA 5F9OL 4FNUA 2IBZY 4UFKA 5KVEH 1E70M 5F3HB 2A3EA 1F4YH 1KJVB 4KXZI 4QRTA 3GJEB 1R5WB 2EDBA 4LVNB 5CZXC 1XGQB 3HI6L 5F6HI 2BJMH 4LFHD 1EUTA 4Z7UB 4WI6A 5GRVK 4LSPH 3VXNB 3W9EB 2HFEB 1YECH 1BECA 2FEEI 1R75A 1QSZA 5KS9A 1X4XA 5BMFL 3WIIL 1KLFA 4QHMA 2ID5A 2R4RL 4NT6A 4Y4FA 4P2QB 1CLZH 3TV3H 4U6XA 3WIJA 4XPFH 3AMGA 1OM0A 3AHZA 3VILA 3VXOA 2C3GA 2VXVH 4IRSD 1WK0A 4NSKA 4L4TE 4U6TA 1Q9WB 5E6ID 3RL2B 5EZJB 3EMZA 4X9YA 4Z76A 3G04B 2HKHL 1UWIA 2D9QB 2MQ0A 5K9JL 2Z35B 2ZUNA 2FEDC 3NPSC 4PIRF 5ALCL 3C5ZB 4ZE5A 4BS0A 1KCVH 2AERT 5IMOB 2CEQA 3WDQA 4A4AA 1MAML 1KGXA 5EUOB 3BAYA 2K1MA 1CDJA 4EVNB 7TAAA 3SKNB 3U5YA 4ZS7H 1J0IA 4F58L 3BAKA 2FX9H 3HNSH 4W89A 3HG2A 2IQAA 2KKQA 2Y36L 1CWVA 1OGAB 3GRWL 1WBXB 2WCAA 2MTPA 3BKML 3EAKA 4RISH 1J01A 3GXNA 5JHDB 1W9XA 2AEQH 4NM4H 5C09D 2VURA 1N3NB 3KPSA 2F9BT 2IXUA 4PRHD 3EKCA 3GHEH 3WEXA 5L2KE 2WQ8A 5A2JH 4AM0B 3VI4E 2QLYA 2EYRA 3SGJC 5ECUA 5E2JA 1F42A 4OUUA 5FV2A 4XPHL 1W0WA 1MH5B 3T0DA 3G6AA 5I1JH 5DVKA 3GSWB 3O2DH 5HVHC 3UO1L 5IB2A 1G7MA 1NCCH 1TJHH 4XHJC 2HKHH 4YGAB 2NZ9C 4K7PL 3S36H 4EQ3A 5D1QA 3IS1X 3FNDA 2A6DB 2D7TH 2BFVL 2FR4A 1CFTA 5CQ1A 2VXTH 3DLQR 1OWQA 4YHGA 1Q9LA 4KGJA 2GUOB 2PXYC 1F02I 3W27A 3SKMA 4IJ3B 3KWWB 4WUKL 4N0CD 1ZBWA 1FJ1B 3SE9L 3DV6B 1JFQH 2OL3A 1OGTB 4XX1E 4K9EC 2XVGA 3W28A 2CRZA 1RJYB 4JFPA 2WP3T 1JTOA 4R27A 4MS8C 3QO1A 4IMLA 1FNAA 2BRQA 1PVHA 1G9NH 4S10A 4YXHH 4DKFL 4IHOA 3KPOA 3BZFA 2I9LB 1PX4A 2E7HA 1K4DA 2RAMA 1GZJA 2DAVA 3QUML 2W65A 3Q1SH 3LEYH 1YN6B 1GYAA 4WUUA 4JQVC 2XFXB 1GL4B 3O8XA 3ESVF 3L95B 2NW3A 1IEAB 1Z9SA 3TH4T 4EXKA 2EEAA 4ZSOA 3VSTA 2UUDH 2F54D 3TJHD 2ED9A 2P8LB 2B5IC 5F7LB 2JB5L 4MJIE 5MENA 1I3GL 4AEHL 3HJEA 4XB3A 4ODXA 5KSVB 5FECB 2GUYA 1INEL 3MODH 4KRNA 5J11B 2MMXA 2BNQE 4RX4A 4F57L 4W8BA 2DMBA 5BRPA 2F8VA 5HHNB 1QI3A 3H7BB 5DDHA 4QRQA 4PRNA 4TULH 3BEWB 2NY7H 3QRGL 4GG6B 2O9TA 4TSAL 1JZ3A 3SDXB 2ZKHH 3P11H 4CCEA 4CMHC 1VADA 3P0GB 5DJDA 3T2OA 2O5YL 3AXXA 4MB5A 5FYLH 1WKYA 2D31B 4DWSC 3QFJB 3B9EA 4UMGA 4H8WL 3RO8A 3PWVB 3HMWL 4IRSA 4KHXL 3REVA 1S9VB 2XA3A 3H9ZA 5E6IA 1PZUB 2WCSA 3PN8A 2ZCHH 5T33H 5AYBA 4PYGA 1P4LB 1R3HB 5I8KL 1KXQA 2FGWL 1ZA3B 1MF2L 1ORSB 3S36X 1CQYA 1U95B 1BSIA 1CK0H 5DZOA 3UC0L 4W84A 2VDQL 1KULA 2OWXA 1CDGA 1GGTA 2Y9RT 3MYZA 1SM3H 2JJTA 4OZGF 2CERA 3QDJA 1OAZL 4D9RE 1BIIB 3E6HA 1MCCA 1RP8A 4GKLA 4GMTH 4O58L 2F7RA 2NY4C 3GSXA 1KTBA 5DJ2A 5HHPB 5GGTA 3VKKA 5F7DA 1B3WA 3QEQA 5AZ2L 1G9MC 5JR1L 5C86A 4XVSL 3BZEA 3PZUA 1IC1A 1S3KL 1T80A 4I4WB 4OLUL 5J1TC 3FQWA 1I7TA 3DNKA 4X99A 3TC9A 1E1EA 3MMUA 4PRHA 2W9EH 4PJBB 5E4EB 2CKNA 3NTCL 4U5KA 5D7KD 3ZE2F 5HHMD 3L4XA 3VH8G 2VT0A 5D2NB 3QH3B 5I1HH 4R4NC 3OGOE 1W32A 3FN3A 4ODVL 4PJDB 3QUZC 1IKNA 4NP4H 3W0WB 2J7HA 5IXEA 5CGYD 1RMFH 4PYSA 2W4XA 2PNDA 1NCWL 3V79C 2IFFH 5I18H 3FOMA 2K7PA 4Y88A 5IGXL 4MCZB 5EU4B 3TBVA 1BGAA 2VTFA 3WFBL 1M71B 3WIHA 3QYCA 3L5JA 1JNNL 5CJQL 1FGVH 1N2RB 1HQRB 4NQVB 4AIZA 4S2SA 5EB9A 3V7AE 4P8UA 1UVQA 2DMKA 3MUZ1 4YDLC 1YMMA 3SKOA 4KZEH 2UY5A 4PJ9B 1YYML 1F58L 2VSDA 3AIVA 4G6KH 4DOHE 5LXGH 5EB8A 2J8GA 2BCKA 2XKNA 4JN2A 1PFCA 2WIMA 4OSUH 4EBQH 3BVXA 4AD0A 2WZPD 1AKJD 1E6JH 4MAYC 5F1IA 2ESVD 1R3KA 1X6LA 4LEXL 1E4KC 2YD2A 1MEXH 1MCHA 1CFVL 4C7GA 1T7XA 4ENED 1HWHB 5KS9F 5LWYL 3IETB 2CDGA 2WXDM 4PJAA 5FYJD 3WL0A 4ZAKC 3RZCB 1A1NA 1SVZA 3OXSA 2X9WA 1KCLA 3RWDA 3KYOA 1GPFA 5CZVH 3V4PH 3GM8A 3M1BA 4JFOA 3OQ3B 2PB1A 3CFCH 5ANMB 1W3KA 1JGEB 4JO2H 4PREA 1A4KB 3TBTA 4QRTB 2DIEA 3QHZH 3QCVH 5C8JA 4PGZA 3E3QE 3LVEA 4OFIA 1BD2B 1D9KD 3UTSE 3DSNA 4JY5H 2HAZA 2FO4B 3FAXA 5C0DA 1YNLL 4PJIB 1CXLA 1AQDB 4JFEE 4RBPH 5IBLC 4NSBA 3STBA 4LHUA 4QCIA 1F4XH 4X98A 5E7BA 3CZFB 4JREC 3IYLW 5E00B 3FB7A 5JXED 3U0PB 1TPXC 2N7BA 5TJWK 5HPOA 3SDAC 4NZCA 4J3WA 2BDNL 1NCAL 3INUL 1H3WM 3MV8D 3ILQC 4QHUB 4ODTL 1QBBA 2GK1A 4AISA 3MBXL 4K9EH 5DD5H 1ZVSB 4B5EA 4Q0XL 4YHLL 3B2VL 3D85D 2BVOB 3CX5K 1UWGH 5IESL 1YMHA 5DJZA 5I6XC 5D96B 2WC3A 1DE4A 2EH7H 4NJAH 2ITDA 4P49A 5D71L 4D3CL 1V0LA 1KSRA 2PW1B 4C83A 3LRSB 4MVBC 3PBGA 1VFAA 1MCSA 4NRXA 1PKQB 4NGHH 4Y19E 2Y7QA 1FVEB 4PRIE 4PN2A 1YY9C 3P4MA 3OMZA 1KFAH 1QO3B 4FQIL 5C9JA 2H2SC 5ICZA 4HBCL 5E5RB 5FDYA 4JKKA 4H04A 4XNUH 2O5ZH 3U82B 4WNQB 3OL2A 3OKLB 3CVIH 1AI1H 4CD4A 2HWZH 3A24A 4OUUB 1R3LB 4OT1H 1MIEH 4B41A 1W0WB 3MSDA 2W0LA 3WKMH 1LO4H 4UOW1 1T89A 5I71B 3MSPA 3AXIA 3N15A 3WH9A 3V6FA 5KBNC 5FDWA 4M62H 3EJUA 4X0KB 5BRZE 4KI5C 3V4VL 1XD0A 2VH5H 4M6AA 4HHAB 3TA3A 1M53A 2XVNA 1U41A 1CFTB 1MUJA 3L3IB 5E2VH 5J56B 5BZDA 1R7OA 4OLXH 3MRRA 4JB9L 3BP4A 2W9DH 2HT4D 4JGJA 3BWAB 1J0HA 3EJZD 1H3TA 4OJFL 1B90A 1YEGL 2F5AL 3BIBX 4HXBL 4NM8H 4JFPB 2ATPA 3BGMB 3WIFA 3I2CL 3VXSB 4LLYB 4APQA 3PNWA 3GJFA 4GI9A 5J3HD 5DA0B 3HG1D 4QOKA 3KAAA 1INDL 1QQDA 3FMGH 3LKQA 4DUVA 4D6FA 1CICC 1QSFE 5JIWA 5EC2A 2CRIA 4U1JA 4X6CB 5E4IA 5FK9B 5AC5A 2NXZB 4K7FB 4WUUB 1G7IA 2VERN 3JTSA 1QR1A 4CADB 3HRPA 1P6WA 4MCYB 5CEZH 3GSQB 5J06A 4MNJA 3HRZA 5ACMA 1DWHM 1H0GA 3DMMB 4QO1A 1G9MH 1UWXK 2XWBA 3WF1A 4GW5B 1J1XL 4GS7C 3V5DB 1QFUL 3DGGA 1WIUA 2R2EA 1BOGB 1EUUA 3HMCA 2CLVA 3L9RB 5IVOA 1GXEA 5L2KD 4NKMA 3ETBF 3ARFD 3BKJL 5C8BB 2AJSL 2ARWA 5TF1L 4PRNB 4PTUA 3EFFA 4Q9CA 5DYOB 4F37K 5CSZA 5EZOL 1XSJA 2AAVA 2EAEA 3W9DA 2CKBH 3CXDH 4MNQE 5MERA 1DBML 4U1KA 1MCWW 1BFNA 2ZCLL 1FE8L 3U6RA 43C9B 2UWEE 5D7JC 3QQ9C 3ZR6A 3VFTB 1LL7A 4IRSB 3O6MH 1UD2A 4U1HB 4N8VB 3UTQA 4JG0H 1AGDB 3FZUC 3QEUA 4M29A 4I9WE 2XWTB 1WBYB 4FQJL 5IEKB 4WW1B 5IJVB 3WS6A 1RK0B 4OCSH 5I66B 1W72A 4HZLA 1FL3A 3SHSA 1FFPB 3UYRL 1NWSA 1VPOL 2C26A 5CBAB 1W1VA 3LV3B 3OG4B 1GHFH 1DL7L 2MCG1 7CGTA 4HIIB 4C56E 1NANI 1FGNL 4LASH 4MJ5B 5JZ7C 5C09B 2X6MA 2HVJB 4UZUA 4L9DA 5BXFA 3AY4C 4CBPA 3ZJ8A 3RWHA 1A2YA 1UYWH 4HPOL 3DX9A 1I8KB 3ULUD 2FIKB 1BTCA 2DJ4A 2OYKA 4H1LH 3DOSA 1MWAH 5HBBA 1BMGA 3HLAA 2D23A 3CX5J 1TVHA 4Y16A 4GO9A 4IISA 1AY1L 4UT9L 2HJFB 3MA9H 4OV5A 2J4WH 1KCSL 4DN3L 1TQSA 4MJID 4P9ML 4KTEL 2YFNA 2NW0A 4PJAF 4DZ8B 3FOMB 3QQNA 3MJ7A 3U83A 5E5MB 3MFFA 1RUPL 3MLTB 3QIWA 3W2DH 3KL0A 5ADPH 4S2SB 3KPPA 2R4SH 1JAEA 5FO8B 4OQTH 4XB8A 4P7OA 3MRLA 3SKOB 1ZHKB 2EYTB 4PEEA 4WWKD 4PB0L 3GGWA 2XWJA 1GHSA 4KK5C 4KKLD 3MX0A 1A14L 1WFUA 3ARGA 4FQ2L 3BPLC 4JN2B 1D6VH 3P30L 3RTQC 1JYVA 4I3SL 1UHVA 3HUJB 4MXWH 3DVGA 3TBYB 5JLZB 3IFNL 4YPGA 3GMLB 3OF6D 4JFWA 4W7WA 4L4TA 4BA0A 2DQHL 1T5WB 2R1XB 3FB6B 1T5XA 1H09A 1YNKL 2BNUA 5HYQB 2VISB 3A6CH 5CJOH 1C92A 1AHWC 2F19L 2G60L 3VG9B 2OYPA 5E8DH 1S7VA 1OL0A 1KIPB 1U91B 3RWDB 1BQHG 2X2HA 1XCTA 1YPZE 4FNTA 3PABA 1CENA 2F54B 3PWUB 1HXMB 5HDBE 4LCIL 3C5SA 2NT0A 4NHUA 2BSED 2R56H 3LN5A 2LABA 3N85L 2PETA 5L6YL 3MO4A 3KE0A 3QIUD 2X4RA 1XMWA 3FO0H 5C0DB 3DRTA 2E0PA 5HGGS 4JQXC 5A43C 1RIVH 4LDLB 2CSPA 5HYEA 1MREH 4OF8A 3FQUA 1ORQB 1U8LA 1EEZB 5L2KA 3VFGL 1RIHL 3ARFA 3N9KA 3O6LH 4C59B 4NF7A 4DM1A 3A4XA 4GAJL 4G6MH 4CD5A 2WWKO 1BBDL 2B39A 5DD3H 5I75B 3VSUA 1ECEA 1D5IH 1F2XK 4L8SC 2QQNH 4L4VE 4TUKH 4GW1A 2YD7A 4XH2A 5D2LE 2ADFH 5IW6B 1KPVA 1RJCA 2WAHA 1BG9A 1HL8A 2XG4A 2APVA 2MHAA 3G6JE 2IPUG 4DCQA 3EYQD 5FHAL 3B9AA 3OR6A 5SWSA 1ZGLB 1K4CB 3KPMA 5H94A 2V9TA 3ZE1E 1E73M 1IM9D 1N82A 3FCTB 1AR1C 2NMSA 3QUYD 1SBSH 3ARZA 4ZPVB 3ALXA 4YK4C 1YMHB 5HYSB 3WLBB 1HJVA 3MV01 4F33A 4WI9A 4KMTH 5D4YA 1VA9A 1WFTA 4LPYA 3IDNB 2Y23A 4DTGL 3ZDZE 5J6GB 4HPHA 1CN4A 1VKXA 4PJEF 4Y4HD 3S8WA 3UYPA 5C9JB 4KRMB 5TE7L 1WITA 1FCGA 5A2KH 2LFGA 1U3ZA 3UG5A 1C3FA 1MCNA 3MROB 2ZWZA 1EO8L 1N59B 4PGJA 1T2XA 1V08A 2I60L 3TP4A 5BV7B 3WXVL 2VRJA 3RY4A 4L5FH 1NC4D 1EEQA 4H20H 5HHMB 3NZ8A 5C0EB 3L2LA 2QHRL 2G75A 1J87A 4LNVA 1Y18A 3KJ4C 3AMDA 4KDWA 1KTDA 3HAEA 4EI5A 3AGVA 3PGCA 3MOBL 3TPUB 1EDTA 1H5BA 1JDDA 5LBSH 4O2EB 2E40A 3MZGB 1IFHL 4MYWB 3UTSD 1WDPA 5BZDB 1OAQH 1T1YB 5F89A 1KEGH 1CLYL 1W2VA 3BP4B 1DTUA 2F5BL 4JFED 2BNQA 4PJXE 1J88A 1NGZB 1AXSB 1TMCB 3UR8A 3WXWL 2CUMA 1NCUA 3MXVH 5IB3B 1WJ3A 4KK6D 4AIXA 2R0LL 4KAQL 3VRLE 1U2YA 1GVYA 2ZZUT 1AKJB 3H0TB 3EDKA 1D5MA 1QLFB 4XNXL 1YEIH 2ESVB 1N7ML 4PRAA 3HCVB 2YHGA 4KY1H 4OF3A 2OI9B 4QXUH 1BEYH 3RY5A 1UD5A 2OSLA 1SQ2N 1KJ2L 4LYPA 3OJVC 3MRIA 4FQ1H 2BMKA 3SKJH 4RNRB 4YXKL 3AM8A 3OLIA 4HS3A 3GBNL 5IB5A 3MANA 3TWCH 4LPXA 1FLTX 1PYWA 1FZKA 2PYEE 2CBJA 3EOTH 5T1MA 3BXNA 4JKPH 3T1WA 4X7TA 5ESQB 4YHML 5FOBB 1KTLA 4PMRA 4Y2OA 1OAYL 4H1LG 3EYOB 4GINA 1G7PB 1T83A 2R69L 4PRID 5DVMA 2DH2A 3IDIA 1D7FA 1AXTL 2DKUA 3MRFB 5C08E 3O41A 3DDFA 1D9KB 3N9GH 2IGTA 3MGOA 5HOSA 2HA1A 3T0AA 3AZSA 4U3AA 1ROWA 3NFPB 4RFOH 4LGRB 3EFFB 4PBVC 5LAXA 1JGDB 2Q86B 1I7RA 2Z91A 3REWB 3QNYB 3V9FA 1KACB 4M4RA 1VJSA 3C8DA 4YHNB 2R8SH 4WU5B 4NKOA 4LPTA 1AO7E 4XC3L 2H3NB 1IGML 1JWUB 3ZO9A 1LQ0A 5BRZD 3MBEC 5I76B 3MCG1 4LSVL 1MCEA 5IMKA 1AQ0A 3UTQB 3MV8B 3QEUB 4NKDB 1NGPL 1U3YA 3UEQA 2J7GA 5IROA 1YEFH 1E4WL 3QUYA 1X5ZA 3D85B 5FIEA 1T1WA 4MA3B 1WNOA 1OOAA 1Q9KA 4UIMB 5I16B 1A9EA 1C12A 4XP5H 3GEWB 2FBJL 1K9EA 2LTQB 1IV8A 3QHFH 2MPAL 3G5XB 4Z7OF 3VPLA 1MFNA 1ACZA 3WYRA 1DSFH 1N6QH 2OCFD 3EJYD 1KGWA 4AZ7A 3PQYE 4Y4HA 5CJXA 3CLFL 1X5IA 5E9DE 5HD8D 2DB8A 2WBJD 5BXFB 4MJ6A 1TVPA 4X4YA 3P9MB 3T2QA 1MRDL 1UB6B 3WE6A 4O5LH 4UDTB 3U79A 1NC4A 3NSXA 4GSDL 5CD5D 5K9KB 4NBXB 2I9TB 2VLKE 2OLDA 5CIPA 4X6DB 5I73B 5H2BA 1Z32X 5FYKH 1GOKA 4YQXL 4Q6IC 4RAVA 2FGLA 3AZTA 1VGKB 3ZL4H 5TF0A 3MV9E 3ZOAA 4DO5A 3MLSH 2J75A 3GNOA 4LSRL 3LCYA 4JFEA 3QWOB 5DRXB 1A7OL 1BZQK 3D25A 3X12B 3TT1H 5I0DA 5IR1A 4PLJD 1A9BB 1TXKA 3QXUA 1J0YA 2X89A 5L8JB 3QUXC 4MZ3A 1T0NB 3ROLB 1XYZA 5F88A 1A3LH 1MY5A 5JHLL 5HVGB 3THMH 3GMQA 1JPFB 3RPMA 2BC4B 1QLRA 3HG1B 3D39E 4LSTL 4JFSA 1ZT7A 2E9MA 3QPXL 1EGZA 4M5YL 2E7CA 3BESR 4BQ2A 1AE6H 4WIWA 5ID1B 1T2QH 4EUPB 2A6IA 5EBWA 4D2NA 1MSPA 4CGTA 5KSUB 3VXPB 3WNLA 4PJGE 3PABB 3WLWC 1IAIM 3DYOA 1QSEE 3MLRH 4OTXH 3C5SB 3O2WL 1BP3B 1U8QB 3UPRB 2BRRL 3BX7C 3KPRE 4XTRC 4ZUSB 3W39B 4M48H 3TZVD 1IAIH 4X80L 1HDMA 4Y19A 4X7SL 4C56D 4PRIA 4Z7QE 2C3HA 5CILL 4CD6A 3IU4H 1A7OH 4RFNB 1Z9MA 4J3TA 4GO8A 2D7QA 4PV8B 1X5HA 3GZKA 4OFKA 5L2KB 3BVTA 2P43B 3ARFB 5C0FA 1HL9A 2V7NA 4P2OA 2X7LB 2WW5A 3N18A 1KB5A 4HFWB 4PUBH 2E6JA 2WV3A 5IHZA 3WH6A 5CS7A 5DJAA 1NAKL 5DQJB 4KDVA 4ODSL 4KKCD 4JHWL 3RWEB 1PEWA 4TX8A 4KRPC 4PJFF 1KPVB 2NT1A 5BRZA 4ELKB 1XR9B 1U3HC 2MHAB 4L9LA 3OR6B 1EO7A 5H94B 2JLLA 2IAMA 4R7DB 4Z7NE 2NX5E 4W5UA 1CI5A 5DMGC 4NZRH 4GXUM 3UBXA 3EYUH 2AQ3A 4GQ9L 3K2UL 4U7SA 5DJXA 4M4PA 5CINL 1FL5B 5L9DL 3WY1A 1U8OA 1GOMA 4G3YL 5DR5H 5CAYB 4IPLA 5IQ7L 5D1XB 1M7IA 1UXSA 3QHOA 4K3DH 3MRGA 5INDA 3SDYL 4DVBA 1OIMA 4XVUD 1QSFA 5D6CB 4E41E 3VGFA 1EXPA 4LSQL 2DKSA 1W9BM 1A7BA 2AJZA 1KEMH 1GGUA 4YHYC 5GRUH 3RWIA 3PHQA 1UR1A 4PV9A 3WMBA 3I9GL 4GI8A 1ISYA 2VX7A 3M8OL 4LVOB 1UT9A 3EOAA 3PGCB 3ZKQD 5GS2D 1F45A 4MJIB 5SV4A 1P7HL 4IDJH 3ECBB 3O3BA 1A22B 1I9JH 4BH8A 1ACYL 4EN3C 2XSBA 1P1ZB 4JFQB 2EDDA 3B4NA 3HNVH 1HNGA 1MFAL 4IIQB 1ZLVK 4UTAH 1YZZA 3BN3B 2H2PD 4HLZH 5JDSB 1CYGA 4GH7B 5FYKU 2OXGA 2EE6A 3ZTNL 5DS8B 1KPUA 3Q5OA 4R26H 4WK9A 4WWKB 3RVTD 1SJHB 4YX2H 4WJ5A 2ADIA 2OW7A 3KLHC 5KOMC 2FH6A 4OBSA 1VFFA 3PZIA 4AZGA 3H54A 1V0MA 1EZVX 4HJGA 43CAB 1F3JA 3S5LG 3WD5L 4JVPA 2IH1B 3PV6B 3BIKA 3PZ9A 1BWWA 4MNQA 3SCOA 4NO5A 2UWEA 1KJMA 4LGXA 1ZANH 2F58H 3BD5A 3ARDD 4JDVB 2BMKB 2FJGB 5DT7A 2DLHA 4P8XA 3SKUD 1RV6X 3ZR5A 4HG4K 1A6WL 5E8OB 4LMQI 4G42B 3VGAC 1GZPB 1PYWB 4XCYB 5TDOB 2WIIB 4HS8H 3IGUA 2PO6C 1VHPA 5DJ8A 4W86A 4NO3B 2A9MH 2YD9A 1CL7I 1V6XA 2ZXBA 2XJ7A 4RA3A 1MJUH 2B1HL 1NM9A 2Z31A 3BAJA 3AI0A 1GGIH 3QIUB 1MQQA 2MCPH 4C56A 3QPQC 1HH9B 4HH9B 1OW0C 3CV5A 1Y6KR 4NWUH 4RDQG 1EH9A 1V3JA 3BE1H 3EJPA 5CEXB 1TETL 5ADOH 3MC0A 5DC9B 1R34A 4M1GH 3L7FA 2APFA 4LKXB 4NN5B 4RMTA 3ULVL 4MAVA 5LAXB 1NJ9B 1A7PL 3IDMA 3PHAA 4EOWH 1F6AA 1OTTC 1UACL 3UROR 3BLKA 3FQTA 3RP1A 4O2CA 5F3BB 2W9LA 5AD0B 1RD6A 3U1SH 2ED7A 4AXNA 2AJYL 1VGEL 3UCRA 2W5FA 2VQUA 1UG9A 2DLFL 4L3AA 4DKAA 4H0IA 4FFYL 4UTFA 1EGJH 2HKFL 5EIIB 4AY1A 3L7EA 1UQYA 2BVDA 3A4WA 1IM9B 4UV7H 2XUCA 5EUKB 2Q3AA 1GZQA 1HTYA 1HHHB 2F7QA 1S7RB 3T4YB 4ZUWA 5B38G 4FS0A 4JY4B 1RI8A 1M7DA 1A6VL 1Q9KB 4PGBB 2MKLC 3KDMA 1R6VA 3K0WA 4QHKI 4DK3A 1FFNA 1WISA 2ZSVA 1UASA 1WAAA 4E8DA 1ND0B 1U6AH 5KVGH 3IJYA 3DV4B 4Y4HB 3WH7A 1V3HA 3N04A 4OZFB 4PR5B 2UYLB 2I5YH 1TZHA 1KR1A 5FO9B 1E56A 1A4JB 1CGSH 4HUUB 1BGXL 4U49A 1BYCA 2DQJL 1JYNA 2UZIH 3WE6B 2VAAA 4U3CA 5TDNA 2W92A 5T5FH 1NC4B 3KWXA 4BQ5A 1JNHA 1AIFA 1QVOA 2CYGA 2VLLA 1YPZA 4TNWK 3BP6A 4HUKB 4R97B 3KLLA 1CBGA 3ZJ7A 4M61A 4QRRE 2OL3L 1H3XA 4JDTH 2D73A 4V2XA 2ZSWA 4QWWC 5C08D 4XBGB 3UTSB 4XPGH 5GJSL 3TFKC 3M45A 5D93B 3VFUB 2CDFA 3NZHH 4W87A 2Z4QB 2X2JA 1K6QH 1FLRL 1RUQH 3VXTB 3TT3L 2D3LA 4YGVB 3VFRB 1XCWA 4YFLF 2VX5A 4KVNL 3MRHA 3GMOA 5EC1A 1C90A 1MVUA 5T3ZE 1WICA 3JWOC 4L4VA 4UT7L 3P9WB 5D2LA 4G6JH 1H8NA 5TPWL 5D70H 5LYRA 1T2JA 3QWQB 4Y5XC 1G5AA 3IF1B 1K3IA 3G6JA 1YYLH 2XZCH 4PRBB 5F7EH 5HHOA 2YPLD 1FH5H 3MRDB 2J8HA 5EBWB 4GPNA 1G6RB 2XRAL 1HSAA 2A38A 4A3HA 5EBGA 1KLUA 5DUPL 1TUXA 2WMFA 2AOSA 5I1KH 1ONQA 3BVWA 1EFXA 3PHSA 3C6LA 5BQ7B 2V5TA 1MJ7L 2DL9A 3JTTA 1UH4A 5E99H 2AGJL 4GKNA 4UQCA 1EERB 1HCFX 1LMKA 2VCBA 1OAKH 4PGEB 3FHQA 1WWCA 3TNNA 4QP0A 1L6ZA 3GI9L 1JV5A 2BVQA 5E9DD 3BO8B 3GNMH 2WWKT 1DBJH 4NYLA 4IOFD 1CXFA 4M6ML 1NBVL 5ID0A 3NN8A 1K85A 1XR8B 3U0TB 2XPGA 2V7NB 4EEEA 3WJJC 4HG4J 1KB5B 5JOFB 2EC9U 1SMDA 4G5ZL 5DJAB 3BD3A 4HLZG 1R33A 4WEMB 1NDGA 3UJIH 1NLBH 2BSTB 5LJYH 1M6OA 1UCBH 5CZKA 2ADJB 2WWDA 4AEIH 1MHPL 3IKCA 3UETA 3OKYA 4QXWA 4PLKC 3OKKA 5BRZB 1ZOXA 2BSRB 4L9LB 3AREA 1RJZA 1WQVT 2C1PB 3T3MF 15C8H 2QR0A 2R1YA 3CMGA 1QFWL 3MV9D 4YDIH 5TE6L 2EO7A 6TAAA 3IJSB 5D72L 3CK0L 4DFIA 5BJTA 4PJXA 1RFDH 1RK1A 2TAAA 2DTML 2DJSA 2ERJC 1AGFB 5GGRB 1MFDH 4K2UH 5BVJA 1MPAH 3HG3A 1MQKL 4QTIH 4EXPX 4IM4A 3H9SE 2HLAA 4LIQH 4F15C 3MACL 1ZLSH 2IGFH 2ZUQB 3LSOB 4TOYL 4Q9QL 3MTRA 4YWGL 5C6TH 5CCKH 4BELD 4OLYH 3BT2L 2WBJB 2WVVB 5HI3D 2H32B 2NY6D 2BV9A 3O9WC 3MI6A 4NFCA 4K8RC 4Z77A 5GZOD 4GQPH 4TPRH 1HHJA 3WY3A 3MRNB 3OR7B 2PYEA 3IDYB 1TVBB 5DUML 3O3AA 1V7ML 1OCWL 3LKSB 4XBPB 5HGDB 2GDVA 4K3JH 3LOWA 4Q74A 3SE4C 2QADB 4X7CC 2CGRH 3IFPA 5IFAH 3DX6A 3RIFF 1J0ZA 1TA3B 4JJ5B 1U8KB 3G9VA 2AXJA 2IPTL 2YRZA 5C08A 4JM2D 5FUCE 5EFIA 4LQFL 1FO0A 2OR9L 4IS6A 1WZLA 2HT3D 1TENA 4JY6A 2ICEA 5DFVD 3OKEA 2WUBL 3TLRA 1VFMA 5GIRB 1XZ0B 3C2SA 1RZ8B 4IRZL 2MKWA 1NMCC 2GSJA 2WMKA 1XGTB 2DQFB 4QHNB 1AO7A 3TYGL 2UWEB 1QHOA 2E7MA 1TDQA 4D6DA 2OZ4H 1L6XA 1HJXA 1ZT4A 1GOWA 2XM1A 1V3MA 5EU3A 3BEVA 4F7MA 1XH1A 4PSRA 1P5UA 5ISZD 2ZG3A 3AS3A 1UB5A 4ONHB 1TQWA 1TJGL 1WE5A 1Q8MA 1RUKL 4WFGD 3ZDXE 3GB7A 1I4FB 1QRND 2PTVA 2H1PL 5DEGA 2IAND 1GSMA 2VABA 1IT9L 3OHXB 5ESAA 5DD1H 2WHJA 4OZGB 3TZVB 3DHPA 5FIPA 3S6TA 4D6EA 4GRLD 4C56B 1MYRA 3QEGH 1DBAL 3PQYA 1SFSA 5I6SA 3NCJH 4JRYE 5E9DA 2VRKA 1ADQA 3QHMA 3ARSA 4E41D 1JFHA 3GXMA 4W8LA 2YEZA 4P9HC 5FYLE 3U9PH 4XRCB 5HHVL 1WAAF 3C09C 1B4RA 2VDMH 3O6AA 3HPLB 3FQTB 2WMIA 2UWFA 3F6LA 1WPCA 1XSKA 3CHDA 4UBDD 3STLB 3GHBH 5C92A 5KTEL 4PUDA 2VLKA 1GHRA 2RQ8A 1JZ7A 3ZHLA 4QHLA 1HCVA 4LPWA 2QSCH 4ONFL 4MQXD 2DQEH 2RCSH 5I9QB 3JWNC 4RQQB 1HNYA 2DLIA 1MW2A 1VAHA 3S4SG 4PJ8C 3M7SA 1MHCB 5HTSA 1YPZF 4OFYA 1GZQB 4Y5VA 4AQOA 3BAEH 1XCQB 4OD1L 3SJVD 1ES0A 5E03A 5DZNA 1NFDB 4G80A 1AP2B 3S3JA 3VW3L 2XIIA 5HVWA 3JWOH 3TCLB 2OK0L 5GGSY 3MQIA 4UB0H 2EKSA 5JPNB 4G43B 4FABL 5GZND 2YBRB 4YEEA 1CG9A 5BV7L 1KPRB 4FP8L 4RGNE 4X9HA 1UD6A 3FL7A 5AAWA 5D1ZA 3DXAE 4E0RA 3BQUA 4ZXBC 3D39A 3CJJA 4ETQB 1AD9A 1FN4B 2UVEA 1D3CA 3BYYA 3HI1A 4I77H 4QYOA 4S1DC 5F96L 3U46A 2FL5A 2DLGA 1VEOA 3P4NB 5LVEA 1T6VN 1WB0A 4ZS6C 3HC3H 1JNHB 2R0KL 5D2LF 3UJJH 1AIFB 3FB8B 4PJ7A 1FNFA 1S7QA 1QVOB 1BJ1H 2VLLB 4PJGA 1MAKA 2JF1A 3G6JF 1JZ8A 1QSEA 3B8SA 3VIPA 4M61B 3RA7L 2NR6D 4U33A 3KPRA 2DIAA 3GSVB 3N1MC 2YL9A 2ZSWB 4JR9L 5JO5B 3D69A 5J12C 3MV11 3NCBB 3OSKA 4XGZB 5JW3H 3HI5L 1F8TL 1KENH 5L2JB 1TR1A 4W88A 4BZ2L 4HK0A 4JCLA 4JM2A 4WW2C 3V5HA 1VSCA 4TUFA 5I15L 5JTWA 4B7IA 4Y5YA 1HSBA 2WZEA 3EZJB 1X5YA 1M03A 1AMYA 1FYHB 1V02E 4U1GC 5JPMA 5TH2B 1IT0A 5IUSA 2OTPA 3MRHB 4I0PD 3C5JA 3LXCA 1T03H 4B0MM 1Q9OB 3RX8A 5AUMA 3B5GA 1ZU8A 5FYJL 3F58L 2J7CA 3VTRA 3PIQA 4D0BB 4MAUL 1I9RH 2AJXL 1C5BH 4B9ZA 3LZFH 3AFBA 3CFDB 4Z2LA 4RAUB 1BFVH 3PDOB 2HG5B 3ARDB 5MP6H 2JALA 4X6EA 2VE6A 2HVMA 2J8UE 4NRSA 4D9QE 2NX5A 4E9LA 1KC5H 2BVUA 2GKIA 4HZ8A 5KN5B 4MQSB 3T4AB 4AIOA 3TTOA 2GSGB 4W70A 1JPTH 2JB6A 1C5CL 3G5VA 4HDIA 4LP5A 1F3DJ 5HPCA 1NBZA 5E7FA 5F44A 3TN0C 3L3HA 1TQTA 4WO4D 4LLWA 4Z7VE 3WD3A 4BKLB 4K8RH 2FLBT 1HH6B 4HGMA 2JEQA 5C9KA 1QOXA 3NN8B 4HWBH 4O4YL 4Q58C 1PX3A 3QO0B 3M6DA 3V8OA 4H5SA 3BLPX 4GRWH 3WL1A 2VLJA 2ARJA 4G8FA 2VSCA 4X5WB 3MRQA 1HXYB 4JFXA 1DVFA 5IFJB 5IHSA 3OKKB 1OY3B 3DX1A 4OKVB 3QCUL 4XVJH 3UZEA 1UWEH 1F6FB 4UQ9A 2NY5L 4KRLB 3IDJA 1LVEA 3BKCH 5FL0A 2YL6A 2VMFA 1DN0A 5JIPA 1RZ7H 1JTTA 2AEPH 4PJXB 3NCMA 1YN7A 4XVTL 3BSGA 1KB3A 1T3FB 1WZ1L 4NX0A 4F8XA 3LKRB 5C71A 3BUBA 3DURA 3UAJC 3MLXH 3IT8D 4YH6A 4YC2B 3RVUD 1HKIA 3GMRB 4PS4H 4J3XA 4P5KB 4XMPH 5GISH 5J13B 3BDYL 3QDAA 3SE8L 5HJ3B 3U4BH 3FTGB 4YFDB 3H3KA 5IB4B 1ED3B 5CD3A 4XP9L 1MRFH 1FIEA 2GIYA 1BF2A 1D5XB 4K7PY 3WL9B 2VDOH 3AMLA 4R9HA 5EOCL 3CC1A 3EGSA 3EBAA 2G4FA 5TQ2L 4C57C 4LBEB 4NJ9L 1ZTXL 4ZUVA 4DO6A 4A6YH 3SCMC 2CDEA 3B83A 4Q6YA 1MJ8L 3VD9A 5DC4B 2EDEA 2ZIDA 3DETD 1MY7A 1C08B 1NCTA 1NUFA 3LQMA 1JWSB 3RPIB 3NH7H 2AJVL 4GMSH 3CMJA 1J0KA 2G3MA 1KT2A 5GGUB 2GTZA 3QNXA 1RUAH 4P9HH 1JWMB 3TO4C 3HE6C 4KK8C 1MCKA 2W0PA 1R5VA 4KV5E 4TTGA 2XVPA 3GIVA 1CL7H 3VGHA 4I3RL 1A6ZA 2JCCB 5CPSA 3OKEB 5EFDA 3MLYH 3HZMB 3H9YA 4FFWD 5DD0H 3QEHA 3PXHA 3SPVA 2AKRA 4E5XA 1IEBA 5LQBL 5I24A 4ZUTA 3OGRA 1XGUB 4P59H 2EXOA 3IXTA 1GOHA 5JNYB 3I02A 1TLKA 3HFMH 1Q94A 3CVHA 4FG6D 5K9QI 3MRCB 3WSUA 4XWOD 5A6AA 1LDSA 1S78C 2JFEX 2DBLH 2PN5A 1XGPA 3LQAH 3QA3B 5DTFB 3O6FD 4OCMC 3U30B 4IMKC 4JFTA 1WDRA 1J18A 4JCMA 3VGEA 3ZZ1A 1PIFA 3BEVB 4ZFZB 2V5RA 2YPLB 2RFXB 3KG5A 3RI5F 3B9KC 1IGFL 4M1DH 2NY2D 4F7CA 3LPGA 3ECQA 2HT2D 2ZJSH 3RDTA 2CKRA 4LLMA 4IRJB 3MLPA 4HFUH 1N4XH 3B8YA 4KK9D 5L7XL 1CLXA 2X4NB 2DDQL 4M56A 2Y06H 4JPVH 4W4OC 3R0NA 2CUHA 4GAGL 1QD0A 3VD5A 5E9DB 1RZJC 1C93A 3CSYA 1I9EA 1VENA 3PJSA 1K6AA 2ADGA 3QAZB 4P46A 3G6LA 3JUYA 4D0CA 1FVDB 4AYGA 3B2UD 4QT5B 4EUPH 3T04D 1G7QA 4PP1C 1WP6A 4JFZH 4KVCL 4ZXLA 1MCBA 1LJYA 1UA6H 5GS1B 4QHLB 3RNKA 1TQCB 3NIDE 2KH2B 4NZUH 3VFMB 2JK5A 3VRJA 2YPVH 4QRRA 3BW9A 1MCPH 2DQCL 4PJ7F 2WM0A 4PJGF 3MV9B 1DCLA 1JL8A 1DLHA 1PS3A 4ZO7A 3KPTA 5DMKB 2ZUUA 4G80B 5SX5K 2FD6H 1NAMA 1CFNB 1YC7A 1KTRL 2DQUL 3BFOA 1B0WA 4NUGH 3UZVB 4PCTA 4GJTB 4Z7QF 4X5XB 4P4KD 3AHXA 4RMSA 3RQ3A 3MV7E 3R0MA 3V52H 3MOAH 4KTDL 4YUEL 1KN4L 3UTTE 4N0FA 3ULUL 4U1NA 1TCRB 4HOWA 2CRYA 3PL6C 4GUPA 3HI1B 3T2NL 3T2PA 3T8XA 1E43A 1AC6A 4XWGL 1U8IA 2NY6B 2ZPKL 4YBQD 1RZKL 4DM2A 4WV1A 1WT5C 4LF3A 4AT6B 2A6JA 2DT3A 4PMOA 5LA1A 3DO7A 4QXGH 1A6TA 3E2HC 2YUVA 4JDZA 4FQHA 3C6SA 2Q6WB 4LCUA 4NRRA 5TE4L 3X3GL 3GDBA 1R5IA 3WDIA 2APXA 1GPOL 4ZFFA 4TVPH 3VFVB 4JRYD 5F70A 3VIGA 3RX5A 4M43L 4QY8A 3ILPA 4JM2B 3ARBC 5C0CD 5FYLD 1GOIA 1U8PA 4F9LC 2FYVA 1R46A 5HY9B 2GJXA 5C0BB 4HJJL 4YDJB 3T0WA 4YDKL 1WDSA 1VFBB 2BVPB 3HE7C 2AK1H 5HGAB 1FORL 3T77A 5HYJE 4GZJA 5DHYB 5AYUL 2J6EL 2PR4H 4JPKH 4TVDA 3H3BC 1NDMA 1FP5A 2IJ0C 5K59E 4XMKL 1W0VB 4Y4KC 3SGKA 4P5TA 3IU3B 2ZCKL 3MJ9H 2FJHB 3F12B 2DI8A 5ISZB 4CD7A 1JNLH 1SYSA 1TQBB 3V2AR 5AYIA 1ODUA 3NGBC 3BUIA 3TBWB 5LCVL 5D5MA 4XBEL 2PKDA 3KXFE 2EDWA 3NFSH 4I5BB 4AMWA 3WQWA 3EJQA 1QRNB 1NUGA 3FO2B 3HKFA 3PHOB 5TE4H 3O6KH 4QRSB 4YHOH 3WFCH 1NEZG 4LCWA 1ZA6A 3HC4L 2IANB 2W0FB 1JGUL 3H9SA 5B39B 3NIYA 1IL1B 1LE9B 3JXAA 3NPZB 3LS5L 4MX7B 4GRLB 4RGND 1ODAA 3VIHA 4XCEA 2PTTA 5IK3A 4D0DA 3O2DA 5GQBA 5IB1A 4E41B 3EYFB 1X3DA 3P4OA 2H6PA 4H5SB 4ZYKA 1HOCB 3TNMA 5E8EA 1XF4A 4DGYH 2ARJB 3S96A 3C60C 3BP7B 5IV2A 2GITB 1LF1A 4FA8A 1FH8A 3LRKA 3EDFA 5D4QA 3K80A 1KJ3L 3QUKA 5HDRA 1K9TA 3X11A 1I7UB 3W26A 2EPNA 2XTJC 3BSZL 4CN4A 5DJYB 4RE2A 2VKXA 2ZCKH 3WKNA 2MOVA 3D18B 4P48A 4UT6H 2NYYC 4FQQA 3GRWA 5C0IA 1Q72L 4G8EB 4M7LL 2OLHA 3T65B 1DN0B 3ZYIA 1QFWI 5EU7E 1A21A 2CMRH 3SJVB 2FEDD 1IARB 4XC1H 4HGWA 4CW1A 4CVUA 3BRFA 5MI0B 2VIRB 1LEGA 1K5NA 5I74B 4XI5C 1IE5A 2NY1D 1V7NH 2VLMD 3MRJB 4KJQC 4P4KA 1Q0YH 4O02L 4X7FC 4YBLC 4Z95H 3W53A 5ERWB 4GBXC 3QQ4A 4MD0A 4R8WH 3RAJH 1NBYB 1ZHBB 4X7DC 5IBUG 5GHWH 3RM9A 3LPPA 4YHZH 3LB6C 3KLSA 3QG7H 3T0EE 5DRZA 1OF2B 4FQXC 4D9QD 4Z5RB 1JYWA 3MMWA 4OCWH 1WEJH 5EZIL 4LHJB 3NCYP 2XQBL 1US3A 4JFYB 4MD4B 1BZ7B 4N5EC 1XH0A 2J5LC 5KG9B 3AMCA 1QYGH 4O9HH 5HGBB 1JBJA 1RZJH 4ORGA 1P7QD 3AIRA 3SCNA 4YPJA 3PWLA 1E71M 3GI8H 4XHJD 2J62A 1GIGH 1UKQA 2NZ9D 1ZB5A 2CJUH 2VRAA 2GK0A 4JRYA 3KJ6L 3FW6A 4JG1L 4RMRA 4P3DA 4FXGB 4YNYB 1ZEAL 5EG6C 3VDCA 1R0AL 2QPUA 1AGEB 4LCYA 1DBKH 5F1NA 2PXYD 2J2ZA 2OR7A 3QUMA 3S37H 1N0XL 1UYQA 3RGVA 4S1SL 5ABFA 1Z0NA 4I0PB 1A5FH 1LO3H 2B4CC 3CVHB 5M03A 2WBWB 4XCCL 1ZXQA 4MNMA 4U6VH 4TYUA 5BOPA 1G6RL 2GFTA 4MS8D 4POUB 2RGMA 1XGPB 4OLVL 1PG7H 3V6OC 3SGDI 4DQOL 1JZ6A 2EXWC 4KWUA 1UQSA 4MAZA 3HHRB 5GGVH 5J57B 2D20A 4XPBL 1TZGL 3WNMA 5EO0A 4QLKA 2YLAA 4LLMB 5DHVB 2XGIA 1W8OA 2Z1SA 1E0OB 1P4BH 3ME0A 5JW4R 2O9RA 1UJ3A 4R3SB 4WGVB 3VA6A 1EHLL 2EXYC 3WEZA 3IFOA 1KFWA 1U92A 1KB5L 2OW6A 4WO4B 4JVWA 4M7ZB 1J05A 5JXAL 1BREA 4BFIA 2YL8A 3P2TA 3WFZA 5IEHA 3DXAA 4YHEA 2AMGA 2ADGB 4M7JH 2ZOLA 1ZWIB 1TITA 1JPSL 4YIQA 3MUGB 4PY7B 4LRIA 1UR9A 3U0WL 3EO0B 2QEJA 4J28A 2V2WB 2GW5A 4F7TA 4JO3L 3GMMB 2VVNA 2ITCA 1H3PL 4ERSL 3NIFE 4DWSD 1KG0B 1NCBH 1OQXA 3FO1B 2A9NH 3VFPB 4A3YA 4Y4FC 2EEDA 2UZXB 3K81A 1DEEA 1FBIL 1UZ6F 3AIQA 3HB3C 4XZUB 1PY4A 1UD8A 1BQUA 5C7XL 2ZICA 4P2QE 2H26A 4J1UA 1E6OH 3BH9B 2B1AL 2DT0A 4ODHL 3OB0H 3PTMA 5JUEH 1DQDL 1OP3H 3HZVA 4ZUUA 2V3GA 3F7YA 1OARL 4ZXOA 2FATH 3BPNB 1MFCH 4GIAA 4LYRA 3UJTH 1UFUA 1JRHL 1S9YB 3C8KB 2BHYA 4PJ5D 3D2UD 5IP4A 4UQAA 4UFLA 4D1IA 2NY4D 4KGLA 2HVKA 4GUPB 5CEZD 4M3JA 3T8XB 5GRJH 3VMPA 3L3KB 5HSFA 4DJMA 2AJ3A 5EUOE 3LKPA 4WV1B 1Q6FA 2J8UA 3MRPB 5E1HB 1C8YA 5FYKE 4DN4L 5AC4A 2CR3A 1PG7X 4OZIA 3QXTA 3BISA 5EO1A 5E0CA 12E8H 2BK8A 3IGAB 4WIQA 3VH8B 4OOZA 5JHDE 2VJXA 4AD4A 2WKLA 4LCUB 2WINB 4R4ND 2NCMA 2C7UB 1P7QA 3QUZD 3UDWA 3BPOB 3QDGD 1FYTD 5JA9A 5D5MF 2QKIB 4HPYL 4R0LB 1CXHA 4L8BA 3Q5YA 4U2YA 2H41A 3OGSA 4UDUB 2XTKA 4NC1C 4UOJA 5D1QC 1S5IL 3WN5A 5TDPA 3WNOA 4OF6A 3O81A 4U1MA 3MRKB 3F7VB 4GAFB 1MCRA 3SCWA 2YD6A 1K8IB 2IXVA 4Y2DD 4CJ1A 4Y1AD 2X4QB 1TG7A 4BQ4A 3OKMA 4MAYD 4M7KL 4HF5L 3AIBA 3X3FH 4JFDD 3O6FB 4PJFB 4UNIA 1TTGA 2APWA 2HTLC 3I75A 3SDDA 3PWJA 4JHAH 1MI5A 2NY2B 4ZG1A 1NFKA 2EPKX 3FONA 1A7QL 2ATKB 3NOIA 3THDA 3WUFA 3STZA 2EYSB 5IVXA 3JUGA 4FQCL 1CE6A 3CH1A 4M9PA 2VXSH 4YXLH 1IAKA 2HMID 5E8NA 4PMQA 3O8XC 3QZWG 2GAZA 3MLVH 4HZAA 1OGSA 1UA3A 5D8WA 4CVXA 1I3RB 3UTTD 4MD5B 4XCEB 5IK3B 4JM4L 2A1WH 4QRUB 5I1DB 1SVCP 4Z9KB 3GSNB 4GG8A 4OLWH 1S5IH 3P4OB 2J7FA 1T1XA 2LU7A 5I8EA 3IJ7A 4AYSA 5M5DA 1MVFA 3PWNB 4EAMA 1E4LA 1F11A 3TNMB 2CIIA 4F37F 2X1QA 1MIML 5CUSH 5K9OA 1NQBA 2PWHA 1U8HB 2XWEA 5MHSE 1GCYA 4J27A 4I18B 1IM3B 4HLJA 5CP7B 4C4KT 3QJHB 1HILA 3ZJKA 1WCBA 1A6UL 3BHBA 4XP6H 1BPLB 5AZEL 2YPKA 4ORZC 3CFIC 9CGTA 1E27A 2ZOKA 4FHBD 4YN5A 5IBTH 4RMWA 1AQKH 1RVFL 1RZGA 3DUUA 1CZ8L 3RWCA 3SDAD 1B0GB 4G9DB 1RQ5A 4PB9H 1CXKA 4NKIH 1XEDA 3LRHA 4CJ0A 2WHMA 3OTTA 4NQCD 4BQ3A 3OPZL 5SWZD 1DQLL 1UM6H 1RU9L 4GG6E 3FY1A 5FB8B 1U58A 3NABH 5BOZG 3SQBA 1OGGA 2B4CH 4GW4A 3D0LB 5EOCJ 1JMXA 2ZX9A 5E6IC 5A2BA 1FIGH 3OKOA 4XPTH 2CH8A 3QFJE 2X4TB 5H35A 4TSCH 4WCYH 32C2A 3CFBA 4J23A 1KCKA 4UTBL 1FPTH 5HYJD 4CU6A 4OIIH 2J25A 2BHZA 1YJDL 4XNZC 3BSHA 3CIVA 2JJTC 5EN2B 3S6CA 2BSSB 1RIUL 1TTUA 1N64L 1YY9D 1B3JA 4TUOA 2CR6A 4F7EB 5CSYA 4AZCB 2H2SD 4PTTA 1N5YH 5DRZB 3UG4A 3AC0A 4MXQC 3SO3B 2OWCA 4J3SA 2WB5A 3DVIA 5EWIL 2BY2A 4HEME 4PG2A 3L1OH 4G7YH 1PZ5B 2AW2A 1NP0A 4N9OB 4KQ3H 4HWZB 2VDRH 1UZ8A 1NGWB 3VWJD 1IQWL 3WDHA 4OM0L 4TVUA 1IGIL 1T66D 4HKZA 2PWEA 3WN6A 3MJGX 4ZTPL 3BAXA 5FGCB 4KI5D 1CBVH 3EO9H 3B3IA 3PF2A 4JRYB 1IKNC 1C91A 3VFSB 2HJKB 5C0CB 1I7ZA 3FRUA 5JW5B 5D2NE 3L3OA 3E6FB 4PJDE 1HIML 2VOTA 5DT1H 1EEYA 2EE3A 3VWKA 3MNVB 4BFEA 3CFEB 1JYXA 3WCYA 3MYJB 1ZLUH 5A3HA 2YBTA 4Y2DA 2V7HB 4KROD 5EOTA 5IM7B 3MA7B 3L4YA 1VCAA 5DQDL 3OG6B 3WUWG 3DI2B 3RGHA 3ZKXC 4MAYA 2VL4A 1LO0H 1LD9A 1MFUA 2WWMC 1H15B 5IF0A 1L7TL 5I5RA 1CICD 1B3YA 2G2RA 2ICWB 3K8MA 1A02N 3OZ9L 4NO0A 2LU3A 3P0VL 3WF0A 1US2A 3DVNB 5A6BD 3RNQA 2MWCA 3RJDA 4F3FB 1S7SB 1HE7A 5C0JB 3KNBA 1LK2B 1MJJA 1QBLH 2W60B 4YDVA 3MV7A 1D5ZB 5IVZA 2XA8H 2P47B 1SYVB 5DO2C 3CFKB 3WFLA 2BHUA 2AXFB 3UTTA 2A73B 5DRNA 3WFEL 5HHXL 3BUTA 5B8CA 1BQLH 3QIBC 3TM6A 1NWUA 3H42H 3UCQA 5L0QB 1I1AA 2QSTA 4Q9RH 3T0ED 5HNNA 1UA7A 1NUNB 4GOSA 3S88L 4G7VL 3U7WH 4YIQB 3P9LA 5I17B 1LP9B 2YR3A 3F62A 2DJUA 1C7TA 3DX4A 4NXSA 1KN2L 3A0OA 4OQTA 4FFVD 2J8UF 1HZHH 2DI7A 4ZO6A 4UFHA 4Z7WE 3WQVA 1QEWA 2IQ9H 1IGCL 2C3VB 4PJIE 4OZIF 3Q3GA 3QQ9D 1HINH 4N0YH 5DVNA 1GJIA 1IBGH 5I30L 4EDWH 2EABA 3FZUD 4DGVL 3KYKH 3NPSB 2JIXB 3MNZA 3NACL 5BS0A 1JHLH 4D9LH 3ZYJA 4NKQB 3ULVE 3II1A 5I1LA 3H6JA 4LDOB 1E6RA 1OSPH 5GS3A 3F5KA 1CLOH 4WHTA 5I1CH 5JQHC 4OGZA 5D8JH 1NGXB 3BVNA 4NOBA 5HYJA 2HVKB 3M17B 1T1ZB 3RUGF 4BA8A 3UP1A 4M1RA 1BIHA 1YUHA 1MRCL 3LKPB 2GI7A 4K3GA 5DK0A 4DVRH 1S9WA 3CLEL 4GKZB 5CSGA 2VZVA 3WJLC 3ARPA 1R3IL 5DA4A 1CDBA 4L29B 1DQMH 5CEYB 3BVVA 3O4LD 3BH8A 4RZCA 2X4OA 3PZVA 3KXFA 4PMVA 2EDYA 3IDGB 1XF3B 3ET9F 4FZ8H 5E2WH 1DQQA 3WSQH 1IC4H 2GY5A 2VXUH 1G7HA 3VWJA 4L4OA 5D7IA 4U6HB 5HVHB 3VM5A 3L3DB 1PSKH 1ETZA 2C8NA 4LCCA 2VYRE 4Z7VB 3BDXA 3B43A 4LKCB 1T89C 1X5JA 2X5PA 3P0YL 5IVXF 3TJEL 3AYRA 4QTHB 4K94C 1IQDA 1QPKA 1F5WA 1JVKA 3QOMA 1IGYB 1G7LB 5TDPB 2PXYB 3TA3C 2V17L 4P5MA 4V27A 3TPKA 2JJSA 1WTLA 2C1OB 4MWFB 3WFHA 1QKZL 4KK5D 2B2XL 1J12A 2I26N 2BVTA 3RTQD 4TRPH 2GK2A 5I3DA 1SMOA 4N9GA 1K2DB 2NW2A 4ZFGH 1BWMA 4OI9A 4WDIA 2R2HB 3OAZH 1ZHNB 3CD4A 4APQC 4LOUD 5CMAA 3FONB 3ORJA 4JKWA 4ZD3H 2VZUA 3L3JA 1CE6B 4RWYH 5F1OB 4PG9B 3CDYA 1ADQL 1R85A 3HA0A 5FHBL 5K9QG 1RHHB 1BQHB 5IT2L 4P2YA 4P2RE 4D8PB 5E8NB 1S9XA 3VXME 4KV5F 1RP9A 3WF2A 5IIEB 4GRMA 2B5IB 2CIKA 1NSNH 1T7VA 3ARUA 3CZKA 4X6CE 2R0WH 4NO2A 3WUGA 1AD0A 5GGTH 3I6LD 3TVMD 2PYFA 5KSBA 2V2TB 4JPWL 1NL0H 2P4AB 3O0RL 1V3IA 4XNMB 1RJLA 3CSPA 1QNSA 1WAWA 5FYKD 3T0EA 4NN6C 1TMQA 1GGBH 3SY0B 3CFJB 5EBMA 4CNIB 1HILB 1J5OH 5FUOH 1UXWA 1ZS2A 1J8HD 4MA7H 3EYSH 3FHAA 4WU7A 5JHDD 2VO5A 1R3JB 3VCLA 2YPKB 3RILA 1UM4H 3DUUB 1RZGB 4CMHB 1ZGLP 4DWSB 4M5ZH 5DURD 1JXJA 3DBXB 1CFBA 4LIQE 3WIHH 3HZKA 1U58B 3LH2H 3PZQA 3GSUB 2ZX8A 4HUVA 1AR1D 4YZFF 5IMMB 1HHGA 4M80A 3OKOB 3RVWC 2EDRA 3V0WL 3EHBD 1L0QA 2EIBA 4Y8AA 1WTGT 3WS6C 3C9NA 3CFBB 4AEEA 1QHPA 5JBFA 5AWNL 4BYHA 4PJ5B 1FZMB 3D2UB 2FX7L 1I3VA 2NY4B 3SBWA 2DPEA 4TQEL 2AP2A 4MNHA 2GTWA 4XP1H 1MQ8A 3ZO0A 1LO5B 1NC2A 4LRNL 5JORB 3TIEB 4OB5L 2EDHA 1RH9A 1UWRA 1ZMYA 2WMJA 4ZFMA 1JDCA 2V2XA 3W11C 3AB0C 1GJWA 3VNYA 5J1SC 3SGDH 2AK4D 1I1WA 2A6KA 4I48A 1RURL 5C09E 2YN3A 4KHTL 2MJWA 5BVPH 3QUZB 3E8UH 3QDGB 1FYTB 1J1PH 4JZOA 4AG4H 2B0SH 2X42A 4Y16C 3EJSA 3FRPA 1VERA 1E4XL 2CKBB 1FL6A 4FQLH 1J0JA 5FUZH 4X6BA 1AGCB 5T1LD 3VI3E 2LVEA 1QVBA 3O11B 3QXAA 3GIZH 4YDLB 2AXGA 3QIWC 3IK2A 1XF2B 2YL5A 5MHSD 4UILL 2X1XR 1P7KA 3IRPX 1FP8A 4HPGA 5FCUH 5F3HA 1KJVA 1F4HA 2H45A 4M02A 4Y1AB 3GJEA 3PV7A 4PGDA 4NRZB 3WDRA 1R5WA 4Z8FH 4PRPE 3ARGC 3S5LA 2EH8L 2F8QA 3OKNB 4MAYB 1LL4A 4OGXH 5D6DA 4Z7UA 4JFDB 3VXNA 3AMKA 5HBFA 3W9EA 2HFEA 3PGFH 1YEJL 1X4ZA 3RPKA 2MANA 1GW1A 4XAWH 2DYPB 4RGOL 1UUQA 3M07A 3W37A 2PW2B 5KVFL 1EA9C 2N1KA 4P2QA 1A7NH 4ZAKB 5C0GB 1GJUA 5C2BL 3QI9C 4MZ2A 3HUJE 1S7XB 1N5AB 3QFJD 4YFLI 4AMKL 3LMJL 5JW4M 1MJJB 2IG2H 1LWJA 1Q9WA 4M6NL 4AD1A 4MQTB 3MJ8A 3RL2A 3ZQ9A 5EZJA 5DXWA 3G04A 4H1LB 1MWAB 3UTTB 5I1IH 5DRNB 5GGQL 3C5ZA 1Q6CA 3TVMA 4N68A 3MLZH 4WW2F 4YFEA 5IMOA 3Q6GL 2A77H 5EUOA 4PJCF 4EVNA 2LU4A 3SKNA 4DAGH 1HF6A 2F53E 4QFUA 1C1EL 3QULB 4MDJB 3EO1B 1A0QL 1Z9OA 1N8ZB 5DLML 1OGAA 5LGHL 2R29H 5E08L 1WBXA 3DVFA 2EO1A 3EOBB 5HDOA 2O9PA 1CGTA 1P4IL 1LQSR 3U7VA 5JHDA 3ARFC 5ELIA 2J8FA 1QEWB 5DMIH 1TPXB 1BPVA 1N3NA 1PBYA 2BVEA 4K94H 1U2CA 3MBED 3SDAB 1ITBB 4GXVH 2W62A 4AM0A 2IFGA 5DVLA 4NQCB 5SWZB 3L4ZA 2F1BA 5D7IF 1CGXA 3GSWA 4HEPG 4TTDC 2IBZX 2CO7B 4OI7A 5FKPB 4GKSB 5FGBA 4XX6A 2GJZB 5BROA 4XP4L 3B6SB 5I1GL 5I6XB 2XN9B 2A6DA 2BZDA 1MCWM 2Q87A 3D52A 5HYJB 3BUYA 3VG0H 3GJFH 5I78A 2GUOA 2YOCA 1A1MA 4DO4A 2Q8AH 4CCDA 2CK0H 1BYDA 3DV6A 1OGTA 4ISVB 4HV8B 2G3NA 5BXSA 3W6MA 2XICA 5I1EL 1EPFA 3A6BL 1Q6DA 2OQJA 3BD4A 5E1QA 4ACZA 4IBLT 3VWJB 4DW2H 3GTNA 1BQCA 3ZJ6A 3OLDA 2I9LA 4F9DA 1W0YT 2ILLA 3OAUH 1YN6A 2G3IA 1V6VA 3RZCD 4EI5C 4AWEA 1EX0A 2WZIA 5D7KE 3CVHL 3L95A 1TIUA 2VDPH 4WEBH 4XNYH 5GRWA 3QQ3B 1H5BC 5T1LA 1CIUA 1QBML 5D9PA 3L6FA 4L8DA 1T22B 4LSUL 5DQ9B 2DQIH 4UQ3A 5KSBF 3MKKA 5KSVA 1GC1C 3QUXD 1JP5A 5FECA 3OIHA 3CUHA 4NC0B 5FO7B 2PBOA 4KKLC 4HIHB 3NA9H 4WDIB 4XHQA 4FTVD 3PZGA 2ZUSA 5HHNA 1IC7H 4NWTL 3SOBH 4N1EA 1CICB 3BEWA 2J7DA 3SCUA 4U0RC 4GG6A 1GOFA 1EVTC 3L3JB 4HC1L 1KXTB 3SDXA 3LXBA 1JGVH 2XZAH 5DF0A 1W72H 1A1OA 2V5DA 1YEEL 2ESVE 4N1CA 2D31A 3AM8C 3LD8C 5CKGA 4KKBC 3QFJA 1YQVH 1S9XB 4ATDA 2BNRD 3L5XH 1TZIA 2I07B 3PWVA 4GRMB 2PWGA 1S9VA 4NO2B 3ZTJH 1P4LA 4GS7B 3X17A 2PYFB 3FQRB 2IADB 1ZA3A 4BQ6A 1ORSA 1U95A 4KPHH 1RJLB 3A47A 1T83C 3T0EB 1T4KB 3H3PL 1B0RA 35C8L 4P8VA 3OAZK 4YHIB 3UG3A 3LHPL 1OQOA 4WU7B 5HHPA 4MB1A 1T04B 5BO1H 5EPMB 4HUWB 4R2GC 3L4TA 1ZBVA 5CWSB 4LHUG 3GKWH 4KRPD 5FFLA 3L2MA 1Y7VA 1O0VA 5D7JB 1HHKB 4PJBA 3VO0A 1U3HD 2AJUH 4YE4L 3SGEI 2D4FA 2VDLH 1OWRM 5EORL 4JZNA 4W81A 5D2NA 1A6PA 3QH3A 3N1AA 5L88L 3W24A 5DMGD 2DL2A 1U93B 3SQOH 4PJDA 3DX3A 3UEZA 3EYQC 2VL5B 3W0WA 1KCUL 2G9HB 4J7RA 4ZNEE 2GJ6D 3JV6B 3MV8E 3QUYC 2WNGA 3U7YL 4MCZA 5EU4A 5KVEL 4UQBA 2PI6A 4BFGA 1F4YL 4NQVA 4F8TA 1ZL1A 4PY8J 1X5FA 2BJML 3WHXB 2Z8SA 4PJ9A 4R90H 4LSPL 4UIKH 2RIKA 4OCLC 1YECL 3QT2A 5B3JE 1XHGA 4MA1C 1LDPH 4TNWF 3O4LB 5CJXC 5AY7A 3B9VA 3WO4B 1HP5A 1QA9B 4OBRA 4I0KA 3K4AA 3NIFF 4Z7UF 1CLZL 5TFSH 4I48B 1SEQH 3TV3L 4P2RD 4XPFL 3VXMD 3Q6FB 3CHCA 2AABH 4UFJA 5EBLB 2VXVL 3IETA 1QI0A 3KLDA 3K1DA 1MQRA 2QSVA 2NXZD 4MDPA 5JMOC 2FO1A 4EN3D 4OIAA 3RZCA 1BHGA 1CXEA 4X6BB 1WSST 3QXAB 3WD4A 3O4OC 1KCVL 4HIXH 5KVDH 4WHCA 3JV4B 1H0DB 3CZNA 1B30A 4XPAH 2YD3A 3VIIA 2YUWA 4X6DE 4ZS7L 3WY4A 5ANMA 1LGVA 1JGEA 3KLHD 4FNQA 2FX9L 3HNSL 5A8OA 5ITFB 1A4KA 3MU7A 2DLEA 4LLVA 5EU6B 1XH2A 4PGDB 3MRBB 4BF7A 5EUOF 4HJ0D 3RTQB 3S5LB 1BD2A 4HIEA 4RISL 1OHQA 4Z7WA 4HKXB 2FO4A 5BXPA 2AEQL 4PJIA 4NM4L 4HGKC 1AQDA 4KK6C 3OZOA 5EZLB 1XAUA 3BWUC 4FZEH 1G7JA 3GHEL 4CMMB 3CZFA 1PKOA 5E00A 4AZBA 1AHWB 1UGNA 2HJLB 3U0PA 5I1JL 3LRGA 1OAUH 3C08H 4MB3A 3O2DL 1W9DM 1NGYB 3HG1E 5CHNB 5KJRH 1L0XA 4BQ9A 4GAYB 3MJ8B 2L7UA 1JI1A 1NCCL 1TJHL 4DZBB 3RM4A 5C3TA 1B31A 3S36L 4QHUA 2D7TL 1ZVSA 3TVMB 1EMTH 4X7EC 2VXTL 5LGJB 4OZOA 5GS0C 5A8QA 2AV7B 4ZDHB 2BVOA 3QPQD 3RWFB 3X14B 5IW3A 1XIWC 3KR3H 1JFQL 3NSNA 1BLNA 2PW1A 4U2ZA 2GDUA 4FFZH 3LRSA 1J8HB 3UMTA 1PKQA 5EDXA 3K7UA 4F2MB 1FVEA 4EZMA 4JKMA 1QO3A 4JAMB 1FV1B 4P2OC 1G9NL 3HAEH 3O3DB 4YXHL 3R1GL 4L3EE 4L8SB 3NAAH 1MCDA 2L0DA 1KB9K 4WNQA 3OKLA 3MMDA 5DURB 2CESA 3WFDH 4PMDA 2K3TA 4LGPB 2IF7A 3Q1SL 3LEYL 1R3LA 4M93C 3T1FB 1E4NA 1HKLH 2DN7A 5IFHH 3AQUA 3GSNH 1P6FA 3V4UH 5EOQH 1XGRB 1GC1H 1VACB 3RIAF 2GSIB 2IAMC 1HYSC 2GJPA 3VU2A 1GNXA 3QCTH 5B38B 1G0XA 4YK4B 4X0KA 4G6FD 3APGA 4HHAA 3D4ZA 3BUYB 3GXFA 4LP4A 4PRPD 3L3IA 4JHOA 1A1MB 4MSWA 4FNRA 1IAOB 1WZMA 5CJBA 3MODL 1RZIB 1MCFA 3BWAA 4RGMC 1OAXH 3ZTJG 2XNAA 1JF5A 1D5BB 3AJ7A 5SWQB 5ETUA 3BGMA 2J3SA 3EJYC 3VXSA 4TULL 2NY7L 1FNLA 4LLYA 2OQJB 4TVPE 3LKOB 5HD8C 4H7VA 1ODZA 3VIOA 2AK4B 3V6BR 3K46A 3QB7C 4ACZB 3R1GH 2ZKHL 3UXFA 3P11L 2PTUA 2VQ1B 3KJ4B 5FYLL 4IEFB 3PWPD 2NY0D 4X6CA 3SDXF 5FK9A 3FFCE 4BM7A 1UWUA 3AHVA 2DQGH 4K7FA 2ZCHL 5CD5C 5T33L 1J1OH 3ULUE 1JHKH 4QWWD 4CADA 4WKHA 1QHZA 3TFKD 3SUVA 2NXYD 5T1LB 1C16B 4ONGH 1F4AA 2P8MB 1CK0L 4MCYA 3GSQA 4JRWA 5GJTH 3VGGA 2F53D 3L6FB 4L8DB 3DMMA 1SM3L 4YO0A 4UQ3B 4GW5A 3GBMH 2VR4A 3IXAB 4MA8H 3GH5A 3V5DA 1A3RH 2ENSA 4GMTL 2VQTA 1MLCA 4JN1H 4D6IA 2W91A 1KGUA 1BOGA 2BVYA 3L9RA 4FNSA 3VFNB 4MLIA 1Q0XH 1HN1A 2W9EL 5EU5B 5DYOA 1OM3H 1JGIA 4LLDB 1DANU 4MNLA 2EDKA 3WEOA 1A1OB 1NMAH 4DGIH 2W59A 1FFOA 5I1HL 1XF1A 4G9FE 3HR6A 43C9A 4PJBF 5F7KC 3W0KA 4OGYH 3VFTA 1TZIB 4OOUA 4NP4L 3ES6B 2W67A 3U9UB 4U1HA 2CXKA 1RMFL 3LEVH 4N8VA 4UFIA 2CPCA 2IFFL 5I18L 1F4WH 1AGDA 1II4E 2GJJA 2XWTA 1WBYA 5IEKA 5FAAA 4GXUN 4WW1A 5IJVA 4MNGB 4PJDF 1RK0A 2A3BA 3POHA 1FGVL 5I66A 1BG4A 3OX8A 2X4UB 1FFPA 1KLGA 1OW0A 2Z31C 5CLWA 1B0RB 1VBRA 4KZEL 5CBAA 4G6KL 3LV3A 1UG6A 1ZVHA 5LXGL 5J0BA 3N12A 3H53A 4OSUL 4EBQL 4HIIA 1HI6B 1E6JL 1B6DA 2GCYA 2YLLA 1MHHB 5IG7B 2BXZA 4PGCB 4MJ5A 1FH7A 5C09A 1GQIA 5MEOB 5CIPH 1MEXL 2XQYG 2FSEA 2HVJA 4Y89A 1RPKA 4PLOB 4PLKD 1EJOH 3MBEB 2YS4A 5A2CA 3QG6B 3EJRA 5F9JB 2WC7A 4JZNB 1I8KA 1JN6A 3ZE0F 2FIKA 3HMXH 3FQNB 2A0LC 2MQCA 2DH3A 1KELH 2QQKL 2HJFA 4S1RH 3SIMA 2PWDA 1U8MB 3V4PL 5CZVL 5ENWB 4DZ8A 2VITA 1GAFH 1SY6H 5E5MA 3RCNA 1BVLA 3CFCL 3MLTA 3UESA 3ELAT 4JO2L 1HKMA 3QNZB 4MHHG 5D9OA 3QHZL 3QCVL 4XX1G 3S35H 4CDGC 5FO8A 1ZHKA 2EYTA 4PRDB 1KB9J 4OM1H 4JY5L 5D9SB 2E3ZA 4GI6A 3U4EB 1EXUB 4ATWA 5TQ0H 5DEFB 1P69B 1EOMA 1U8NB 4KUCF 5TGBB 3HR5B 1F4XL 1MFBH 4ZO8A 4K8RD 4P57B 2V3DA 1NCDH 3HUJA 3TEUA 1K9DA 3Q5TA 3TBYA 5JLZA 4K71C 4ELME 4HS6B 3G6DH 3GMLA 1PY9A 1T5WA 2R1XA 2FHBA 3FB6A 5GS0H 1WZKA 5HYQA 4WI4A 2VISA 1FNHA 4HSQA 3WQ6A 4Q6IB 2HFFB 3ZYZA 1V5JA 2BY3A 3HAEG 1REIA 4K9EL 2QQKH 5DD5L 1KIPA 3ULVF 1H0IA 1U91A 4KZDH 3GNRA 5D9MA 3D48R 4BSVB 2F54A 3PWUA 1HXMA 5A3IC 1UWGL 5FXCH 5IWLA 2F53A 1ZK9A 2EH7L 4NJAL 1FH9A 1DANT 4LLVB 5HPMA 5KSAC 1N6VA 5C07E 1MNUH 25C8H 1V8HA 1DWFM 3QUXB 3FQXB 3P40A 4HIEB 3ZYOA 4NGHL 5FD0A 1H8SA 4Z7WB 1SEBB 2G8ZA 4JFVA 1KFAL 3BZDA 3HTLX 1ORQA 4XNUL 1EEZA 4FTVB 2ZXAA 5I1AB 1G7JB 3F4VA 2O5ZL 3CDFA 4HXAH 3CVIL 3OLGA 3WKZA 1AI1L 3KS0H 2HWZL 1RULH 4P4RB 3G08B 4OT1L 1MIEL 4FOMA 2Z8WC 3WKML 2PWFA 1LO4L 4I13B 1J9CT 5IW6A 3AHYA 3GO1H 2ZUTA 1QNZH 2BNRB 4M62L 3QFDA 4OLZH 4Q7NA 2YK1H 1CGUA 1ZGLA 1K4CA 1YC8A 2E5EA 2VH5L 2D4DA 1CF8H 4POYA 3DX0A 3QGVA 3FCTA 4FNLH 3C6LC 4O00A 4JHBA 5E2VL 4AZ6A 2CUIA 4ZPVA 1YEDB 4OLXL 5E24E 5HYSA 3WLBA 2W9DL 3GH4A 1BLNB 3IDNA 4D6HA 2ZE0A 1NFIA 4NM8L 5HI5C 1MELA 2GYSA 3JWDC 4LAQH 5J6GA 1AVAA 3CAFA 4OZ4B 4E2OA 8FABA 1W1TA 3VDHA 1I8MA 3NDYA 5ITBH 4KRPB 4JL1A 3FMGL 3DSFH 3MROA 2M26A 1WGOA 4F7PB 3VD4A 2XIDA 1N59A 1U3HB 3MMEA 2GT9B 3S4SB 4TVSa 4PJ8D 2A3HA 5CP3A 5C0EA 3AREC 1ZLWH 2HFGH 1S7TB 5CEZL 2YMXH 4X6CF 2A2QT 4JGUA 4NNYB 4Q9BA 2P5WE 3TPUA 5A8NA 3V7AG 1SZNA 1G9ML 2GJ6B 1BYBA 4O2EA 4KUZH 4KC3B 1UKPA 4MSWB 2NNAB 1L9NA 1T1YA 3JV0A 4L1DA 4RE4A 2MNUA 3C87A 2XNAB 1NGZA 1AXSA 3QXDB 4ZXBD 1S5HB 2VAJA 4S1DD 5ETUB 3ZHKA 5J13C 3ZKSD 2YSSB 5IB3A 3GMPB 4TXEA 3VXQA 1UKOA 6FABH 4FLQA 4ZS6D 4YHYB 1AKJA 3H0TA 1HVQA 1L7IH 1QLFA 2ESVA 5B4MC 4HWBA 2CKBL 3GK8H 3HCVA 4P2RB 3CXDL 3VXMB 2YKLH 2YA1A 2X10A 3GBDA 8A3HA 4NN7C 3O6ML 4RNRA 2XTJE 3A67H 4QF1B 5C0RH 3A5VA 4JG0L 2HRPH 4XCFH 4EN3B 3MXWH 1U42A 4OCSL 1A47A 5ABDE 1I85A 3FOLB 2YJQA 5ESQA 5FOBA 4YO0B 3LXAA 2EDTA 3NCCB 2C9AA 3EYOA 4ZOBA 1G7PA 4PP2A 1MLCB 1SR0A 4Z2IA 3BJLA 4HCRH 3OLEA 1GHFL 3MRFA 1D9KA 3LN4B 4L3ED 5I8CB 1GONA 2EDLA 4JPIB 2BY0A 4LASL 3SUUA 2SEBA 5E6ZA 3MJ6A 1KCRH 3L5IA 3NFPA 3UYOD 5DK2B 2X4SA 4JE4B 3QDMD 5F1KC 3QJFB 1JGDA 2Q86A 2O26U 2QHLA 1UYWL 3REWA 3GUTB 3VIJA 3QNYA 5BW7A 3N1FC 2DBJA 4NHCH 2V6HA 1FFOB 1MWAL 4LSSH 4OCYH 4WU5A 4YHNA 5JXEA 3VGAB 1OP5H 5JMRA 2H3NA 1JWUA 2BOCB 2PO6B 2DM2A 1T0MB 1YEKH 4KMLB 5I76A 2IH3A 3MA9L 3S3SA 2WQRA 2J4WL 3SGEH 2UUDK 5J1AB 4AENB 2DD8H 2Z92B 3MV8A 1K8DB 3VI3F 1NEZA 4NKDA 4M81A 1IZKA 1O6IA 2EZ0C 4NQSB 3TN0D 3FN0H 3W2DL 4DWHA 3OX8B 5ADPL 2R4SL 3D85A 4OQTL 3C2AH 2DWEB 3W5NA 3O45B 1KLGB 4MA3A 2L7JA 1JI2A 2ICCA 1DBBH 4UIMA 5I16A 1W1YA 3I50H 1BGGA 5D1XD 5ILTH 2ZNXA 3G5XA 4TVPD 3IJHB 1IC5H 4OZGE 1D6VL 2IWGA 4R4FH 1CVRA 2GCYB 5EO9A 4MGXA 1LL6A 4D94A 4MXWL 8CGTA 1SYTA 3W25A 2ORBH 1BJMA 2FSEB 4GT7A 2EO9A 3CUPA 5MEQB 3P9MA 4XNQA 3FFCD 1NP2A 3IDXH 1KIRB 4GLRH 1W2PA 1UB6A 3V6OE 2OJZH 1JN6B 2X41A 3CMOH 4EIZC 2OSXA 1GGYA 1CU4H 3A6CL 3TTSA 2OTUA 2D7NA 3BPCB 4UDTA 5CJOL 1YY8B 5DJ0B 5E8DL 1CD0A 5KW9H 1FAKT 4QRPD 3L4VA 3ZE2E 1DFBH 2E9JA 3AFLA 4ZPTB 5K9KA 2I9TA 4X6DA 4WTZA 2VITB 4U1SB 4G6FB 4Y5VC 1BVLB 3FT3A 3UAJD 1YEHH 2R56L 4S1QH 4BZ1H 3UBXG 1KYOK 2VUYA 4PRPB 4NQDE 4J4PD 2VLRE 1VGKA 3DHUA 3FO0L 2EE9A 1W3HA 1RUMH 5H8DA 1MCOH 5BYWA 2E9WA 2PF0A 5DRXA 3QWOA 1NFDE 1RIVL 4OQ1A 5CKAA 3CUIA 3X12A 1FNSH 1MREL 1YNTB 4KRUA 4KXZH 1IJ9A 5FM5O 3PGDB 1A9BA 1QI4A 3O6LL 3ROLA 1T0NA 5D1ZC 3BQUC 4HMCA 1BZ9B 2OJEA 3MUY1 4G9FD 4G6ML 3SCMD 3HZYB 2YDQA 1PAMA 1JPFA 1FVCB 5DD3L 2BC4A 5HI3C 3HG1A 1D5IL 2UZYB 2QQNL 4IOIB 4TUKL 5ABHA 2VI0A 2ADFL 3ULSB 3PWPB 5HDQH 2NY0B 4NRYB 2IMNA 5ID1A 4U7MA 4HUXA 4EUPA 4WFFE 3TO4D 3LS4H 4OAWB 3HE6D 1DUZB 4KK8D 5KSUA 1WC7A 3VXPA 5IW1B 1SBSL 3JWDH 2NXYB 2WHKA 4HT1H 3MCLH 2F53B 4UV4H 1U8QA 3UPRA 1CR9H 2E9IA 2HH0H 3L4UA 3W39A 4KMTL 2FIRT 4ZUSA 4H2CA 5HPMB 2O5XH 4JM2C 4U1IB 3MLWH 4YHPB 2C3WA 3DC0A 1BFTA 4NZTH 4Y5YC 3BXWA 1CGWA 1GVIA 4BK5A 3ALFA 4PV8A 1KBGH 2FBOJ 3TH2T 4QXTB 1HT6A 4Y5XB 2X7LA 4HFWA 3W82A 5CJ5A 5DQJA 1VRXA 1OTUC 3B9KD 4L5FL 2VR9A 4H20L 3RWEA 1C5DB 5FM8A 1NEUA 2Z93A 3DWTA 3S34H 1JTPA 4NQTA 4ELKA 1XR9A 1MFEH 3MR9B 1H2JA 1CFQB 3QFDB 4WI3A 5DUBB 3IVKB 2FZ3B 2GY7B 3KYMB 5LBSL 5T5NF 4R7DA 1TJIH 4NCC2 3AS2A 4Z0BH 1SMAA 3S5ZA 1OAQL 1KEGL 1M4KA 3OAYH 4UZSA 2QPSA 4ZFOB 3AAZA 1FL5A 4RBPK 3ESUF 1NFIB 6CGTA 5LA2A 4JHZA 2FB4H 2RHEA 3MXVL 4NC1E 5D1XA 1FRGH 1JJUA 1NGQH 1LEKB 1PLGH 8FABB 1I8MB 5DD6B 1YEIL 4PP1D 3D9AH 4KY1L 5D6CA 4QXUL 1BEYL 1OSEA 2V9QA 4GZIA 1KV3A 2D9CA 2FLRT 3MMEB 3VIMA 1DVFC 4FQ1L 3SKJL 1W91A 3KPQB 3HNTH 4H25B 1HJQA 4Z2HA 1EBAA 3TWCL 5MEPB 3CHEA 3OGCB 4DKEH 1T0OA 1MHEB 4MQXC 2YBUA 3CXHK 4P23D 3EOTL 4JKPL 4MJIA 4UOQA 2ERJB 2DOCA 4QGTA 3ECBA 3MJ9A 5C07D 4U31A 5IOPB 4R6UA 1P1ZA 4X8JB 4JFQA 4PPTA 1W8NA 5JQ6H 1M01A 4F15B 4J4PA 4IIQA 1M1SA 1S8DB 1F90H 5JDSA 1NMBH 5DS8A 2ZX6A 4ZSOE 4WWKA 3N9GL 1SJHA 2A74B 1KXHA 3PL6D 4P3CH 4WKFA 3R06A 4RFOL 4NUJB 4ODUB 3JVGA 4Q7DA 5MENE 3H9HA 3VXQB 43CAA 3IKKA 2IH1A 3PV6A 3V5KB 4G9FA 2R8SL 4YAQB 3CH8A 4W68A 3OF6A 1BM3H 2Q76B 4GRWB 4JDVA 1KYOJ 4HIJA 5CBEB 2P42B 2FJGA 2ICWJ 1B4JH 4OD3H 4V1DD 3MREB 5E8OA 3MNWB 4G42A 1GZPA 2J6EA 4XCYA 5TDOA 2WIIA 4G8GE 1T20B 1YEFL 4NO3A 3TESA 1AR2A 3NCEB 3S3PA 1CGVA 1MLBB 2HYMA 4PP2B 4XP5L 1E4MM 1CDIA 3QHFL 3VFWB 3QIUA 4J6RH 4AMCA 1IGTA 2IPUK 3CUGA 1KXQE 4YLQT 1DSFL 1NMCB 2JELH 4AIEA 1V6YA 1HH9A 4NZFA 3PP4H 4HH9A 1N6QL 4PJHB 3BP5B 4HA3A 1E28B 2CO6B 1B2WH 2SEBB 5CEXA 1OTSC 4LARH 2JCCE 5DWUH 2KZWA 5A1AA 4FLRA 2X4SB 4LKXA 3QDJE 4BH7B 3GBLA 2VWEE 1NJ9A 4Y4KD 4AL8H 3VD7A 4O5LL 5F3BA 5AD0A 3QEQE 1SHMA 2IH3B 1HYRC 5JOPE 1Q4NX 2P5WD 3HPJB 1A7RH 4JQIH 2E7BA 1Q1JH 2P46B 1AFVH 4LU5H 5FYKL 1FDLH 1NEZB 3RDTC 3W38A 5EIIA 2QBWA 4TUJB 4A6YB 4WSJA 2JF7A 2MSPA 2XXCB 4WENB 1XCXA 2YPLE 4K55A 1IM9A 1EEUA 3O2VH 5EUKA 1LNUB 5DHXB 3WD1A 3ZL4L 1HHHA 3RVVD 3RWJB 4X6DF 1S7RA 3T4YA 3MLSL 1XSIA 4QNPF 4JY4A 3WENA 3AU1B 3VUPA 1NLDH 4PGBA 5IHUH 1JGLH 3TT1L 4NQXB 3O9NA 3C09B 4U6YA 4U05A 4Z78B 2XZQH 1ND0A 5EO9B 4YR6B 3DV4A 1OD8A 1A3LL 3JZ7A 4P46C 5I8OH 4OZFA 4PR5A 4MQ7A 3THML 3U5UA 2UYLA 4OZHB 1FFQA 1YMME 5FO9A 2WZHA 1A4JA 1HKFA 3CUPB 4XNQB 4HUUA 2XTJD 5DI8B 1X4YA 2PBGA 3P4LA 1AE6L 5F7MC 2OTUB 1T2QL 2H9GB 4PJ8B 4CRPA 1BVKB 4LPVA 4K3EH 4NDMB 1XV8A 3G5ZB 4P23A 3NUKA 2QADD 3MLRL 5E8PB 4EJ1C 4OTXL 2F1AA 4M24A 5M3WA 3FT3B 4UUJB 2WLZA 4WF7A 4V2BA 2VZOA 1WBZB 3IFLH 1Z3GH 4XI5D 4M48L 4PJAE 4XB7A 1QPPA 1IAIL 5HHQB 4JO1H 4XBGA 3UTSA 3OXRB