3VMPA

Crystal structure of dextranase from streptococcus mutans in complex with 4,5-epoxypentyl alpha-d-glucopyranoside
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
632
structure length
632
Chain Sequence
GNMINLTTDKAVYQAGEAVHLNLTLNNTTSLAQNITATAEVYSLENKLKTLQYTKYLLPNESYTTQKGEFVIPANSLANNRGYLLKVNISDSQNNILEQGNRAIAVEDDWRTFPRYAAIGGSQKDNNSVLTKNLPDYYRELEQMKNMNINSYFFYDVYKSATNPFPNVPKFDQSWNWWSHSQVETDAVKALVNRVHQTGAVAMLYNMILAQNANETAVLPDTEYIYNYETGGYGQNGQVMTYSIDDKPLQYYYNPLSKSWQNYISNAMAQAMKNGGFDGWQGDTIGDNRVLSHNQKDSRDIAHSFMLSDVYAEFLNKMKEKLPQYYLTLNDVNGENISKLANSKQDVIYNELWPFGTSALGNRPQESYGDLKARVDQVRQATGKSLIVGAYMEEPKFDDNRIPLNGAARDVLASATYQTDAVLLTTAAIAAAGGYHMSLAALANPNDGGGVGVLETAYYPTQSLKVSKELNRKNYHYQQFITAYENLLRDKVENDSAEPQTFTANGRQLSQDALGINGDQVWTYAKKGNDFRTIQLLNLMGITSDWKNEDGYENNKTPDEQTNLLVTYPLTGVSMAEADRIAKQVYLTSPDDWLQSSMISLATQVKTNENGDPVLYIQVPRLTLWDMIYILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural elucidation of dextran degradation mechanism by streptococcus mutans dextranase belonging to glycoside hydrolase family 66
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
molecule keywords Dextranase
total genus 216
structure length 632
sequence length 632
ec nomenclature ec 3.2.1.11: Dextranase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13199 Glyco_hydro_66 Glycosyl hydrolase family 66
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vmpA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vmpA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vmpA02
2BNJA 4NQXB 4L4VB 2DYPD 5LJYH 4HWEH 1IQDA 1WICA 1MFNA 4Z9KB 1P1ZB 3BVUA 1LNUA 4K23H 2ICWB 1CTOA 4OCNC 5F7NC 1PX3A 2ESVB 1ISZA 3TH2T 4QHMA 5LGHH 4Z7VB 3A22A 3HZKA 1IARB 4BZ2H 3IETB 3RIAK 2E9WA 4F37F 4YHZL 5JDJA 5C2UB 5JW4R 2C3XA 3WKZA 3NDZA 4F7EA 2R56L 4N0YL 5D1XC 1AQHA 3A6CL 1IT9H 2OR7A 4OCYL 3BMWA 5A3ID 3W39A 3POHA 4YX2H 3LAFA 2WWCA 1E28B 4OZIA 1IAIL 1NAKH 1TETL 4UNUA 1A7PL 4D8PA 5B38G 1KLGB 1YNTA 2WM0A 3STLA 3T77A 1L9MA 2DH2A 2R0LL 3BKJL 1T5WB 1JGEA 1CK0H 1CU4L 4PRIB 3BEVA 4NWTL 1NH6A 4ZFMA 4J1UB 1KJ3L 3RWCA 4W88A 1JYWA 5KS9E 1GSMA 2CIIA 2YMXH 3KPSE 3MZTA 3QEQD 3RGVD 4RAVA 2AXHA 4F9PA 1QZ1A 2P7TA 2X4SA 1WQVT 2ORBL 5EA0L 1VADB 2V5SA 5F3HA 3KPRA 2NY4D 2X41A 5D7LD 2BC4A 3QUXD 4X5WA 3C6SB 4TNVF 2HFEA 4O2FB 1NGYB 4OFYA 1G6VK 2OR8A 5I74B 3DDGA 1AKJD 2FD6H 1EXUB 4DGYL 4U1KA 4G8GE 5CLTA 5CMAA 3CAFA 5SWQA 1DQMH 2CYGA 2H32A 4G6AD 3TBTB 1EHXA 5MI0B 1GCFA 1KJMA 1KXVA 3BKMH 2OR9H 1GOFA 1TG7A 1DVFD 2BNRE 4JFQB 4ONGL 3BUIA 5C0EA 3BD3A 3PTQA 2P43B 1UCBL 3LQAC 2GEEA 4NF7A 3KXFB 3K8KA 4YXKH 4ALAH 3FB7B 3QEHA 4X6CE 1H49A 1DBAL 4PLJD 4JM4L 1LWRA 4N0CC 3IDGA 1ZKAA 4PBWD 3GJFH 1IC7H 3MJ6A 2AJUL 3W5MA 1JGUH 5HJ3B 1MNUH 3GTNA 4HKXB 4LSRL 5HI5C 2AMGA 4Z2JA 3W9EB 1ZEAL 1E4KC 1Q8MA 4K2UL 4EVNA 4QRRB 1RIVL 1IGML 5TFSH 4AIUA 1C12B 4WKHA 2V17H 4JFXA 4WWID 4U31A 1EFXD 5CCKL 4NHCL 2ZG2A 1QNQA 4ZDHB 4LLVA 1QX1A 5MEPB 3BWAB 1N4XL 3WFLA 4LKXB 4X4ME 2Q8AL 5BQ7A 4U6TA 1Q1JL 4P2YA 4WI7A 5EZLA 1TQSA 3QPQC 4W89A 4NJ9L 2EZ0D 4H88L 4OQTH 4F7PB 3PZNA 5FM5M 5CILL 5HVGB 3VXRA 3C60D 4HK0A 2LE9A 3LKPA 3HCVA 4LRNL 3M07A 2YWZA 5BRZB 1F4YH 1AGFB 3ZTJH 3H3PL 2CEQA 1TFVA 3OZOA 4FFWC 2CKNA 5I5RA 2SEBB 3CXHJ 3FHAA 2A74B 2OJEA 4XPFL 3VIHA 1UB5B 2XTJD 1A3HA 1XGUB 4TSBL 1G1YA 4HG4K 3NGBB 1XF5A 3TBYA 3RUGB 1ZMYA 1B1YA 4XWGL 4RAHA 5IMOA 3HE6C 3GNMH 1DE4A 1F4HA 2NZIA 3JWDC 4PTTA 4R7NA 5ELIA 1ZLUH 3ARBB 3QO0A 4KXZI 5I75B 3OBAA 3MRDB 2BERA 3BP7B 3CFKA 4OIIH 4V2BA 5BVPL 4AIZB 3AHYA 4W86A 3U0PA 5DJ0A 1WBZA 2AJZB 3LXAA 1NSNH 4RGNE 4M1RA 5D93B 4ZXLA 5DEFB 3SE4A 3ARED 3VMPA 3AROA 3SJVB 2IBZY 2DWDA 1HTYA 3MRMB 3O2DA 5I1HH 3D3VD 2HVJB 5F9OL 1OIMA 2P5ED 4JZJA 4PJBB 1EX0A 3EJJX 5E2WL 4G8IA 1SY6L 4F15C 4FNSA 1FPTH 4QYOA 3ZO0A 2CO6B 4ZO9A 1FV1B 2W07A 4UCFA 4WSKA 1BX2A 4UIKL 4IMKC 3RNQA 4ZFGH 5I19L 1F13A 3PF2A 4H1LB 1PBGA 2P5EE 3BZEB 4YDIH 1FLRH 1RJYB 2ADJA 3GMOB 3HG1B 1G7MB 3LRHA 4PS4L 5I1DB 4JFTA 3VG0H 2IH3B 1R3IL 3MSDA 1YY9C 2P8LA 2YMXL 1S7UA 1VERA 2E6QA 1C5CL 3GIVA 3MYJA 1KJ2A 3MZGB 2VCCA 2PW1A 1HXMA 2XJ7A 2KZ1B 3PN8A 2EPOA 4M93C 4QTIH 4HK0B 3VFSA 1GAFL 1A6PA 4U6YA 3E2HB 2PR4L 3I02A 2JEPA 3MACL 4LRIC 3VCLB 4PJBF 1GUVA 3S36L 2PF6A 3B9DA 3EDDA 3FO1B 2C3VB 2DF3A 5T5NF 5E5RB 3TN0A 1PFCA 4ZUSB 1HE7A 4UIMB 2GUOB 1XF4B 1I8MB 1MQKH 4S1RL 4DK3A 5FCZA 3DX2A 3G5ZB 1WPCA 4ELKB 5I30L 4WU7A 1QRNB 1MRFH 1QFHA 2BSED 3PWNA 4KHXH 5TPWL 3TP4A 3LSOB 2B4CC 5F3BB 3PWJA 1W1PA 3ALPA 3QIWD 3WFDL 4BZYA 4UNTA 3TT1L 1OM3H 4PJ9A 3CHEA 3N1GC 3OAZH 2DAVA 1Y6KR 2H8PA 1R3IH 4XI5C 3F7VB 5F88A 2WNGA 2YS4A 4URIA 1PY4A 3GBDA 4MAYD 5HY9B 3MV7E 3CFEA 4RNRA 3LMJH 5A8MA 4NZFA 2W63A 3HMWL 1U9KA 3WJJC 1BD2A 4NP4L 5LCVL 2HTKC 1WBXB 2NSXA 3EMQA 3AM8A 4AZHA 2Z4QB 1C8YA 5E2UH 3WFCL 3O3EA 3GRWH 3NCMA 1I9RH 3QUYB 4PTVA 3HC4L 4KK8D 5IKCB 4GBXC 1U8HB 4J28A 3TVMB 2HVJA 1F90L 4UDTB 1JPGB 2QSCH 5B3JE 5TFSL 4LYQA 3PWPA 5EFDA 5ECUA 2ZOLA 3BJLA 2EEXA 4JDTL 4ERSL 1U3HD 4I2XE 3TNMA 5MEOA 1UR2A 4H1LA 3OR7A 2VL5A 4LBEB 4YE4L 4CCEA 4LIQE 1FL3B 1RK0B 3H9ZA 4JVUA 2Q6WB 3L4XA 4WU7B 1NBYB 3N0PB 3D5OF 2RAMA 3MQIA 4QRPD 5ILTL 5BS0D 1T1YA 5CZXD 1S7XB 3F6LA 3RWEA 1Q9WA 3ULUL 4POUB 1QPPA 3NABL 3GGWA 3HFMH 1JYXA 4WLCA 1WE5A 2WYSA 1KCSH 2FJGA 5D9MA 4NRXB 1OCQA 4UBDC 5GZOD 1TVNA 3CDFA 5E9DE 2QKIA 2UVEA 4A2LA 1R75A 3ZMRA 3NPZB 1BZ9B 1FYTA 2O26U 1CFTB 5C0AE 3QIUB 2EE6A 1XH0A 4XB8A 1MCDA 3NCJH 4QF1A 2VSCA 2J6EH 3U46B 4Z2GA 5HGHA 1JP5A 4XPAL 1DBKL 3BDYH 2DBLH 3ZKXC 3OGRA 1UD8A 5AYIA 3MOBL 5GISH 1HOCA 4LLYB 3BDBA 4GXVL 4HGKC 1QR4A 1RU9H 3ARDB 3GH5A 3PWPB 4JHOA 2BVDA 2VDKL 2CH8A 1MWAL 5E00B 3QIWA 1JCKA 3ALWA 1NUFA 1UR0A 2JB5H 4YDJB 4TUOA 1PG7X 3HTLX 3ZLQC 4EDWL 3GSNB 4DQOH 2WMIA 1EGJH 1ZGLM 4G6FD 2FJFA 3FFCB 1HJXA 3BP5A 3PHSA 4MNHA 5CKAA 5DMYA 3L4VA 2NR6C 4OZFA 4R4BB 4LSRH 4A3YA 3LKRA 1HKKA 3C5JA 4J3XA 1FORL 1KBKA 1XR8B 3NTCH 4WIWA 1V6UA 2V5MA 4P23A 1CD9B 1J05A 1L6XA 1U93A 1SMAA 2ADIB 3GSRA 1HQ4B 1Q9KA 1T1WA 4DZBB 4MNGB 5DJCA 5HDLA 4LBEA 5I79A 4PLJC 1V3IA 3SCMD 4AT6A 1S9WB 4XP5L 1K8IB 4YAQB 1FNAA 3R1GH 2J6EL 2XQBL 2X4PB 2W0LA 1YC7A 5D6DC 3NCYP 4F7EB 1TQWA 4I18C 4AZCA 5B3NA 1NOFA 3KPLB 1MLCB 5TDNB 3WXWH 2JF7A 2O9PA 1M7IA 2CLRA 5CHNB 4PJ7B 4QLRA 3OTTA 2DN7A 1A6VH 4DWSD 2J88H 3OZ9L 4G5ZL 3TO4A 4QRUB 1HHJA 5HGBB 3AFBA 3S96B 3LKPB 4MDPA 3HRZB 1RURH 3VFMA 5HHNB 3MV9D 4FP8L 3ZDZE 3HE6A 4U1GB 5DHYA 2D1ZA 2XVNA 2X4SB 4R4FL 1S9YB 2EIEA 1B31A 3MFGB 4OKVA 4BH7A 3AS1A 5F7EL 3WHE0 3H0TB 3C5JB 2IXVA 4P2RD 3H53A 3S37X 3L9RA 2XIDA 2Z0BA 5HHQA 3TIDA 3VE0A 1OAUL 2GCYA 4OV6F 4K55A 2E7MA 5D96B 5C08B 5J9PA 1WCBB 3VWKA 2CQVA 5CMAB 1H3UA 2ZPKH 3VMNA 3KPPB 4N5ED 3A24A 3WKML 2JELL 2G3NA 4NOFA 4J6RH 1R85A 2ITDA 5LA1A 3VFRA 1UM4H 2FEDC 5DWUH 3D4ZA 5DUML 3C87A 5FYKH 1Q0YL 3O4LE 1NMCC 3HZVB 1II4E 2XIBA 3NYDA 4LL9A 5LBSL 5C3TA 4Z8FH 2R29L 3MLXL 4JM4H 3DETD 1LO5A 4OV5A 1XC6A 4Y4HA 3VGDA 1NMBH 4K68A 4UQ9A 4OCXL 1BQHG 4CL7A 1QSED 4FLSA 4F7CB 2BOBA 3AUVA 1UQYA 3H2WA 4UFKA 1H5BB 5SWSD 2HKHL 5C0BB 2V5RA 1ZHNB 3UTTE 4BF7A 2CBUA 8A3HA 1OP5H 4LSTL 3VFWB 3KLHC 4IRZL 4LNVA 4WY7L 1UKTA 4U33A 5I1EL 5CWSB 43C9A 1GPOH 2VVSA 1BVZA 4GKSA 4KQ3L 5GSVB 1AC6A 4QO1A 5EU4A 3SGEI 5GSRB 3S35L 2Q8XA 5DT1H 1LO0H 1A1MA 2YPLE 4PR5B 3P40A 3UDWA 1UWUA 5C0BD 3WIIL 4HZAA 4R4ND 2LTQB 3D85D 2ZUXA 3VKKA 3UTZA 4I3GA 2EDEA 1ZVSA 3MSPA 5L6YL 2WBWB 1E4XH 1EMTH 4PJAB 1MI5A 3AHXA 1OGSA 5JXAH 2PWFA 1F3JB 1HYRC 3T0XA 4JKWA 3BLBA 4NM4H 4NWTH 5HHOB 1MJJB 1YEHL 4PJ5B 1J8HE 4NC1E 1DQLH 2EYRB 3LMJL 2AK4A 1FJ1A 2EYSB 3CC1A 1N3NB 5HYJD 1V3HA 1EBAA 1RU9L 1IM9D 3GMRA 1Q6DA 2GCYB 3CVHA 4H25B 4A4AA 3RVXC 3GKWL 1OCWH 4KV5F 4KDVA 5C09E 4XWGH 3ULVC 4L4JA 2W9LA 1FNEA 5E5MA 3WS6C 4YHKL 4J2XA 1TNMA 4LSUL 3ECBA 1RZ8B 3MRKA 3NAAH 1RULL 3RTQD 3VWKD 5JQHC 1M7DA 1BZ7A 3NJ3A 1JFQL 2BP3A 2X70A 4FQPA 4XX6A 1JK8A 3DX7A 4G8EA 4HJJL 3QNXA 4PRIE 2RGMA 3MO1B 3WQVA 3AU1B 2Y1VA 2Y07L 3C5SA 5EZJB 2DH3A 2IF7A 3QDME 3ALFA 1ZVHA 5TDPB 1Q9LB 4CVWA 2HJKB 3VX1A 1KEGH 1O7DC 3S3SA 5D2NE 3ROOA 1U41A 1WBZB 3HMXH 1OAKL 2CUHA 1D5MB 4ONFL 3BGAA 5HD8C 3W38A 3LRGA 4PG2C 5D1XA 4GW4A 3TIEA 4BYHA 4C4KT 4N8VB 1UQSB 6A3HA 4J1UA 3WIHH 2YZ1A 2ERJC 2G5RA 3GMPB 5D4YA 2QEJA 4KH2A 1BFVH 1PX4A 3T3ME 4KGJA 4AW7A 3MCKA 4AD1A 4LNRB 3RNKB 3RVWD 4E41A 4U0RC 4MNQE 2DJSA 2WQRA 1AO7E 5E94A 4X80L 5D7IF 3QUMH 2RGLA 4Z7UE 2Z1KA 3W26A 1EEZA 5GGTA 3MNWA 4GINA 3LEVH 1RJYA 2BDNH 4P7QA 1T1YB 4U1KB 3AREA 1ZVSB 1VB9A 2IH1B 5F7LB 3EDJA 2CXGA 3X14A 3BVTA 3JUGA 1KG0B 2VAJA 1LWJA 4IS6B 4JZ5A 1XD1A 2YC1B 3OIHA 2DQIL 3SO3B 4BZ1H 2VXQH 2F5AH 5I1KH 3QZWA 1RJZB 3QRGL 3MOBH 4PRBB 3HE7A 4QXGL 1QNSA 5E6IA 1F42A 1UJ3A 2KZWA 2WP3T 2OTWA 2EICA 5LBSH 4UT7H 3ZKXB 1CDGA 3V0VB 1AR2A 2BNUB 1AGBA 3WF4A 3V6OA 4WDIA 1JFHA 5IJKA 4XVTL 1LK3L 2D9CA 2HWZH 4OFPA 1AO7D 1JHTB 1TTFA 3LEXA 2VRQA 3O9WB 3PHQA 5IVXF 3U9PL 1UQSA 1I8LA 2EIZB 3MLXH 3HR6A 3ZKMC 4X7CC 1FCCA 1RZ7H 2HJKA 2UWEA 3DRTA 3MV8D 2C4FU 3PV6A 2WHMA 5E94B 3RJDA 1E6SM 2R8SH 1CE6A 1KCVH 1JNEA 4JQXC 1IFHH 1NAML 5MEPA 2OI9B 4UU9B 4OB5L 3VFSB 2CRZA 3AY4C 1AVAA 1RMFH 3GSRB 4JFWA 2W65A 4Q9QL 3MRRB 1A6UH 4NKOB 3RUGF 5I76B 3HCVB 4G5ZH 4LPVA 3MRCA 4X8JA 1JZ3A 5EBAA 4JLRB 5DJ6B 3VDCA 4J4PD 4PJIE 2I5YH 1T1XA 2QHLA 4PG9B 1WLHA 4OD3L 4QXWA 1H3PH 1UJ3B 4PREA 4X4YA 2D0FA 1T7XA 2WCSA 4HCRA 5JW4Q 5FIPA 3T0BA 1QI3A 1U8OB 1K9TA 2C1OB 1R5VA 1GZJA 2DJUA 3TJEH 3F58H 1NAMH 4P46A 2EE3A 2VDNH 5J13C 4YPJA 4E2OA 4GO6B 4KROC 3VFMB 4AMXA 1NOUA 3ARFA 5I2UA 1FAKT 2QHRL 3EO1A 3D2UA 2UY4A 2X7LB 4W8BA 3MU7A 5EDXA 3RILA 4OAWA 4IJ3C 2GFBB 4HA4A 3KPNB 4HEME 4YO0B 3HI6L 3KAAA 2X4TB 3VINA 3UTQA 2DICA 2YPLD 3OB8A 3O9WA 1JPFA 5C08A 2D03L 3U4BL 2HLFD 1FNFA 1KCRH 4YUEH 4ENED 3GHEH 3LIZL 4NI3A 2Z92A 3QCTL 1BEYL 4JVWA 3F7RA 1E5NA 4M48H 1NC2D 1HQRA 3K0WA 5I76A 1OSEA 5I1AA 3V6ZA 2ATKB 1UXWA 4Y16A 1G7QA 1BGGA 1I1AA 3L3GA 3S3PA 2FO1A 3BVNA 1LEGB 3JV6B 4DTGH 2PXYA 5BRZE 5IBUG 3QXAB 3UZQA 4JFDB 4R0LA 2Z8WC 3RWFB 4L4VA 4JREB 3ZDZF 2FNBA 2VDQL 2YN5A 2JEQA 3ZDXE 3S5LG 1IGCH 3GIVB 1OARL 4ESKA 5I3DA 4Q0XH 3TYGH 2YLLA 5A6BD 3OWEA 4FZ8H 4BJLA 2G60H 5DT1L 5H8DA 2QSQA 5MERB 4YHMH 5H37H 3RWCB 2F1AA 4KJQC 1V0MA 1MCBA 1UWXK 3EYUL 3E6HB 4TPRL 4ZFFB 1XF4A 1VEOA 1I8MA 5TE7L 3PP4L 2O5XL 4G7VH 3ARSA 1EERB 4TXEA 2AAVA 2Z31C 1YJDC 3D9AH 4JG1L 1ZLVH 5KVDH 2D7TL 1V7MH 4K94L 4FMVA 2JIXD 3D69B 3DYPA 4I2XA 1Y6MR 4NO2A 1A14H 4JCMA 4ZENA 5KSUB 3BISA 4L3ED 4N0RA 2VXUL 2E9JA 4FNLL 5DUPH 4PMNA 3R4DA 1MY7A 1W91A 4L3CB 3QQNA 2Q86A 2WWKO 5F6HJ 5C0GB 2X42A 3W9DB 1JXJA 5ETUB 4OSUH 5BJTA 4ZEPA 3S98A 1H0IA 3HU7A 3NIFF 1QKZL 4WW2C 4LDLB 2ZCLL 2DL9A 4K71C 1JTPA 3BN9D 4IDJL 3MUGA 4P4KA 4PRHB 5DRXA 4KZDH 5IHLB 4G6AC 3PGFH 4GMTL 2W5FA 3BE1H 4OGAC 3AVEA 5A2JH 1JGVL 4FQ1L 3TYFB 1A4KA 1XGTA 1Q72H 1CFQB 5C0DB 2ZICA 4DO5A 3SPVA 2YWYA 3IFNL 5C09B 1VBRA 1D9KC 1P5UA 4TOYH 1TQCB 3IGAA 4Y4HD 1YJDH 1OM0A 1UVQA 4Z78A 3QUMB 1X5FA 4N42A 5IVOA 3JTTB 1HWGB 1B30A 2GSIA 2AEPH 4OCSL 2V7HA 4RFOL 3KPLA 3CSPA 1RH9A 3KPSB 2ITCB 2R69H 1PG7L 3MBEC 4M3KB 4K3JL 4JRYA 1AXTL 5C0RH 1LQ0A 1XGRA 4XC1L 3O6KH 3WNNA 4UAOC 4R4NC 5E9DB 3U36A 4UQDA 1NCTA 2MQ0A 5A2FA 3SDDC 3HRZA 4GXUM 3W82A 1FGVH 2MSPA 4BQ5A 4MXWL 2JCCA 3EYQC 4Z5RB 3VXRD 2VDNL 4YPGB 2APVA 3OKMA 3Q6GL 4ZMAT 3VFWA 3QHTC 5DJZB 3WFBL 3MCKB 1QNPA 5F9JB 2DIJA 3VWJA 2V5DA 3HE7D 1YPZB 1TDQA 1YJDL 3EJQA 2ICWJ 4PRPA 1A4JA 3QIUA 4ERSH 4B41A 1RIHL 2WZEA 3RWJA 5ICZB 2W62A 3CSYB 1HXYB 3G5VA 2VX4A 2J7LA 4GKOA 1DL7H 3VGBA 2WUCL 1U8KB 3LB6C 1UADC 2CRMA 3T8XB 1KPVB 4ETQB 4I0CC 3UP1A 2YC1A 4F8XA 3ARDA 4I9WE 5C0GA 3T1FB 1TJGL 1WAAA 2AP2A 1TA3B 2E9LA 3SKNA 1MFCH 4NZTL 4Z7UA 4FXLA 4AEFA 3GXPA 4TUOB 3BVXA 1A3LL 4I0PA 4Y0GA 5L8LB 5IESH 4P7LA 5J56B 2E3VA 3O41A 3O6LH 4GS7C 4PRDA 2A6KA 4XP9L 3ZT5A 3BP7A 4JY5L 4OZFB 1MIEH 2F5BL 3ARFD 1SJEA 1QR1A 4W93A 2AJSL 5EN2A 2YD4A 4OLUH 2MPAH 1F4WH 1LNUB 1KB9J 2WCAA 4F57L 5D7JA 3TA3B 2WMJA 3B8YA 4PMUA 4P57B 1GGYA 1JI2A 2FIKA 2B1HL 2EEDA 4GAYB 3SCQA 5JBDA 4A2MA 1PBYA 3W37A 3U4EB 4OZHE 5DQJB 1IC5L 5ID1B 3VXMD 32C2B 3HMXL 5TQ2H 3V5HA 5DD3L 5EO0A 5IM7B 1BZ7B 3ULVH 5JW5A 2A83A 2AEQH 5GGSB 2QADB 1T7WA 3MLSH 3MREA 2VKWA 1PYWB 3AU1A 4CKQA 1JGEB 4G7VL 5DTFB 1P53A 1X5KA 4RISL 1NGWB 2XN0A 2NY3D 4Y4FA 3CXDH 2ADFH 5IIEB 2NY6C 1AFVH 3H6JA 3RHWK 4TSAL 4D2NA 4GW4B 2XVKA 4AYGA 1ES0A 4AISA 4MYWB 3DDFA 3VWJB 5F1NB 2EYRA 4HWBL 3ES6A 1KB5L 2QQNH 3HE6B 1ZAGA 5DHYB 2YD3A 5I16B 2MPAL 5T3ZL 4S1SH 1J5OL 3LPWA 1P2CA 2F7PA 1RUAL 4HAFA 5DDHB 5CGMA 4X80H 3LD8C 2X5PA 1ND0A 3G6AB 2J3SA 5DMJB 1QHZA 4HS8H 3H0TA 4QRPE 2Q87A 1U8KA 5HDRA 4QXTB 5EOCL 4GUPB 1M05B 3EOYG 4IRSC 1U8IB 4P2OB 1BVLA 4WGVB 4YC2C 2DKSA 2NXYC 2PCPB 3UTSE 4LU5L 5J3HD 4HSQA 1V0KA 2K7QA 2HTLC 3BGMA 3W6MA 3O3BB 4MAYA 4G8EB 2V5TA 4APQA 4RWYL 2D31B 2WINB 1ITBB 4Y5YB 4EAMA 4G3YH 3CFEB 4RNRB 1QBAA 5TDPA 4KDTA 3KZSA 4LCWA 2AJVH 5FYLE 4ZDHA 4P7OA 4UT7L 4U05A 1T2QH 1S9XB 2WZHA 1NCUA 1D6EB 4MNQD 1AR1D 1E6QM 4H8VA 1DBBL 3BP4B 1P7KB 2XQYG 1KGXA 1N7ML 2ZCKH 3EYVA 5INCA 1PG7W 3HNSH 3QI9A 4YXHH 5C07D 4QY8B 3VFGH 1ZHNA 1ZV5A 1QVOA 3FFDB 4NQVB 2JK5A 4PJFF 4AMKL 4ZPVA 2GK1B 4L29A 5EU3A 4GLRI 2I25N 3VFUB 1CZ1A 2MHAB 4XCYB 3O6KL 1NGZB 1JWSA 4JM2C 5F9DC 2OZ4L 3ILPA 3RVUD 1NQBA 5D2NC 5FKYA 3UDWC 1I9JH 2A0LD 4XT1C 2IMNA 3WCYA 4KRLB 3TONA 3QUKB 3QG6B 4M1GL 1N26A 3PNWA 1T03H 3L7FB 4WO4A 3TBYB 5GRVL 4BH8B 1AKJA 1IGJB 2PW2A 3LX9A 4HFWB 1U8QA 4NQDA 4K71B 3UX9B 3KLAB 3CHDA 5HHPB 5AC4A 1IGTA 5F1NA 3FFCE 2Q7YA 1I3VA 1EO8H 3EAKA 4MWFA 1IGYA 3DX9B 3OV6A 1J8HB 3P4MA 4JFYA 4Y4FD 3KLKA 1AMYA 4OLVH 1RPKA 3MRGB 2NR6D 3NZ8B 4N0UA 4NT6A 3FCTB 3LS4L 4L8SC 4PLOB 1RK0A 1BG9A 5AD0A 1FRGH 3HS0B 4BSJA 4OKDA 1EJOL 1WFTA 2DQGL 1CLYH 4IRJA 3VD4A 1RJCA 2IANE 4LCWB 1QA9B 4Y4HC 3SUUA 1GGIL 1ZL1A 4WUUD 1UA6L 5DD1L 1E1EA 1PGRB 4BFBD 2JJTC 4XMKH 1MFBL 2ZG1A 4PYGA 1E27A 1T20A 4ISVB 2E6JA 1NGQH 2AEQL 4NNXA 3P11L 2F58L 2VNCA 3Q1SH 3PBGA 1NJ9A 5IVNA 4NKIL 1OINA 3VFUA 1NMAH 3S7GA 1B3VA 5ABDE 1OGAB 1X44A 5TDOB 2BSSB 2X05A 3RKPA 3AIRA 4YC2B 2DQIH 3TCXA 3IVKB 1LQSR 4PMDA 4HMEA 3HNVH 3DVGA 3HZYA 4YDIL 3T0EC 4JREC 5ESAB 4PLNC 2ICWA 4MDJA 4EDXA 3FN3A 4ZFGL 1BGXH 1ZHBB 3X13B 3SDYL 4QRRD 5FGCB 2XV6B 2R2EB 2AJ3A 1PSKL 4WCYH 1F3DH 1Z9LA 2A3AA 5FYJL 5I1AB 3O2DL 5E9AA 3ZIZA 5EIQA 2CJUH 2VZUA 3CO4A 3VH8B 2XKNA 3WEOA 2AKRB 2PNDA 5SWZA 4PJ8A 1WIOA 4PJCB 5KSAD 2Q3AA 2V5CA 5JHDD 1IAKB 3P9MB 1KLFA 2QQLL 1Q6EA 1L0XA 1NDGA 1X1NA 2CK0H 2MCG1 1B0RA 2DLEA 4TNWK 3L2MA 2DQDH 5D1QB 4JFPB 3FCTA 4KMTL 1US2A 3NCEB 1A2YB 4ZQKA 3WNKA 2YK1L 4TPRH 4WO4D 1RZIA 5DK0A 4D3CL 4O2EB 2CHNA 3BX7C 4D6FA 1MPAL 3UBXB 2M26A 5TDOA 1VPOL 4OM0L 4PGCB 3C6SA 2HJFB 3WDRA 2GSGB 3S4SG 3IJYB 2XI9A 4CRPA 3QDJB 4S3KA 5D8ZA 3IJ7A 2V3DA 1O7VA 1K9DA 3EJPA 4UDTA 4V2CB 1JJUA 1T20B 4CVXA 1J1OH 4EDXB 3N12A 4Y5VA 1GZQA 2XWBB 2YL9A 4YR6A 2AJXH 3U9UB 1CGVA 2P5EA 3WIFA 3UERA 5BV7B 3O11A 4P4KD 1INDH 3GIZL 1PVHA 1H8SA 4L9LA 3S36X 1BBDH 3FY1A 1MCFA 5BJTB 2B1HH 2BSTA 5JPMA 2P42B 1FNSL 2OR9L 2WC3A 5L7XL 2XA8H 5C6PB 4PJXA 2XHYA 5IFTA 3FZUC 1EVUA 1MJ8L 4YHPA 3H9SA 2ZJSL 4PYHA 1JGVH 2E6PA 1T6VN 3WLBB 3P9LA 2F15A 1OGTA 2Y36H 1N6UA 4XRCA 1TQTA 4ODXB 3DXAE 4HPYH 1CGUA 4HUUA 2WB5A 5GS3A 1XCWA 1WAAF 3K1KC 3PE9A 4D1JA 4PV9A 5D7KE 2VZVA 3QPXH 1JRHL 4OF3A 3RZCC 3RWGA 5I71C 4XPBL 5ABGA 1YEGH 5DT7A 3F8UB 2EDYA 1MRCL 4Y2DD 3FMGH 2R2HB 2G9HB 1H09A 1J5OH 5EU4B 3RKDC 1J1OL 1FG9C 4U0QB 3N1AA 3T4YA 3TPKA 2FE0A 1K4DA 5KSUA 5B8CC 1RZGB 1KLGA 1Q9OA 3GSWA 4RZCA 3MS8A 4OGZA 4UQBA 4Q6YA 4PSRA 1MFBH 3D1MC 5E99H 3LB6D 5SWZD 1FNLA 4Z2KA 2R56H 5C0JB 2XFYA 1C5DA 4B5EA 2GUYA 3CZEA 2A74A 3RM8A 4HIJA 3BD5A 4DO6A 3DMMA 1LDSA 4PB9L 2OL3L 3JWOL 2X89D 3CD4A 5JIPA 1N3NA 3EJYC 4CJ1A 1XR8A 2APBA 1KQZA 2H1PH 2I07B 2ZXQA 3VG9B 2EKJA 25C8L 1VBUA 1E4LA 2DSUA 2VERN 3WJJA 2YL8A 4JY5H 1A1OA 1HSAB 2B2XL 1HH6B 5CJQH 4JZNB 4W5ZA 5EIIA 4MXVF 3L3IA 3VXQA 4ATDA 4U5IA 4RRPG 2EDXA 1Y6NR 2DT1A 4M7KH 1J05B 2A77H 3QIBB 2DD8H 2CIKB 4XAWH 1VEMA 5CD3B 5TD4A 3DUHA 3P9LB 5DMIH 1H0GA 1AC0A 3KPRE 2FH6A 2VSDA 4P3DA 4I8DA 1YNKH 1TQBC 2GTWB 4NKMA 1FIGL 1AD9A 3WIHA 1EHNA 1BF2A 3GHBL 4RIRA 2A6IB 4YLQT 1KXTA 5FCSH 1GOHA 3ZE2F 3WS3B 4D6GA 2VR9A 4QRRE 3B5HA 3U79A 1HT6A 4KMLB 1DUYB 2J8FA 3SDAA 1MJ7H 3D3VA 5FUCC 5CJQL 4QRRA 2NW3B 1I85A 1G7MA 5IM7A 1M7IB 2HTLD 2L7UA 5JQ6L 3ZYZA 1I8KB 1RZGA 4WKAA 4PRNB 4XNQA 3OKKB 4HZ8A 3LD8B 4OI7A 3H42L 5KVFL 1EAPB 4ETYA 5BQ7B 4RWHA 4G6KL 3O81A 5AAMA 3RIKA 1V3LA 1ACYH 2DQHH 1H15B 3TT3L 2EE2A 3GJFB 1W0WA 3ZKSD 4JZNA 1FZJB 1JV5B 4XWOD 1WEJL 3BCDA 5KSBA 3JWOC 1P6AB 4XPTL 4CVUA 1SJEB 4RDQG 1QR1B 3LQZB 4OGXL 1OOAA 3VGFA 4U6HA 4ELKA 5J6GA 5BRQA 3DX3A 3GSXB 5C86A 4JVPA 3BIAX 3CH8A 2WUBL 4JRYD 3QIBA 2LTQC 1SEQH 3MMUA 3ULVF 4NKDB 5DYOB 4G9FB 1BM3H 1HHKB 1DDHB 3G5YA 5FGBC 1DBKH 4JY4A 3RDKA 5C0BE 1V05A 4RMVA 4LOUC 4YHNA 1QSVA 4Z7WE 4U4BA 2O9OA 1U3HC 1AO7A 4WUUA 2HT4D 5D9SA 3WS3A 1RP9A 1DN0B 3BGMB 4X9FA 3VIGA 1DQDL 4CBPA 5HPMB 1TVBA 3EHBD 3MXVL 2BNQB 1VIWA 1NBZA 1WSST 3V0VA 1UZ8A 2BOBB 4G6KH 5T1DL 3HMXA 3ZTNH 1DSFH 1TZIB 4LF3A 4Y5XA 3K4DA 3BUYA 3N85H 4FQLL 1FNGB 4PGDA 2ZWZA 1H15A 3JBG7 1CZ8H 5C8JA 3BAXA 4TX6A 4MQ7B 4ZXOA 1K6QL 3JWOH 3WUWG 4TTDD 4B0MM 3W0WB 3BZFA 3C6LA 4KK6D 1SVZA 1XCTB 3DX6B 2ZCHH 3A21A 4PMXA 5I1IH 5DJ8A 4JFEE 2P24B 4OZFG 2D73A 3EYSH 2QLYA 5F96L 3EFFA 1MCOH 1HHKA 1F02I 4GXPA 1TMCB 2VLJE 4ODBD 4OT1H 2XTJE 2WBKA 1VAHA 4WFFD 5ICYB 3HAEA 1HH9B 5IBLC 2GT9B 1M71A 4BA0A 1MVUB 3HN3A 4CCCA 4DGIL 3LOWA 5TH2A 5CEZD 3KYMA 4L3EB 4NNPH 1JE6A 3BLKA 1ZLSH 5D7LA 5GNYA 1Q1JH 4H8WL 5EZOL 4AEHL 1X5HA 2W9DL 4FQIL 2JCCF 4FTVB 4XPAH 4MMZC 3MRNB 5H94A 2FBJH 4PJIB 1LEIA 5CCKH 3QT2A 1LMKA 3MNZA 3KPNA 4HDIA 3QDJA 5EN2B 1G94A 1AJ7H 5JLZA 1KCLA 1KIQA 5BZWA 1R3HA 1UKSA 2VXSH 4AEEA 5ALBH 3IAPA 1INDL 5IP4A 2IQ9H 4NM8L 3MUY1 4KJYA 3BXWA 1MY5A 3GSOB 4KJQD 3MSGA 4MD4A 4Z76A 1M7DB 3VX0A 4A3HA 3TA9A 4P7RA 4YHLH 3VJ6B 4QRSB 2Y07H 4D6DA 2WVUA 3GH7A 1SMOA 4MB4A 4PBXA 4M24A 3M7SA 2YD8A 5DUMH 4AEIH 4NCDA 4WFHD 1I7TB 1U91B 1PX8A 4UTAL 1YHTA 4ZPTB 4AG4H 2BX5A 4Z7OF 2HMID 1AXSA 5SWSB 1MVFA 3OKEB 3II1A 2BVPA 2CUMA 4NQEB 3ZJ7A 1V3KA 4HZLB 3QWOB 4QCFA 4HIHB 2WMKA 1S46A 2BK8A 2F7RA 4UQ2B 3VTRA 2QHRH 3FO1A 2GTZA 1MAKA 1E71M 3BZFB 3FMGL 3MV9E 5JQ6H 4NT6B 3SCSA 3DROA 4YFLF 4FQIH 4FG6D 3EOTL 2QSVA 3HPJA 2RFXA 5GRUH 4ZUWA 4PJ8D 4KZDL 1NC2A 2D7OA 1XF1A 1FVDB 2VZ3A 1FAIH 3CUHA 3MNWB 2QV4A 1HSBB 1UXSB 4HIXL 3OXRB 1WTGT 4Z7WF 4XBEH 2O9RA 5HDOA 2Z31B 1X5AA 3CX2A 3RX8A 5F7MC 4DWHA 4H8UA 4GUPA 2BNUA 3QHZL 5ICYA 4GAFB 2PO6A 4HLZG 4UFLA 1L0YA 1M4KA 1E6NA 3PGFL 4GMTH 1KPRB 2XG5A 1CYGA 4L3EA 3PABB 3VXMB 2VT0A 1K8DB 5KZ6A 3UTTA 5JXAL 5DEGB 5CEZH 2EECA 1IKNA 1F4XL 5JORB 4MA1B 4OIBA 2QJDA 2QADD 5H94B 2VI0A 1MQQA 2YL5A 2DQJH 2IGFH 1CGWA 1B0GB 2A1WL 2OSLA 4LHUA 5BXSA 1FVCB 4UOW1 3W9DA 5LQBL 3FO9B 2UWEB 3LKQB 3V4VL 2AJXL 1UUQA 4WV1B 1MJUL 3T2OA 5E1HB 1UASA 1E6JL 1KJVA 1ODZA 3BLPX 2WWDA 2ZZUT 4BZ2L 4NN5C 4HLJA 1DHKA 5I24A 1N0XL 1KCSL 1RY7B 4WF7A 3O8XB 1J88A 2X1IA 2GFTA 3MXVH 2GTZB 1YECL 4ODVH 1J1XL 1X4XA 3FONA 4EKXA 3U5YA 2WSPA 5KBNC 4PEEA 1XR9B 1RPQA 4XGZA 4ZD3L 3VU2A 4P0DA 4G8FB 3TA3C 3DYMA 2DQEL 3P73B 3G6JF 1TVPA 2ZKHL 3LY6A 5GIRA 1S7XA 2HLFC 3IJSA 4JM2D 2XWDA 4NJ9H 3PL6B 1TZ7A 4WEUD 4LVNB 2OJZL 4HEPG 5BV7H 4NKOA 5DWUL 2MOVA 4ZTOH 2ESVA 1ED3A 3UJJH 3ARTA 3DOSA 4JGMA 3BEWA 3UCRA 3AXHA 2QKIB 3WL9A 1JTOA 4ZUWB 1BSIA 5J12C 5K9JH 1T4KA 2YD2A 1X4YA 4NQUA 2CRIA 4MJIA 5LQBH 1ZB5A 4CD8A 2NY0C 4PREB 2OW6A 1H5BC 2IANB 2W0PA 4OAWB 2R4RL 3OXRA 5IUSA 4I4WB 4AMWA 3SE3C 3FO9A 4IHOA 1YPZA 1YYMH 1E15A 4KMQA 3T77B 2W66A 3A5VA 4QTHB 5A6LA 5HGAB 3U2SA 3V7MA 3TWCH 3PXHA 3O2LA 2R2HA 4OZHF 3VRJA 3PTMA 3GB7B 3C5ZC 4TVCA 4LAJH 2VLLB 4LP5A 4KUCF 1NP0A 2CR6A 5LA0A 4XP1H 3W2DL 4NZRH 2DDXA 2UY3A 3BRFA 4U1NA 4JFFB 5TGBA 2Y25A 2VLME 2ERJB 2NY0D 2BVUA 5C0NC 1EJ6A 4QXGH 5FDWB 3KEHA 1A4JB 1NCAH 3OAUL 4NFBA 5LAXA 3SO5A 2ZNXA 4WEBL 4Q6IC 2XSAA 1A3QA 1MELA 3VXOB 3GM8A 4X7SH 1TUXA 1NOWA 3MANA 3BOVA 1HI6B 4G42A 1Q9KB 3F7PC 3O8XA 1BHGA 2VLRD 5B39G 1MLBA 1E5JA 1GGUA 1D5BA 3I3EA 4NSKA 3GI9L 3L5IA 3N85L 4PRID 1ITXA 1IILE 1UC6A 1T04B 2CDFB 1LEGA 3JV6A 1LHZA 4GAYA 4HPHA 2X4PA 3VVGA 3UJTL 2CKRA 5E0FA 4WNQA 4X5XB 3BH8A 1QLEH 4GRLC 4M7KL 3LVEA 4EANA 2AABL 1MHHA 4WJ5B 2NY4B 3MREB 5DRWA 3BDYL 4NQSB 1VENA 1X9QA 5I74C 1F4XH 2FGZA 1EGJL 5DZNA 1GOMA 3MRIA 3EMCA 5BOZG 5ADPL 4BSWB 2BCKB 2CDGB 2IBGA 4GG6F 2FJGB 3MA7B 2CUIA 1RUML 4HH8A 4LGPB 1MQKL 4S1RH 3HUJA 5AYQA 2UZIH 3IDMA 1FL5A 3DMMB 1EDTA 4FABH 1ACZA 1AGFA 3RWDA 1ZLSL 4XNMA 2EQDA 2GAZA 1WAAE 3C60C 3NPSB 4LQ1A 3DV6B 4DGIH 3PDOB 5E24E 3GUTA 3LN9A 4KTDH 2W91A 4NQXA 4WV1C 3WNPA 3D69A 4HS3B 5DDHA 2ZCLH 4Z2HA 3I75A 4JFEB 2J79A 2IH1A 4U0RB 2WZPD 4N8PA 4JJ5B 1N8ZA 2PI6A 4G80A 2YPLA 1HH9A 2A0LC 1JBJA 3OKYA 1OAZL 2YPKA 2GJXA 3WV0A 4LDEB 3ZYOA 4KMTH 4JHBA 1A1NB 3U6RB 2L0DA 4LOUD 1JNHB 5FDWA 3OX8A 4QLJA 5IB4B 2BDNL 2MQCA 4GQ9L 2YXMA 2XSBA 2D31A 2WINA 2CGRL 3WHXA 4QHNA 1TENA 3H8NA 4NQCD 4NZJA 3N04A 3RUGA 4X6DF 3WBDA 1BVLB 1QBMH 1DQDH 1RFDH 4UOJA 2NY2B 3S5LA 1JNLL 4AH2B 4NUJB 2HT3D 2YN3A 2E27H 3KLHD 3QUMA 3ZL4H 4HUUB 2OYPA 3VPLA 2BNQE 3SCRA 1S3KH 1EJOH 4PGBA 3FQXA 4NYLB 1CDYA 3WUEA 1NUGA 3PWVB 5GSRA 1W9BM 3LCYA 4BQBA 5D5ME 3FQNA 4PJEE 5JOFA 4ZFOL 4PRPD 1MUJA 5HPMA 3IYLW 1Q38A 3GI8L 5SWSA 2M8XA 1G01A 4D0DB 1P69B 2X1PA 2JIXA 1JWUA 4XHJC 1UZ8B 2IPKA 3NIFE 1QW8A 5HDQL 1X4ZA 2N7AA 4MZ3A 1JPTL 5DFAA 3MV8A 1TTGA 1XGPB 3Q3GA 5HGBA 3V5DA 4JL2A 4FFVD 4NBYB 3RPIA 1TA3A 4ELMB 3B6SA 4E0RA 1I75A 4XMPL 1Y7VA 1G7JA 3DGCR 4NQDE 4HJJH 2EYSA 1Q0YH 1DANT 4X6DA 1WBYB 3TN0B 1QI0A 4K7PH 4TNVK 3BJ91 2ZUUA 4PUBH 1Z9OA 3IFOA 4XPHL 2IG2L 5GGTL 4UFIA 1V6XA 3V6FB 4M61A 2OSXA 3HZMB 1S7VA 1VGKA 2EH8H 4AY0A 4XXDA 5GS1C 2VURA 1T2QL 1F11B 1LD9B 2BNRA 3OX8B 3VSUA 1PKQA 1SYVB 1CXHA 1KEML 1MIEL 3O3DB 4RL3A 5GGVH 2GT9A 4ISVA 1U2CA 4H8WH 5EZOH 4AEHH 1Y0LA 3D39D 4O51A 5IFJB 1F90H 2OS7A 4JDTH 1W2PA 4M1CC 3EFDL 4TUKL 3PQYE 2Z4QA 1MXDA 4L8CB 5HGDB 2DI8A 2A73B 3LRSA 5JR1H 4I77H 4R2GB 3RJQB 1UWTA 1JYNA 1DBJL 4LARL 3L4WA 3V8CA 4UIKH 4PGBB 3V52L 4W8AA 4K3DH 2FB4L 5LWYL 1JZ6A 3DVNA 1DBAH 3QULA 5ADPH 1RAMA 1GQJA 5DC0A 4S3JA 4HX1B 5HBFA 1MW3A 3S35X 3TH3T 1A6TA 2PTTB 1QSFD 4P5TA 4M43L 3UR8A 5GS0C 1KEMH 4QCEA 3DHMA 3WENA 1RUQL 4KRPC 3VDAA 4UUJA 1MCQA 3DVGB 1A7BA 1EDQA 3V7AE 2AEWA 4C7FA 3NH7L 4HOXA 3KPMB 4K2UH 1GCYA 3VXRB 1HHGB 2LFGA 5B21A 3V6FA 5JW3L 1S5HA 3E6FA 4YHZH 1VFFA 1XD0A 2VE6A 3GM0A 1FL6B 3STZB 1Q6GA 3D87B 3KYMB 4ZAKD 5JOEA 3GSVB 5FHAH 2LABA 3QWQB 3RY6A 3HE7B 4XZBA 4M6OL 5IBTL 3GMQB 1A7QH 3N15A 1OARH 4D9RD 1U30A 2CDEB 2AQ1A 1KJ2H 2KPNA 1KTKE 1T3FB 3HPLA 5A40E 5ANMA 2P49B 1KJ3H 2NY1D 3O9WD 3B9KB 2IBZX 5DO2D 3JWDL 2A73A 1KELL 5GGRB 5L0QB 4B3LA 3UEQA 4EN3D 2BFGA 3TVMD 2EACA 3Q6FA 4HUKB 5CGYD 1CF8L 4CADB 1AGEA 4YWGH 3VGAB 2X1OA 1T0NB 5HYJA 2XFXB 3EDEA 1BFVL 3QEQB 5I1GL 1PJ9A 5IESL 4NO0D 3HI5H 3OLIA 4DGYH 3AIWA 1PW3A 3MGOB 4OSUL 4ZFZA 1V03A 3APGA 1FYTB 5D7IA 2WMIB 3T3PE 5FGSA 2WUBH 4L9LB 1DBMH 4ODVL 1EQCA 3ET9F 4AD2A 3IJHB 5JDSB 5ISZE 3FQUB 2DWEB 4HHAA 5CEYB 4H2CA 2PW1B 1MHEA 2ZUQB 1JNDA 1AKJB 4QXUL 3AFLA 3D48R 4PJHF 4QRPB 4P59L 2F53B 2IWGA 1CICA 3MOAL 3IXAB 4L29B 5EU3B 3NBNA 2ED8A 2IC2A 1GOKA 5DXWA 4YDJA 4ALAL 1CGYA 2WC4A 4FQ2L 5GS0L 4AIOA 3NACL 1AXTH 5C0RL 2VZTA 2V2XA 1JGIA 3G5XA 4YDVB 4POYA 2AQ2A 5JPMB 2ZUTA 1XRVA 2DQEH 2NY3B 3VFVB 1JDAA 5KVEH 5DC4B 1CD0A 3U30B 2YFOA 1YMMB 4HBQA 3AB0B 4YHPB 4JHWH 3QQ3B 4D3CH 3VUPA 4PJAF 1W3KA 2ADIA 3KPOA 4DN4L 3VXMA 5CG0A 5GJTL 2F61A 4FTVE 4YBHA 5GGRA 4XZWA 1JAEA 1Q9OB 3GSWB 5JW4N 3BO8B 4HKBA 3I6GA 3ARQA 2VH5H 4XMKL 4RMTA 4AM0A 3EDKA 2R0KL 3OAYK 1GAFH 4CD5A 1NGPL 1I4FA 1U58A 1T3FA 1WWWX 3BCFA 1VADA 4QHLB 3T0ED 4OFVA 5DURB 2X1WL 1WBXA 5T1KA 4YEEA 3I9GH 4UV7L 3HHRB 5T3XH 4OQTL 1V6WA 4BQ8A 3SCTA 3SDXA 2K7PA 1HXYA 4JPKL 4YFEA 4X0KB 2NXZD 5HY9A 2VDOH 2I07A 4AIXA 1HQRB 3GSOA 3X13A 3QI9D 5E6ID 4DGVH 3UG3A 1DTUA 2DM2A 1U3YA 4XXCC 2CESA 1VFBB 4K7FA 4X98A 4KRMB 3ULSB 1U8LB 2RB8A 3NH7H 2A6KB 3DX4A 2NLJA 3VXQB 5ICXB 1I7TA 3WMBA 2PKDA 4GI6A 3PL6A 4FXGA 2AV1A 3PTKA 1G7LA 1HILA 5I1JL 3SKOB 1AHWA 3FQTA 4LSPH 4DUVA 3WO4B 2BRRL 4YGAB 2OI9C 3D39A 4APQD 4XCFH 5DRXB 2D3NA 1Q6CA 3F58L 5DGQA 1OQOA 2YHGA 2C26A 3DARA 2GJZA 4AMKH 5J7CC 1NANH 2GIYA 1H11A 1PQZB 4GOSA 4N0UE 4WWKA 5K9QI 3BO8A 1J0YA 4E42B 3G04A 5KSBF 3K80A 1RZFH 3PG2A 4PTXA 2PYEA 2XWTB 3WHE1 3C2AH 4F57H 3UBXA 1UT9A 1REIA 3WN6A 2BXZA 2D7NA 1EXPA 2FYYB 1MPAH 2DQCH 1E28A 4OZIB 3OL2A 3PV7A 1EVTC 3WFEH 1JI1A 1AD9B 1RUPL 1A1MB 2CO7B 1B0RB 2K1MA 4MPKA 4GJTB 5D7SH 5AC5A 4EI5B 3GRWA 4ODTL 1UG6A 5ETUA 4MQXC 3UTTB 4M8VA 2IMMA 5E6ZA 3STBA 2R4SL 4ZUTA 4EI5C 4G8GB 4Y88A 2C3WA 1L7TH 4MXQD 2VITA 4BKLB 2B2XH 3QXDA 1EUUA 1UQZA 1JVKA 3G6AA 4P2RA 4TRPH 1RUAH 1IL1A 2G2RA 4I3SH 2OSYA 3WY3A 4M5ZL 1P4BL 3GUTB 1MCLA 2XZQL 5C09A 1EXUA 1QFPA 3WLBA 2EE9A 4PJGE 4WTZG 4Q7NA 5JA8B 1JNNL 2DQCL 3RM4A 1AD0B 5C9JA 3BQUA 5GRVK 2YUXA 1R3LB 1C08A 1ETZB 4EK7A 3HNTH 2GW5A 4K7FB 2D7MA 5CEZE 1KIUA 5I15H 3ZKND 5I30H 15C8L 2NXYD 4XNUL 2ATKA 3FQWA 3TJHC 1S9WA 4L4TD 3BT2L 4N0FA 5JW4M 3HR5B 1J10A 2NW2B 1G1CA 2VR5A 4X6CB 1FNHA 4ZSOE 5GS1A 3ARGA 2P8MA 1J11A 3BW9B 3PJSA 5LA2A 5DRWB 3VFGL 2WAHA 2OXGA 4NNYB 1WZ1L 3WNLA 1JWMB 5C0AB 5FK9A 1CFNB 3I2CL 3WBEA 1DBBH 4W6WB 5KSAA 1JRHH 4N8CH 5EO1A 3X11A 4QY8A 4PV9B 1HHJB 2JCCE 3VGGA 2X4QA 3QEGH 1WFUA 3C8KB 3BSGA 1A8JH 1I7RA 4KTEL 5FYJU 3VI3F 4GRLD 3VD9A 5MERA 5IFAL 5A6JA 5FIEA 3QISA 5DD6B 1WCQA 1EGJA 3IS0X 1ZK9A 3ZZ1A 4QRQB 5ICZA 4GAGH 1QTYT 3MRPB 4I9WD 5JHDB 1C12A 1UB6A 1AY1H 2W9EL 2P8LB 3DC0A 4Q9RL 1AXIB 1P4IL 1OSPH 3FL7A 1ZJBA 1BVKB 2OJZH 4KDWA 2EO7A 4OLVL 3MRBB 4JPKH 1E40A 1B3XA 4DKFH 3MLUL 4TN9A 3LQAH 1JWUB 1LLOA 3F5WB 2ZKHH 5EO9B 2FR4A 3MV7D 5DR5H 1R3LA 1KB5B 4LSQL 1AQDA 4PGZA 3I84A 4BKLA 3L6FA 4ZUSA 2ZWLT 3FT4A 2C3HA 3U57A 1MWAB 3U7YH 3TTQA 4K7PL 3ARGB 1HKLH 3U9PH 5JIKA 4OLWH 5F1IA 2WVVB 4WU5B 1SYSA 3GXFA 3N11A 2F7OA 3WFBH 4QTIL 4O00A 1UA6H 2EEBA 2AS5M 3TYFA 4LPWA 1X6LA 2OWXA 3G6LA 3IAQA 5CP3A 2Y7QA 2EXWC 2ITDB 3T0EE 3H55A 5CILH 2OTPA 2NT1A 1DP0A 1MFDL 4XXDB 4FQQA 3EZ8A 3OMZA 3IETA 3GXIA 1R24A 1CXKA 5F1SA 5JMRA 1RMFL 5D2LB 1DEDA 3CFDB 4U1JB 3BP6A 4Y7EA 2XQYK 1KTCA 4NFDA 4LSQH 3FT3A 4Z6AT 2HKFH 1U2HA 4RFEA 2ZUMA 3V52H 1T21B 3NGBC 4HH9B 5BS0E 5HYFA 1CFNA 6FABL 4G3YL 4GQPH 5AZ2L 1W0VA 3UMTA 1A3LH 4I77L 5IHZA 4PMYA 2R4SH 1IVLA 4WCYL 4ELMA 1E6PA 3UYRL 4X9IA 3IGUA 1CR9H 4BFGA 2BNRD 3M17A 4K3EL 5DA0B 4CGTA 1P84K 4JN2B 5GSVA 2W9DH 3OR6A 4DN4H 3CK0H 1LO2H 2CKSA 1KOAA 3O3UN 3RNQB 4GLRH 5C6WH 1XIWD 2Z93A 3RA7L 1DQJB 1MWAA 3WD3A 1K3ZA 4MHHI 3OKKA 3AMCA 4F33A 3N1QC 3S9DB 3ZR6A 1YMMA 4KKNA 4BK5A 2XTKA 1WZMA 1UZ4A 4E9LA 3CJJA 1KV3A 2BVPB 1KBGL 1N7MH 5I1EH 2BJML 3P9WB 1MQ8A 1J0JA 5B22A 1PKQB 1SYVA 4KPHL 3TESA 3OG2A 3QP3A 3DVIA 3KNBA 4F9JA 3MTRA 2FDMA 2L4OA 4MB1A 4ZD3H 1TLKA 1JDCA 1C1EH 5EZIL 4PJDE 1IGTB 5F44A 3GMNB 3AMDA 4ACYA 3MROA 5GZND 1M6OB 5IXEA 1PIFA 2A9NL 3RL2B 4I0KA 4K3GA 4O9HL 3FO0H 4HGMA 4PJDA 4K3EH 1YEJH 3IB4A 2VLJD 1N6QH 1WWCA 2VDML 4X0NA 4D9QE 1DFBH 3CVHL 4JPIA 1KN2L 4XHQA 1MW1A 4RGMB 4DUWA 5IHRA 1FRGL 4NHUA 5E4EB 1TZIA 3RIAF 3VIMA 4XVJL 1E1FA 1EO5A 1GZQB 1LO4L 2X4UB 1BP3B 1LWHA 2GK1A 2OMBA 4DWSB 2DM4A 4JFHD 2ZPKL 4KRUA 4ZAKA 3O6FD 1FNSH 5BW7A 2W1NA 3GMPA 3LS4H 2WSKA 4ZS6D 1L7IH 5CS7A 5EU5A 4KK6C 4XV0A 4TTDC 2CNCA 3MC0A 4K7PY 1TETH 3KJ4C 3MV9B 2NTFB 4QKXB 1MCPH 4JRXD 5D96C 5C0FB 1D5MA 2J4WL 2QQKL 5FFLA 5EC1B 3NSXA 4LASH 1U8QB 3QUYA 2L7JA 3ZQ9A 3GMMB 4F37K 3BD4A 1FL6A 1OT2A 2AK4D 1QYGL 2YOCA 5GISL 5DFVD 3QA3B 3SUTA 2DWEA 3RVXD 2ZX5A 2XACC 3UPAA 1BECA 3EIFA 2ZWYA 5I1IL 1WZKA 1NFDF 1J9YA 1XCTA 3DX6A 3IXAA 4W5UA 1LE9A 1BBJA 2HISA 3L5WA 2R2EA 1NPUA 2PUQT 1RIHH 1HL9A 2WLYA 1DWHM 3V4VH 1UB5A 2FSEA 1G9HA 2P8PA 5GIRB 4PD4K 4LMQE 2EH7L 4H7VA 4BM7A 4LXFA 4EN3C 5JLZB 4D6JA 4M43H 4JPVL 4ZE4A 2GJPA 1D6VL 1E55A 1PLGH 2Z8SA 1S7VB 1VGKB 4OLUL 3RVTD 5SWZE 4GI8A 1EDGA 2O92A 3FB5A 1NDGB 1JZ4A 4EI6B 3WBAA 4KY1L 1TTUA 5MEQB 4HBCL 1P4BH 5A6KA 1ESWA 4L3CA 1KPUA 5EU5B 1HEZB 3QEQE 5ANME 2WBJD 3L1OL 3FOMA 1ONQB 1XH3B 2PYED 4IOIA 4CMMB 3RX5A 4JFOB 1GONA 5I66A 1I1FB 1QLFB 3KYNB 4R8WL 12E8H 1S7QA 1Z3GL 4PJEB 5KG9A 3B9KC 3TIDB 3SJVA 3VE0B 2GSGA 3WELA 1JHTA 3LEXB 4MJIE 3PHOB 2W60B 3IFLH 1ZWIB 5HGHB 3ME0A 3OLEA 3T4AB 4JE4B 3ZM8A 1UWXH 4LEXH 5BV7L 3I2CH 1KXQA 4MSWB 3DYOA 3L3DA 1D9KD 3OG6B 4UAOB 5ERWA 1IV8A 3T65B 3MJ7B 4QOKA 1QBBA 2IFGA 4U7MA 3BUQA 3RWEB 1FFOA 1HYSD 1RZFL 3HG3A 5I2IB 3MGTA 3GSNH 3QXUA 3MLYH 5T33L 3U36B 3KLAA 2YBUA 1RP8A 2RCSL 1Z9SA 2ZIDA 3P30L 3RWIB 1MXGA 1HNYA 1U8NB 2WMFA 3WN5A 5IK3B 4D0CB 2FHBA 4C83A 5DS8A 5JA9A 4P8WA 4U3XA 2P45B 2PB1A 2R2CA 4QCIB 4I0PD 1R7AA 1MSPA 3IDJA 2CPCA 4IIQA 3DHJA 5I66B 5JHDE 2BOCB 2ENYA 5FOOA 3LS5L 4NDMB 1RUPH 4DAGL 5GRJL 5HYSG 3EYFB 1WT5A 5FUZH 4KKBC 1XYZA 1C93A 2P47B 4Z7NE 1V0NA 1G0DA 2AJSH 4KK9C 4NC2B 4XP9H 3SE8H 2VDLH 4PFEA 4NNXB 1JV5A 3E8UH 2QSCL 2FBJL 1VSCA 1KWKA 4ZXBD 1C3FA 3MO4A 5I8OH 2VN4A 5FYJH 5EUKA 1UZ6F 4XNMB 3SDXE 4Q58C 3BVNB 2PXYB 2Z9TA 4UOZA 1FVEA 1GNXA 4PRAB 4U5KA 1C16A 1SJVA 3MLZH 3VM5A 1U93B 1WC7A 2K3TA 3O4OC 2DMKA 3WD2A 1TIUA 5F21B 2CSPA 1IZKA 2Z92B 2M1KA 1N8ZB 3MGTB 5INDA 5F6IB 4KXZH 4UT9H 2W4XA 3SE9L 1WWAX 3DUSA 3ECBB 3BGFB 2IADB 2YA2A 3K4AA 3U4BH 1A9BB 4J3SA 5IEKB 3BAEL 3RZCD 3OR7B 25C8H 1JG9A 1ZJAA 4RGNC 4AEIL 5J13B 4NGHL 1TVBB 4RISH 4I3RH 3FQXB 5ITBL 5KN5B 4I4WA 4KTDL 4UTAH 3LPOA 1Q9LA 1RZJH 1HKIA 5C07E 1KLUB 4A6YH 2ZSVB 4OCRL 1I7UA 3RJXA 4S1QL 4LLVB 4HG4J 3I3BA 3CH1B 1NDMA 1QNOA 3KS0H 3CZJA 2Q76A 1MRDH 3UESA 3RZCB 2J4GA 2PO6D 1KIRB 4HS8L 1J8KA 4MQTB 2O5ZH 1TVHB 32C2A 3QG7L 2BJMH 1B6DA 5A95A 4MJ6B 1S9YA 1VFAB 4PJHA 4AENB 4XP6L 2HVKB 3MRHB 5CWSA 5LG1A 3TM6A 4Z7VF 2YD1A 2NY7L 3WXVH 3AMKA 4PRAA 3RVUC 2FECI 2EYTA 3EO0B 4I13B 1XH2A 3TGXA 3KPPA 3NFNA 4NNPL 3C09C 2H2SC 4RWYH 4H0GA 3BKYH 1A9EB 3G6JE 1OTTC 1Q94A 1M71B 4HC1H 1CT8A 2X9XA 4Y2DC 3OB0H 1OD0A 1RJZA 1CXLA 1UJTA 1FZKB 1MCOL 5GJTH 2J8HA 4PJDB 5KSBB 4TQEH 1A6AB 5F6IC 3KPSA 5IFJA 4ODHL 4QXTA 4LLUB 1FYTD 4XCEA 3GSXA 3L5JA 2RR3A 1XGTB 4H1LH 3O6FA 3QDGD 4AZBA 4GRMB 2VXTL 4RGND 2FX8L 3LMYA 4GG8A 1VF8A 3WH8A 1XFPA 4PB9H 5F7KC 1G9ML 4G7YL 3ISWA 5K93A 4C56D 5BXFA 5DD6A 3UAJC 1TVHA 3HG4A 4OUOA 5IMMA 1R5IB 4TULH 5E8NA 5FV1L 3N18A 3RPMA 2HVKA 1V0LA 4PJDF 1JHKH 3HAEH 2LAAA 3IFNH 3CH1A 2VABA 3JVGC 2BXYA 1NGYA 3HE6D 3PZOA 2Z35A 2BY1A 4PRPE 4PY7B 43CAA 2VDQH 1NL0H 3K1DA 1FPTL 2DKUA 3IU4L 3ZHKA 2ID5A 1KXHA 1PZ3A 3H7BB 5AZEH 2HRLA 3BZDA 1R0AH 3BXNB 3L6FB 1KFAH 2A77L 4XBPA 4JFQA 1IAIM 1P6WA 1E9LA 4OI8A 2RFXB 4FQXA 1W32A 5T3ZH 4HUVB 1SM3L 1OTSD 4AJ0A 5I8CA 1ZBWA 5F93C 5JIWA 3E8UL 5C71A 5KVMC 3K46A 1JZ2A 1VKXA 5E1QA 3NCYS 4Y2DA 1NWTA 1IGMH 5EG6C 3JXAA 2OK0H 2NY6B 1PKQE 4MDIA 4FZEL 1I8IB 1IFHL 5CBAA 2VDPL 1FO0L 3IDNA 4YX2L 4MCZA 1HXMB 2UY6A 1A9EA 4M6MH 4ONOA 3ZKQD 5ABFA 4NSBA 4ZOBA 1B4JH 1TJHL 2EDLA 5CBEB 4EI6A 1T1ZB 8FABB 5I1CL 1N6QL 4UT9L 3B2UD 3WLWD 2VXUH 2C3VA 1HP5A 1Q6FA 2WWKT 1MEXH 2BNQD 1W0YT 2ZCHL 4M6AA 3THML 3PZMA 1L7TL 5EZJA 3PXJA 4W4NA 5C6TL 3OKDB 2D7TH 1I1YA 1H3VA 4FMFA 1F3DJ 1BD2B 5ADOL 3GSQA 4F7MB 2W61A 5ANMB 1OTTD 4P5MB 1RJLB 4J12A 3SCOA 1S78C 3F7VA 4IEFB 3OAZK 5E8PA 3FN9A 5BXFB 3MJ8A 3DMMC 3PIQB 1J9CT 1YEFL 3QDGA 4CADA 1EGZA 4TOQA 3DWTA 1JPTH 2X4UA 1MYRA 2R9HD 5DFVC 1BD2D 5DK3A 4D9LH 5J1TC 2XZQH 5T3ZD 4JRXA 1S7RA 2FATH 4XGZB 3SHSA 2X09A 4GH7B 4DKAA 4PGJA 2GK2A 4JO3H 4OD1H 4GKLA 1T2XA 5FCUH 1MCPL 4XVSH 3R8BB 4NN6C 3QDMD 5HHME 3RBSA 1YEHH 1FZMA 1U95B 7TAAA 1BFOB 1K4CB 3RPKA 5ISZB 3V0WL 1UGNA 1V08A 4GZEA 4P2CG 4NQEA 4MLIA 1ITCA 1EQPA 3BEWB 1GOWA 1EEQA 4C59B 4OOZA 4HUWA 4OLXH 1O6IA 1EIBA 1FL3A 5I6XB 3AAZA 4DW2L 4XB3A 2Y5EA 2OLHA 1J86A 1NBYA 1G6RL 4WHYG 1I1RA 2YZ8A 4PG9A 4PJ8B 1BZ9A 3MA9H 4MXWH 4TYUA 5GGRY 1CBVH 1E4IA 4MX7A 3B3IA 5EUOE 5JZ7C 2DSZA 1Q0XL 4RAUA 3VRJB 5EH1A 2N56A 3AHZA 2J7CA 3IU3B 3EYFA 3AMGA 3QUYD 3TYGL 4MNJA 3UTSA 1BAFL 3GBLA 4DWSA 4Y1AB 2G4FA 3U83A 1G9NH 1OWRM 2FJHA 2WVSA 1P6FA 2DQFB 1IC4L 4KPHH 5EUKB 3TWCL 3DX7B 5EBGA 5J0BA 5JR1L 4P5TD 3RI5F 4L8CA 1SR0A 3MRFA 1FFPB 4MNHB 4HUNB 3GMMA 5GGQL 4YHYB 4KK9D 3GXTA 4KFZC 1O0VA 4G42B 3QUKA 4P4RB 4YBLC 1ZLUK 1QBML 2C1PB 4JZJB 1QFWI 5D1ZB 3UBXI 1PPIA 3H9SB 1FGNL 5DJAA 1BX2B 5JBEA 1LE9B 1CD1A 5BVPH 2WPGA 3FN0L 2HLAA 4DN3H 4P5TB 3AZSA 2C7UA 4C56E 1BJMA 5DRNB 1SM3H 1IM9B 2DS4A 2V6HA 1E0WA 3P0YH 2Z31D 3WIHL 5HI3C 5K59E 3W5NA 4Q74A 3L7FA 1CL7I 4WO4B 1QPXA 4OLYL 1KJ2L 3MR9B 1NDMB 3D3AA 2DLHA 4NBXB 1ZT4B 3S8WA 3PGDB 2BFVL 1F2QA 2XN9E 1PZ5A 3LKNA 3PQYB 4XMPH 3WKNA 1YECH 1E0XA 4LCUA 3NZ8A 4NQDD 4G6ML 1MOEA 3WY4A 3MI6A 4TSAH 2P7TB 2X0HA 1VPOH 4ZS7H 1EPFA 4E8DA 4X99A 3WD1A 5KSVA 4M6ML 1T83C 5CP7A 5KTEL 1HJUA 3LKQA 1GJWA 3VDHA 3PWJB 3H9HA 1E43A 3REWA 3F4VA 1YY8B 1OAYL 1DZBA 3ARVA 4UFHA 1K4DB 1JGDB 1ZXQA 2VCBA 1T7ZA 2WMHA 2PYEE 2VLRA 5H35A 3PDDA 4QRUA 3TC9A 5D2NB 5E08L 1CDJA 3TBSA 4M62H 5E2TL 4M1CD 2CERA 1GGIH 2J8UA 4Y16B 1G5AA 3U6RA 4QHKJ 1DQTA 3DIFA 5FYJD 2C7UB 4M5YH 1U8PB 2E7BA 1FIEA 3POCA 1JF5A 2XY2A 4JFFD 3VFRB 5IFHL 3X3FL 2A3EA 5D1ZC 4MNGE 4QP0A 4KY1H 2J7DA 2E9MA 4C7DA 3EFDH 2XKNB 3F62A 3JWNC 1BIIA 2ZX6A 5F8RC 3MR9A 3O0RH 1AHWC 4RFNC 2NY3C 3P2TA 2OWWA 2YBRB 4ZO6A 3W4RA 1KN4H 5CJ8A 1ULVA 5INDB 5EBLA 3L3HB 1JF1B 4HIIA 1UWEH 1W1YA 5IBUB 4JJHA 4QHMB 5KVFH 2DLTA 1D5XB 2V3FA 4XNYL 1BBJB 1MFEL 4IRZH 1MIMH 4P7NA 2WMPA 5HYSA 1YEKL 3SDCA 3R0MA 2HJFA 2WVTA 4X6FA 3WO4C 2P8PB 1R33A 1I1WA 4OTXH 5C0CE 5EB9A 1WKYA 2UYLA 5D72H 3M1BA 4BQ3A 2HP4A 4EIZC 3JTSB 2MKLC 2A6IA 4X4ZA 2NX5A 1HOCB 4LLYA 2DLFL 4JFPA 5D2NA 2NY0B 2R0WH 2J8OA 3RFZC 3FB5B 4XBPB 5IW3A 4DKEH 3OSKA 4JQVA 2LQRA 1JN6A 1CFTA 4PJGA 4X98B 6TAAA 5F1OB 5IHUH 3MRPA 3D0LB 5JHDA 4JANA 2ICWI 4LSVL 4KKAD 4W84A 3UJJL 5CBAB 3DMMD 1HF6A 2AK4B 1JGDA 4EUPA 2X89A 4H5SB 1A6ZB 4M1DL 1L6ZA 4E41E 1QO3B 1YN7B 4F9LA 1ORQB 1EAPA 3IT8D 3I75B 4MQXD 4UZSA 3D50A 4PJAA 5F9WB 6FABH 2D3LA 3KXFE 3VFPB 5FKPB 4L8SB 4KJPD 3F12A 3VG0L 2E8ZA 1AQKL 1YEDB 1MJJA 4GKNB 1WJ3A 2G5BB 4APQC 3WUWA 3SGJA 4WI4A 2QQNL 4XBGA 1JNHA 1IEAA 2J7GA 4N9OB 3BZ4B 3RWGB 2Y6SC 4RFNB 3SE8L 2IAMC 2EJ1A 5DJ0B 5T5FL 1A7PH 3TPUB 1GGCH 5DVOA 3WMCA 3A47A 4IRSA 3ZDYE 3MRIB 1EOKA 1PEWA 4N0YH 4PJ7A 4JFSA 1UYWH 4RZCB 5E5MB 4E42A 1W0VB 1U8MA 5J1AB 4HIIB 2RIKA 3N50A 4MJ5B 5FA3B 3BUYB 5DJZA 1TXKA 3CVIH 3SURA 3VSVA 3B4NA 4OZ4B 4C58B 3KPRB 2R23A 1X5LA 2GK0A 5L88L 1E72M 4JAWA 2F8OA 1U6AH 5FM4A 2FEEI 4MA8L 2KL6A 3G08A 4GFTB 3WD0A 1AGCA 5DS8B 1IAII 3V5HB 2BNQA 4NZCA 4ACPA 3D9AL 1T66C 4GT7A 2W59A 3QDGE 4ZO8A 5ENWA 2CLVB 4WVRA 5DT5A 3BPNB 1ZE3C 2G2RB 3UC0H 5IMLA 5EOTA 2E8YA 3EFFB 4Y19D 4I3SL 2Z35B 4NZUH 1ZA6B 2R2BA 5C0EB 1QPKA 3LEVL 3REVA 5E2UL 3X3FH 2RBLA 4FZEH 4LCYB 5JPNA 4CD6A 5IDIA 3EOBB 2BHZA 5DQDH 4Y4KD 4JFDD 4H26A 2UWEF 3HMWH 5C2BL 1AJ7L 1ZA3B 1ZLWK 1HP4A 1GPOL 1SEQL 4WEMB 2JJSA 2NW2A 5DQ9A 4F33B 5FF6A 2ZOKA 4PJ7F 1EEZB 4U2ZA 5T3XL 1H9VA 3GRWL 3QJHB 1G84A 2WBGA 4JHAL 2OTWB 5D5MA 5IWLA 4YZFF 3MCLL 1UOKA 5IMKB 1OW0C 1HI6A 1FLTX 5DEZA 3RDTB 4JO2H 1NFKA 1S78D 2DI7A 1AGDB 1HJQA 2UUDK 1E27B 1VFOA 1QI4A 4AG4L 3OGCB 3S97C 3W27A 3MLSL 2XKSA 1UVQB 1UR1A 5E8NB 4NZUL 2AXGB 5BYWA 5EORH 4IM4A 3ULUF 1DUYA 1NUNB 2H1PL 3ARBD 3BVVA 5I23A 1W3HA 2A3CA 3CZNA 3TPUA 1J0ZA 1DR9A 1DUZB 5D70L 3ARDC 1KACB 1AGCB 2XN9D 3NABH 3Q6GH 5CJBA 3FOLB 2RGSA 1BLNA 1U92A 2JB6B 4QT5B 2AGJH 3CFIC 1CPUA 1ADQA 2VX7A 1W8OA 1S9XA 4ZOAA 1I1XA 1UWSA 3QIUC 4L3AA 4JHAH 3QQ9D 5HDBE 2R23B 4F9DA 4P8VA 3KL0A 5KZCB 2V3EA 5I9QC 4HJGA 2DBJA 4NC0B 3RY4A 1XGUA 4YHML 2J7HA 2DYPB 4JN1H 1Z3GH 4U6HB 3WEXA 1KUMA 2FB4H 4QHKI 5LWYH 3WDQA 5CPQA 4WI8A 4FTVD 1XSIA 3S34L 3MMEB 1WGOA 2IAMD 3D85A 3F7QA 3OJMB 3GJFK 3RL1A 2CBIA 3MNVA 1IQWH 4JQIH 3AHVA 2B8OT 4PTTB 3VD3A 1RFDL 4I1NB 3D39E 4DQOL 1T1ZA 3QPXL 5J89A 3BH9B 3QHFL 3QNZB 3T1FA 2D4DA 1U8JB 1PAMA 4RBPK 4W7VA 4HU8A 3QXWA 4FNUA 1QRNE 4BQ6A 2WUCH 4HF5L 2BVQA 5IGXH 3WL0A 1R24B 3JSSA 4XP6H 5EPMA 3BVWA 1BQHA 3GMLA 1DQQB 4MB5A 1T0MA 1I9IL 4NPYB 3CVHB 4H25A 4L8BB 4WI5A 5DJYB 5EOQH 2CDEA 4OF7A 4HOWA 1OW0A 4IOIB 4NWUH 3L4TA 4YHYC 3S5LB 4WHYH 4I18B 1FO0H 3ZYIA 3LDBB 1FYHB 2FIKB 5A6SA 4NQED 4L4TB 4PV8B 3B9AA 1NARA 5T5FH 3WFHB 3KHQA 5C8JB 4LAQH 4NOBA 2G3JA 1LP9A 5M7QA 5DMKA 2D2OA 2B4CH 3SCUA 5L2KD 2WQ8A 3H3KA 2DQTL 1HK6A 3IFPB 4AQOA 5I8KH 3DXAD 1S7TA 5B8CB 3MGOA 3WY1A 1V8HA 4NO0B 4FNRA 2X4TA 3K81A 5CJXC 1MIML 1HHGA 1YPZE 4YH6A 4KKBD 3RHWF 3GSUB 2YK1H 3VXUD 4K7PX 1Z32X 1NGXB 1T83A 4F2MA 2VDLL 3DNKA 4DVBB 3INUL 3RVVD 2Y06H 4G9FE 3MRGA 4NHCH 3PZIA 2X1XR 2VISB 5HHVH 4M56A 3NZHL 1E4WL 3OGOE 3KXFD 4JKKA 5I1GH 1CLZL 1FZOB 3DXAB 2HAZA 4JAMB 3S6CA 3QZWB 1M01A 3M6DA 2KQMA 3UROR 4TX8A 3MXWL 3CPLA 1IEBA 4LGSB 2RHEA 1C90A 3B9KD 2BY0A 4OFKA 1T0MB 4DJMA 3GO1L 3CFCL 2J7BA 2EDTA 1FAIL 3UTSB 4OUEA 2ORBH 5EA0H 2PYFB 5I2IA 4LIQL 2VC9A 1LO3H 3V6BR 1K85A 3CMOL 2PCPA 3EYSL 2FJHB 5AY7A 2IAMA 3IDIA 1LP9F 3UCQA 4X8XA 3LKNB 5L7XH 3SDYH 2XFXA 1ORSA 1ZHLB 2ZX8A 1B6UA 1RZKL 1ACYL 1CK0L 2DQHL 4FTVA 2H9GA 1EFXB 4Y16C 3TT1H 5D7IB 3O3EB 1ZT7B 3HZYB 3RGVC 3NCFB 4G9FD 3HC0A 4OLZH 1RUKL 1H3PL 4WDIB 5HNNA 2ZUSA 1K5NB 4PTMA 3D18B 1WC7B 4OCXH 2NXZC 2E9BA 4M5ZH 1BVNP 3EYVB 5INCB 4JFDE 1QRKA 3GI8H 4PJBA 2WW8A 3H3BC 3PP3K 4GAJL 4CVXB 3L4UA 1TCRA 4OGYL 5CIPB 4R96B 3HPJB 4YDVA 5TQ2L 3ELAT 3DRTB 2ARJA 4OZOA 4DWSC 4C56B 2MHAA 4XCYA 2VXQL 3V5KA 2CCRA 3DTXA 1CICC 3RY5A 2DTMH 5SX4I 4P46C 1L0QA 3HG5A 1CF8H 5CD3A 3RVTC 5ICXA 4JHZA 3GZAA 5CINH 2B0SH 1F6FB 1KLUA 5D8WA 2J25A 5IB1A 3QCUH 4Q6IA 3SDCC 1FN4A 1WDPA 3ZT6A 2IPTL 1J18A 1EO8L 3MRCB 4MJ5A 1OGTB 4X8JB 1ZEAH 2HT3C 3DXAA 4CMHC 3P0VH 4GAGL 3WSUA 1QSFA 5IEKA 4DZBA 2HVMA 4LLDB 4DAGH 5DD0H 2CKBB 5JXED 3OKMB 5IB2B 3KL5A 3LEYL 1IQWL 4JQIL 3CV5A 2VXVL 1OAQH 4QEGA 2XGBA 3N06B 4ODUB 4P99A 4YHOL 2GITA 3GJEB 3CDCA 3UJIL 3MACH 1XGRB 4RMRA 5C07B 2AQ3A 1NMAL 2PR4H 4P46B 1H3WM 3OLGA 3LV3A 1D5IL 1C8PA 1UKOA 3M1BB 3QJFB 4NCC1 3NIGE 2NMSA 1Y18B 3KPQB 1RZKC 2B5IB 3NFNB 3REVB 3SE3A 2CDGA 4W6XB 4IJ3B 4PRHE 1FDLH 2VRKA 1KNOB 1CECA 5FD0A 3PP4H 3U0WL 1DBJH 1NCCH 5FYKD 3SOBL 1JFQH 1NFDA 4YGVB 4Q2ZB 2PF0A 1OGBA 3EJRA 2Q7NA 4LRNH 4O2FA 2AJVL 5IQ7L 2GDUA 2A9MH 2XN9A 3D0LA 3WD5L 2HFFB 3PZ9A 5IJKC 2YD5A 3DRQB 2YDRA 3KLLA 3S88H 3M46A 1XHGA 1D5ZA 3UO1H 5SWQB 1N0LA 4YNYB 1A5FL 1LG1A 1KPVA 3O6FB 2QHAA 4R7DB 5FO7B 3OJ2C 2HJLA 1ZHBA 3TBVA 3IJ8A 1JF1A 3FONB 2ICEB 3O2VL 4TRPL 4Y8DC 5BZDB 4E5XA 3CZLA 4P5TC 3QUML 3HE7C 3I6KB 3OF6A 2AXGA 3F5LA 3IU4H 1KB3A 1CVRA 5T3ZE 4WSJA 1FFRA 4NFCA 3NUKA 1EEYA 5AYUL 3C2SA 3MO1A 1EHLH 1IM9A 3G9VA 5MENE 3RUGE 1WDRA 3THCA 4JPWL 4MA7H 2XM2A 3EYQD 1W9UA 4D71A 1QFOA 3VFTB 5ESQB 1IJ9A 4OQTA 1GC1H 5HYQB 1OWQA 2VWEC 4OOUA 4IOFD 4Y4HB 3LPFA 3CFBA 4PJFE 5F7UA 5A6BA 4TNWF 2DSKA 3WQ6A 3D4YA 1OL0A 1ZGLP 4Q97A 3WD5H 3LN4B 1T03L 1IM3A 2IPKB 1CCZA 2FL5B 4U3AA 4HA3A 5GQBA 1CI5A 4Y1AE 2ICES 1MNUL 1UWQA 3DBXA 2O93L 1S7WA 1IKNC 3OZ9H 4X99B 3D3VE 5JOFB 4YHEA 3EJSA 5LGHL 4ODHH 3RIFK 1JFXA 1IBGH 4F8TA 4AD0A 1G6RA 3P77B 5JIHA 3HFML 2WKLA 2MJWA 4HCRL 4K23L 1XCQA 2LU7A 4X5LA 3E3QC 4UB0H 1MFEH 5IROA 1C92A 4PRNA 4JR9H 4HKJB 5L8JB 1A4KB 3KLSA 5HOSA 4TVPE 2EPKX 3T2NL 3ARPA 3C08L 2J8UB 4HC1A 3WF0A 3U9UA 1YYLL 2FYVA 1I3RA 2QMKA 4KK5D 1UM4L 4HD9A 3QOKA 4UBDD 5GZOC 3VFOB 3MRNA 2NLJB 1YNLH 3WS6A 4F3FA 4NNYA 1GHRA 3O6FC 5HI4C 5DJYA 1OD8A 2VDKH 3H9YA 4FS0A 3DI3B 1CTNA 1WCGA 5A6AA 2ZOKB 2AJZA 1WISA 4P23B 4IPNB 1H3XA 4B7LA 4KJYB 5F1IB 2WVVA 4MZ2A 3ILQD 3NDYA 1ZANH 1KFAL 1M1SA 1I9RL 1MHCB 3SGKA 3GYCA 2WHLA 4PJ9D 3B43A 3BIKA 4U1SA 4YPGA 4G6JH 2HH0L 1SFSA 1NL0L 3VXSE 3QIUD 1Z0MA 5D9SB 1M04A 4BQ2A 1I1YB 3TJEL 1MFAL 2X70B 4HCRH 2ZSVA 1S7RB 4O4YL 4TVPH 1NGZA 5FHAL 2EADA 3SDDB 1U36A 2AV7A 5DEFA 4MD5B 1G6RB 3P77A 1K6AA 3WMSA 2FYYA 1TJIH 3QO1A 3GMOA 1NAMA 3EGSB 4LFHG 3CZ8A 3EO0A 4QWWC 3LN4A 3FTGA 3QWOA 4HH9A 4BSWA 5C0ND 4NQCE 1M7XA 1B88A 4MVBC 1U95A 4JFVA 1W72L 3ZOAA 1KJMB 3ARWA 4FRWA 4RE2A 4KUCD 4QYOB 4BFIA 2DQDL 2ZUVA 3HAEG 3RWHB 1VFAA 3MV01 4PJHB 1A1NA 2VL4A 2PWDA 2CK0L 4UOW0 1OF2A 1A6TB 1FE8L 1G7PB 5EC2B 4TSCL 4X5WB 2CXKA 2D22A 3TCLA 1OD7A 3FRUB 5B38A 4XAKE 1UXSA 2OP4L 4JFEA 4G9FA 1CLVA 4R97B 1CNVA 2X2YA 4MCYB 3HG1E 5IQ9A 4XCEB 3K4ZA 4XNYH 5CUSH 2DIBA 1W1TA 4WK9A 2WXDM 1CT8B 4LHJB 4XTRC 3VWKB 1BJ1H 5BS0A 3KYOA 4RA3A 3CLEL 3U0TB 3QEGL 1MHCA 4ML4A 1V7NH 1X7QA 2W9EH 3X17A 5F7EH 3ARXA 3F12B 3VFOA 1OPGH 3GMQA 2YDSA 4ONHA 3WHXB 5M5DA 1GZPB 1P9MA 1DANU 3UZVB 3FQWB 3SBWA 2NY5H 1VEPA 4JDZA 4Z95L 2CITA 2HMIC 4ORGA 5FO9A 5JW5B 4XAWL 2DL2A 3VXNA 4DVRL 1IE5A 3S4SB 2FO4B 4S1SL 3DV4A 3WSQL 1GVIA 4Q7DA 1BBDL 2OL3B 4TSCH 3RTQA 3EGSA 4K8RD 3VILA 1MCKA 5M3WA 4RSVA 2PETA 1CS6A 1H1NA 3KR3H 3ORJA 2CLZA 4YN5A 3OR6B 4JB9H 5FUOH 1IBGL 3L95B 3O45A 4KHTH 3SGKC 2GY7B 5JUEH 4YFLI 1HIMH 1MW2A 2I26N 4JGUA 5DK2A 5CEXA 3TCLB 4MNQB 5E8OA 4C4KO 4PJBE 2ED7A 3TO4C 2ZX9A 2C4XA 5SWSE 2TAAA 1WUNT 3TVMA 2DSWA 3MODH 4WHTB 1E6XM 3PZUA 3O4OB 5IHSA 1KR0A 3IJ9A 4FLOA 2F8QA 3W24A 5ALBL 5IB1B 4PJCA 3RPIB 5JNYB 3V2AR 4TUJA 3WH7A 1ISYA 4KK8C 1CXIA 1OPGL 4XX1G 1BQSA 3NIYA 3MMWA 7FABL 2OJEB 2F9BT 1INQA 4HDIB 4JKLA 5IROC 5HDBF 4MCZB 4NRYA 4P48A 2J4WH 2QQKH 4L3EE 4PB0L 2JJVA 5HI4D 1AFVL 4L9DA 4PIRF 2DWDB 3PHQB 3GB7A 4M1GH 2V3GA 2E7LA 1Q9WB 2R1XA 4QAWA 1RURL 1O7AA 3TZVC 1U42A 1BPLB 2WZIA 5HVWA 2H2PC 1DWAM 1HIML 2DJ4A 5E8DH 5H2BA 1A6VL 4URTB 4ORGB 2Z91B 3QOMA 4XVTH 5GRUL 2GYSA 2BRRH 5ILTH 4IMLB 1H4PA 2NPLX 3VM7A 1ERNA 1JGLL 1KTDB 3FOMB 3Q48A 5DRZA 5GS0D 1T22B 5E95B 1LE5A 4XX1E 2DLFH 3FB6A 1XSKA 4P3WA 4WWKD 3GDBA 1I1FA 1UACL 4RA0C 1CN4A 1P5VA 5IHZB 4FQ2H 5D72L 1B3YA 4MA3A 5J11C 3CFJB 5BZDA 1VJSA 4ATLA 1YYML 4Z7VA 3DIFB 3BAIA 1QNRA 1S7SA 2VVNA 3WIFB 4PJGF 5C7XL 1JWSB 2D9QB 3ZDXF 3W0WA 3LQAL 4CMHB 3MLTA 1MJ7L 3GBNH 2VLRE 1YDPB 1F97A 3LPPA 1UXWB 2KQNA 3BMVA 4B16A 5CIPA 3A4XA 2EDKA 4ACZA 4X7DC 3KPRD 3C5ZB 1P4IH 3QHOA 5AWNL 4NRYB 1P4LA 1I7UB 5HYSB 3LSOA 5F3BA 5J4MA 3D0VB 4BS0A 4QOKB 4EQ3A 2NYYC 4UFMA 4LK4A 5F72S 2XRAH 4Y19B 3S6TA 2IALA 1U8JA 1H8OA 3LZFL 1SBSH 2EABA 3TZVA 2XZAL 4OF5A 2NY6D 1FVCA 4KK5C 1W72B 4PJFA 4YK4C 3SKUD 4PRBA 4CMMA 4YBQC 3OKOB 3WN5B 5A8PA 1HZHL 3HI6H 2RCSH 4P2RE 3M45A 5F9OH 3MUJA 4ODSL 2PO6C 5EWIH 4LSDA 1R5WA 4CU6A 3WD4A 3L3OB 2GJ6B 3CSGA 4GBXA 4HHAB 5CEYA 4U1LB 1XZ0A 3DHPA 4KRPB 4RDQF