3VMPA

Crystal structure of dextranase from streptococcus mutans in complex with 4,5-epoxypentyl alpha-d-glucopyranoside
Total Genus 216
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
216
sequence length
632
structure length
632
Chain Sequence
GNMINLTTDKAVYQAGEAVHLNLTLNNTTSLAQNITATAEVYSLENKLKTLQYTKYLLPNESYTTQKGEFVIPANSLANNRGYLLKVNISDSQNNILEQGNRAIAVEDDWRTFPRYAAIGGSQKDNNSVLTKNLPDYYRELEQMKNMNINSYFFYDVYKSATNPFPNVPKFDQSWNWWSHSQVETDAVKALVNRVHQTGAVAMLYNMILAQNANETAVLPDTEYIYNYETGGYGQNGQVMTYSIDDKPLQYYYNPLSKSWQNYISNAMAQAMKNGGFDGWQGDTIGDNRVLSHNQKDSRDIAHSFMLSDVYAEFLNKMKEKLPQYYLTLNDVNGENISKLANSKQDVIYNELWPFGTSALGNRPQESYGDLKARVDQVRQATGKSLIVGAYMEEPKFDDNRIPLNGAARDVLASATYQTDAVLLTTAAIAAAGGYHMSLAALANPNDGGGVGVLETAYYPTQSLKVSKELNRKNYHYQQFITAYENLLRDKVENDSAEPQTFTANGRQLSQDALGINGDQVWTYAKKGNDFRTIQLLNLMGITSDWKNEDGYENNKTPDEQTNLLVTYPLTGVSMAEADRIAKQVYLTSPDDWLQSSMISLATQVKTNENGDPVLYIQVPRLTLWDMIYILE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dextranase
publication title Structural elucidation of dextran degradation mechanism by streptococcus mutans dextranase belonging to glycoside hydrolase family 66
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Hydrolase
total genus 216
structure length 632
sequence length 632
ec nomenclature ec 3.2.1.11: Dextranase.
pdb deposition date 2011-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13199 Glyco_hydro_66 Glycosyl hydrolase family 66
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vmpA01
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vmpA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vmpA02
3BZ4B 1A7PL 4NPYA 1NEZG 4Y19A 4JRXD 3LPWA 4NKOB 1L0XA 2EQDA 4N0YH 4KKCD 2BVDA 4QNPF 4WLCA 1IM9D 2ZG1A 1P4IH 4FQLL 1U8NB 5D1XD 1BJ8A 4G7YH 4GO8A 4WI6A 5BXPA 1PBYA 4JFXA 5DDHA 1LEIA 2YUZA 4P2RB 3E2HB 3LQAL 4EQ2A 1CD8A 4GG6A 3QAZB 5K9KB 2YBTA 3ZE2E 3TESA 3U7VA 2D20A 5I66B 5SWZE 1DHKA 3B5GA 4GAFB 5DC0A 4Z6AT 1BQHB 1QSED 3PL6B 3AYRA 3BD4A 1EEZB 5BS0A 2Y6SC 1X6NA 3O3DB 4NKMA 1SYVA 1LP9A 3VXSB 1T22A 3DDFA 4NN6C 4GG8B 4OFYD 1KEGL 1MCQA 4EKXA 1LG2A 3VX1A 4ODHH 2PWDA 4NSKA 1Q0XL 3E6FB 4E41E 4U7SA 4HIEB 4ODWB 4EXKA 1CVSC 4PTVA 4AZGA 5FGBC 3UPRB 2UZXB 2J78A 3RTQA 1U33A 1ZHLA 3VIGA 5GS2D 5J6GB 4P7LA 1FFQA 1IFHL 1MHPH 2YKLH 4QLLA 1KENH 2WAGA 5F70A 5C70A 2IMMA 5HY9B 5CD3B 3L4VA 3DX9B 4JHAH 3O6FB 1C08B 2XZAL 2VN7A 1Q94A 1S7QA 1S7WB 3QB7C 3I9GH 4F7MB 4RE4A 3D0LA 4PMXA 1MFEL 2XIDA 3LRHA 5C09D 3TBSB 2P44B 3MR9B 1RUAH 3B6SA 2DBJA 4HWNA 2QKIA 5LGJA 1UADC 3CC5A 3L4XA 4YK4C 5D70L 1T0OA 5B8CA 1UXSB 3ILPB 1QR1A 5SX4I 3MV7A 4OV5B 3GIVA 4X7SH 3TWCH 3NDZA 3B9KC 5D6DA 2R2EA 1UWXK 4PB9L 4L29A 3MYJA 4BQ3A 3OKOB 1U93A 1KQYA 4NN5B 2NNAA 2XWTA 2HKFL 4XC3H 3D5HA 1FL5A 2F19L 5IV2B 4LLVB 3DDGA 2Z31A 4S3KA 4RZCB 3GMNB 1JWSA 3S35H 2EEAA 1VRXA 1S46A 5D8ZA 4BELD 1WP6A 1C5DA 4YFDB 2CKBH 3IDGB 3VFRA 5GS0H 5HYIA 3CLFH 4V1DE 4Y5YA 2CBIA 1REIA 5I1AA 1WBZA 3IDJA 2ATPB 1W0WB 5C6PB 1I7UB 2ZCHL 3GSNB 3BIAX 3QH3A 2B20A 3K4ZA 4GFTB 1QHOA 1BLNB 1WBXA 4OD3H 5L9DH 4NRYB 2DQJL 4OLZH 4HULB 5FF6A 3W24A 4JFFA 3GM8A 1NL0H 1XRVA 1T1WB 4KVNH 4ZSOB 3CFEB 5DFVC 1SZNA 1NWRA 3G5XA 4KC3B 4KDTA 3KPTA 2M8XA 3H53A 1PZUB 4N8CH 1NMBH 1BFVH 1F6LL 2EDWA 1WBYB 2WQRA 3E3QC 3TM6A 3VFMB 5DJ2B 2CK0H 4I13B 1MLBA 3O3AA 4ZTPH 1HTYA 1QLRB 1CDGA 1NPUA 3E8UH 2CYGA 3IDUA 2R9HD 1DDHA 3GMPA 2NT1A 2ZWZA 1BF2A 3O4LD 1XF3B 3QIUD 2J7FA 5BROA 4KTDL 2OTUB 1JGIA 2R69L 2DYPA 3EGSB 1U8HB 2CMRH 3BWAA 3MRDA 3ALFA 3MMUA 1NAMH 4LHUB 3OKYA 3RDKA 3LZFL 5EFDA 2W65A 3CCHB 1TLKA 1KJ2L 1RUKH 5KANI 2R1XB 5DQJA 1U8PA 5AYUH 3LOWA 4M56A 4YE4L 4UOZA 1UWEL 4U6YB 3CH1A 2GTZB 3C09C 3A23A 2KUTA 2VLRD 3QEHB 1MAJA 1JZ8A 4YDIL 2ESVA 3P9MA 1KJ2A 5A8OA 4OJFL 3MV9B 2IALB 2J1KA 4NZRL 4TVSa 4XCYA 4JFQB 4F37K 4K3GA 1U8KA 1OP5K 5F9DC 3O9WD 2Z92A 2E27H 3VXRB 3GJFK 2VX4A 5IR1A 2FWOB 3IXTA 1CR9L 1JNDA 1TZGH 3DYMA 4M4PA 3EJYC 5I73B 2BRRL 3MUJA 1X5LA 5DC9B 5AZ2L 1GONA 5E2TH 3T0DA 2O9TA 4XGZB 5HBFA 2EC8A 4ZUSA 4K9EH 3SJVD 4LLMB 3T0EE 4UFHA 3IDNB 5HDBF 4D6IA 1XFPA 4KHTL 2X8RA 2W60B 4MQ7B 1AGBB 5EZIH 2XOTA 3ZKNC 4XVUC 4HKJB 4HW6A 4PJEA 3MRQB 1OINA 4XB7A 2Z8RA 3DX4A 5KN5B 2CO7B 5JO5A 2XWEA 4MAUL 3IU3B 4URTB 2HH0L 4MX7B 4FG6D 4UOW0 2IPKB 4C4KO 1E0WA 1CLOH 2X5PA 3DX6B 1N3NB 4P4KC 4R90H 4I0CC 5CJQH 1LQSR 4AD1A 5GISH 2AEPL 1CFTB 1GJUA 3T1FB 3HI6H 3Q6FB 4FNTA 3QUZA 3D1MC 3MRPB 4P5KB 1HXYA 3HC4H 3PJSA 4U0QB 3VFWA 1IE5A 4AEIH 2VLME 1V7MH 1BIHA 3MV8D 5HHPB 3MLZL 4U6TA 4CW1B 4AY1A 3PV6A 2A38A 1YQVL 4HDIA 4YXLL 3SQOL 4P8WA 1UWRA 5IHBA 5E8EA 1PY4A 1CFSB 4UTBL 5DJAA 2IFGA 3PDOA 4TVPE 4Z18A 1FYTB 4YWGH 5BZWB 4JZ5A 4LRIA 3BSGA 5EMYA 5FYJU 5IKCB 2DD8H 2MJWA 4HUXA 3HR6A 1EFXA 4C56E 3EW3B 1A9BA 5T3XD 8A3HA 1G1CA 2Y7QB 4TPRH 1EHLL 5C07A 2KPNA 4Q2ZB 3UXFA 4P2RE 1FFOB 4IOIB 5GRUH 5ILTL 5E03A 2EDKA 5DLML 1CXHA 2RBLA 2XIBA 1E4XI 5HGBA 4QAWA 3D9AH 1M6OB 3TIDA 4LU5L 3WIIL 2V17H 4XVJL 5JHLL 2VITB 3AAZA 3NMEA 3DO7A 1MQKL 1MFCL 4D9QD 5C0CA 2X1IA 5ADOH 3L3HA 1UGNA 1DSFL 3VXSE 1CF8H 3O2VH 3V6FA 5AAWA 2WHKA 5C6TH 1CVRA 5HYJA 4C83A 4JFYA 4C54A 1GJIA 7CGTA 3KXFA 3DWTA 1FZKA 2HFTA 3U30C 1HP5A 5E2VH 1BFSA 4JFUA 3RWCB 1TPXC 3BPNC 1XGRA 3PWNB 4I1NB 2YBRB 2VL4A 3ZJ7A 5EU6A 2OI9B 1G9MH 5ICYB 1U42A 4FOMA 4KHXH 4PY7B 4X6CB 3H7LA 5TDPA 4E2OA 4GS7B 4IIQA 2YA2A 3MNZB 4DM1A 3UZQA 1AXIB 5DK0B 3JWOH 4BA8A 1J0IA 1IC4L 2X89D 2HMIC 4P3DA 5JHDD 3C5ZB 1HL9A 4LAQH 4U1MB 5JXEA 1UJ3C 2R29H 5E8OB 1VBUA 1V3IA 4DKEH 4M8UA 3TA3A 3MRFB 2WHJA 4X80H 1X5AA 2UY3A 1RFDH 1H5BA 2CKSA 2V3FA 1PPIA 1NKRA 1RK0A 5CUSH 3AM8C 5IVXA 3SDCC 1C91A 3BW9B 3SKOA 1G84A 2BOBA 3ROLB 3IJSB 3NZHH 4MJ5B 1OSEA 4K68A 2AJUL 3P9WB 4XPHH 1N5AA 5I30L 1ISYA 4K3EH 2HFGH 4W6XB 3K2MC 3IAQA 4FZEL 1A3QA 2ITCB 1GC1L 3PWVA 1RP9A 4JKKA 4K8RH 3D85B 1OPGH 3OB0H 5EU3A 4UQ3A 3WIFB 3QUXC 3QUYB 4DTGH 1R46A 3DARA 4PMUA 4RAUA 3AICA 3OJVC 1YEEH 5CZXC 2B2XH 2D4DA 1F90L 4N9GB 2CDEB 3PGDA 3V0WL 1IQDB 4KJQD 4D94A 1OARH 2BSED 4ZSOE 1BVKA 2ARJQ 3A5VA 5B38B 3BSZL 4QRRB 3TJEL 2GJRA 2FYYA 4RQQB 1ZAGA 3QDGD 4IISA 4U1SA 3I3BA 3QNXB 1GOFA 1AFVL 4F8QA 1GVYA 1AH1A 1WC7B 1UWIA 1JDDA 2A9ML 2Y06H 3MJGX 1LL6A 3RUGF 3EOAB 2H32A 2LU3A 3IFLH 3L3KA 4KMTL 3V4UH 3D25B 3MGOA 1B4JH 4PJCF 3LEVL 5GIRA 4P5TD 4DUVA 4JO3H 4LEXH 2P24B 1KXTA 1HZHL 1GOQA 4MJ6A 3UZEA 1NBQA 3U0TA 2L4OA 4DGVL 4LLWB 1XT5A 3P2TA 4JY6B 3RNQB 2XG4A 4Y4KB 4O02H 2NY3B 3W9DB 3QGVA 1TA3B 4ZEPA 3UJJL 4B9YA 1ZT4A 1IAOB 5TPWH 4MLIA 3VI4F 4W7WA 3PWPA 3UYRH 1JPFB 3MV9E 3FT2B 1MRCL 1I9EA 4R7DB 2WUCH 2IANB 1KIRB 1OP3H 3QXAB 4KV5E 2G5RA 3RHWF 5TDOB 4KY1L 2F74A 4JDVA 1DZBA 1VSCA 3IVKB 2F7QA 1KOAA 3OKEB 5F1IA 1OB1B 2R23A 3SDXA 3S5ZA 3LPOA 5AYIA 4GUPB 3G6DL 4P9ML 2Q7YA 4DAGL 1S7SA 4XMPH 1P9MC 2WWCA 1TJGL 4NNXA 3VDBA 2H1PH 3L1OL 5D2NC 2J8OA 4FP8L 4Z7OF 4Q6YA 2NY6B 1U3HC 4UAOB 5J3HC 4ZE5A 4JIEA 3EFDH 4CU8A 2EEBA 3ZT7A 5JUVA 1UR9A 2C7UA 1IL1B 1QEWB 2EECA 2YIHA 4M1DH 2YR3A 1HKJA 1XGUA 1NGZA 5TE6L 4WV1B 2HLAB 3BEWA 1AO7B 3RJXA 4POZC 4N42A 2ZOKA 1Q9KA 2IH3A 1BIIA 4PRNB 4MZ2A 4DN3H 5KW9L 5HVHB 2D7NA 3L7EB 3IS0X 5FCUL 5I1KH 1DEEB 5EA0H 4UNIA 4AIZB 4TTGA 1II4E 5FO9A 5T3ZL 5ID1A 3W5NA 3CZFA 1C16B 2FJFB 3N9GH 4LGPB 4LCYB 4MD4A 1EA9C 3SE3A 2XPGB 5LGHL 5BYWA 4D6JA 5AD0B 5J4MA 5IB1A 4BK4A 3IFNH 4O9HH 1UKOA 1KB9K 1E73M 3INUL 5F3HA 3AGVA 2VC2L 4JB9L 3DBXB 2AK1H 3I84A 2UZIH 1PBGA 5BRZB 3IJ9A 4H04A 1YY9C 4HXAL 3KJ4C 1ZOXA 1FYTE 3QG6A 2J62A 1GOHA 3DGGB 3V7AG 3VG0L 2WBJB 4N0CC 3KDMB 4K3JH 3P9LB 4EDWL 3PWUA 5FM4A 3MJ9H 2BZDA 3FFDA 2LTQB 4QYOA 2GUOA 4AEEA 1ODUA 2OSYA 3VSTA 5IM7A 1K9FA 4WFEE 2EE6A 4OF7A 1FFRA 3TBVB 1NCDL 5JOFB 3L95B 4Y4HD 3BT2H 3RI5K 4BS0A 4PS4H 2HWZL 3N13A 2NTFB 1UVQA 4NUGL 5IMKB 1H2JA 2W62A 4GPNA 5BOPA 3W26A 1EDTA 4P46C 4KJYA 4WJ5B 2A73A 3LKSA 3KPSB 4MADA 1INQB 1NSNL 2I25N 3HUJB 1ZHBB 1WDRA 3QXVA 1FDLL 4TUJB 4EN3C 3OV6A 2EDJA 4J4PC 4ZFGL 3UBXG 1RUPH 3I6GA 3ZT5A 5T1LD 3ULVL 2FDMA 3V52L 1ZS8A 2H2SC 2VRAA 5EOQL 2KQMA 3L5HA 2J6EH 3DSFH 4OZIA 2E9LA 4D8PB 3L3OB 5JORB 4JFSA 3D39B 4PLNC 3NH7H 3EKCA 5A2BA 1FE8L 4Y4FB 3T0EC 4M5ZL 1L9MA 1OAXL 2CDFB 1OAYH 5DURD 3NCCB 2I24N 4UB0H 4Z7VB 1UM4H 1J7VR 4X6CE 4D0BB 1MCPL 2AI0L 3P73B 3MRRA 1S7TA 3P30H 3AREC 5KVGL 1VPOH 2YDRA 1UOKA 4XPTL 2JJSA 1GOGA 3M17A 1VFBB 4PGEA 5DHVA 1ESWA 3MRNB 3D3VE 2RAMA 2D3NA 2HJKB 4KMQA 4WWKD 5L0QB 1P7QB 1SQ2N 4HPHA 1R3HB 2BVOB 5ICXB 5E5MA 1T03L 5EIIB 1EV2E 5D8JH 2BVYA 1K6QL 1XZ0B 3LEXB 2Z8WC 3BRGC 5EORH 3FNDA 1JMXA 5HYQA 3SCMC 4J3OC 4QGTA 2YA0A 1QLFA 1NUNB 4FRWA 3ZYOA 3BVVA 4ML4A 3RL2A 3BWUC 4QRPE 2J4WH 3IKCB 5IEHA 3LQAH 1YPZA 2B31A 2NY0D 5I15L 4RGOH 4MSWB 3SDDD 4AH2A 4OCWH 4RWHA 1E72M 1SJVA 1T1YB 3CO4A 4M6MH 1HHJA 4GAGL 2CLZA 5F96L 1QP1A 3KYMB 1FP5A 4ZNEE 4OZHF 3NZ8B 3GNML 3ZTJH 1MFBL 3E2HC 3J8F7 2BSRB 3L4WA 5I2UA 5TE4L 4W6WB 4LSSH 2WVVA 1CDJA 4EBQL 2G9HB 2FIKB 5CGMA 3IXAB 2JCCA 3SGEI 1QX1A 1MFVA 3ZTJG 4QRRE 3ZQ9A 3NN8A 5D7LA 3GXNA 4S2SA 1UA6L 1MJ7H 4JRXA 3WUGA 3IETA 5LJYH 1U91A 2F53E 4GQQA 5DJDA 2NT0A 2A6IA 5F44A 5D1XA 2YC1B 4N0FA 4R97B 5C0JB 3VKKA 5TFSL 1U95B 1T0MB 1GIGL 3EBVA 4B50A 5I71C 3VH8B 3BRDA 3NIFF 5L7XH 4JPIB 3O0RL 1CGXA 1NCBL 2J8UF 4R96B 2BSTA 3V5HB 4NRZB 4PP1D 2VX6A 1B0RB 1IKNA 1UQYA 1U6AL 1MFEH 4M7LL 4JM4H 3UPCA 3PQYA 3P4NB 1HHKA 43CAB 4KAQH 5DEGB 4ZUUA 3U2SB 3FOLA 4XCFL 4HK0A 2A0LC 1NMCB 1NBVL 3OB8A 4OFYA 4TNWK 1YEDA 5D70H 2CXKA 2B1HH 2C8NA 2VLLB 3MLSH 4ZFMA 2N7BA 1NBZB 1UD4A 3TJHD 1SFSA 1VGEL 1QYGL 2VQTA 3T0WA 3VGEA 1QSFB 3CVHB 3DNKA 2IANE 1EBAA 4DKDC 4MXVE 4IMLA 4L9LB 2DLHA 2IADA 2HKFH 3JV4A 1B3ZA 2UY6A 4DUXA 2F19H 5C6WH 4WO4B 4JFDD 4BSWA 1BYAA 1E6RA 5BS0B 3MJ6A 2X4UA 1SYVB 1KTKE 1G7PA 3HE6A 2WC7A 4H5SA 4FQCL 5KSBB 1HSBB 2VDRL 3C60A 2HT3D 5DA0B 2VNCA 1H41A 4NSKB 4XC1L 3UTTD 4JG1H 3CFBA 4H25A 5C09A 4L3EB 3H6JA 2A77L 4J27A 3NFPA 3BMVA 1UEMA 2ZCKL 4PJHF 3RWJA 2IAMD 4FQHB 1KYOJ 2X1XR 2XG9A 2EE9A 3E1F1 1A02N 2P5WD 4WJXA 3FO9A 3S34L 1NOWA 3SBWC 2J88L 1AO7E 4ZS7H 2E7LC 2AAAA 4X0VA 3MMEA 2M2DA 1T7WA 4MZ3A 4LNVA 5FKAA 4WI4A 4EZMA 1Z9OA 3ARXA 1Q94B 2QSVA 1I8LA 1OAUL 3CFDB 1ZVSA 4QDMA 5IROC 2WNGA 5DMKA 3L7FA 3V79C 3G6JA 4P7NA 2WWMD 4KTDH 1XCQA 4PJAF 3VXQA 43C9B 3T0BA 3V95A 3ECBB 2AXJA 3H9SD 4PR5A 3MBED 1PYWB 3DXAE 4BKLB 5LGJB 3CC5B 4NCC2 4W81A 3NGBB 4M7KL 3MREB 2XNAB 5JQHC 1KJ2H 2GJ6B 3BVUA 1KCVH 4OCMC 5C86A 1YZZA 2VIRA 3I2CH 2J7DA 4NOBA 2IQAA 3K8KA 4F9PC 4YE4H 4YXHL 1JGUL 5BRZE 5C0BB 2ZUXA 1VKXA 1FG2B 4ZOBA 3MRHA 3WHE1 4YDIH 3PZIA 3IDXL 4OJFH 1KELH 4NZRH 1GPOL 2I07B 2NZIA 5KJRL 3TPKA 1XGYH 2PW1A 5KSVB 3FCTB 3K1DA 3ULUE 1XGQB 3O3BB 4L1HA 3T8XB 5FYJD 4OI9A 5CZVH 1C1EL 3F12A 2VR9A 5CCKL 5IP4A 3AS0A 3VVGA 3WFZA 2C0HA 1FHDA 5I8EA 3O4LA 1CR9H 3CVIL 2DDXA 4DW2L 2P5EB 1FVEB 5D1QD 2DRUA 3BQUD 2AEQL 5CEYA 5GNYA 1EMTL 5MHSD 3UETA 5L6YL 5B3NA 1FNFA 4U1HB 5CJXA 4GBXB 4BH8B 1ZGLB 1EO8L 3KPSE 1OHQA 5J06A 3WDJA 1INDL 3MTRA 4NO3A 4J6RL 3U36A 1BP3B 4GT7A 3O3AB 4TX8A 2K9UA 3EZ8A 1G9EA 5A2JH 2VLRA 5I73C 4FMVA 1Z3GH 1DDHB 2HP4A 3GMPB 3D39E 1I9JL 1ITBB 1CGTA 4YHYC 3WQ8A 2VZ3A 3LXAA 1N82A 3ECQA 4RGND 1D5MA 4CADB 3O9WA 2NY2B 3RX7A 2HH0H 1FO0L 3VFSA 1HILB 3QUMB 3AU1A 4Z7VE 2APXA 4DEPB 1JPGB 4ZAKB 5BVPL 3RPKA 5DJYA 5HGDB 4IHOA 3NA4A 3WUZA 1H0DB 2VSCA 2Y36L 1EHXA 4F79A 2YUXA 1HSAB 5TH2A 1FO0A 1C8XA 1CD1B 1VFAB 2ESVB 3MOBL 1OWQA 1KWGA 4OZGF 1WISA 5HYSG 4NKDA 1HWGB 4OLWL 2DSUA 3LN5B 3TZVB 4JM2F 2DT3A 4MNMA 2YD1A 4XB3A 1YQVH 1V7NL 3SQOH 1R24B 2DSVA 1DBMH 2V2TB 2QADD 4UTBH 5IR1B 1RMFL 1L6ZA 3BPOC 1U58B 1O0VA 2V5YA 2DLIA 3DX2A 2FZ3B 1MEXL 1UQSB 3U5YA 4FXGA 4D6DA 2PTTA 2YFNA 3HZYA 4N0UA 4JO1L 1RIVL 5A8MA 4GOSA 4M7LT 1EUUA 1U36A 2R1YA 4F7EB 3OG6B 1YNKH 5EBMB 5ACLA 2AJZB 2RFXB 5JNYA 3BPCB 5DLMH 4DQOL 1VGKB 1MJ8H 3GI9L 3OXSB 1DUYA 3VRJA 4S0SD 3VGHA 5IMLA 3ZR5A 4F7TB 3MROB 1ROWA 2XYLA 4LU5H 5KS9F 3UTQA 3WFHA 2ZOLB 2BP3A 3EZJB 1MFCH 3MV8A 1KB3A 1P6FA 1TJHH 2OTWA 3OJ2C 1J11A 4PJFF 2XHYA 4H8WC 4D3CL 5T3XL 3L2MA 2QPSA 3CZNA 2GW5A 3FRUB 4TN9A 1Q0YL 3BMWA 4M81A 1W72B 2I9LB 2VAJA 5IEKA 4NUJB 5C0AD 3VFPA 2EADA 1W9DM 4JQVA 1KC5H 3KLDA 3TN0D 3ZDYE 2NXYB 4JKLA 4K23H 4ODSL 3MXVL 4XWGH 5ENWA 3QUZB 3KPNB 5D6CA 4R2GC 3QCUL 2WZPD 5I1HH 2E4TA 4WSKA 4DO4A 1E6PA 1LD9A 5CEZE 4UV7L 2BX5A 4QFUA 3MLXH 4R4FL 4G3YH 4HDIB 1KNOA 1HNGA 5E8EB 1UKPA 5MP6L 4F37F 3PDOB 4K55A 2ZJSL 5FM5O 2GUYA 2VSDA 2OI9C 4C57C 1HXKA 1ADQL 4YBHA 2Z35B 3WHXA 1AD0A 1CGWA 4W87A 1I75A 3FO2B 5C0DB 2ADGA 2HTKC 4JG0L 2WIIA 2APFA 2QBWA 2X9XA 3WUFA 5FA4B 2D03L 2OL3H 1QI5A 1ADQA 1AR1D 3ZE2F 2P4AB 3DTXA 4ONGL 1QSFE 2P7TB 3C5ZC 1KN4L 2JK5B 2UY5A 1UT9A 3CUHA 1E1EA 5I17B 3KPRA 3TIDB 4HS8H 1ORQB 4HCRL 2D22A 3OA5A 1ZBKA 2NR6C 5I30H 4NXKA 4IRZH 2XQBL 1WWWX 3DO7B 5BS0E 4NFCA 2DQTL 3HB3D 3C9NB 3OKNA 5LAXB 1GAFL 1H3VA 4JM2D 4FZEH 1A7OH 4PG2A 5KSBE 5JBFA 3U57A 4HCRA 1X44A 2YK1L 3KXFB 1JPTL 1KLGB 1BECA 1T7VA 1FZKB 1ZA6A 5JHDA 3JVGC 3KEHA 4LDLB 1JD9A 3WE6B 3AMGA 4L3EE 4YN5A 2BNRD 2NY5C 1R5VB 4PMOA 3HKFA 4APQD 5I6XC 1F90H 4GW1A 4KK5D 1CLCA 4D72A 5IOPB 1U3ZA 4KROB 5TDPB 3M45A 3ARRA 4IIQB 1NLBH 4HLJA 1QRNA 1J1OL 2BSSB 3BSZH 3GDBA 5E9DD 1ZVYA 3EYQC 4PRAA 1YMHA 5JIIA 2GCYB 2K7PA 3ARPA 1LE5B 5D4YA 3CH8A 2J4GA 2CR3A 2A9MH 2VDQL 4M9PA 4U49A 4P3DB 4LQ1A 3DI3B 4MAYB 3RVWD 4KMTH 5FOOA 1LILA 2EIDA 1B3VA 3L4YA 4D6HA 3SDYL 2ZE0A 1WZKA 4ZO8A 3LEVH 1AD9B 2GT9B 3BKYL 3ZYJA 1HZHH 1MIEH 3GSXB 1E4NA 1JHTB 3PXHA 5EU4A 2H2PD 5LKNA 2KKQA 2GJ6E 1A6WH 1XR9A 2AV1A 2MNUA 2XA8L 1YNTB 1N2RA 4K7FA 3N11A 1EAPA 5HGHB 4Z2IA 4KVCH 3HZVA 5C0BE 3VFNB 2CKNA 5HNNA 4HGMA 1AC6A 4WUUD 1RJLB 4OCSH 4DGIH 1HINL 1G7QB 2V5RA 3CMJA 5F7WC 5CPTA 1OBAA 1MRCH 3KPPA 1RVFL 5EO0A 4EEEA 3F58H 1TQVA 5ALBL 3IJYB 2ZG2A 2NY3C 4P2OD 1JE6A 3QDGA 2OLDA 4LF3B 3HHRB 5IBLD 3QWOA 1QPPA 1ZBCA 5J9PA 4R26H 2LU7A 1RSFA 3BH8A 4PJ7F 1RV6X 4N5ED 5T5NF 5DJXB 2P5EE 3PP3H 1JWUB 2NCMA 2J8HA 4P5TA 2G2RA 1X5JA 2OX5A 4J12A 3MGTA 3VPLA 3PN8A 3PZQA 1TJGH 5DD5L 3WKNA 4XBPA 1I7RB 1FP9A 4FP8H 5F88B 3HMWH 5ITFB 1J0KA 1IGJA 2X40A 5F7MC 3PTKA 3RDTD 4G8GB 1WF5A 5SWZD 4LSTH 3G6AB 3RO8A 4F33A 1F00I 1MYRA 3N1AA 3R1GL 3FB5A 4YHKL 3GSOB 3LS5L 4GXVL 2VISB 2E6PA 1EOMA 5TE6H 4HJGA 3PP4L 4M48H 4AZ8A 2CSPA 4U1NA 4Z2JA 3DVGB 3EUUA 5KW9H 2MPAH 3HLAA 5FYKE 2C9AA 5M7QA 4GIAA 2EDNA 2RR3A 1I1AD 2BVPA 4UBDD 2X2HA 1JRHH 3IF1A 2Y25A 4FF5A 3HPLB 4WSJA 1ZT4B 3WIHL 4WV1C 1CGSL 1R3KA 3P11H 4NNYA 2ESVE 5GS1A 4BQCA 4MCYB 1ITCA 4X4YA 1I3UA 4NQCB 1AQKH 1IM3A 4OLVH 1PG7W 4HWBL 1KJ3L 2XN2A 4HZLB 3WIHA 1FVCB 2EPOA 2ZUUA 1NEZB 2R0WL 1FRGL 3EYUL 4IMKC 3WF1A 4PJXB 2AABL 4ZS6C 4JZNB 4UT9L 3L2LA 3VG0H 4HWBA 1FAIH 2GSIA 3EJQA 4GI8A 3VFOB 4OD1H 2K7QA 2Q7YB 4LX4A 3KPMA 1S7SB 4KKAC 2VX5A 5SWQB 3RGVB 3BPLB 3C5JA 2NTSP 4NNXB 2DBLL 1J05B 4PBXA 4YUEL 1NCDH 1UEYA 4V2CB 4IJ3B 4UR9A 4OI7A 2GIYA 4EAMA 4NQXB 1S9KC 2WBJC 1GGBL 3PWLB 1QVOB 5J1AA 3S5LG 2XN1A 1FNGA 3HAEA 4XVSL 4NM4L 2XICA 4UINL 1NSNH 4P23B 1NGZB 1VFUA 5IQ9B 3L9RA 5GZOD 3C2SA 2P43B 4JEGB 2EDLA 2TAAA 4M8VA 2IH3B 1FORH 5DS8A 3RVXC 2GAZA 4OT1L 3V52H 1EH9A 4IS6B 3GHEH 1HXMA 5EOQH 1TQSA 2QF8A 4EK7A 4OGAD 3ELAT 3RUGA 3W0WD 3LN9A 4UZUA 1NCCL 5JTWA 1FE8H 4M5ZH 4JFTA 1OAXH 1HIZA 3KYAA 4PJCA 4X5WA 4FTVB 4MD4B 3W39B 1FNHA 1I7TA 2O61A 2DS4A 3VWKB 2AI0H 5DK2A 4XP6L 3EJPA 4DZ8A 5KVGH 3O2WH 3SO5A 2GTWB 4RDQG 1UB5B 4JAMB 5C08A 4M29A 4Z95L 1T5WA 4JHWH 1L9NA 1E28A 2FL5B 4Y4FC 1BGAA 5FCSH 4NRRA 1I85A 4JREB 2C4FU 3C6LD 1B1YA 3HG4A 5FUCE 1LK2A 5MEPA 3W27A 5ANMB 1CG9A 3QXDA 1FH8A 1T03H 4TTUA 5KSAD 1A7NH 3FFDB 1P84J 4YPGB 1HHIB 3W25A 8FABA 4F9JA 4DKFH 1DBBL 1MCIA 2GUOB 4MXWL 2WANA 4XP4L 4GRMA 4WW1B 1XD1A 4XCCH 3SE4A 4LCCA 5HHMB 4GKSB 2CBVA 4QXWA 4OB5H 4I48B 1VB9A 3QI9B 4BQ8A 5IWLA 3LQZA 1HYSD 4W5UA 4URIA 1FV1A 4KJYB 2XV6B 4J23A 1G7LB 4HKXB 4OCXL 2C26A 4XZUB 4ONHB 4NQSB 1J0HA 3ZTNL 2X6MA 4G5ZL 3CMOL 2EDQA 2CKBB 2QSCH 3HRZB 2E0PA 2HTLC 3RX8A 3KXFE 4I4WA 4NKIH 4GAGH 3VNYA 3GUTA 2IQ9H 3KYNA 5JUEL 2X9YA 1B88A 1JP5A 1KCUH 5IFJA 2XIIA 1MFBH 5BV7C 3DX7B 4JFPA 4WWKA 4MHHI 1ZJAA 2X4SB 3TC9A 1A0QL 5F9JA 4EBQH 3MRRB 1IC5L 2PN5A 3BHBA 3DURA 4Z78B 4ZYKA 4UUJB 3IRZA 2ZCLH 1M7IB 1KWKA 4OZOA 4Y2DD 4LGRB 3BN9C 5SWSB 4CRPA 3WMBA 2HRPL 3ZO0A 5DTFB 2CHNA 4X9YA 3CZEA 3UG3A 3KS0J 4AIOA 5TFSH 4BUHA 4KK6D 5DHVB 5ERWA 1KYOK 3ARZA 4Y5XA 1GPFA 1EGJL 3MRIA 1GIGH 1HI6B 3WNLA 4PJBB 2WXDM 3SDDA 3MFFA 3O0RH 5E5MB 5ESAA 3HCVB 3VDCA 1MCDA 5IW1A 1RI8A 1U6AH 5CBAA 3QNYB 4M7LH 1EGJA 1NEUA 4L4VB 5HYQB 1B2YA 4R97C 1A6PA 1AGEA 3ARGB 3BESR 4ZXBB 2YMXL 2CDGA 1H15A 5L2KE 1QLFB 4XCFH 2WINA 5DO2C 3S37X 1BZQK 3RL2B 3A0OA 3HTLX 5I1EH 3RPIA 3RI5F 4TSBL 5DQDH 4CL7A 3DV4A 5GZND 4LVHC 5K9QG 3SHSA 3D0VA 4HD9A 1HCVA 4DWSD 1A7QL 2JB6B 4G9DA 4LSVL 4TVPD 2IXVA 3BCFA 2QQQA 2CLZB 4QEGA 3QZWA 5I2IB 3FQRA 3WS6A 4WHDA 4BA0A 4F2MA 1NARA 4NP4L 4AWEA 3DIFA 3AQUA 4O58L 3T2NL 4QT5A 5JR1L 2A6JA 1HH9A 3X3GH 2YS4A 3AIBA 1OAKH 2Q6WA 2VDRH 4BQBA 3AFLA 2WVVB 3U4BH 4MXQD 3MNWB 1HK6A 1CXLA 3HNTH 1KIQA 1MPAL 3U7YH 5I76B 5D7JA 3WXVL 3I75A 4HC1H 4LCWD 2W4XA 4R6UA 4WO4C 4EI6B 2A77H 4G8GE 3GMQB 3UTZA 3REWB 3UAJC 4I3SL 4CN1A 4QLRA 2H9GA 5DJDB 3RWIA 1IM9B 2MFNA 3VG9C 3CXDL 3PL6D 4TSAL 1JDCA 1AGFA 3S34H 4GSDL 1MCWW 1HQRB 3VXSD 4L4JA 1ES0A 4I0PB 4KI1A 1JYXA 4PRBA 3FB7B 3ZJ6A 4OIBA 1MIMH 4R0LA 3L6FA 1LL7A 4FQQA 4JFDA 4A3HA 4GMTH 1QSEB 1OLZA 3MLRL 3KR3H 2YBUA 3KWWA 4AXNA 5EUOB 2O9RA 5ESVA 3U9PH 5INDB 1UD6A 2YD9A 2Q87A 1XD0A 5I19H 1GORA 1JG9A 3N17A 3GI8L 1I8IA 3PZVA 4LLDA 5HDOA 1I9RH 4NQCE 4KV5F 4YC2B 3QFJB 5ACZA 1N0XH 4HIJB 1HOCB 4UV4L 4TUFA 1JGUH 3ZJKA 2ENYA 3FHAA 4NM8L 1JAEA 1EOKA 4ZQKA 3O6FD 2IAMA 2ITDB 1KBBA 4PJXE 5FKPB 1GPOH 1DN0A 1B0GA 4HV8A 25C8L 2P5WA 3OGCB 3S37L 3NGBC 1QI4A 2WC4A 5F6IC 4U1JB 3WFEH 1S9YA 1JN6B 4M4RA 2L7UA 5HHVH 5A94A 4LDEB 4JLRA 4M00A 1W3LA 2C3VB 5C2BH 3NIDE 3OBAA 1GGIL 4FFYL 4ATDA 5D6DC 1WCQA 3VMNA 3CVIH 2YZ1A 1J01A 1LO2H 1I3GL 3ZZ1A 5KBNC 1ZU8A 2AAVA 2AEQH 2Z31C 1TENA 1EMTH 3MBEA 4OZHA 2BMKA 3RWJB 2CRZA 2W92A 1JAKA 4E42B 3TF7C 3M7SA 1VACA 4TRPH 2AOSA 1INDH 3W81A 2W1NA 3T2QA 3GMRB 3C5SB 4J6RH 4O2EA 3U79A 1MHEA 3FONB 3VWJD 5A16A 1KXQE 2ZX9A 4ISVA 1U3JA 4FQ1L 2E9IA 2CLVB 3WN5B 4QXGH 2VXSH 1KCRL 3MLUH 1ZLWK 4XBEH 1ZVSB 3B9KA 1ZLVH 5DMKB 1XCQB 4YPJA 5GRVK 4KDTC 1CWVA 4QTHB 3UTSD 4X4MA 3VGBA 4ACYA 5EOTA 1GZPB 4FTVE 4WI8A 2V7NA 5D72L 4JAWA 2V2XB 1QNZH 3RVVD 5BCAA 2DAVA 2J8UA 2YD3A 4RBPH 5BVPH 1ZT7B 4RL3A 4XZBA 5E2JA 5D1ZD 2DT2A 2Y36H 3LH2L 3O3EB 4TNWF 3OPZL 1IEBB 3WEMA 3DX3A 3BQUA 1ZA3A 4YDLB 2DH3A 3U0WL 1QI3A 4RAVB 2G41A 3MOBH 3WFBH 5EO1B 2YKKA 4PIRF 4OLWH 4AMCA 4FQ2H 1FN4B 5DMIH 3EO1A 4ZAKC 3QOMA 1C8QA 4RX4D 4MDIB 2CIKA 3FN0H 2FB4L 4LHUD 5ANME 4F8TA 4S1QH 4S1SL 4U2ZA 3QP3A 2YDSA 3VXNB 4EVNA 2B5IB 4HUKB 3SY0B 1F8TL 4PJ5D 3QIUB 5HHME 1A1MA 3RWDB 4A6YL 4MDJB 3EFFA 7TAAA 5EIVA 4JO1H 1RIVH 2VUYA 3FMGL 3KLAB 3DX8B 3MV9D 1U8MB 5IW6A 5TD4A 4IPNB 2DQGL 1T1ZA 3SCUA 4A6YA 2JE8A 3GGWA 3GI9H 3GMMB 1B4RA 1GVIA 1SBBA 4XRCB 3NOIA 4ACZB 5IHRA 5A2LH 3QDMA 4HIIA 3FFCD 4PJHA 3L5WB 4OZFA 5I9QB 2ZSWA 1RZGB 5J13B 4PMQA 3QEQE 3O9WB 5AWNL 5IQ7H 1NGWA 5T3XH 4X6EA 3O11B 1N8ZA 2XT1B 1YN7B 1ZEAL 2C4FT 2H26B 3NAAH 3V5KA 5E7FA 3UTPE 3SCOA 4XP5H 1ZLSH 1LG1A 2XTKA 4OUUA 3GTNA 1SJXA 5SWSE 5CILL 4PJAA 1FZJA 4ODSH 2XI9A 1E3ZA 4FNQA 1DQQA 3WBAA 1CQYA 3SJVB 1X5XA 1INEH 3D52A 2EC9U 1E4JA 2EDXA 4S0TD 4JE4B 1ISVA 4RRPG 1FVDA 4PJBE 3WDRA 3MRBB 4CN4A 3KJ6L 2J12B 1VJZA 2ZJSH 5JDSA 4Z9KB 5FV2A 3QUZC 5ICZA 4L4VE 4LPUA 4P48A 2GJZA 4LP4A 4NHUB 2A3EA 2PTTB 3W38A 3H9ZA 1G0XA 2ZNXA 1NDGB 1JZ5A 2R0KL 2R1YB 3ZJ8A 2D03H 3MUY1 3B3IA 2DB8A 4HEME 5C0AA 3RZCB 4LPYA 3HE7B 1KPVA 2R0LH 3TN0A 1ZJBA 5FUCC 1P4LB 4P4KA 5I3DA 3U9UA 4ODVL 5I74C 4LRNL 2DF3A 4HCRH 4KK8D 1IGML 1NCWL 5DHYB 3Q6GL 2O5XH 3WFHB 4I9WE 2XQBH 5B4MD 2DQTH 4ZFOB 1OAQL 3D69A 2J7LA 2ALWA 1F3JB 3ZDXE 1GHRA 5CEXB 3EO0A 1EZVY 5C92A 2BNJA 3UDWA 2HAZA 3D2UD 4YBQD 4CVZB 4JKWA 1WE5A 1T5XA 4L8BB 5IHZA 5E6IB 3S4SA 4AD0A 2O9PA 4PUBL 3GHBH 2YXFA 1T0PB 5ENWB 3WMSA 2X10A 2N56A 2KDGA 2P8MA 3OZPA 1VENA 1J1OH 4B7LA 4AZCA 3NPSB 1OD8A 3CK0L 4HUMB 1X7QB 3IDIB 3PZNA 4NWUL 4TQEH 3F7YB 2VLJD 4KKBD 3SOBL 1W9XA 1JF1B 4HS3A 4QCEA 1QSEE 3OR6B 3AIEA 1NC2A 4OZGA 3SDYH 4G80B 1UXWB 3GSVB 1HKKA 4IIQC 5CJ8A 4UT6L 2ADGB 5EUOE 4JM2A 2A9NL 2WIIB 5GRJL 3ZL4L 4WDIA 5SV3A 2XA8H 4NDMA 5T1KB 2OR7A 1AP2A 3GO1L 5C0FA 4PCTA 4LLQA 4MXVF 4GJTB 1E4IA 3QFJE 4MAYC 3PGCB 2C3WA 1MY5A 2BNRA 1VADB 1DQML 1Z2KA 1R33A 2XWJB 4LOUD 3T4AB 3WJLA 2APTA 3TA3C 3UP1A 1HINH 4YDKL 1BWMA 3EDFA 4PLJC 3VA2C 5I18H 4FFZH 3F5KA 5K9OA 1H5BC 3D3VD 5E9DA 4HBCL 2VDML 1CLZL 3QJFB 1V3KA 2B0SL 5JA9A 2VRQA 4NO2A 2Z9TA 5DRNA 5CJ5A 1RQ5A 3O8XD 4ZO9A 1I1XA 1J8HA 1K5NB 3SPVA 1D6EB 2PO6D 1LWJA 3BYTA 5KS9A 3EOTL 4ORGB 4B9ZA 1LWHA 1ORSA 2HT4D 1F4AA 4QRPD 4PJFA 5M3WA 2W63A 1UH2A 3QPQC 3WF0A 1NGXA 5EC2A 3VU2A 5GGVY 3BIKA 4MNGA 1EXPA 2ADIB 1MJJB 5BXRA 3F4VA 3LKPA 5HHOE 1KLUA 1BVZA 2W0KA 1MCSA 2VVNA 1A8JH 2XN9B 2JLLA 4LXFA 2W66A 4WUUA 1MLCA 5C0ND 3SDCA 3R1GH 3HNVL 4YHKH 3QUYD 1GC1C 3GMOA 5JBDA 3QXUA 5HDQH 1GZQA 1F3DH 4JN2B 1YY8B 3QCTH 4P2OA 4V2BA 4YHLL 3BZFB 1IGFL 4LKXA 1IAIM 3EHBC 4YIQA 5CKAA 3B4NA 1XF4A 1Q72H 3BKMH 3G5YA 5AZEH 3QA3A 4JO4L 2LAGB 2FE0A 1F4WH 4E8DA 3WIHH 1GL4B 3WS3B 2F53D 3GJFA 2W9EH 3MZTA 3ULUF 1NANH 3KNBB 1FJ1B 5HHNB 1KJVA 1AGCA 2XZCL 1XSIA 4AZ7A 3L3JB 1XCWA 4R4BB 5LXGL 2FO4A 1KJ3H 5IUSA 3OAYH 3LHPH 3PIQB 4P5MA 3IAGC 1CD9B 5SWZA 1AIFB 3PBGA 5DT7A 4WCYL 2R0WH 3DVIA 3TYFA 3UR7A 5F8RC 1KIUA 4XNXH 4Y4KD 1N7MH 2AABH 4HJJH 1N4XH 4W5ZA 1Y0LB 5FL1A 1WTGT 1I1FA 1AQHA 4Q22A 2G5BA 4IRJD 4OIFA 2P1YA 3AVEA 2XFYA 3BP5B 1EEYB 2WBGA 2R8SL 4W89A 3PTMA 4ZUVB 4DN4H 1B30A 5T1DL 2NY7L 4XBPB 3HAEH 4PRID 1KLFA 4E41A 2DBLH 5CWSB 2AQ2A 1P84K 2IAND 2D7TH 2OK0L 2DI8A 4JQIH 2XWBB 3H54A 2XZZA 3HAEG 1L7IL 3IDYB 4GKNB 3SGKA 3V0VA 2Z91B 2Y23A 3SDAB 3FB5B 1AQDB 2VDPH 4JANB 4NRXB 1N26A 1DLFL 4XNMB 5JQ6H 5C3TA 3FB8A 4Z7VF 5HDLA 1OY3B 4OT1H 4NCC1 4BFIB 4JRYD 3N85L 1A4JA 2NY6D 3BFOA 4YDJA 5IBUB 4QCIA 4FMFA 1NCCH 2NZ9C 3E6HA 4U3CA 4L4PA 2FHFA 5F6HI 5IG7A 3BVNA 4B53A 1WT5A 3THML 5KAQF 1GZJA 5GS1B 3A4XA 1NGYA 5DK3A 3SJVE 3BAJA 12E8L 5IDIA 1P9MA 4M9OA 3STZA 4L8SA 4ZDHB 1U3HA 1UR8A 2VKWA 4Q58C 1N64L 1G0YR 3SE3C 1QA9B 4XBGB 2APWA 1W2PA 1GYAA 3MFGB 4N8VG 1U8OA 3KPMB 3DXAD 1TZIA 3MRJB 3VXPA 3DRQB 1XYFA 3G5ZB 3APGA 3EJZD 3C5JB 3S7GA 4V1DA 1DBBH 3FQWB 4DVRL 1AE6L 1NGPL 4GRWH 1BD2B 3ULSA 4ZD3L 2R56H 1MJUL 1OWWA 1KB5L 4JREC 2E6JA 4AIXA 1LDPL 3TNNB 1NJ9A 2LE9A 2FATL 3MS8A 4CVWA 4OLUL 1KXVC 1LGVA 3HC0B 5DR5L 4YDVA 3TIEA 2EIBA 1CDBA 4U7MA 4OCXH 3ULUD 1G7IB 4UIKL 1E6QM 4PUEA 2X2YA 2ATKB 1KB5A 4LFHD 3DMMB 3R4DA 1IAIH 1EQCA 3KZSA 4N0RA 4U31A 1HQ4B 2H3NA 4RMUA 1DBJL 4G5ZH 1JNHB 4N8PA 2MQ0A 5CIPH 2WZEA 1QFWL 2EC9T 1U8JB 3C6LA 2OCFD 3ZDYF 5F7EL 3RUGB 5JUEH 1DFBL 1NGQL 2E8ZA 1ZTXL 1GGYA 3LRSA 3LB6D 3U6RA 1TZHB 2AVGA 3WO3B 4LP5A 3MA7B 4PBWD 4PLKD 1MUJA 2PBOA 1I7TB 1MFDL 3KPSD 1MF2H 3LKNB 5C3LD 4OOUA 2ZXBA 3BP4B 1HVXA 1IC5H 3MLPA 4UFMA 4YLQT 4DZ8B 5A8NA 4Y4HB 2DTML 5DT1L 2HRPH 2EDFA 1RD6A 5JPMB 3ULVC 4MNQD 2EDOA 3NA9L 3D39D 3ARDD 3EYSL 3HR5B 1EGJH 3OJDA 4YO0B 3TCLA 1NWUA 4P46A 1HJQA 5T1LB 1L8NA 4XX1G 4KI5E 8FABB 4IM4A 4OSUH 3LS4L 4D9LL 5HOSA 4YHIB 4FLQA 3A6BH 3V7AE 1RUML 3WV0A 2IFFH 4ENED 1R85A 4MD0B 4YHGA 2ZG3A 4OBSA 1NMAL 2F5BL 2WK2A 1UCBL 2EH7L 3T0EA 2BOCA 1ZE3C 2OP4H 3V8CA 4KJPD 2WB5A 4WKAA 3NCMA 1K9TA 5KSBF 2FHBA 1LO0H 3KYKL 1U9KA 2PCPA 4PP2A 5HDBE 4OAWB 3AREA 1FOBA 1CDUA 2LU4A 2VQ1B 1UASA 3TFKC 1S5IH 5E95B 1ODAA 3GBML 2XKUA 1IKFL 4QHLA 2J74A 5LVEA 4F58L 5IFJB 5EZLB 4O58H 3T2NH 3VFUA 1FNAA 4WWKB 4Y0GA 5BVJB 3N04A 1KN2H 5F7DB 3EMQA 1E6ZA 2RGMA 4XHJC 3OB0K 1T2QL 2IPUK 2QEJA 1UM5L 3G5VB 4F7CB 1MPAH 4ZYKB 3DURB 3VM5A 4NJ9L 3WXVH 4G42B 4QHUA 4NBXB 4OFDA 4HJ0C 1VERA 5JMRA 5GNZA 2XN9E 4HU8A 6FABL 2HISA 3DSNA 3MRCA 4MD5B 5C0IB 4HWEL 4TVPL 3SCMA 4TSAH 1RJYA 2HVJA 2YEZA 2Q86B 1HJSA 4MB3A 2D7PA 4GSDH 5GGUA 4PTWA 2EPLX 1M71A 3SDDB 1NDMA 4DWSA 4NN7B 4M1GL 4QF1A 5FO8A 5EH1A 1RZIB 1VEPA 3FTGA 1OGBA 4KKCC 4C56A 2EDEA 4U1GB 3BO8A 5D1XC 1BPVA 3MLRH 3OXRB 5HYSB 3BZ4A 5L88L 1TQTA 1MNUL 1R3JB 4NKOA 1GQJA 5JW5B 1Q9OB 2WINB 5DUML 1NH6A 3SCSA 1U8NA 1YEIL 1XIWD 1T66D 4P2RA 4U0RB 4WVRA 5H8DA 5CEZD 3O41B 2B4CL 5K9KA 2MMXA 4UV4H 1H1NA 5I66A 4NM8H 4Q9QH 1IBGH 3EBAA 4UILL 4G9DB 4Q6IB 2XM1A 1BBJB 2WMIB 2W38A 2QHRH 1BQHA 4PJDB 3PL6A 3VIPA 1EEZA 5ITBL 3O3DA 3RY6A 3VXSA 3BUBA 1RZKC 1OP3K 2AMGA 2UUDH 3TO2B 4EDXA 1GGIH 4FFYH 1TMQA 3F7VB 1ZVHA 5F7UA 1XV8A 4JHOA 4HIEA 2A74B 3IS1X 1QSFD 1UQZA 3QBTB 1RP8A 4JL2A 3A6CL 4PV9B 4UU9B 3RU8H 3WQ5A 3V5DB 1YEKL 3M1BB 1CFVL 3RWIB 5J6GA 5I5RA 3FL7A 3CDCA 1RIHH 1UZ6E 5IW3A 1BZ7B 3VMOA 3U4AA 1WIPA 4FQXB 4JY5L 4BZ2H 5F1SA 5CD3A 3DX9A 1JTOA 3O6FA 1C08A 4HPGA 4D0CB 1S7WA 3PABB 1WLHA 4F7MA 4QP0A 1L0YA 2W0PA 3TBSA 4KXZI 4L3ED 5E4IA 3MR9A 4L4TD 1J1PL 3F5WB 3O4OB 2X42A 1RZFH 3TT3L 5GXBB 5ESVB 5D72H 4JFHE 3N15A 2X4NB 4PD4K 1OSZB 3UTTB 3H3KA 3LMJH 3LH2H 4OV5A 2AJXH 5ACZB 4MLSA 4G6JL 1JZ3A 3BH9B 1JV5B 3OKOA 5EWIL 2OLHA 3U0WH 2IAMB 4NGHL 2OWXA 1C5CH 3T3ME 4HOWA 3QT2A 4LLVA 2P5WB 3GMNA 4WI2A 3T2PA 2F54E 4HXBL 4X98B 4AZIA 1S9YB 1QG3A 3GSNL 3CU7A 3VWJA 5IHSA 2FB4H 1IZKA 4TSCH 3IDGA 3SBWA 3QRFM 3GXFA 4I8DA 2OL3B 3EDJA 4YDLC 2P46B 4OCYH 1BD2E 2ATPA 1W0WA 3GSNA 4JZJB 4O2CB 3FN3A 5F6HJ 1BLNA 2DM2A 3H9SB 5IROA 1I1WA 3MBEB 4NRYA 3K81A 4ZFZA 4ZSOA 3CFEA 5E8PA 2EACA 3WF4A 5FCZA 2Z8SA 1JGLL 4OZFH 2MQ3A 5D1ZA 1WBYA 2R9HC 4UDTB 3VFMA 2B5IC 5DJ2A 1BJMA 4O2EB 2RJMA 1WEJH 5JW4R 3QIUC 4RE2A 4ISVB 3N0PB 1BHGA 4N1EA 4MDPA 2QSQA 4OZFG 1W1PA 1XF3A 2P5ED 1K2DB 3OR7B 5CJXC 2OTUA 3C8KB 4B0MM 3EGSA 3ESVF 1U8HA 1X1NA 4RX4A 5AWNH 3ALWA 3B5HA 5EUKB 4LHUA 3UJTL 1BG4A 1X5KA 1W9BM 3TVMB 4GBXD 5D2LB 5CFHA 2IBZX 3MSDA 3OKLB 1J12A 4LHJB 1ZEAH 5KOMC 2R1XA 2E8YA 5IF0B 3Q0HA 3T77B 5FYLD 5D1QB 4Q9RH 3MO4A 1RIUH 1QFWI 4U6YA 5TJWK 1JHKH 1IGIH 2GTZA 4LHQB 5CILH 5I9QC 1HT6A 1ZA3B 4OLEA 5DF0A 2ZOXA 3QEHA 2CRMA 2DQXA 5TF1L 5J13C 3DI2B 3O9WC 3MV9A 2MCG1 2IALA 5A40E 3JWDL 5C9JB 3RQ3A 4JFQA 3NYDA 3A67H 4N90D 2NY2D 1H3WM 2R4SL 1R47A 5FYKD 3BX7C 1MVFA 4HPOL 1E4WL 4G8IB 4NSBA 1J88A 2FWOA 3QXWA 4EVNB 1Z9MA 2CBJA 1OCWL 2GK1B 3X3FL 3VTRA 2F8OA 2B1AL 4RGNB 1EZVX 2C1PB 4DFHA 4XGZA 1D5IL 1RUQH 4LLMA 3L4UA 3ILQD 1WNOA 2DKSA 4NQTA 3V4PL 3IDNA 3TZVD 3KL5A 4GKZA 2W60A 4UT7L 1AC0A 4EIGB 5TE7H 3GB7B 5IFAL 3MRQA 1EAJA 3CLEH 4LRNH 1E6JL 1MAML 2D7QA 4LNRB 1D9KB 4FG6C 5KN5A 4NOFA 1UWQA 1ZV5A 4B15A 2NX5E 1J0YA 1WIOA 5ECJE 1HNFA 2VYRE 4QRSB 1SY6L 3IU3A 4FQPA 5JOPD 1OAQH 5E8DH 2NYYD 4Q7DA 4MX7A 2IPKA 3DX1A 4ZG1A 3DX6A 1N3NA 1W3KA 3WL0A 3DETD 4K3HA 1CLYL 3S4SG 3MODH 3V5KB 1SY6A 1CFTA 4ODTL 4CD4A 2VH5L 3T1FA 1D7FA 3HI1B 4PUBH 3ALXA 4NKQB 1V3MA 4TULH 4NT6B 1PKQB 3MRPA 4P5KA 4RGMB 3TH2T 3O6AA 4PLOB 5HHPA 4FZ8L 4CW1A 4QCFA 3HI5L 3N1FC 5F7YC 3CK0H 1QKZL 1P4BL 1UWXH 2C4XA 4JQVC 2WKGA 4N1HB 2X1QA 4NWUH 4RWYH 1FYTA 5BZWA 3LEYL 5J11B 4BF7A 5IKCA 3VM7A 4R8WL 4HPYH 4H8WL 1QBLL 2NXYD 4UT6H 4HZ7A 4X99B 2A9NH 5GRJH 3A47A 1QFHA 3VSVA 4V27A 3AC0A 4Q2ZA 1FFOA 4IOIA 4Q0XL 3B3IB 3GO1H 1KCKA 1KEML 4M82A 3ARBD 4P49A 2DQHH 2XY2A 2X4OB 1LNUB 1MVUB 1YHTA 4XCEB 3U9UB 2ZUVA 3W0KA 4YDKH 4PJDE 2VITA 4WNQA 3AJ7A 3GH5A 3BAEL 4HBCH 1CLZH 5JZ7D 2J7GA 4K3DL 2X4PB 3GJEB 1P69B 2B0SH 3WD5H 1A2YB 4EI5D 4FN0A 4ZE4A 3KAAA 3DHPA 3S5LB 2NW3A 4OZ4B 3EOTH 1ZHNB 2WMPA 4R3SB 3RWCA 5IHZB 4OCNC 3PDGA 2YBRA 4QTIL 1WV7T 2JF1A 4QHKI 5I78A 5ICYA 4OTXL 4CKVX 1UD5A 4PY7A 1E0OB 1TXKA 5EOCJ 5J8OA 4PV8B 4WIWA 1X3DA 3AHZA 3MNZA 3EYFB 1GOMA 4H1LH 2Y2WA 4POYA 1IMHC 4XI5C 4KZDH 5KVDL 5DK0A 2FGLA 3C8HA 2NSXA 3NCEB 3HNVH 4Z8FH 4LKCB 1DWGM 4H1LG 2V5DA 4HS3B 5GSVB 3D3VA 5E8OA 2I9TB 4G6KL 4TUOB 5HI3D 1OP5H 4WI3A 3MRFA 3AIVA 1XF5B 1OD7A 3EYVA 4LSRL 4JM2B 2PI6A 4KROD 5ID0B 3BUYA 2XRAL 1GUVA 1D5BB 3UTTE 5CJOL 4B16A 5DMYA 4LLQB 5GHWH 3VDAA 2IBGA 1ZB5A 2HG5B 5DD1H 3S36X 3DRTB 1R3IH 3MANA 4PJXF 5CSZB 3IJSA 4APQB 4MJ5A 2FR4B 1UYWH 3JVGA 1PEWA 1VESA 4NYLB 4QRPA 2QSTA 2XZCH 3RRQA 4JFZH 2P5WE 5LXGH 5E9DB 1YDPB 3NIDF 4UQDA 1MCLA 3STLB 1V05A 4MA1B 2ITCA 3WH6A 5ABFB 4LASH 3D85A 1O7AA 3SE9H 3WIFA 3QUYA 4LDOB 4KJQC 3E0GA 4ZNEA 1K4DA 5GGVL 3FN9A 4LEOB 5L2KD 3N18A 3OLGA 2YFOA 3H9SE 5MI0B 2CDEA 1C93A 1IQDA 2R8SH 5GGTL 3S88L 5IBTL 5T1DH 5CMAB 4MNGB 1KBGH 4QRRA 4RQQA 3MLYL 1R7OA 4P2QB 3Q48A 5E2UH 2CO6B 3QNXA 4GXPA 2F53A 3GKWL 4H20H 5GGTA 1L7IH 1A3HA 4P5TC 3IYLW 1MLCB 3EOAA 1EPFA 2EYTB 5I8KL 2BS9A 1GZQB 3D25A 5JBEA 3TNMB 2Z93B 2P24A 4DK3A 3IDMB 5FYJE 4P2OB 4PMNA 1RURL 4LLWA 4YGVB 5D2LE 3NIFE 4QXTB 5I79A 3MXWL 3N85H 2O5YH 4JY6A 3RNQA 4J3TA 4Y4KA 1CT8B 2IMNA 3G5YB 1EGZA 3W9DA 3IDYC 2WSPA 1E0VA 5A8QA 1TA3A 2YDQA 1IAOA 3GK8H 2F61A 4NZTH 1TQWA 4MA8L 3TO4B 2YD6A 2N4IA 1U92B 1JPFA 4XB8A 3UTOA 4L3CB 3FT2A 12E8H 1DWHM 1G7JB 4R7DA 3NCYP 1U3YA 3CSPA 3OAZK 4RISL 1MW2A 3CU1A 2IANA 1EEUA 4GINA 1K4CB 1S7VB 3CHEA 1T2XA 3QXAA 1OGTB 3RDTB 1QOKA 5TDOA 1HN1A 2BHYA 3TYFB 1PIGA 3WY4A 2QQLL 4B7IA 4WGWB 2VCAA 3NABL 3OKEA 1N64H 1OB1A 3LPPA 5D9SB 4GUPA 4TVUA 1UD3A 5GS1C 3D5OF 2D0FA 1QBBA 3X12B 4U1IB 4RGNE 5ADPL 4XUYA 2COQA 4M80A 3K7UA 3ZE1E 1FNSH 1AKJB 1I1AB 3KPLA 1NGPH 4NQCD 5I1GL 2Y4SA 3DX0A 5T5NG 4ZD3H 5BO1H 1KB5H 1NANI 1LDPH 4LK4A 2FECI 3BJLA 3H0TB 4GQ9L 5IK3B 4ALAL 1BQCA 1IL1A 1QEWA 4OLUH 1FFPB 5DR5H 2D1ZA 4XP1H 2E9WA 4UIKH 3MBXL 3SGJA 4WV1A 3UCRA 2HLAA 2JFEX 3FB8B 4PRNA 4X6BB 4KRLB 2FO1A 4JQXA 2QHLA 4C55A 3RJDA 3RGVD 3DV6B 3L7EA 1IGCL 3UJIL 4HG4J 1A4JB 1X5YA 2ORBL 2ZIDA 1NGQH 4QCIB 3I50L 1ZTXH 5I8OL 3EYOB 1FLRH 1C16A 3DXAA 3VE0A 2XPGA 1PKQE 4HKZB 1PSKL 2ZZUT 1VDGA 4P23D 3BYYA 4PJBF 3HMXL 4HGWB 2E5EA 1PG7X 3ULUL 2F8QA 3U82B 4UQ9A 4E9LA 5BRZA 5DT1H 1QI2A 5E1QA 2WWKO 4Z2GA 3NA9H 5F1NB 3WFDH 5EZOL 2Q8BH 3HMXA 3DGGA 1ISZA 2WBJA 2QMKA 4JPWL 1A64A 3P9LA 3CZLA 3MRKB 4FABH 2F5AH 3VXPB 5EBWB 3VWKD 1KFAL 4RFOL 4Y4HC 3MPCA 3LS4H 3H2WA 4D9LH 1OB0A 3TBVA 5JOFA 3L95A 1A6VL 3W0WB 4PJ7B 1VIWA 1RUMH 1FPTH 3OZ9L 5IMKA 3NCFB 2YPVL 1LHZA 4O51B 1CZ1A 5FEBA 4Y16D 4OIIL 1I1RA 1NMAH 4WJ5A 3KPSA 1UCBH 2EH7H 3TIEB 4UI2A 1YECH 1ZHBA 3K2UH 4PJ9B 5E00B 5JOEA 2EXOA 3VIFA 4TUJA 3UEZA 3ZDXF 3KLHD 2D24A 5L8LB 1HH6B 3KYKH 4RSVA 1T6WA 1JI2A 3SE4C 4PEEA 1KBKA 1QQDB 4U1LB 5DZNA 3WEXB 4BH7B 4D8PA 2FHCA 5JORA 3D39A 3ARDA 3RVTD 3SO3B 5FUOL 5HHMD 5B39G 3T4YB 4Y4FA 2CDFA 3PXJA 5DYOB 4F58H 1TFHA 3KWXA 1ISXA 1E4KA 3QI9D 3PZMA 3CZSA 4Z7VA 1MUJB 1SMDA 4Z0XB 4D0BA 4ZTOL 5A2IH 5KSAB 1JL8A 5BJTB 4DFIA 3P73A 1T2QH 3MACL 3OIHA 1IAKB 2XKSA 1A6UL 4KJWD 1DE4B 3L3DB 1ZMYA 4GRLD 3CFCL 2JIXB 4D0DB 5K33A 6FABH 2NY4B 5GS0D 2A3HA 4ERSH 4WWKC 1G7MB 3DLQR 3MRNA 2R4RL 5EUOF 4E4PA 2HJKA 3V2AR 3QEQD 3NCJL 3W2DL 1BFNA 3CIQA 1P7QA 1KT2B 1R3HA 5ICXA 5MENE 4I3GA 3CJJA 4JR9L 4M1GH 5AYBA 1PG7L 3U83A 4DM2A 3QCVL 4M03A 3BEVB 2E3ZA 1XZ0A 4JGMA 3UTPD 3LEXA 2Z8VC 2D7MA 3EDDA 1CK0L 4TOQA 4M62L 5L88H 1MNUH 1MQRA 4G7VH 1TFVA 4Y5XC 1MCFA 2NY0C 2M1KA 3FAXA 4QHKJ 3TBWB 5IMMB 1CLXA 2PYFB 5GSRB 3SDDC 1DBKL 3IKCA 3NFSL 5D96B 4NN7C 5E9DE 4YJZL 1HDMB 5I8CB 5AYQA 4MSWA 3VIJA 4H26A 2CJUL 4Y2DB 2JJWA 4U1GC 1T1YA 5LQBH 4UILH 3R8BB 4ZPTB 1I8KB 4X5LA 5CSBA 2MWCA 3WSUA 4L4VD 3ARGD 5ITBH 3NZ8A 4ZXBD 1B0IA 4PBVC 4U0RC 2BSRA 1FNEA 1WWBX 2PXYB 2VI0A 1TTGA 1M01A 2FIKA 3IXAA 3JUZA 3VFTB 4Q6IC 3V0AC 3P4OB 1CU4H 2ICWI 3PHOB 4P2QE 5KOVC 5CEZL 3WS6C 3AMCA 1YEKH 1U41A 2L7JA 4P59L 4PJGB 3FB6B 3OGOE 5C0JA 4RIRB 4YZFE 1UG6A 1FA2A 1U95A 1EO7A 2HVJB 5EIQA 3RCNA 4I9WD 1T0MA 5CINL 5E70A 3MO1B 5GGUB 4PP1C 3VH8A 4EE9A 5IFPA 1J87A 4JPIA 4JY5H 4M8QB 4R96A 3NUKA 3CV5A 3X11B 4DWSB 4JPVL 3WUWA 3V5HA 3BCDA 2W0FB 2VXUL 1B0RA 2BDNL 1QLEH 3U4EB 1LE9A 1E4XL 4Z7WB 3BH4A 5F9WB 4NQED 3P4NA 5F9OL 43CAA 3CVHL 4V2XA 1T0NB 2F8XC 4QRUA 5DEGA 5TF0A 3U2SA 1J1PH 5ISZB 4H7VA 1R5IB 1WKYA 4M6AA 5CZKA 3TJHC 5IXEA 2VN4A 3TT3H 4YHEA 1WCBB 2AW2A 4PRHB 1ERNA 3OKKA 5BRPA 2BK8A 4KDWA 1H3UA 2VLLA 1OLLA 2AK4E 1NBZA 2GDUA 4R0LC 2B7DT 1QSFA 3CVHA 3GNRA 4UFKA 4I0PD 4LCWB 4EIZC 2CPUA 4G6JH 4TXEA 4MPKA 4L9LA 5E0CA 2IPTL 5EWIH 5FA3B 1I7ZB 4NGHH 2G3IA 3O4OC 1J5OL 2D9CA 4WO4A 4OM0L 3RKDD 5E0QA 5I16B 2DQDL 5HSFA 2XA3A 5C0EB 3SE8H 2HT3C 2R2BB 4OQTL 5TGBB 2VQUA 1UR4A 3GSNH 1Q6EA 1UWGH 4HWZB 2BY2A 5KSBA 1US2A 1HSBA 1OF2A 4EDXB 1TDQA 3VMPA 1CL7I 5J6HB 4OV6F 2IAMC 2Z4QB 3QFJD 4L3EA 4OQTA 5C7XL 1E6OL 5E6ZA 2WUBL 5SV4A 4DVBA 4FQHA 2ID5A 1QRKA 2VZTA 2DQCL 5HHQB 4JDTL 1OOAA 3RA7L 1WAAE 4AD3A 1DEDA 3VRIA 3W9EB 3OGVA 1TVBA 1US3A 2WWMC 1A6TB 3CUFA 4JZJC 1VFMA 2IG2H 1BJ1H 3BVTA 5IVZB 1SJEA 3CFDA 3Q1SL 3MBEC 5IB4A 5DFWH 4N68A 43C9A 2OZ4H 5ALCH 1WDSA 1OGAB 3ECBA 3TYGL 1PYWA 4LAJH 4BKLA 3UJTH 1YYLH 1JHLH 3ARWA 2LQRA 3MREA 2XNAA 2GJ6A 5GJTH 4ZO7A 1ZL1A 1VJSA 4HZ8A 2CGRL 1A14H 5HHOD 1YC8A 1YEJL 5C0BA 3OJMB 1A21A 1FG2A 1BREA 3GXTA 3MRGB 1E9LA 8CGTA 1XC6A 1I1YB 1QWNA 5TF1H 4PYHA 2ED8A 2J8GA 4DUWA 3WNKA 1RU9L 3ZSSA 2I07A 1JI1A 4EANA 5KSVA 1NC4D 3GKZA 3TVMC 2QL1A 3FCTA 2JELL 4K2UL 1XGQA 3O3BA 3T8XA 4LMQE 4NRSA 3VWJB 2HKHL 2VDLH 4WTWA 1E6NA 6A3HA 5D1QC 4ZXLA 1P7KA 1QW8A 1JJUA 3BQUC 1DVFD 3ES6A 1AI1L 3MV01 1OCWH 2JEQA 3BDYL 2P5EA 1FVEA 5T33L 3GBDA 1NAKH 4M3JA 15C8L 4PTUB 3W0WE 3X3FH 4MNLA 1QO3B 2B1AH 4PJ7E 3ZHKA 2HVMA 1MOEA 3BI9X 4LBEB 2OSWA 3DVNA 4Z0BL 3UTSB 4U4BA 3OKMB 4U1HA 4NO5B 4GBXA 4OGYH 4ZFZB 4BH8A 1ZGLA 1QNRA 1KTLA 4YX2H 3PZGA 5E8PB 5AEAA 3VXUD 1UENA 3HNSL 3AMKA 2WCGA 5D1ZB 3H7BB 3T2OA 2BXZA 4UT7H 1FSKB 1HF6A 2UV3A 5FYKL 1E56A 1O7SA 5IFAH 4RGNC 2VLKB 3QUML 4FQJL 2PYEB 3S3PA 1TR1A 1RZJL 1E6JH 2C3XA 1K3ZA 4QHMB 4QY8B 1BFOB 5J7CC 4M3KB 4CADA 1SY6H 1U8IB 2XVNA 2HFEB 3TBYA 3QISA 1HILA 3QUMA 5MEQB 1JPGA 4ZAKA 5HGDA 2VZUA 1HIML 4N1CA 2G4FA 1H0DA 1AHWA 3IU4L 4CNIA 4PJ5B 1HSAA 3POHA 1RHFA 4ODTH 3DROB 5KTEL 1EUTA 1SBSL 4KQ4L 2HJLB 5EBGA 3WD1A 2BY3A 2JIEA 1CD1A 3HRPA 1VFAA 4K8RD 2WP3O 4C7GA 1W0VB 2QADC 3BAWA 5DD3L 2VWEE 3LN5A 3TZVA 4LPVA 3H3PL 2VDNH 1YJDL 4X9FA 5HGGS 1ACZA 3CGTA 2NY1D 1MRDL 1R24A 4KI5F 3BP7B 1P4BH 2X1WL 3MCKB 2V2TA 1YEGL 4ONFL 5GGRB 1U58A 4WFFE 2VXVL 3FFCB 2FZ3A 3WNPA 4CUCA 3FZUD 1UQSA 1F58L 1S3KH 2JF6A 2AJSL 4RGMC 1CE6A 4U3XA 4H8WH 4X4XB 5AAMA 1JGEB 3VD4A 3KPOB 3SCQA 4NWTL 1TVNA 4F7EA 5EBMA 2AJZA 2RFXA 4Q0XH 1QW9A 3SUVA 2XVPA 5D7IB 3IFOB 2DDQL 2AP2A 3BPCA 3CSGA 1FH5L 4M6NH 4GKZB 1JGDB 1KEMH 1VGKA 3OXSA 5J11C 4F7TA 3MROA 1WFOA 1B2WL 1R5WB 1WWAX 2UY7A 3D87B 1W72L 3EJUA 2VR5A 2ZOLA 4KPHL 2VJXA 1G0DA 1M03A 3U46B 5E24E 4PG9B 4UOW1 4K3DH 3UG4A 5F7HA 3LV3B 3V6ZB 3FRUA 3TN0C 4DJMA 1W72A 2I9LA 3IAPA 4NUJA 3RZCD 3RAJL 3HE7D 5HI4D 5EU7E 2YWYA 3MCLH 1OSPL 4QTIH 4AIEA 1RULH 1N59A 2H8PB 2ZSVB 4OTXH 1TG7A 1J0ZA 2PR4H 3KPNA 4PJGE 2DJUA 3OKDB 5AC4A 3VDHA 3UDWC 3ZE0E 2Q76B 3ARBA 3FT4B 1TETL 4L8CB 5LCVL 4IDJL 4DCQB 3QPXH 2EPNA 2WMFA 2CLRB 5M94B 4ZODA 1OT1A 3SCWA 4XNQB 5D93B 4F8XA 1A1NB 1W1YA 4Z7WE 2OJZL 2Z35A 4FQIH 1HX0A 5FB8A 1EO5A 3FO2A 4MMXC 5E6ID 5ISZE 5C0DA 1AR1C 3NCBB 2E6QA 4YNYA 4RFNB 4PRHE 1R87A 3B2VL 5FA4A 2PNDA 1OTSD 3D2UB 2YPLB 4L5FH 2D73A 1UYQA 3AY4A 5KVEL 2NY5H 2FEDD 2P7TA 4LCWE 2JK5A 3LDBB 5DJ6B 3QULA 4N8VB 5I17A 1D2KA 3F5JA 3MLWH 3HB3C 1ORQA 3FRPG 2V9RA 3TTYA 4JM2C 4YR6B 5DWUH 4KWUA 4WNQB 1CYGA 3LN4B 4LARL 3C9NA 5LAXA 2P47B 4KRPB 3O6KL 4KI5D 4TVDA 1KLGA 4APQC 4KK5C 5T1KD 3WJLC 2FSEB 4GRWB 3GIZL 2NW3B 2VLJB 3WE6A 5E0FA 4EUPB 4HIXH 1OIMA 5GRVL 1R5VA 2IF7A 4EOWH 4LLAA 4U05A 2WQ8A 5IOPA 1UZ6F 3V4VL 5B38G 2ENSA 4MA1C 4PY8I 4JHZA 3WFCH 2BSSA 1PZ3A 2OYKA 3VW3H 2XQYK 1NFDE 4AD4A 2AGJH 4XP9L 5IIEB 2GCYA 3RVWC 1MRFL 1LE5A 3KL0A 5CIPB 1CZ8L 2AJ3B 4UQ2A 5MI0C 4MAYA 4PGDB 5L2JB 4XI5D 5I8KH 2DQFA 3C6SB 5A6AA 3DHMA 2H2PC 3D3VB 1WGOA 4WHTA 1AD9A 2V9TA 3V6OE 2EZ0D 2GT9A 1OGAE 5EB9A 3EYVB 3GSXA 4DGYL 1JHTA 3SCNA 1RURH 4OM1L 3MXWH 3EO9H 4PJ8B 3BUYB 3IKKA 2YD5A 1YNTA 3O8XB 3I6KA 2PO6B 5EC1B 5HGHA 5HGAA 3NCYS 4HG4K 1LO4L 4LLYA 5F71A 5L2KA 2OQJB 3VFNA 2ZUQB 2XN9D 4C4KT 4JFVA 4I77H 3T3MF 1RJLA 3BJ91 5HVFB 2X4QA 4QRPB 4ZO6A 1G7QA 4P2OC 3BDXA 3MJ8B 4TTDD 5IBLC 2EAEA 4M7ZB 3VJ6B 4RISH 3IJYA 3QDAA 4X7FC 5BMFL 1LDSA 3SQBA 3CUGA 4G6AD 4N5EC 3DOSA 5TQ2L 1J1XL 2BNQD 3L3GB 4LF3A 4LSPL 4S1DD 2X0HA 5BXSA 5I24A 4I2XB 1WFNA 4IOSD 1YMMB 4X0KB 2JF7A 3BP6B 5DJXA 1JWUA 1AR2A 3CFKA 3BE1L 1K4DB 5HPMA 1V6VA 4W86A 4HSQA 4E5XB 3UTSE 3OQ3B 4XWOD 3M8OL 2ICWB 3RDTC 2A6DB 3IFPB 1I7RA 1R6VA 1ZT1B 5F88A 2VXTH 1IJ9A 5I1GH 2F1BA 5ITFA 3QG7L 4OIAA 4JFEB 1Q6GA 1BG9A 4QRTB 4G8GA 3NBNA 2UY4A 4MQXD 4HT1L 2F53B 3G6AA 1MHHA 2VLKE 2VE6B 2G3NA 1CFBA 2PYEE 1NWSA 2VZOA 5KZ6A 3GSOA 4LIQE 4XVTL 2VISA 4BFGA 4KK9D 4AMXA 3C2AH 3MBXH 5F7NC 5H37H 1I1AC 4XPAL 2XSAA 2CUMA 4CD8A 3VCLB 4UBDC 5MERB 4PTTB 3DVGA 1Q8MA 3OGRA 5F7KC 3UJIH 5H37G 2FX8H 3UROR 5ABGA 4P57B 3WKML 3SGKC 2ORBH 5E08L 4PJ5E 5J1SC 3HPLA 1TTFA 3I50H 4ATLA 3CFIC 3Q3GB 4IRJB 5I8OH 2V3GA 1GHFL 5FUZH 4HP5A 3NTCL 5FDYA 4H41A 3SDAD 1N6QL 4MCYA 1MWAB 3CUPB 3FXYA 1PSKH 1Z9LA 5DD6A 1VFOA 4PRIB 1G1YA 3PTQA 4NQCA 3HMXH 1KPUB 1CQKA 3FY1A 2B8OT 3P4LA 1NCAL 4HZLA 1FVCA 3AHYA 2PKDA 1TQCB 2XTJD 1NEZA 3QQ4B 4N0YL 3S35X 5H2BB 3RTQD 4AENB 4AMKL 1P4IL 4PJXA 3U5UA 4OJYA 3NVQA 4G7YL 4JZNA 3RIFK 3FFCE 1KTCA 1WT5C 4UQAA 3VFOA 4WTZA 4JPWH 4NN6B 2J47A 1AY1L 2DL9A 4XXCA 1F4XL 3TT1H 4W8BA 4M7JH 5SWQA 4JFHD 1KFAH 4RFOH 1I3RB 3RGVA 2UWEB 4AMWA 4L8SC 3ZDZE 1D5XB 4JRYB 5I23A 1J05A 4P3CL 3KPLB 4MB4A 2ADJB 4POUB 2X7LB 5M17A 5D7IE 5AG9A 2H6PB 3TBTB 4NQXA 3OZ9H 1S78D 5L8KB 3SUWA 3PWLA 1QVOA 5GZOC 3C08H 2W9DL 4HFUH 4ODHL 3QR2A 4BZ1H 4P23A 3MV7D 5IQ9A 2F54D 4J3WA 4OGAC 4P8UA 1K3IA 3K46A 1KXQA 1Q1JH 3BAXA 1JFQH 4IS6A 1QSVA 1C7SA 1T7YA 5GJSH 2GITB 4JDZB 1BD2D 5LWYH 4ZOCA 5FUOH 3AXIA 1I1CA 5C0GA 3W11D 4GW4B 2D3VA 4HX1A 3DXAB 2YD8A 3VE0B 4FTVA 3W39A 4JHAL 2OJEB 4BM7A 3VWKA 4M93B 1NM9A 3ZKMD 3I9GL 3MACH 3U7WL 2GY5A 1A6UH 3DMMD 4LSQL 1K8DB 2GTWA 1TQBC 1UB5A 4JAMA 3SO3C 3C6LC 3CFCH 4RA0C 2AJYH 5M03A 2FL5A 1A4KB 4JVUA 4JFFD 3AFBA 5FO7B 2FGWL 5KAQG 5A6BA 3MLVL 4YHZH 3ZLQC 2W91A 5KSAC 2R4RH 4X7CC 2SEBB 3JSSA 4X7SL 4PGBB 3NCJH 3TWCL 1KXVA 2A1WH 1OQOA 5ANMA 3NSNA 4XPGH 4XNYL 1OD0A 4YPGA 1HHIA 4JR9H 2XFXB 1G6RH 1YC7A 2YPLE 1RJZB 4WW1A 4NC2B 4WWID 2NW0A 5BV7H 3LQMA 3S35L 1HYSC 3LY6A 4GKSA 2DYPD 3RMEA 4I48A 3MRLB 1ONQB 2VWEC 3QI9A 2R1WB 2FNBA 4FXLA 4PJDF 4U5IA 4RCAA 5A3ID 3P40A 2CKBL 3PDDA 3C87A 5GS0L 3CLFL 1G7LA 1MY7A 4HKXA 4UDUA 4XZUA 5KZCD 3T65B 1H5VA 4Y5VA 4ONHA 5F93C 1V02E 4GZEA 4NQSA 4KRUA 2EH8H 3NIGE 4GRLA 4GAJL 4OD3L 2CKBA 5L9DL 1JVKA 3HRZA 4OLZL 1KCLA 4X7TB 1M04A 1TE1A 3U1SH 4LYPA 1HHHB 1WZMA 4PFEA 4MNQB 3BZEB 1F2QA 3JTTA 4JGJA 3ARDB 4GRWE 4AM0B 2VLJE 1NMBL 3IGAA 1BFVL 5EB8A 2AXFA 2CK0L 3QEQA 2QQNH 2XKNB 4M43H 5K9JH 3LKRB 3DX7A 3U0PB 4ZOAA 5D5ME 2I5YH 3E8UL 2PWFA 1V3JA 4Y2DC 2DLFL 2EIZB 2X4SA 4ELKB 3HC3L 3RWHB 4Z78A 3QWRD 3AHVA 4UUJA 1M7IA 4JPKH 3CSYB 3NDYA 1ZGLM 2HJFB 1UACL 2CMRL 5SWSA 4KK6C 5DTFA 3G9AB 1FYHB 5DRWB 4MCZB 2IGFH 1FIEA 2DI9A 2BCKA 2V9QA 3JUYA 1RUKL 2NX5D 1UM6H 3EJRA 5CINH 3VH8G 1HI6A 3WL9B 4HUNB 4PJBA 4B3KA 4FNLL 4O4YH 3RWGB 5E2WH 1OTTD 1Q4NX 3HCVA 3BKJL 4FMKA 4MQSB 1E4XH 3L5XL 3QNYA 3OX8B 1NCUA 3LSOA 4L4VA 1E3XA 3CVHH 4W70A 1T7ZA 3ARGA 1A7PH 4ZXBA 5I1DB 2GYSA 2X2IA 5GZNC 3QJHB 4FQLH 3M6DA 4H8VA 3PHSA 1O7VA 1BZ9B 5MEOA 4L1DA 1MQQA 4PY8J 4DWSC 3VGAB 3PHQB 1MCWM 1JUFA 3WH8A 5DUPL 1EHNA 1MVYA 3WY3A 4H26B 2JB6A 2HT2D 5KEZA 4I2XE 1YMME 4OM0H 3ZYIA 5I2IA 2EBNA 1UCTA 2X70B 1LL4A 2YSSB 3LXCA 2AV7B 3X14B 4OQTH 4MXQC 4PREB 2Q3ZA 1FNEB 1Q38A 5EZIL 5HD8D 1KEGH 3QAZC 3CFJB 4U6VL 3MNWA 1Q0XH 3BXWA 1R3LB 5I76A 5FAAA 4PTMA 1P5VA 4C59B 1WPCA 1EFXD 1Z0MA 2HN7B 2VXQL 1PFCA 4JFEE 4U33A 4WEUD 5DI8A 1Q9LB 3WBDA 4CDHA 1FL3B 4EI6A 1FC2D 5C7XH 3GMQA 3PL6C 3REWA 5H35A 2B4CC 1TVHB 1E15A 3I6LE 3QIBD 1W9UA 5F21B 5DVMA 3RY6C 1IM9A 2DQCH 4P99A 3RA7H 1IFHH 1XIWB 4BQ2A 1T83A 5C07D 2VZ1A 4R90L 5KG9B 2ZUMA 2FIRT 1Z0NA 2X05A 1SYTA 5CJQL 1HQRA 2J77A 3UMTA 4I0PA 3QUKB 5D2LF 3FB7A 2WIMA 2AEWA 2XZAH 3WUWB 1X6LA 4KMLB 1S5HB 4X7EC 5GPRA 1ZLUK 1HJXA 1W3HA 4W68A 3HC4L 1LE9B 1JFXA 3MJ7B 1RZKL 1QSEA 4AEIL 1A1OB 5C0CD 4QRUB 5EUOA 5J12B 3X13B 1QFOA 3RBSA 3L5IA 2VT0A 4OFKA 5INDA 1D6VL 3OKKB 1LVEA 4GKOA 1KACB 4YWGL 1IT9L 1SVZA 4PRIE 3O6FC 1P1ZB 5BQ7B 4D1JA 3AROA 3QFJA 4HIJA 1HOCA 4FQXD 1NFIB 1YEJH 1F6AB 4PB9H 1XCTB 1SMOA 5EU6D 2ITDA 2CIIB 3V6OC 1J9CT 5FKPA 2W59A 3OGCA 4PGZA 4JCLA 4P2CG 1MCCA 3ARSA 3BN3B 3HN3A 5EZJB 5GRUL 4U1JA 2WZIA 1S7RB 1JN6A 2E40A 3DUSB 3ZE1F 2ZKHL 2HKHH 2C3VA 4OD2B 3D9AL 1BQSA 1OF2B 4AYFA 1ED3B 1YYML 2DQEL 2UWEE 4M1CD 4P2YA 4JRYE 3O9NA 4NN5C 5HXMA 3BPNB 4I0KA 4W4OA 5JXED 1KTDB 1MW1A 3WN6A 5ADOL 2ZCHH 4L4TB 5C8JB 4Z0BH 3GSWB 4PGJA 5C6TL 4DVBB 2DQJH 1CLVA 4E42A 3VWJC 3WD0A 1CXEA 3GSRB 3BGMB 3HNSH 5EPMB 3GMRA 4O2FA 3C5SA 2A3BA 3NIYA 3FONA 5IFTA 5HHOA 3VRIB 4AEFA 1TVBB 2D4FA 2CLVA 3WN5A 2H45A 3IK2A 1G9ML 3QFDB 1MCKA 1SJEB 4F7PB 1C5BL 3F6IA 5IB4B 1W8OA 1FFNB 2APVA 5FHAL 5IJKA 5GGSB 2R69H 3RVVC 2P49B 4QTHA 1KULA 4CCEA 3JWNC 5D1ZC 3MLTA 2WMHA 1GZPA 4UIMB 3JWOL 4AIUA 5IHLB 1BM3L 4PB0L 5A6MA 3LZFH 2V2XA 1XH0A 5F3BB 1DVFA 1TVDA 1ZT7A 4ELMB 3LCYA 1I3VA 4X4ZA 4LAQL 2FRGP 4R7NB 2R29L 3O3EA 4H1LB 3ZKSD 1IEBA 1BBDL 1UWEH 1SBSH 4KQ4H 3L3IB 4X80L 1HKIA 4U3AA 1RFDL 4RAVA 4HH9B 5EO1A 2Y24A 1E5JA 5DRZB 1DUZA 4JZOB 5CUSL 4ORZC 4K7PY 5DD3H 1FN4A 5F1OB 4HKBB 4WK9A 1OTUD 4MDIA 3V6BR 3TVMD 4WY7L 1C12B 1P7KB 3I02B 4ONFH 5A2FA 3BD3A 3VXNA 1N6UA 4CD7A 3SY0A 1OAZL 4G8FB 3ES6B 1X5FA 4MA3B 1T1XB 2ZX5A 3QIUA 5A95A 1I9IL 4X6DB 2AJSH 2WBWB 3RWDA 3LKOB 2BRRH 2VOTA 4MDJA 2AS5M 5AZ2H 3DVNB 3MOAL 5TQ0L 4X5XB 5EULV 4MJIB 3KLAA 3DX8A 3QNZB 3R06A 5DMJB 3S6TA 2I27N 1KTLB 1U8MA 1OPGL 1XGTB 4TVCA 4YBLB 2EICA 4DTGL 4OLXL 3H9HB 3JWDC 3MC0A 2DDQH 1R7AA 2G8ZA 4KHTH 1YEEL 3GMMA 1NOFA 2B2XL 4XRCA 4ACZA 1B2WH 2UVEA 1OARL 2IH1B 2EO7A 1TVPA 3L5WA 4MNQE 1ECEA 5E6YA 4PMYA 5HHXL 4KPHH 4Y89A 3G6MA 4MAUH 1BVNP 1RZGA 4M5YL 1M05B 3TBYB 2HVKB 1CBGA 1V6YA 4CBPA 3O11A 2Y06L 1AGDB 1YN7A 2H26A 1OGGA 2EO1A 3GFUA 3IFLL 4CCDA 1AHWB 3V4UL 1W9VA 4CNIB 3WEZA 2AEPH 1B4JL 4X8JB 5D7SL 1OSPH 4YEFA 2AJVL 3JUGA 1XH2A 1IC1A 4NBYB 3SJVA 1D9KD 5D7KD 4O02L 5CGTA 4RDQF 4LGXA 3MLZH 5EFIA 3RGHA 4YXLH 4NO0D 5LCVH 4IDJH 1E0XA 3MRBA 1DL7L 3DJ9A 3IJHB 3UYRL 4HAGA 2OJZH 3MKKA 4F3FB 5F9AC 1CE6B 4NHUA 3CHCA 5KSUA 3WDQA 1PDKA 1JPSL 1NDGA 1YQ2A 2NW2A 1IARB 2GEEA 2V7HB 3P0GB 2A83B 3B2VH 3B9EA 3WDIA 4Z2HA 1EHLH 3B8SA 1B3YA 3RZCA 3KPQB 5ILTH 3HE7A 2XFRA 2IBBA 1M4KA 3G08B 4KK8C 2VAAB 4ZFOL 1P4LA