3VO8A

Staphylococcus aureus ftsz gdp-form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
305
Chain Sequence
ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 109
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3vo8A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vo8A01
5MN4A 2VAWA 4TUYA 4X1YB 5EYPB 5IYZA 5EIBD 4TV8A 3N2KB 2BTQA 5LYJB 5JVDB 4DRXA 4ZHQB 5LP6C 5LXTB 4I4TB 4B46A 2BTQB 4TV9B 4U3JA 5J2TB 4HNAA 3JARB 3JALB 1W581 4FFBA 3RYHA 3VOBA 3RYIB 5J2UB 1SA0B 4EI9A 3UT5A 3CB2A 3VPAA 1RQ2A 3R4VA 4IIJA 1FSZA 5EZYA 3C8LA 1JFFB 5IJ9A 4IIJB 3VO9A 4X1YA 3RB8A 5EYPA 5JCOC 3N2KA 4M8IA 5LYJA 5JVDA 5MN5A 5EIBC 4ZHQA 5LXTA 4I4TA 2RHLA 4EI7A 4IHJB 4TV9A 5J2TA 3V3TA 1RQ7A 3HKDB 3JARA 3JALA 3RYIA 4X20B 3WGJA 4WBNB 5J2UA 1SA0A 3JATB 3WGKA 3RYFB 5KMGA 4E6EA 3ZBPA 5LP6B 1OFUA 3ZIDA 1Z5WA 5KX5B 4O4IB 1JFFA 5KMGB 1W5BA 5CA0B 5C8YB 1W59A 3RYCB 4YJ2B 4O2AB 3JAWB 5CB4B 2VAMA 5FNVA 4EB6B 4IHJA 1FFXB 3HKBB 4I50A 5GONB 3N2GB 3HKDA 4O2BB 4XCQA 3HKEA 5IJ0A 5FNVB 4X20A 4WBNA 3HKCB 4I50B 3JATA 3M8KA 3RYFA 5BMVB 3HKEB 5IJ0B 5CA1B 3VOAA 1TUBB 5LP6A 5LA6B 5KX5A 2Q1XA 4O4IA 4X1IA 2BTOA 5ITZB 4LNUB 5CA0A 2VXYA 5C8YA 3WGNA 5JH7B 2XKBA 4I55B 4X1IB 5MN6A 3RYCA 4O4HB 4YJ2A 4O2AA 2R6R1 4YJ3B 5M7EA 3JAWA 4ZI7B 5CB4A 4EB6A 2Q1YA 3HKBA 1Z5VA 1FFXA 2R751 5LOVA 2XKAA 5JQGA 5GONA 3N2GA 4O2BA 1TVKB 4O4LA 3JAKB 1W5AA 3WGLA 4O4LB 3HKCA 4TUYB 5LOVB 5JCOA 5JQGB 5IYZB 5BMVA 4TV8B 3M89A 1W5EA 3WGMA 5CA1A 4ZOLA 1TUBA 4DRXB 5LA6A 1RLUA 4U39A 4U3JB 2RHOA 4ZOLB 3E22A 5ITZA 4LNUA 4B45A 4O4JA 4X1KA 4HNAB 5JH7A 4DXDA 4FFBB 4I55A 1W5FA 3RYHB 4O4HA 4F6RA 4YJ3A 2RHHA 3E22B 2GVIA 3VO8A 3ZBQA 3UT5B 4O4JB 4X1KB 4ZI7A 3JASA 4F6RB 4EI8A 5EZYB 1TVKA 2RHJA 3JAKA 2VAPA 3JASB 5IJ9B 4KWEA
chains in the Genus database with same CATH superfamily
1DEKA 3W2HA 1H1TA 1RBMA 3PNLA 1RRCA 4CFYA 5F4ZA 3EQ9A 1TZBA 2AJTA 3IUBA 3L8ZA 4KOAA 5SYNA 3W2GA 1XB2A 4EW3A 2FK8A 4K6CA 2EERA 4HMQA 3DR3A 3D54A 2OYSA 3RPEA 4U3JA 4AZVA 4QD3A 1V41E 4HPJB 2VBFA 1F60A 1LDEA 3TSZA 1N1EA 2C5EA 4MR7A 3CUTA 5C4MA 1HMPA 4JBWA 2JI8A 5IAJA 4MLPA 4ZVPA 3RW9A 1KBZA 1RACA 3MAGA 2G82A 4URFA 3UZUA 3FNBA 1AJEA 5E6UB 4W7HA 3A3OA 2VZ0A 3GLHB 3BE6A 4Y18A 1GZ4A 1MQ9A 3OJWA 4QHTA 1IY8A 1EGHA 2HZBA 3SZUA 2B8WA 4HAUA 3L0CA 5TB5A 5D00A 1Y6FA 4FLMA 1OIVA 5B8FA 3ESCA 4FFDA 1PJ8A 3VUFA 4NFHA 3ZXUB 5ECYA 1OB2A 2APJA 4GR9A 3O4HA 2E4YA 1CQWA 4GX0A 4DMGA 1OKKD 2B3DA 3H3FA 3IUNA 1LI4A 3LY7A 2EATA 3N7TA 4XYGA 3IL2A 3T1TA 4QKQA 1EVLA 2GM9A 1R6DA 2C29D 1A9XB 2XTMA 3LZCA 1J8MF 3DCYA 1CJVC 4AUNA 4ZXPA 4DZRA 2ZPAA 4XVRA 3TR6A 1RLOA 3I2IA 4D9GA 3T3PB 4Q15A 1QQ5A 3LUKA 2DHCA 3S8YA 3U7GA 4GI5A 3O8DA 1K6MA 4L8LA 4LXQA 2Q07A 4QG3A 2ZRPA 5FNVA 2WJWA 3RE3A 4MH0R 4DG5A 2W43A 2NU6B 2M6LA 4RULA 3ZD6A 4BMSA 1G41A 4P84A 1OXMA 2YJ5A 4X8MA 4C29A 1G3RA 3VKHA 1SKUA 5CK5A 4HNGA 3PV0A 5DI3B 1KI2A 1X3SA 1X77A 1AGNA 1NDQA 2G08A 2G5PA 2NIPA 2IP4A 2NSHA 2PKWA 3L8GA 4FNOA 4GR5A 5D3ZA 4EZIA 4PLHA 1WEHA 2DYYA 1O0SA 3A1TA 2ECKA 4NDAA 1CEXA 1T5IA 1RTTA 3G8BA 5HFJA 3AUAA 2ADMA 3ILXA 4BYMA 1YB1A 1VHWA 4P9NA 2WT9A 1W9HA 1WD5A 2WYUA 2YHAA 1DBVO 3RRBA 1SQFA 2XDQA 2ZDQA 7ABPA 2V1UA 4LTDA 4EJ6A 3D8HA 1Y5NA 2C2OA 2OXFA 5T3UA 1LPMA 2OQVA 4F71A 3OQIB 1RRVA 4R8MA 4V0RA 1VI2A 1PBTA 2ROQA 1QF7A 3AERB 4EWLA 1UANA 1MOQA 3ZVRA 2BDEA 1XQVA 4H6PA 4KAAA 5FYQA 1IY0A 4NG4A 5A0VA 2W70A 2TMDA 4BKOA 4JVSB 4CKCA 5KOIA 1JG7A 1W73A 2KQUA 4GI2A 2XCLA 4JLMA 2OGSA 2AEMA 3A4MA 4G9EA 1P29A 4JC4A 1YHNA 1PK7A 4M99A 3TK1A 1DRUA 2V74B 2X8BA 4NYIQ 3K1ZA 2C2HA 4X1OA 5G1NA 3ZX4A 5HW0A 1F8GA 1AUOA 3G89A 3HUDA 3S1SA 4NK4A 2N0SA 2P9CA 1K5DA 2Y3IA 1N57A 1H4VB 4JB2A 2G40A 3GG9A 1NI5A 5G3ZA 3LL7A 5DBOA 3EA0A 4MV4A 5GMOA 1E0DA 4UCFA 5MN4A 1DAFA 3I8XA 1J33A 3QTLA 4C4XA 4XE5A 4DDUA 2I9KA 4HCJA 1E7SA 1OU4A 4LY9A 3VTIC 4PSDA 2B61A 5EQJB 3VR5H 1TM2A 3ANNA 3FF4A 1E2KA 4DMRA 2Q3HA 3MIIA 5FFNA 3COSA 3FXAA 3NALA 1TT5A 1QO0D 3NORA 4HH1A 3GLVA 3KQQA 3TLCA 3L7AA 1AGXA 1SUAA 3AM1A 2H3EA 2IHUA 2KSQA 2AWNA 1K89A 1YIAA 2P9JA 3RUAA 1DO2A 5LLSA 1P6QA 1QORA 2G4VA 2R8RA 4DG9A 4LGYA 3HBJA 3V48A 5KTRA 4MGZR 1GPJA 1HDZA 1W8DA 2E2WA 2RI0A 1QV6A 1V8DA 1JSLA 1T9KA 1Z2NX 2G8LA 3C4JA 4HB4A 4LOLA 4TXHA 4A4DA 1DIAA 1GPBA 2CFSA 2CD9A 3HDQA 4MVJM 2ZVQX 1QF9A 4LJAA 1I0ZA 2JKYA 4TRMA 2O3UA 1C3XA 3PRJA 1JPNA 1NNSA 5T4EA 1B74A 1LK5A 3ENVA 3ISTA 2GR9A 5IJZA 4BFLA 3W5SA 1X80B 2JLCA 3EGDB 5T57A 1SULA 2YYZA 1FP4A 4BB6A 1KQNA 3LUCA 2H54A 3G02A 4Q48A 4A6XA 5FOSA 2FR8C 3F71A 1E2NA 5E0OA 4IJ5A 1BTOA 4IS2A 1CQZA 1TIPA 2EZTA 1LF5A 3TM5A 1YZNA 4BE4A 3BKXA 2VHYA 1F38A 3BD8A 5HILA 1H2YA 2PMCA 5K03A 2P2ZA 1U3TA 1FA9A 2FN4A 2BMVA 1L8LA 4LY0A 4DBZA 1AB5A 4FBLA 4MPJA 2AJBA 3GNQA 1YHQF 1GDDA 3EVNA 5G0VA 4G2NA 5IC4A 3LDGA 5FWYB 1Y8QB 4WZZA 1TJPB 3QUBA 4QUIA 5D3QA 2QX8A 4G09A 1R1MA 1W42A 2VCEA 1RHRA 4HADA 4F5EA 4RYLA 3BZUA 4UHJA 2GK6A 2RGEA 5D8DA 5IJ0A 3WGQA 4YRNA 1G18A 4J7AA 4JYPA 1DXQA 1WCXA 1K6EA 3F0EA 3M6XA 3RYFA 3SYMA 3BDVA 3C7CB 4KLCA 1O77A 3LC0A 4UEWA 5FOWA 3TZBA 4B71A 3AFOA 3R6LA 2RE8A 2CSLA 5H82A 2NU8A 1XAIA 4WMLA 1VLJA 3PFBA 5JASA 1OLSB 1BXKA 4JU9A 4KO8A 3TIVA 1M2GA 4W6ZA 1NC1A 3SMQA 2Y1CA 3CVJA 2P69A 4LZAA 5GINC 1MOPA 4YRTA 1FDRA 1J23A 4LQ4A 4ZHQF 1VQOF 4GE0A 4CR7A 4ZCRA 4ENWA 2W2MA 1EXMA 3L8MA 1W5AA 2OLKA 1OVGA 5BV8A 3SBOA 1YL6A 1WO8A 1FFHA 2RDMA 1WTCA 2J8ZA 3HVJA 3NIFB 4RVNA 4WKOA 3MK31 5MHTA 4KACA 4PBSA 1S2LA 1BCRB 4OXRA 5IN4A 2G9QA 3IDOA 3L0SA 1QD9A 3HSKA 2X4DA 1LQUA 1ODSA 2EDAA 3RK4A 1IG3A 1Q1AA 2HJHA 4UEQA 2OYCA 2VZEA 2X3UA 5CDFE 4JSRA 3ZCXA 1FNSA 5KCZA 3WRXC 1R3DA 3EUWA 2D8MA 3DO6A 3LWNA 1I9GA 2AUMA 2F64A 4P83A 1GCGA 1U43A 3EF3A 1B8NA 2QX7A 3QEOA 1FLAA 2X4LA 1TW2A 4JR1A 4XJSA 4I1UA 1Y9AA 5H4GA 2XZOA 3KCNA 1MO3A 2IF0A 1M6WA 1L5FA 3ZLUA 2I7DA 5D7BA 5K3SA 4A26A 5AVSA 1QGOA 1X1AA 1L5KA 2VSNA 1WW3A 3TEFA 2J5XA 1YS7A 4CM4B 3HS3A 5F98A 3F0DA 1TQ6A 2VPTA 5HS4A 1WIWA 3LNTA 5GIOC 1EG2A 1FS5A 2E3JA 3B1YA 1A9ZA 1ODLA 3MINB 3VJLA 3WAGA 1ZJWA 2W7TA 1VQ1A 4CTKA 2B4RO 2C5HA 2Z0MA 2R00A 2OUIA 3VDMA 1P5RA 1YJ8A 4LWZA 3AQIA 4P4NA 3P5BA 2QXTA 3KZVA 4RSHA 4BE7B 1RRKA 3SQLA 5ILQA 3MTIA 1SC6A 4KE7A 3H2KA 3WDKA 2OV2A 1JEYB 4EGSA 3PZRA 2R5FA 2C9BA 1NBOA 5B4UA 4J0FA 3I3SR 2WWYA 2J9XB 1L0BA 3ABSB 1M7HA 1KK3A 3HU5A 3LVRE 3V33A 2ZIXA 1VHJA 4RE6A 1SCJA 3BBLA 1DMSA 4AY3A 2I4LA 2BFNA 3S4YA 4NMWA 5CFNA 1E2MA 2NUPB 1P0IA 1NG9A 1WCWA 4R2IA 3VSDA 2JC3A 1R00A 3BG5A 1MOSA 2LXNA 3GRRA 3TQFA 5A2QA 3L46A 2X40A 4WN9A 4YJGA 2MSKA 3ZKWB 5KCMA 4C78A 4FCVA 1RLMA 4NABA 1AUVA 5ALQA 5CW2A 3V7WA 1JP7A 1KJWA 2J0UB 5C8YB 5ECDA 3OPYB 4IIXA 2P8JA 2V7QA 3TMKA 4WI1A 5JXIA 3L2OB 4OFBA 4WXHA 4BPBA 1MPXA 2AA3A 1KAGA 5CDYA 3UXMA 2GAAA 1TKBA 2GBLA 2GZSA 2M6SA 3N2ZB 4LJ9A 3WYDA 4EDHA 1YZQA 1JE0A 3G0DA 2VDLB 1E7QA 4IFBA 3BF8A 4R3WA 5TSDA 3RC8A 4MA4A 1FDSA 4OMFG 1U0LA 3FW1A 2G28A 1X3LA 4PIMA 221PA 2IXFA 3TTTA 5LP6A 2VSQA 1GZ5A 3AESB 2HS0A 2GKOA 2AFIB 4O4IA 4MI1A 4I4LA 4EKGA 4PG8A 1XUOA 3FI0A 3DBRA 4IQ4A 4FFRA 3VDRA 2G63A 3O91A 4C4YA 2ZT6A 4M60A 1S2IA 2AR9A 4RYDA 3U4QB 2C2XA 1XRGA 4KQGA 4BV8A 1O6FA 3NB0A 4P98A 1N33B 2GLXA 1RRFA 4NJOA 4NHOA 5GONA 1CQXA 4DE5A 4KDEA 1T1GA 2O3QA 4KRGA 4OUDB 2B4QA 4HDMB 1U1IA 1YXMA 4RK0A 2JFXA 3ITDA 3RS4A 2J6IA 1DTWA 4YC7A 5KNCH 1M2EA 3MCWA 3G2OA 3IAAA 1NR7A 4MIYA 4TLMB 1CDZA 3ZQ6A 3GJYA 3NONA 4BKUA 4B3MB 3PJFA 1T8PA 1BGXT 2X6TA 3Q9NA 2VJOA 5ALYA 2BHNA 1ULSA 1Q0PA 3W8FA 1ZEMA 4UASA 1XRRA 4EI2A 2HMVA 1VJGA 1KMHA 3EVDA 4OYRA 2DZDA 2IIVA 2P9EA 4C03A 2FPGA 4F9TA 4D4HA 2HDOA 3JQFC 3ASUA 4DMHA 5A62A 2X5OA 1CSEE 3ON1A 1S2DA 1XNHA 2IWRA 1NONA 1JE1A 1GFZA 1TMOA 3I42A 1DUSA 2ZDGA 4GYYA 4NAUA 4ONEA 5FPSA 2WD8A 4E1BA 3PICA 4BX8A 5HYVA 4NOKA 1QFZA 4JP8A 3ZY2A 2A57A 1Q0QA 4MS3B 2V7WA 4TL9A 4ES6A 3V4DA 3DWIA 4WK4B 2GARA 3PWKA 1E3LA 5AKEA 2OOKA 2P2YA 1ATZA 2YJ3A 5HMMA 4DMLA 4JUDX 3DOUA 4BNGA 1PGOA 2AI1A 3IV9A 2HYDA 4OQZA 3PJEA 4BAUA 3ETCA 1U9IA 2IL1A 2D1YA 4YDHB 3VNUA 2UVDA 1V8ZA 2JIRA 3QKWA 3RBXA 5D2CA 3ZD8A 4RD2A 5K0ZA 2P2DA 1SOWA 4HGZA 1MHTA 3VPXA 2XA9A 1XPJA 1KFBB 2O2XA 4MYUA 1N77A 1H9CA 4L6AA 3IS3A 2Q0SA 1OBFO 2BZ1A 1C7IA 3OA2A 4A6DA 2W8BC 4U8HA 5C51B 1H2BA 2J5QA 4P8RA 5ARBA 1IHOA 2IH4A 1Z0ZA 1OX6A 3ZV3A 3J81k 4RWZA 3JVHA 3QP9A 4RD6A 4YUWA 2G6BA 2CDCA 4NESA 3HZRA 1F12A 2HA5A 2QEQA 2XUOA 1LDNA 1GPH1 2QRHA 4ZCIA 4TLLB 2VHQA 3JALA 1GNTA 4OXQA 4DHEA 3C39A 4IUCS 1XEWY 2FWJA 2VQSA 1EVEA 4EFDA 1TVEA 3JR7A 1UAAA 3LI2A 1YASA 2PFKA 2NZ2A 5JMPA 4F60A 1T8TA 1M6EX 1FUEA 2IEGA 3BWEA 1RYHA 5HPYB 1H85A 2HI0A 2JD1A 2CFCA 4PZ9A 3A4LA 1L5RA 4FHCA 4ASUA 2P6UA 3GYBA 4OAQA 3CUKA 4PLPA 1ESCA 1QZXA 1LX6A 1LLDA 3EOAI 4ZMBA 3A9CA 2ZZNA 4DMMA 5AKIA 1Y9DA 4J6EA 1QIGA 3E4CA 3I2KA 2OBXA 2RGBA 3TZQA 2ZWVA 3JQ7A 3MUNA 3BIFA 4BLPA 3AG6A 3FTQA 5DP2A 1JTVA 2Z09A 1RVV1 1SKQA 4UVDA 3HU2A 3QITA 1X7XA 1YH3A 2AI3A 1PUJA 3A2LA 3HBNA 1DCMA 1BMDA 4M3NA 3O85A 3ROZA 3IYLW 3DT8A 2DC1A 2OESA 3E8MA 4HWGA 4EVIA 1MX9A 4G0UA 2Q5IA 1QVWA 2H1HA 4BQPA 4B3CA 4G4VA 1Q91A 3KYJB 5TVKA 5K6RA 2C7PA 3H16A 4RHFA 5C37A 4FCWA 4JV5B 4B4KA 3FFWA 1F06A 2JASA 1T2UA 1DP4A 3AF5A 3NG1A 5DSZA 5T6BA 5C3MA 5K6TA 4Q9IA 2ZS8A 5A7FA 4ZQIA 4AM8A 1ZPDA 2W2KA 4XDYA 2UXDB 5JJKA 2IGTA 2VS1A 1U1EA 2EG9A 4JLSA 2QRJA 2F2TA 3UFBA 2NQ8A 3FTDA 5DYTA 1PYOA 1JKXA 1IEWA 5K0BA 3GLFA 3WB2A 1OLUA 2DQ4A 3RSSA 2WMOB 1Z6TA 2C5SA 1O9GA 5CT9A 4ZVVA 4CNQA 4Q3LA 1RT9A 3QE2A 3EXFA 1OZ0A 2LP4Y 2JLAA 5B3KA 3ID6C 4M55A 1YZUA 3DS8A 2L26A 2GJSA 3RF6A 1L7DA 1DT5A 3HM9A 3MPOA 3O9MA 4M9UA 1TMYA 3O3NB 1G5TA 3W6OA 2JJMA 1A5AB 1DG3A 4LCEA 3CE6A 5EOVA 5JCXA 2NZYA 4LY6A 2ODQA 3N0VA 4HRYA 2Z6UA 1F4LA 1MUUA 1G21E 4ZPJA 3DAGA 2LRHA 3T95A 1LNSA 1U2DC 4JLVA 4NE2A 5GQSA 4FQ5A 3NGLA 2IYNA 1EUYA 2OB1A 2PX4A 4OIMA 4TTRA 5KKNB 2AKEA 3UWSA 3W90A 2FCRA 1PLJA 1DB3A 4UM8B 3SVTA 1GU7A 3EE6A 1VSQA 5JUWA 2R86A 2WIJA 3M33A 1Y5IA 1X8XA 5CJ2A 5COBA 3EQ6A 1DEOA 2D3WA 4U6QA 3PE6A 3A1VA 4QPZA 4MR8A 4P1ZA 3DONA 1HTTA 4EHHA 4IV0A 3VPCA 2P2SA 3LW8A 1ZN2A 1XLUA 4GPAA 4EQ6B 2CL6X 1J06A 1BROA 4EMUA 3PG5A 4OQ4A 1ULAA 1MZPA 5EKXA 3JQ6A 3QWAA 5EAIA 3ZCQA 1O6ZA 3OLYA 4OFXA 3DV9A 2H57A 3GCXA 3ETEA 2FSVA 3I4CA 3KJIA 3S68A 4O1IA 4OP2A 3H84A 4BO2A 5C8YF 1C3EA 1GSOA 1NI4A 3AF4A 4RH0A 4WLOA 1MJGA 2I7CA 1QQ6A 4BKMA 3RFUA 2DJIA 2HEGA 4KE6A 3AVVA 2JCGA 3OY2A 1KE1A 1E2EA 1SA0A 2DT4A 2BCEA 2JLWA 1WPGA 4N49A 4Y2TA 1NC3A 1VA5A 5FLYA 1MA0A 2WHRA 3QVTA 1K8YB 1MC4A 4QM6A 1OFUA 3Q15C 2OTJF 1AKNA 4JLWA 4D44A 2CV2A 1W87A 4JQZA 1MRNA 1U4OA 3H65A 1X87A 5F23A 1M2FA 2X1HA 5DBEX 1CIVA 3CXUA 3CMAF 1T3TA 1UINA 4MV9A 2HJSA 2NO7A 4QFDA 4PLGA 4MRPA 4IEIA 5AUNB 5ES3A 4RCZA 1K4YA 3JWGA 1IY2A 5AVVA 4MRMA 3S28A 2NUAA 1WE2A 2I78A 2XDWA 3N6RA 2G76A 3PFKA 4L0DA 4RIEA 4ECAA 2HMUA 5GP1A 3VHXB 1FW6A 2EJVA 4HLNA 2AG6A 1CFZA 1YRBA 1TUBB 1YE5A 4CU2A 5FP0A 5AYVA 3ZHCA 3PGJA 3KR2A 1EIWA 2Z6VA 4EPRA 1XJ0A 2GZHA 1G5RA 1QLWA 4EUHA 3GUYA 4ZRMA 4RK7A 3ERCA 3OCWA 3VJRA 2QSJA 1A8QA 1HURA 4RENA 3RYCA 4HJRA 5IZCA 3L7QA 1VZ3A 5EIWA 4TKUB 3G1UA 3M81A 4RIIA 1VBKA 1UJ5A 2WYVA 3F5FA 1DIHA 3FFTA 5L8VA 1NW6A 2Q4EA 1RWNA 1Y7TA 2V7EA 4ZAFA 3VJKA 3KFXA 5BO5A 1DQPA 2JD0A 2EQAA 2WSSD 1UBEA 5JCZA 1XN4A 3CWCA 4JNKA 4HGPA 4OA8A 2XUZA 4PG6A 4B5KA 3TZHA 3B51X 5AK3A 2JGEA 1W5EA 2PTGA 1O3YA 1PYGA 2J08A 3KX2A 2HRDA 1UOOA 2PTHA 4BP9A 3H5AA 3F6SA 4HKTA 1H2FA 1CLEA 1Z4JA 5M3BA 4EHNA 3V7QA 4YQZA 4KXLA 3EIOA 2IYYA 1TPZA 2Q49A 3AFIA 3FCUB 4BU0A 3OTWA 1HLGA 3H8VA 4LSWA 4K6MA 3L05A 4ASUD 3HB9A 5BV7A 1QX4A 1YVPA 4DMFA 4X7RA 5D1HA 3EWNA 3V7YA 1ULTA 1KOGA 3CZQA 1ZGCA 2PWBA 1M1YB 3ZDXB 3SMVA 4DSUA 4EGCB 1T3GA 5CLHA 3FYUA 3DDWA 3UG6A 2QM7A 3JTEA 4I0WB 1M2OB 3ANSA 2V9ZA 4F1JA 5BYAA 4GDFA 1H1DA 4RCVA 2WIGA 2K87A 4XQCA 3PUHA 4ZVQA 3MJVA 3OW2F 1CDDA 4LYDA 2UZ1B 2M6KA 1GZ7A 3OLWA 2XGJA 1CD5A 4POOA 2XMPA 3UOGA 3WWDA 1AKQA 2Q9AA 2E4AA 2ZDHA 4LUCA 5A7HA 1IZZA 3PUZA 1KPGA 3HA7A 3HXQA 4EF4A 2YQ5A 4J9VA 3G5AA 4LSGA 1ZCAA 1R5JA 4MJLA 3DVSX 3GZNB 2F8SA 5DGHA 2DFDA 3EFOA 4FBGA 1NXQA 4RTNA 5LMUB 1BJTA 4HLDA 4II7A 3I39X 4QOGA 2X77A 2C2WA 4EAQA 3RSFA 3T38A 4F21A 4ZHQA 4INOA 4U8GA 1UEJA 4L6IA 3PVSA 5DM4A 3K5HA 1MKYA 1Q7GA 3U09A 2VR1A 2ZYRA 4QO7A 2IPLA 1DCKA 2IXGA 2J5RA 4D45A 5L40A 2TSYB 2DLCX 1NTRA 1RM5A 2C3PA 4BOYA 5CU7A 4K8OA 2YMPA 3CN9A 1P6UA 3ZG6A 2J6CA 4RA9A 6NULA 2ZYSA 2ZBFA 3OC0A 3R3JA 1M10A 2XPCA 3GD7A 3ON5A 1MP0A 4X7MA 3WGHA 4LBVA 3VSCA 3FPSA 2HK8A 3H7AA 2PDAA 4HGQA 1C7JA 1WXDA 3OZUA 4FILA 3O82A 4OOFA 2G7ZA 4PPNA 3UJAA 1C9NA 2CSXA 1Y4DE 1GPWB 1AGYA 3WIVA 2BFOA 1BHSA 5FUVA 3SYLA 1Z8DA 4QJIA 3AB7A 2I8CA 1R4AA 4BFCA 3WGGA 1HQKA 1FZTA 3LHFA 4GECA 3RSOA 1E3QA 1YB7A 1TJ4A 2J3LA 4MUXA 4ATNA 2QQGA 1O94A 4CE6A 3K9QO 3PHGA 4EHIA 2C31A 2QUKA 2PXXA 2UVPB 2Z2YA 3KHSA 4H4DA 3TF5A 3LQFA 4ZQEA 4FD2A 1ZU5A 1X7ZB 4KNWA 2AJ8A 1Z7WA 4OI4A 3LDFA 5HMLA 1I1HA 4NU5A 4N3BA 4GAEA 5JD5A 1D03A 3HA3A 2DG2A 1Y82A 2CEKA 3BTUA 1UM9B 4R4JA 4S0XA 5AI9A 3ZZNA 1KYYA 2NSYA 3K1AB 3R6TA 3IUJA 3CF4G 3PYLA 4NENB 1GT91 2ZSJA 4DR2B 3IEQA 4JVNA 2RAUA 4XDGA 3CLTC 2PZBA 3R5HA 3GHYA 2QRNA 2Z3VA 4GP6A 3CE9A 3K6JA 5LMNB 1OTYA 1T0HB 1Q22A 3LGSA 3ENZA 1AMUA 4E15A 3CZRA 1PDOA 3WP1B 2ZR7A 2JNWA 1UT8A 3T06B 3U0BA 1ML4A 1IK4A 5HQTA 3KEQA 4M53A 1EJ2A 1YZVA 3I6QA 4PHFA 1IXZA 4IVQA 1MT3A 3R75A 2R8EA 4WK6A 3EZGA 4DPMA 2DSNA 2HQ1A 1YMUA 3VI3B 4KJXA 4YFYA 3DW1X 1ISHA 3O95A 4BNIA 4HSEA 2FUG1 4Q9DA 4F4DA 5KTKA 2AW3A 1RAGA 3KOZA 4EJMA 3K2XA 4UFPA 2BLLA 2P7IA 1J09A 1TLFA 4DCTA 4EGJA 3R0PA 1X1QA 1ZRMA 2CHQA 4UCXA 5CTAA 4D3YA 6GPBA 4BFVA 3LVQE 4X1YB 1PJ2A 2BO1A 3K0HA 3KTDA 4ITUA 3TZKA 3AI3A 4RZ2A 3H2SA 5F7ZA 2H1LA 4HDKA 1SEVA 4KRFA 2JI4A 5KIAA 2WIFA 1E1DA 1T9GS 3E1GA 2O0KA 1CF2O 4Y6GB 3V8QA 3ENWA 3PQ4A 1Q2UA 2I6TA 3AY7A 2HUPA 1G20E 4FFBA 3AIMA 4W5RA 4BN5A 5JSUA 4HDCA 3GJ5A 5BUQA 1BAPA 2QX4A 2C88A 1UOPA 3I2FA 2GVDC 2IK8A 2ZJ7A 5J40A 1XRPA 3C8MA 4KXVA 1CVRA 1WMBA 2PY6A 4LMBA 1ADFA 1US8B 3PQ3A 5DZSA 5AOAA 3UWMA 2R8ZA 3GLUA 3I55F 4P35A 4RVFA 1WM1A 1IEVA 2IQ5A 2VWGA 1XZHA 4ND6A 4R5HA 3TDNA 4O4HF 2QQ0A 4ZEVA 1SCUB 4YCJA 4C7XA 3PEWA 3D7LA 1J21A 1EZ4A 1PFKA 3H17A 5B7NA 2CLSA 3E23A 2D2VA 3EVZA 5IJXA 2NU9B 2W2OA 4A2PA 5B7PA 1DU4A 3AEQB 3KDSE 4E1AA 5IULC 1P7VA 1H2AS 1Z5ZA 2V0CA 2Y1GA 3KYIB 5LDGA 1R10A 4L2IB 1TUGA 2GEVA 3KUUA 1N2XA 4PRLA 5FR2A 3EFEA 2ZJAA 3M9LA 2AS0A 3JQEA 4FVTA 4JT8A 3I6MA 1KQSF 4PSVA 5H0IA 5KQSA 5HWEA 3HCDA 1PS8A 3W8NA 1W49A 3ZE2B 1EFPA 2GNPA 1YIJF 5AKGA 2QMQA 2GEBA 2WF8A 2P0YA 3CYPB 1IHXA 3AR5A 3QE4A 4NYJQ 4YROA 2GB4A 3FZQA 3WLLA 3ZU5A 2MINA 3M4JA 2FW1A 4Q6BA 2DHQA 4FT2A 3HUFA 2RGAA 3I7TA 1V5WA 4IKOA 1ZL2A 2CHTA 2RH4A 1XRNA 2W48A 4QPDA 1RM0A 1WQ4A 1J49A 1SVIA 2GN1A 1B16A 4H77A 2F43B 2WTNA 4RC9A 4AJ4A 5CVVA 4F3NA 2GBCA 4DLYA 4A6EA 5CAEB 3UHAA 1ZVKA 2QAIA 2HRRA 3U3DA 4EKDA 5K05A 2R7NA 1CJCA 1CQJA 2WLSA 3FSEA 1LGYA 4GMFA 2I76A 1MVOA 2B7LA 2O0HA 3KQHA 4DJEC 2AJCA 3RARA 2GRAA 4BX3A 3LZDA 4QJ5A 4RELA 1E2FA 1QYIA 3O4JA 3HKBA 5J58A 4MS4B 3ZK7A 1A1SA 2WWXA 2JFFA 3BWMA 2Q1SA 3PRKE 4RJJA 3CW8X 4L4YA 5E7QA 2O8EB 4BCDA 3VKVA 1HO3A 1O4VA 4EUEA 3D8RA 4Z9BA 3F49S 1AF4A 2FFRA 2CW4A 1JIKA 1QYVA 5FUXA 3EX7C 3E6AA 3X2EA 2A5LA 4DCCA 4Q7LA 5AESA 3WWYA 1QHNA 2YHBA 1E7RA 5KOJA 3QU7A 3ROXA 4I4CA 3F8WA 4FOSA 1C9EA 4HK4A 1X39A 2W6CX 4S2UA 2SKEA 3WTBA 3SIPA 1PSZA 3V7NA 2BFMA 1N6RA 1ZSVA 4V0MA 4O4JA 3CB4A 5FJ4C 3W4JA 1VKOA 1PG5A 3AZPA 2D0OB 3WNCA 1NMXA 1E1KA 2BBTA 4Y0NA 4RV9A 1X9GA 4R1OA 5FTMA 2GXUA 3QHQA 2RI6A 3FNEA 3IBFA 3D6JA 2ZI5A 3B1JA 4DLTA 1E0AA 2MT9A 3WISA 2B4TO 3QXGA 3KLMX 4HWSA 1N9ZA 2HIAA 4LE0A 4YK7A 3THWA 4A36A 1ADJA 5M34A 3PQ8A 1SCNE 1MB9A 4FX5A 2HXGA 3RTAA 3T34A 4HOYA 1XRJA 3DDSA 4RSGA 1ICEA 2OHVA 4DLWA 1QGAA 4ENQA 1GVHA 1EP9A 2EGUA 3IJRA 4ISBA 1GKUB 1Z82A 1PS0A 3D6FA 3DXZA 4M46A 1CUDA 4LHZA 1EB9A 2RIPA 1NXOA 2P90A 4C0XA 1DOHA 3GGDA 2J59A 2RAFA 5J1TB 2HQOA 2X4GA 3TLGB 4I2VA 4D9BA 2OFOA 3GMDA 5DXFA 4LN1A 3UW3A 1RPNA 4ARUA 2XEDA 2P3SA 1X74A 3ECCA 1E4EA 3THXA 4QE3A 4JI7B 2FSIA 4JI0B 1NY6A 1IZ0A 3QF4B 5FOXA 1FRFS 2J3KA 4QGGA 5JFGA 4YR7A 5B7GA 3LKBA 1RM3A 2JGAA 3LHIA 2EIHA 3VR6A 3DF7A 2GESA 3U56A 1X9HA 3EH2A 5DHPA 2NQ2C 1IY9A 2FFAA 2PJZA 2VFAA 4YRCA 3ELWA 2Y4OA 4CR6A 1VI6A 4QODA 1FL9A 1CUVA 1Q95A 2F7SA 3FVTA 4CLHA 5JWRA 2RC6A 3BGWA 2IYWA 3PPYA 5LNK6 5ALIA 1FY2A 4ENUA 1EUQA 1KZ7B 1ACJA 4EEZA 1UZLA 5G40A 3KB1A 5F9FA 3I52A 4KMOA 2ZB3A 4UKDA 1HE5A 3C1TA 2P5TB 2BGLA 1OI4A 3DBIA 4PZYA 1N1MA 3ZQJA 1CQIA 3PX3A 3K9FC 3IA7A 3MHTA 4G01B 4YS6A 4BKRA 4D9KA 4DJDC 3VA7A 2ISSD 3L0IB 3NWJA 1L7RA 3A58B 4EZBA 2VEOA 5IAGA 5FBVB 2IS4A 4R9UC 1XCGB 1PD0A 6YASA 4RGQA 3GA7A 5DLPA 3OE5A 3AKEA 1K63A 3M8KA 4RQOA 3B12A 4IXMA 2ANCA 4ZVTA 2HRUA 1AXRA 4XB6B 1ZJYA 3DE3X 4F8EA 4ENSA 4ZMRA 4YMTA 5FWXA 1KK1A 4YEDA 4KLNA 3FCAA 1DKPA 2A35A 1ZM9A 3DO5A 4IJVA 1J2YA 2DUWA 4FQ8A 5KS2A 4KMMA 3LF1A 3RJMA 3BHMA 3IAHA 4C0QC 5NULA 4WASA 3H18A 4R1PA 1GGNA 1C1DA 2I66A 4QSHA 1VGQA 5EZSA 4KR2A 4R40A 1HK7A 1LV8A 1JHYA 1BXZA 2EYQA 4ZO6A 2WD9A 1KEUA 2G06A 3P9KA 3TLAA 2RKBA 4DB4A 1Z38A 3R77A 2WHPA 1S0UA 1T6ZA 1O97C 2R1TB 2JAHA 5CIWA 4IDBA 4MWTA 5J59A 1X0XA 3VC7A 3QPVA 4DYVA 1GTRA 4FHGA 2VUHB 3FMPB 1P80A 4NC9A 3TEMA 1ESNA 1BGVA 1KYVA 3BD9A 3BB4A 3LCCA 5F64A 1QOZA 4OI1A 1ATIA 1Y3AA 1ZK4A 3QUAA 1NNLA 4PY2A 1M6VB 3R3UA 4B0PA 3AL0C 1HF3A 1SWWA 1SVUA 1JDBB 2W98A 3ML1A 4L22A 3K0AA 1GXSA 4IVNA 1SELA 4L9RA 1FJHA 3PNQA 5E1BA 4ZAZA 4NCBA 1G8SA 3Q3HA 5DDIP 1XVUA 2D0PB 5AKKA 4C2TA 3D9QX 2OQ2A 2O8FB 4PRKA 1JTFA 2VF2A 4TUYA 4J43A 3EDQA 5ALEA 2FSHA 3UPDA 2ZT5A 4KGXA 5A6SB 2CLFB 4DCMA 1VXRA 1PWYE 1SXJB 2GN4A 5BWLA 4M9ZA 1C0LA 3U7IA 3X1ZA 5MGNA 1NXPA 2QZSA 4RTQA 4WKNA 4YAUA 2B9EA 1Q44A 2IV3A 2ZYUX 3RTCA 3RUPA 4AN4A 3IJPA 5IG2A 3L93A 4TMVA 2WKWA 3SSOA 4CMIA 1T29A 4O2BF 3I0ZA 2A1UB 1GZDA 1OV4A 4G26A 2O2DA 4X84A 3V1UA 3GRCA 1SVLA 2X7HA 4RTKA 4OHVA 2CKDA 3HSSA 1BE0A 4EEXA 3INTA 1Q20A 2O14A 1UFVA 1W30A 3N8HA 4WZ6A 3H6GA 5EN4A 4L8YA 1CR4A 5JPIA 4CLOB 1E2DA 4KWTA 2BM8A 3S70A 5EB1B 1AY0A 3P8ZA 3CNBA 1H5NA 3D3WB 3U4AA 2CFIA 3WA6A 3QVUA 1SBCA 2BGJA 5KZMB 2L82A 2G9RA 2JEYA 3SR4A 4N48A 4LOJA 3R6DA 3RLIA 1A9TA 4LSZA 4KITB 1CZKA 3OZXA 3EBOA 4O4LF 4CQMA 4D6YA 1JHAA 4IZHA 1RAEA 2C7QA 3AVQA 4L57A 2OV8A 4PC7A 1JQKA 1HT3A 3TNJA 4V03A 3TRFA 1GDTA 2IIQA 1ZCZA 4M21A 4Y2XA 2BFDA 2R87A 3FSGD 3GRVA 2HPAA 2XCQA 1ARZA 5AUOB 1IWPB 4TQ9A 3UT6A 1TCCA 3FFMA 5KKAA 2WOOA 3M4ZA 2YN2A 2QRZA 4RK1A 4D8UA 4ZK6A 1UXOA 3ABOB 4N5NA 1EQUA 1IHYA 2X3YA 4Q5IA 2VWHA 1P2DA 3G68A 5FUQA 4FGLA 3KT0A 2MYNA 2G71A 3NBFA 4J6FA 1DKNA 1AKYA 2EWCA 3DBOB 4WADA 4YAKA 3GA5A 4FN5A 2ZRLA 3OZIA 2QAGC 2UDPA 2YXEA 2P1DA 1YRHA 3IR6A 4AMUA 4Z4CA 4KPYA 5MF6A 2DTEA 5FQNA 1NQWA 2GAJA 4C0LA 4B76A 5E6SB 1BE6A 1SG6A 1WY5A 4UNPA 1OX4A 2Y99A 1GTG1 5JR3A 3HXOA 1C3JA 1EP2B 2BRUC 3FR8A 3QYFA 3LT2A 4LJ7A 1EBBA 2XYGA 4K9RA 1RAFA 2IYSA 4NBTA 4AJ1A 4K0KB 1RDFA 5KHAA 3D8TA 2CJXA 3DDCA 1BEZA 1DVRA 3B3JA 3QLVA 5KSYA 3DAOA 5DM1A 5LZ5A 4E5VA 3Q5EA 3S1AB 2VTBB 2O59A 3DPUA 3K9BA 4JJ4A 3VR6D 3E7DA 4GZMA 5C1DA 1M74A 1A1VA 3AY3A 3CEAA 2PRYA 4N6GA 1YGPA 2H7XA 4AO7A 2GEUA 2V9PA 1M6NA 3WMFA 3LKVA 4G3XA 3C5HA 1XHFA 3QEBZ 3EIXA 4ZOLA 1H7MA 1J1ZA 1Q7CA 2C4TA 3EN0A 5DYNA 2C2GA 3NOXA 1RWKA 4RFSA 5FF9A 3UJ7A 3OKFA 2GILA 4MV0A 4OBEA 4L9AA 3AB3A 3A4IA 4MRSA 1BKSB 4GP9A 2ZRNA 1DXHA 3ACDA 3KT8A 4ZVUA 2WSMA 4KAXA 3ZH9B 4UBJA 1PQYA 2ZBGA 2UYGA 4EHLA 1NN5A 1F1JA 1K8RA 4X00A 5LDDC 1L7AA 3HL4A 1XI2A 3IEKA 5JC8A 2AE2A 3GNSA 3QFRA 2ZBQA 1V1MA 1M1NA 3GRUA 4QYMA 1C4OA 2WSIA 4W5HA 3RLFA 2GTHA 2VDRB 3BS4A 3CRMA 4TV8A 3N2KB 2OXIA 2R25B 1GOTA 4N5DA 1X7WB 3GRFA 2FETA 1U0OC 1PZNA 2W90A 5L3ZA 3UHFA 3DAFA 4DJ5X 2JIQA 2KTVA 2V4UA 4KX5A 3ZWYA 5J2TB 5A3JA 1UJ4A 3NWPA 4DR5B 1JDVA 1E5VA 1TKCA 2PSSA 2ZUVA 3A11A 1DAPA 4M4SA 3WRYA 3U3KA 4ZK2A 1NN0A 2OP0A 3FDXA 2F3UA 3E15A 1W52X 4R2JA 1E6WA 3GLQA 3H04A 3ZCPA 2EV9A 4NLLA 4DUPA 4MLCA 3VGJA 4HP8A 4MI9A 1L7BA 2RGGA 3IP9A 4PSUA 2ZQ5A 4UE3S 4PZEA 3G0OA 1GWNA 1BS2A 3LV8A 1XZLA 5K3EA 3ZJYA 1R0RE 2FNAA 2Y0BA 1CJSA 2NXEA 3HCAA 4JKOA 5HDBB 3FZYA 1N7HA 5DT9A 1ZM7A 4YDQA 3CINA 2I1LA 1JIVA 2Y27A 4GKKB 2J0QA 3K70D 1JU3A 4XWWA 2MSDB 3PEUA 3ESRA 1PTKA 3NM4A 1ZK0A 4FDMA 1YU9A 4XFJA 2QBYB 3WLRA 3VU3A 2RHDA 3VOSA 3DE0X 5HA5A 3FE2A 4QBFA 3EG5A 3VV3A 3T9CA 3EPRA 4K9KA 4PN3A 4UMVA 3CF2A 4RKFA 2Z56A 3D8BA 4HLUC 4YV7A 2Q2QA 5C1PA 1A82A 1YB2A 2YY7A 4HNQA 3DHVA 3K8QA 2B8EA 2WIAA 3DPIA 4QQNA 4UHBA 3N7AA 3TWOA 1N8RH 1KJQA 1L5SA 1RI5A 4Z0TA 2PUTA 4WNCA 3HJBA 1MAWA 4MGIR 5I9MA 1ISJA 1M0SA 4TVKA 1KDVA 3WNBA 2CMGA 4US1R 1RWOA 1KS9A 3ZC3A 3GUUA 2R79A 4OMCA 3IBSA 4S24A 3MHPA 1R8YA 4KREA 2RGNA 3D4LA 3CG6A 2I2XB 3LRPA 4FR0A 1KOJA 5FXMA 1RCFA 4DLBA 4Z3OA 4TWIA 1EB8A 4R68A 3USES 4XW2A 1Z6ZA 2PX5A 1Z4MA 4LNUB 2GXQA 3TS1A 1VMKA 2IKSA 4HQ0A 3LDUA 3UMFA 3GT3A 2HPVA 4K6OA 4OO3A 5EC8A 5A1JA 1KO8A 2HN9A 3P26A 3P9YA 2HSZA 4Y0AA 1UT6A 1EWRA 3Q7QA 1UPBA 1T4GA 2QYOA 1WNTA 2WUDA 3OONA 2XLBA 3NTVA 1OWMA 2GCOA 4FOOA 2H92A 3U4HA 4EG3A 3KOMA 3V2GA 2FLWA 4Q47A 1YNOA 3I61A 4CQMD 1E5XA 1ABEA 1NMEA 3FPJA 4B47A 1I7PA 2ZZKA 2J85A 3FLEA 3E0QA 1CJTC 4DRXB 2O6LA 4H1VA 4ESVA 4G0WA 3K6SB 3EZXA 1NW5A 3KVNA 3EEOA 4J2OA 1D6MA 1JB9A 3I64A 3MLAA 3IRVA 4FYMA 4LEIA 4PYKA 2G9VA 1R6BX 3OCUA 3GFPA 5G53C 4B48A 4DQDA 4Z49A 4WZAA 4CKZA 5JARA 2X2OA 1XHLA 2Q2VA 2NPOA 2WB4A 1VMDA 5FULA 3ENQA 4N54A 3EQ7A 1JHPA 4PLWA 4TSKA 4WZBB 3ZXIA 1UDWA 5EQTA 3K14A 3LZ6A 1NMZA 1N92A 2V8OA 3PF8A 1ZY2A 4G5YA 3F0FA 1S89A 2IYZA 3E27A 1IPHA 4MUEA 1UQTA 4NFSA 4CKEB 3T3HA 4IUYA 1HSOA 2WUGA 5LDHA 1B26A 4Q4AA 4HAYA 1JHOA 2CVOA 1G66A 2P0AA 5AIBA 2Y71A 2OECA 5ITVA 3PNPA 3CEJA 2DTXA 4AK9A 1Z28A 2YR0A 2Z4SA 4Q4JA 1W6UA 1XTTA 2Z1DA 2QX9A 5KEIA 1N34B 2CMKA 3ODGA 3X1MA 2AK2A 2HK7A 1WHTB 4EKNB 3B7WA 1VCIA 2YHSA 2Q3JA 3C6QA 4WK0B 2G17A 4RHYA 2XGOA 3HH8A 1J9ZA 1Z88A 2ZW9A 3GMTA 3IP6A 4QUHA 1PGQA 1SK8A 3K9WA 3O6VA 1HFWA 4R1QA 3ROQA 2X9VA 2XKKA 4C2UA 2A9RA 2Y0EA 3Q3CA 1U0EA 3VR4A 1XNJA 2BR4A 2FFBA 5F12A 4BLUA 3NDPA 3AL3A 3HB4X 5KTOA 1O0CA 4HGYA 1UFOA 1ODJA 2ENUA 3U44B 4GYJA 3GEMA 2BFCB 5CYOA 1KOLA 1YVRA 2JGMA 3UOAB 4CQNA 4QQRA 3QXXA 4IILA 5DK6A 3HJCA 1DIGA 1XXHB 4L73A 8MHTA 3H1GA 1HX7A 5E7MA 4ARVA 3CA8A 2UUPA 1P2GA 3PEEA 4IIFA 4CN9A 5BQ5A 4JENA 1B23P 3HAXD 4FGWA 2EFJA 2WRZA 3NNSA 1A5ZA 4N9WA 3HUTA 1VPTA 5IDVA 4M37A 2IUEA 2B7BA 3WHLA 4R8VA 4RTJA 2EW2A 3Q9SA 1WSDA 1NA5A 5THQA 1XDBA 4GI3A 2FW0A 1XXLA 2I29A 3DLAA 4NATA 4C9BA 4EHDA 1KO4A 2FEWB 3KJHA 3MTDA 5I8ZA 3C16C 3CUSA 3PDCA 1LPOA 4Q4HA 1TK9A 2QQEA 2WG0A 4H7KA 2KI5A 3T8YA 1EVQA 4GD3Q 1DFIA 3MEQA 4PCAA 3WLTA 3OO0A 1ESEA 1EZ1A 1LLFA 1QH8A 4H6XA 5IVIA 3B9BA 1SVWA 1ZC4A 3ITEA 3AW9A 3TOCA 2AVNA 4CDRA 5F4BA 2X5NA 2OGTA 1SQGA 4MKIA 1KJIA 1PL7A 2FW9A 2WU8A 3G2KA 4LZLA 4NJMA 3H2GA 5GJVC 1QR6A 1SD1A 3L92A 2CNLA 3PI6A 4JUBA 3O8RA 1VTKA 2ZR8A 4QNRA 5FA6A 3C97A 2FWAA 5LLDA 4WTOA 5AK0A 1NXXA 1GG8A 1UZAA 2ACEA 2OYRA 1X1EA 4JI5B 2CW5A 4ETMA 2ECPA 2P1RA 1YQGA 2O52A 2UUOA 3C1UA 3ODPA 2NN3C 3QV2A 4KR0A 2OGWA 4MCAA 4CFSA 4CEHA 2VT6A 4NU8X 1GRVA 4KH1A 5JZVA 2QGNA 3GYGA 3T35A 2UZIR 4MI3A 4MR9A 1Z5OA 3TTXA 1SUCA 1H8HA 5IC6A 4BO5A 1H1LB 1K3FA 4HMOA 4QDKA 1CNEA 2AFHB 1I24A 2F3QA 4LWPA 4PICA 3GPCA 4XD2A 2AD1A 4V02A 4WACA 2IX3A 1EK5A 4KX3A 3MUOA 3TLYA 3WB0A 2Z9DA 2XWQA 1R5OA 3VPGA 3LPMA 4W9RA 2A84A 1P60A 3FHJA 3F6MA 3FZNA 3Q8XB 3IKFA 1GQSA 1NOIA 2RHHA 1F9EA 4RPIA 2EU8A 1BW9A 2ZITA 3BHNA 2NO5A 1LPBB 2QRMA 3ZWDA 4RTLA 5LWHA 4UM9B 4MIOA 1L4MA 1I3CA 1NY5A 3EXHC 2VN8A 4V3CA 5I4BA 1I4EB 1VBNA 1DBIA 1JDJA 4DA6A 4LDPA 3AOEC 2QSYA 4A82A 1XCPA 2IWHA 5EKDA 1I80A 2XWPA 3P94A 1TA0A 3V1MA 4DSOA 3QPDA 4QYIB 3N8KA 3RADC 3SBXA 5C53B 3HO8A 4WESB 4ARZB 2W6NA 3BK7A 3ZD9A 4NCXA 2C5BA 3QFTA 3WYFA 4ZEOA 5EKSA 5I7WA 2DULA 4YMVA 1BEUB 1VRWA 1XQ6A 4XVHA 5DULA 1TT7A 4AG6A 4PSCA 4C07A 2M32A 4JX9A 1W2WB 2BM0A 3C4QA 1AVTA 4NWIA 4RZUA 4U6SA 3JYOA 3TOZA 5IABA 3RREA 2TECE 1FSFA 3IPXA 4HNVA 5K09A 4P36A 1U5BB 1WF6A 3CSUA 3KKZA 3NT5A 4JK3A 5CXXA 4CM9D 1H66A 1FYXA 1QVVA 3MGBA 3JQQA 4B8YA 3OQPA 1H0KA 2CJPA 2GEFA 3ME5A 4L5IA 3W5CA 4ITVA 2VTKA 1KEVA 1CEQA 5ENDA 1W36D 1J9EA 2OTLF 2RHLA 5K3CA 4LRYA 3A2KA 2H07A 4MB6A 5JNSA 2RH5A 3NM5A 4HGOA 4BMNA 2B6HA 3I76A 2FZ4A 3VNQA 3RRYA 1D1TA 1UADA 4CHGA 3JZDA 2IBTA 4YHBA 2ICAA 1I2CA 1N0UA 4H7FA 3QEMA 5ER9A 1AZSC 1H2XA 3VYTC 1PKXA 1XTSA 1MPTA 2JCSA 3NGXA 4KXQA 4YGXB 4ZYXA 5K0TA 3ZY5A 3PGKA 4GOLD 4MLDA 4PAMA 3UBMA 3IEUA 4YYEA 1SK9A 2VKTA 3D0RA 2D2EA 3S99A 3WB9A 4ZTUB 4IZ6A 1NI3A 3OO1A 2WTBA 5EINA 3E9DA 1TQDA 4D81A 2B35A 2HU2A 3DA8A 3IO5A 2GK7A 3L6RA 1Q0TA 5TQ2A 3GXOA 3GA0A 4XX1A 1GQYA 4GSKA 1EFKA 2JBAB 1F51E 3ZIAA 2NZ8A 1D07A 1JHRA 4CIXA 4EJ0A 2AOVA 3FNIA 3KOYA 4C7OB 4NBVA 3FPKA 4YMIA 1V25A 3L6UA 3L4JA 5H9WA 3UWDA 3ZLTA 4HNTA 4ARCA 1ZW6A 3EY4A 5J4VA 2WKPA 1LEHA 1MD9A 3V00A 4EG5A 5A0TA 3LYBA 4TL8A 1VJRA 3LHKA 4I6JA 4PQYA 1BFKA 1T6YA 2BBOA 5CTJA 3KJXA 2PMEA 5JQWA 2A2ZA 2Q1XA 2AOUB 1G9XA 1GIAA 2JA1A 2ZREA 5DNDA 3HA2A 4RDCA 1DKLA 1V6CA 2C61A 3QUCA 5DN6A 4YAWA 2VDWA 4DA7A 3VR4D 1AUPA 3D5QA 3GEPA 4IJMA 1UMBB 2GF2A 1P5FA 2XE4A 1CYEA 3LT4A 3LD9A 2ABWA 4JLNA 5REQB 3WHPA 3KLPX 2B1QA 4AYXA 1YSCA 2C8KA 4FMCB 3M6VA 2IVFA 1XJ5A 3Q8WA 4IOMA 3UKDA 1T0KB 5EHIA 4B80A 3NT2A 3OU2A 2VDMB 1GNSA 3ZE6A 1H0SA 2XMQA 3FHCB 4MUJA 5TY0A 3W79A 3IQEA 3HL0A 5HGXA 1KP9A 4NCKA 3BT7A 3P2JA 4V0NA 1RQGA 3ZTWA 4TYNA 2FMUA 5KTPA 3M82A 3QX7A 1NJ1A 4FLEA 1E92A 1K4MA 1JA1A 1K5GA 2Q3LA 1XZMA 5HQ3A 4ZV4A 3J7AC 1RPTA 4QVKA 4WKCA 2H1OA 1GADO 4GC9A 5BVGA 1Y9ZA 3ITNA 1IBMB 3HO1A 3D0OA 4YN3A 3LL4A 4YCNA 2I6UA 1T35A 2PL5A 4C7BA 5KSWB 1NR5A 4Q3DA 3TJMA 3GVCA 4NK5A 1Z0UA 2V7XA 1JG6A 2G3YA 2ODNA 3PE4A 4OYHA 5K3BA 4H3KB 5DISB 4IIYA 5EE0A 3Q40A 3DEHA 3N3AC 4YBRA 5YASA 5BN4B 1FIUA 4MVJF 3GV0A 1ORIA 3KPVA 5JSHA 2WIBA 1EKXA 3KQSA 2FR1A 4N3NA 1XZJA 3JPYA 5KNDH 3SPXA 2CL5A 3GH1A 4FI3C 2AHOA 1IBCA 4QOEA 1YKSA 2PMFA 4UU8A 3C3YA 3OWHA 1YFJA 3IT2A 3EFHA 4I6EA 4EY3A 1ML3A 2DBQA 2QZPA 1A76A 3I0NA 3ORSA 4YQEA 5HRUA 1T0UA 3TGPA 1RYDA 1Z0JA 3PJRA 5AJHA 3RFXA 2PE5A 4DRZA 1H8HD 4QOJA 1WMDA 3VSAA 2JEZA 5CIYA 3U4DA 1IN1A 3GT0A 3SDBA 4RGYA 4IHJB 1TADA 2Q1TA 2YQZA 4RZ3A 3BERA 4ENPA 5K0SA 2PX8A 1M1YE 2IHBA 2GYWA 1AUQA 4MJ3A 1UDRA 2VH1A 2FP4B 2PBLA 2ZBPA 3HWUA 1T8YA 1E4OA 1W0KA 2FLKA 1H9AA 1G8GA 2CNDA 2N48A 1V8BA 3M3DA 5AW8A 2O50A 3ZNOA 1ES9A 4OY3A 1W1UA 5ICSA 1UJBA 3A06A 1PF7E 1IEXA 1W48A 4O2RA 1GKIA 3KFVA 1GCUA 2F3PA 2UYKA 2OV1A 2XWJI 4A92A 3W5DA 2D59A 1Z62A 3IIEA 3ZDYB 3V3KA 4OXXA 4CMGA 3GU3A 4OK3A 1XPRA 2UVQA 4TLEA 4EW2A 5EJAA 1U31A 4GT1A 4XM2A 5TARA 1M76A 1NVVQ 3H1BA 3IGFA 4GVXA 4YUYA 1B76A 1KYWA 4EB6B 1BX1A 2RARA 3NC1C 4HDOB 1A3CA 2ID9A 3AUUA 1ECPA 3FKJA 3ZW9A 4MEAA 1ZNQO 3EQ8A 5FPPA 4Z1OA 5HIKA 3T1HB 2VT7A 3AKZA 1R6UA 2V54A 4IGEA 4ZRDA 4J4TA 3LX8A 4D8YA 2HTEA 5D85A 2YFYA 2X0IA 1KFJB 4Z8YA 2G5TA 5KQMA 1ZS9A 5IPFA 2IEBA 4N9QA 1PSDA 5BR8B 5AW7A 1WXQA 3ELDA 4BIIA 4JVMA 3KB8A 3Q2IA 4QYTA 3VAAA 5J4HA 3E3AA 1H48A 3WL3A 1TECE 5C7IO 1YO6A 2G09A 2O1SA 1CW2B 1VJ1A 2HBZA 1AKEA 2XOXA 3AWIA 3VMFB 1TJ5A 1E9DA 5EP1A 1ZXLA 3OZWA 4OI0A 1UDCA 1IMOA 1U1CA 3NEAA 4DV7B 4KL8S 1CS0A 1X8LA 2NYVA 4NV0A 3ZDFA 3T61A 3L0ZA 3A8TA 2Q99A 1GVNB 1M3SA 3RK0A 1EE1A 3QU5A 3WOVA 1FP7A 4OLJA 3Q0IA 3EW9A 3WGMA 4FYXA 3R7NA 3ZCRA 2O8CB 4JGIA 1AKWA 3SG0A 1XZIA 2Q9UA 1NX6A 1JALA 4LX8A 3IAS1 3PKJA 2PLAA 1XZDA 2PWPA 3SHOA 3GOHA 4HRAA 2XW6A 1E6CA 1L1EA 1INLA 5HBRA 1M8FA 1M34B 3CZPA 3GF4A 1QH1A 2RMKA 3MQWA 3FMFA 3KOOA 1JFVA 2W6PA 3CQ9A 4J49A 4TLCA 5J5AA 3BYZA 1WDWB 1TCBA 1EE2A 3ZIAD 3VIUA 1X2BA 2OB2A 3I2YX 3NJ4A 4M0DA 4GOMD 1R0BA 2A7QA 3SE0A 1H94A 1VLMA 1J2TA 1CVIA 2GM4A 3KTAB 1ADYA 3GFVA 2VNJA 3G82C 3IP7A 2RBKA 3MBIA 3VNBA 2B1IA 2P3OA 1ORHA 5TJHA 2WZBA 1U2ZA 3QPWA 1G59A 1YR6A 4F5WA 2CLDX 2RKWA 4MQMA 4D3ZA 3VI6A 1ZKMA 3T7DA 5EPEA 3QK7A 5ADWA 2PGJA 1SVSA 3P52A 3DZCA 1UK7A 2FPXA 5HM6A 4TWBA 4OLHA 5BQXA 4JASB 5GIPE 4JFAA 4UBNA 3KYBA 2DY0A 5K3AA 5A5DA 4HNHA 1H2WA 1YR2A 2PZGA 4AAYA 2XOKA 1EFVB 1E6KA 2PKRA 4RNCA 3GEDA 1HEYA 1MQAA 3RWBA 4MHSA 4QEZA 5EE3A 9ATCA 1JILA 1X13A 1ZH8A 2PBFA 3OPNA 5MN5A 2HDNB 3DT9A 1N3YA 3C8HA 2QYSA 5AW1A 5LPNA 3BFVA 2J9FB 1BIFA 1ELOA 3BJZA 4MO9A 1WUJS 4JBYA 5DF1A 1ZIOA 4F96A 2X0RA 1NVAA 4HUJA 1DUIA 4CMKA 1QQTA 2R6JA 1SZCA 2DWOA 3TQCA 4F56A 1NBIA 2GF9A 4AIRA 4BNJA 1JQ5A 3PLAE 3KP1A 1QQ7A 4G4WA 1UBMS 1CDEA 5E6UA 4IH1A 4BRUA 3GLHA 4D0RA 4JQOA 1G2QA 3P0FA 4FOLA 4I9FA 2AIRA 3CKLA 3AC0A 4URUR 2HS3A 1KVTA 2R4QA 3KZXA 4DVJA 3RRXA 4DR3B 1EX7A 1TZJA 4WBSA 5G4UC 1YIDA 3GLGB 1Z8FA 3D3JA 2Y9MB 4MWDA 2VA8A 5SYMA 4IR7A 4YGYA 5JY1A 1VHTA 1OYOA 3DTVB 1K2WA 121PA 1CZHA 2CNBA 4MYDA 2F1JA 2X8AA 2QL9A 3ASZA 2IPOA 2OHOA 1OFTA 2O7NA 3TVTA 5BW5A 2JFVA 1ZOPA 5LYJF 4RPLA 1RAIA 5I45A 1A9XA 4I81A 3RVMA 3I9OA 3JWEA 4X85A 3VAZA 1LSJA 2Y2VA 3O9ZA 5LQDA 4N1AA 3CCRF 2OO5A 1NTOA 4DG8A 3AUXA 1G98A 1GKYA 5A4JA 2XNHA 2NQTA 3SR0A 3CKMA 4I55B 1XEFA 4H7JA 4NECA 4U9IS 4IOJA 4X8OA 3STVA 3VHRA 1OR8A 4PN7A 1ISRA 3SJAA 2HO4A 3RUFA 3VPDA 2GJKA 4HY3A 2NU6A 4AQ7A 5HGJA 4KPUB 5H5JA 3TFOA 5HZMA 4AT1A 1U9JA 3R1IA 2OQRA 3O2NA 5HKLA 3V8PA 1IQPA 3TD3A 2Z1FA 1JLSA 2H4XA 1BCSB 3KVRA 4J0KA 4P6VF 2BI7A 5DI3A 1V1JA 1L5LA 4RF2A 1DV2A 1W0KD 1ZGGA 5TEWA 3ZQKA 3E8SA 5JD3A 4DREA 2C1XA 5ALUA 1NBHA 2AN1A 1Y6QA 2PR2A 4PVDA 3AVXA 1GUZA 1NXTA 3GRAA 5E9JA 3QJ5A 5K99A 3QFHA 2V0NA 1MLDA 1V7ZA 4RHUA 4LHYA 3NHLA 1A7UA 3DD5A 3KE8A 3SLRA 3VO8A 3PLRA 3BM5A 4Z2YA 2PKQP 3KT3A 4UNRA 2R2AA 2VYNA 2X4IA 3EWSA 4LDAA 2HMWA 4KTVE 3ZVKA 3AHEA 1C1XB 3OQIA 2J46A 2FSGA 1YFLA 4LJ5A 2GLZA 1OV6A 3B20A 2X1MA 4M0LA 1P9LA 3C14C 1ISGA 2O0LA 3WKBA 1EA7A 4LYJA 4ZGGA 5JJCA 4YREA 5JVDB 2H17A 3CNQS 2QTGA 3SZOA 3HB1A 3Q41A 3KPJA 2BKAA 3CH4B 4J16A 2O57A 3MC1A 4BTEA 4NWOB 2OCDA 2POQX 1P5ZB 4DWWA 1KR5A 4DIKA 1EAMA 2ZP1A 3ZE1B 3K12A 2VYQA 3JRNA 4GMXA 3OBBA 3OF2A 4LC9A 4PO8A 3EEFA 1ZJ6A 2WNHA 3GUHA 3ORYA 3UN1A 5FA5A 4YTEA 1RYYA 2VKQA 1TZCA 2IV7A 3KUCA 3BQMB 2ONKA 3QFCA 4ZT2A 4ZHSA 4PIVA 5A4FS 1O96B 2ATXA 5B5SA 1EGQA 1NUPA 4O6VA 2D13A 4HVLA 2A4KA 2DPGA 1U2PA 3KOWA 4BNMA 3PNOA 1PGPA 3SHWA 2EW8A 4YCCA 3RU2A 3LKZA 1Y34E 5KYUA 4TVSA 2BP7A 1BYIA 1ZKDA 4KXWA 1CLUA 4I3GA 1WZEA 4YP7A 3GLGA 1OI3A 2QGZA 1UJCA 1CN7A 2NW6A 1XZKA 3CRNA 3R6WA 4QFMA 3U7EB 2FPKA 1P3DA 4RZHA 3JQGB 4C08A 3T7KA 2QSZA 1A9YA 1PCXA 1Z5WA 3WLQA 1QHHB 1UP7A 2H6EA 3GFTA 2DWQA 5AHKA 4FEEA 5HY4A 4XARA 3UK1A 1X1DA 1OYVA 5C46F 1YJ9F 3KQTA 1DV1A 4QT4A 1VE7A 1X80A 1NW4A 3FNHA 3L6BA 4TVBA 3EGDA 1Q6YA 3KUKA 2VHZA 4XIYA 4A5OA 3TUZC 1Y4ZA 4CGYA 2FEAA 2PQ6A 4F4HA 3FA2A 2GBPA 3G4SF 5DRTA 2JK0A 2OP1A 2Y0PA 3P9QA 2JGLA 4QTUB 4EP1A 4RQBA 4NZYA 1ZD5A 2WYIA 2VLIA 3B6ZA 1BRTA 5DCVA 4A0RA 2F17A 2P4UA 4TT3A 1DAEA 2LBWA 3LQ1A 2ERYA 3TLKA 4HNUA 3DL4A 2QMUA 4LKOA 1YCGA 3OJFA 1Z75A 4FDVA 2XOKD 1Y6ZA 1UDXA 4G63A 1M7GA 3B6KA 4X0EA 3RU3A 4ARAA 2L42A 4P81A 2WDZA 2XMCA 3OF3A 1EUDB 3RFTA 4EA8A 5A04A 2WR8A 3FB1A 2QJOA 1OASA 1U4NA 3G1TA 4S12A 5FWYA 1E6LA 1Y8QA 3VKFA 2NT3A 1NE2A 3FOCA 5I3CA 2QROA 1AK9A 2W2VA 4JT4A 2PS1A 1MJHA 1RHQA 3HJFA 1JUDA 2YHUA 3AHFA 1BDJA 2P5UA 3IQDB 2BFWA 5DO9A 4E6PA 2X3FA 1ILEA 4V0LA 3RNOA 1EM8B 4XDHA 1Q1BA 1U9IC 4RKWA 1JIXA 2CE2X 4ZCMA 1Q1GA 5I7SA 3H1AA 1OLSA 1QU2A 4XB1A 2EBWA 2E4XA 3V4ZA 2QZJA 3UQYS 2QG6A 3AM4A 2V5VA 3LXUX 2PRSA 1KO5A 2EJWA 4QVIA 3JASA 2EAUA 3P20A 5CT5A 1XE3A 4AW9A 4YT2A 5JY6A 1YACA 5C8VA 3M6WA 1JQ3A 3CUWA 1P44A 2RHJA 1QHEA 2P9FA 2PKYX 3NJRA 4EB8A 4R83A 1OZHA 2YC2C 5ERYA 3U48A 4FC6A 1L8XA 4MUBA 3IDQA 1QFSA 1SKAA 1C14A 2PU5A 3P32A 2NACA 2PWYA 4I9GA 5D3MB 4ZKEA 5TS3A 4O63O 3TNYA 1W96A 3KSZO 4Q82A 4MP3A 1BCRA 4MUGA 2AC4A 4NZPA 3CUEF 4TZTA 3O84A 2ESRA 3FWKA 1KZ4A 3SX4A 5KQLA 3OZTA 4EPXA 5HHTA 1HRKA 4KG7A 2IP1A 2C1ZA 3K35A 2R4UA 4RU1A 2P40A 4L3WA 3KFLA 1QR2A 5CFOA 1GDHA 1XD2B 4MUNA 2W2LA 3VCZA 4UQOA 3P45A 4RPHA 4CIAA 1I2ZA 3U3ZA 3S02A 3G71F 2GO7A 5H70A 3T5TA 2X0EA 1K6IA 4C0SA 4LJSA 2OTCA 4RQTA 4B4OA 5IRCD 4IINA 1SUDA 3DULA 2FMFA 2C4NA 5PNTA 4C21A 4YJ3F 1R27A 5B3LA 3JZFA 1K1EA 3LUFA 3BH0A 3BQNB 4HVCA 4CM4A 1IXSB 2JAXA 4PNEA 3MINA 3T3NA 1QQBA 1Y6GA 4TXLA 3EPHA 1P9NA 2DFKB 1E66A 3GCGA 5DEIA 4WBNB 1DDGA 1GT6A 1U7HA 3SF8B 2GD6A 3NHFA 1PSWA 1LJ8A 2VYND 3AEUA 1XTUA 2WM8A 4IG9A 1U8CB 1JEYA 1YJWF 3A28A 3TZEA 1RZRD 4G5FA 1P0FA 1XU4A 3U7QB 3LP5A 3QEJA 4EGFA 1NUTA 2BWJA 2PRKA 2ZKLA 3GEHA 5IC5A 1D2GA 1ZYUA 2G77B 4ML3A 5JXJA 3ZGXA 5IAAA 4PTYA 4TL7A 2QQFA 2OZPA 2X22A 5BQ3A 3VZRA 3LFUA 2NUPA 2W8BB 3SZLA 2FUNB 3NP9A 4HEHA 3BSFA 1CUSA 4BEBA 2IXTA 2OG1A 4PCLA 1Q15A 4UAGA 3TD6A 4KO3S 1O8CA 4L16A 4ND1A 1VPDA 2ZODA 4RIGA 4Y2RA 1K88A 1HZZA 5C8YA 4XGIA 3OPYA 3HEMA 1SB8A 4M87A 1RLGA 1PBNA 2XUKA 5IKXA 4DLPA 4RXMA 4DARA 4DDMA 2IZ0A 4LZWA 4QFCA 1JQBA 1EUCB 3BFPA 3QNMA 2WG2A 1UUFA 4IVPA 2QRKA 4BECA 1XLTA 1ZIYA 2ONJA 3DLTA 3STUA 5JCJD 4DXHA 3G0IA 3HYCA 2DQKA 5CHYA 1OBVA 7REQB 3GELA 2MDTA 4OMDA 1ID1A 1J0XO 3E9CA 4KI7A 2XCSB 3EZFA 3QVVA 5FCDA 1QCZA 1JEAA 1V2GA 3AESA 4NPAA 3QG1A 4EHBA 2AFIA 2HP0B 4BLRA 5KYWB 5DRYA 3NATA 2ZJ3A 3ZTYA 3HR7A 3VH1A 3W78A 3EGXB 2QR3A 5JD6A 4DXDA 4MAMA 3CLRC 4ZVSA 3GP8A 4G0PA 3U4QA 3GIWA 4KFUA 3ZDEA 5CH3A 2H4FA 4LRUA 3DV0B 1JIIA 1XCLA 3I23A 3U0VA 5KQPA 3I12A 3OJLA 3QLEA 3W9BA 1W5TA 2GZRA 3ANLA 4FHFA 4BVQA 1DJNA 3TPCA 1VYTA 4QBIA 3PPIA 3GBPA 1H0HA 1UR5A 4OUDA 1MNAA 5IS2A 4GI1A 2CDBA 3L4SO 1AMNA 5JHHB 3T7TA 1WBJB 3LC1O 3N9IA 5C7LO 3N39C 5JNTA 1Q3HA 3GYQA 1A5SB 3RSGA 2VJAA 2QU8A 1N2HA 3RASA 4XQGA 3T7IA 2R11A 4AJNA 1ZUWA 2FVXA 2H1IA 2GPJA 5I9NA 1G6HA 4YLGA 2IHYA 1KARA 4C8IA 1ZIXA 3A1EA 4LBWA 2BFEA 4AJLA 2QVZX 1T1RA 2YV3A 3I72A 3W5VA 3M6LA 3SBEA 2RK3A 1F2DA 2GA8A 2Z58A 5DW0A 1QSGA 4D92A 5HJ5A 2ZB7A 5LFAA 4MUFA 4HAVA 1FDIA 3ZNQA 5KJ6A 1GRNA 1U8XX 4OIFA 1E5LA 3Q7IA 1WUKS 3REFA 3IHLA 4BB0A 4NBWA 3O7WA 3EQZA 2Q27A 4WOPA 3M84A 1QGED 4UVIA 4MS3A 5H4HA 5BR7A 4J0CA 3LCMA 1VFNA 3HYLA 1JSRA 4ZCSA 2ZYDA 3FVRA 2QPLA 2ZJZA 4GWGA 3BE4A 4EI7A 3QOYA 4L5CA 4XYMA 1NFFA 1WVMA 1ZITA 4R9SA 3RT9A 4QX6A 4TMKA 4D3XA 4DT1B 4BC0A 1PWEA 3FDJA 3LDAA 1ESZA 3PTLA 3KQKA 4NXNB 1U3UA 1MG0A 1TZ2A 1COMA 1I14A 1QYDA 2LWIA 2J1LA 3D43A 4L0MA 4OSOA 1G7SA 1ZJ4A 4TTJA 5FLEX 4ZEWA 5A4IS 1BJKA 1NJGA 1V11B 3VZQA 3GEBA 4O8ZA 2XT9A 1SHJA 2VNHA 3C7TA 4ZAXA 5KMGB 3I45A 4P7KA 5JYCA 3E18A 3RRJA 1DC3A 4K81B 4EENA 3Q8MA 3WC4A 3OCYA 4E5UA 3VNVA 1P7ZA 2I34A 4CLRB 5CCBA 5HR5A 4QXQA 5IARA 3P5SA 2RB5A 3OIGA 1AKRA 4J75A 4R1UA 1YCHA 2QRLA 1JWLA 2QYTA 4KIFA 3WLOA 3EC2A 3OTIA 3UAZA 3WPXA 1G42A 6CHYA 3N53A 4ER6A 2B4YA 1Y8AA 2JGDB 3RAPR 3NTQA 3F5DA 1NBMA 3QQPA 2X8LA 1S01A 2UYOA 2GQ0A 1KO7A 2W2LD 1WA5A 4QNNA 4BWVA 4BQEA 4EL0A 4CQLA 1UP4A 5L3VA 4C8EA 3KJJA 3V34A 2NM0A 4YAIA 1CETA 1I7LA 3OURA 5F1OA 1MG5A 2BEKA 3AH8A 2P4SA 2D2IA 3A37A 4IIUA 4BWGA 2C92A 3G9ZA 1Z5VA 2V55B 2LD4A 2VVTA 3TCKA 5LC1A 2E1PA 2OFXA 1FS6A 1QK3A 3OMLA 4TMTA 3WKCA 4DLNA 3KTOA 3OESA 1PL0A 8LDHA 3NK6A 1RRGA 1VSBA 4ZO4A 5KYGA 1OC4A 1DNPA 2DH5A 1NP6A 2ZRKA 3OZGA 4R01A 4WJKB 3TGWA 4B85A 3N2LA 4MW1A 1D0SA 2WZQA 5EI5A 1GLVA 3IPLA 2HWKA 4XTRA 4OYLA 3TH5A 3FJ1A 2ZYVX 2PL3A 3ZNNA 2BEVB 3MCVA 4BGVA 3FYTA 4MXDA 1ACMA 3M5CA 5DFAA 4ZJZA 4CR8A 2BFFA 3IHWA 4EARA 2XMGA 4BMYA 2NUTB 4OTZA 1FUYB 2QZ9A 3SXPA 1BG6A 1WOYA 1VHAA 4EA6A 5K8CA 5AXCA 1NIPA 2AZXA 2VAWA 2ODEA 2OHXA 5GM1A 4NBSA 2QW8A 3BCUA 3T6KA 5CITA 3OCZA 2YJZA 4C4TA 2IAFA 1FXUA 3AJ8A 3F7MA 4F84A 2GLTA 1NNUA 3JYQA 1O5IA 2GRUA 3CVOA 2AI2A 4ZT6A 3ZJTA 2J5KA 4U2GA 4B79A 4ZKDA 3F1LA 3GLSA 4G0XA 3ELBA 3UGQA 5HQJA 4F2HA 4LI0A 1Z8NA 1JKJB 3RRMA 2W2QA 5FBLB 3WP0A 1WVIA 3I8OA 4DQLA 4WVLA 4E2ZA 4GVLA 3TG2A 2PKCA 1QVAA 3FUTA 4CTMA 2W0MA 3OPQA 3HY3A 1QHGA 2JD2A 2QN6A 2VK2A 4UBMA 3TBFA 3D31A 2C7BA 1Y7IA 1XDGA 3L77A 1J22A 2WM3A 1IC6A 2B25A 4OUKX 4QXPA 5D51S 1K97A 1W3EX 1RP7A 2YYYA 4OB7A 2W4QA 2ZYWX 4OL0A 3Q0TA 3ZWOA 4HJXA 5DLEA 4ISCA 3T15A 1GEGA 4NCNA 3HPRA 3THRA 5EVCA 3FFAA 5A06A 2DFPA 1JQJC 3JYPA 1CDOA 1LI7A 1W4AA 3P10A 2ECFA 2X19A 1IDOA 5HZKA 1G8KA 1E7KA 2Q5OA 3LY8A 4O8CA 3PNVA 1EWYA 5EXSA 5C1IA 1T2DA 3IT3A 5LU8A 2D8AA 2AG8A 2ATCA 1C8KA 2GCIA 4M1QA 4EMBA 4PO1A 2IY9A 4DLLA 3ZU6A 9GPBA 4N76A 3CRRA 3UQZA 1KFEB 5JWHA 2CDNA 4EUFA 2PKXA 2J7KA 3ZIUA 3L79A 4V2UA 3C4VA 4CKBB 3TD4A 1JZTA 3KAKA 3UMVA 4JT2A 3MCAA 1LFDB 1Z3CA 2LUOA 3H2BA 3H99A 3FJYA 5BUSA 4CIWA 3CCJF 5EJIA 3S1LA 3TYXA 3KQWA 2BCJQ 4B40A 2PXCA 3GLIB 4JH0A 4DPKA 4O2AB 3CR7A 2PMPA 2BR3A 3VAYA 1PG0A 1TEVA 5I8PA 4LZZA 1XEAA 4IDFA 3NWBA 3G5UA 1YDEA 4E51A 3MWFA 2CXQA 3N2GB 3WX0A 4BT2A 4A0SA 7YASA 3UPTA 2O8DB 2RHCA 4G2TA 3BGDA 4OQEA 3H87A 4Z8XA 4I50B 1L5NA 3LT1A 2X7JA 5LYYA 3X1WA 5JS1A 4CT5A 3JWPA 3E81A 4N47A 4DR4B 4E7PA 1EDOA 5F76A 3CXCF 3GWZA 4X1IA 1DTEA 2ZI7A 2B1GA 4YAJA 4ZVNA 5A1TA 3RQIA 1LSUA 3TBHA 3KJQA 2GOYA 4W7SA 1N8KA 3FLMA 3HE3A 3ZWCA 4IDNA 4XZ3A 2MTBA 1DKQA 3RR2A 3X2SA 1R4ZA 3QBTA 4OCZA 2EARA 4J0EA 1DAKA 3DE4X 3EZ7A 1WXIA 1T15A 2XGGA 1JLKA 3MJFA 1H2EA 4N8DA 3PIDA 2YC4C 2XA2A 5EKTA 5BW4A 4S04A 16PKA 1FXWA 3CMEF 3SYNA 3B2QA 4Z5XA 2PAFA 1K75A 3PUIA 4V0KA 1JIQA 1T9DA 2Z30A 2FFHA 1U6JA 2ZJ6A 3NRJA 4PM4A 2W2NA 1DWOA 4ZCPA 1TUBA 4ZYWA 1AOXA 4C14A 2DECA 5JAUA 3A0RB 4LHVA 5HZGA 1JYFA 2BTEA 4GKAA 4GX5A 3GHZA 1YB5A 4GI7A 3QJYA 1ZIDA 3WZLA 2HWWA 4FYKA 5EP2A 3I83A 2NTEA 3MWKA 4R0VA 1U94A 4TKUA 2OHFA 5DTQA 5G4KB 5TQVA 1V9LA 4IM7A 1YONA 2V7BA 3AI2A 1CU1A 2XI4A 1TW3A 1AO3A 1U0TA 3WLMA 4O4IF 4M1MA 4WLEA 3Q87B 4CM8B 3PXUA 4MCIA 3UAGA 5EB0A 2XTNA 4BNNA 3GPIA 1FFSA 3LC7O 1Z12A 4IX9A 1JMYA 1QNFA 3KR1A 5FH9A 1NBMD 5JLJA 3R8XA 4Z7NB 1U40A 2BFAA 1N25A 2A4MA 4B3FX 4CHTA 4NBRA 1GSHA 5GONF 4EUSA 1AN0A 5KWJA 1ONSA 2VJQA 4LOHA 4BNDB 3EAGA 5JD4A 3UA3A 3G0HA 1B15A 4ZDJA 3L5OA 5EXPA 2BI4A 4H7IA 4EB3A 1A7AA 1L1QA 3IP5A 1B8UA 1XZPA 4OK5A 4BZZA 1KORA 3W77A 1JG3A 1M5RA 4HFJA 5HVNA 4H0FA 3O0DA 3KQLA 1WCIB 1IVYA 2QN1A 1AV7A 3C6XA 1LWOA 1Z4OA 2QM8A 1O9HA 4NH4A 4EECA 3T7RA 1M2OA 2Q4RA 3ZHVA 1LLUA 1JFTA 2I6QA 1T8RA 4MICA 3ETGA 1YUNA 3BILA 3QYAA 2UZ1A 1Q0RA 2YIDA 3T7JA 3PQFA 3KAJA 3UMCA 3O26A 3NCTA 1Z17A 2VO1A 3U61B 3OWXA 4MWCA 1K9MH 1Z2CA 4DCOA 4P3OA 1YTLA 5BURA 2CNNA 4WA7A 4X94A 3IUEA 1TA9A 1W35A 1DQYA 3PSHA 4JBHA 3F3SA 4AZWA 4OV6B 3BYQA 3OOYA 5FOTA 3NOOA 1JDSA 5J4LA 2EHDA 3GZNA 3KEFA 2JI9A 5FLKA 3OCXA 2P62A 1KI7A 4O29A 3DZDA 1GO1A 3VYRB 4R0MA 2DCMA 2EP7A 4QC2A 3H9EO 5ALGA 1P2VA 2OO3A 1LA2A 1POWA 3E84A 1Z33A 1DBFA 1HOTA 4GBGA 1F6DA 4RVDA 3ZVLA 1RQRA 3LUDA 4YWHA 2XZDA 2JJ1D 1ZMRA 4Z7JA 2ZPTX 5BQPA 3TNLA 5GTDA 3KZCA 5HFAA 5E4FA 1UFYA 5BMOA 1P33A 1N2CE 5F2NA 1JQLB 2Y6UA 2IEDA 4QNMA 1MX3A 4F7DA 3JW8A 2VXCA 1OYWA 1U6IA 5FIUA 1K0UA 3C3KA 1WDTA 1KDYA 5BR4A 1IXKA 4E09A 3VU0A 4PU0A 1KC3A 4K2HA 1M8PA 2XKBA 4EX6A 3FYSA 4AWXA 2PUAA 1B8VA 1IV3A 2H4ZA 3KM0A 1A4UA 3L7BA 2ZI6A 4OB6A 1WUIS 4KQ2A 4Y1EA 1E6UA 4A91A 4CKWB 4FB4A 5CRIA 3DF9A 1U3DA 3BAFA 3IALA 4WW0A 4ZDIA 3U0OA 4DKXA 5BP7A 4GOOD 4EKIA 1SHZA 1SUEA 1BA3A 3FVVA 2UVPA 1XZ8A 2HSEA 3I8SA 5DCUA 4UTVA 4LF4B 2JIZA 1X7ZA 4GGOA 3UICA 5JROA 1Z9BA 4TKVB 1IN7A 3K7EA 3UAWA 1P1RA 2HCTA 3ANMA 4UEOA 5EL0A 3G0BA 5TV2A 1H6BA 3L6EA 2JIOA 4HH4A 5IVDA 1S2MA 3HGTA 1AM4D 5HUQA 1IJKA 1BQ4A 1UM9A 4PEVA 3OQOA 1B7GO 1PWHA 3K1AA 4NENA 1DDOA 4CMHA 4ABTA 4P22A 2GI4A 1NQVA 3RRFA 1S3FA 3D00A 4H7HA 2C5FA 1ORTA 4Q34A 4IDPA 4L4SA 4RF3A 3DAPA 3NHYA 4U7WA 2HJ9A 2I7TA 1F5NA 1HE1C 1Z06A 2PJDA 4BUZA 1TD9A 3PJGA 3Q3VA 5DV9A 4B3HA 3LLUA 5FUMA 4UUPA 5HJ2A 3D6UA 3FM9A 1IONA 2GZ3A 1YFZA 1OH6A 2AZTA 1FEZA 1GZHB 1Q0LA 5E1OA 3DXFA 3DUFB 4R51A 4MWSA 1F5SA 5DBIA 3GW8A 2XSZD 3QVJA 3P27A 2QE6A 1P91A 1JF8A 2BF4A 2VPQA 3I1YA 4G41A 4MINA 2B69A 5D7NA 4IP0A 4X93A 4BNVA 4KZKA 4Z2AA 5IASA 1KKMA 1Z3IX 4X3MA 4X1YA 4FMBB 4ZOCA 4AJ9A 4YXWD 1N2OA 7MDHA 4ERHA 2I4NA 1ORRA 5LZ9A 1D6JA 1BZYA 4GF5A 3AP1A 3KJEA 1HL3A 2IUSA 3BWDD 5EUCA 4B8ZA 3QVKA 3LTNC 4L7VA 1TU4A 1GTZA 4CVNA 3MJHA 5SYAA 3MRSA 4EBFA 1NASA 2QTCA 2VRWA 2FA9A 1SCBA 4ZCTA 5DTIA 3M4XA 3PQ2A 1ZD9A 1ETUA 4WEQA 1I5EA 5EMMA 4IIEA 4ZMSA 1AK2A 1WKCA 1TLLA 1NSFA 3K9HA 3FMIA 5FHRA 2WMYA 2WYOA 2C7RA 4BQIA 1QRTA 3E82A 5CXSA 2MSNA 2PJUA 4KO4S 4AC9A 1QDEA 1KMIY 2EKBA 1UMCB 3OUTA 4DLKA 4EB0A 2FDCA 2PXAA 3N6XA 3QVGA 1EHYA 1U3CA 2WSBA 4U6NA 1SOVA 2AX4A 4YJ2B 2IELA 3FB4A 4DCPA 2IYTA 1R0ZA 1Z5PA 3AX6A 3QELB 2NU9A 1VRCA 4J07A 3AEQA 5AJXA 1I2DA 1CY7A 2NV0A 4URYR 1UXHA 3O83A 4D9FA 4ROSA 3RBVA 2E5LB 4GLFA 4L2IA 4AKIA 1BQEA 4AP5A 5JMWA 1S6YA 4L15A 3UWPA 1G8PA 4CTOA 4EVSA 3HKEB 1D09A 5AKYA 1DBWA 4YJFA 3K70C 3BMNB 1G4UR 1R50A 4HUQB 4BJ1A 2VP6A 3CVYA 1IAQA 3G9QA 4P58A 3DC7A 1B2RA 2ZB2A 3BICA 4RQAA 4NCIA 2G1UA 2O5CA 4BQFA 1F48A 2EP8A 1WWKA 3B3GA 4OKSA 2I54A 3GEIA 1OA0A 3SZGA 2OHWA 3V4OA 1F4PA 4N3CA 4NEHB 4LJ4A 3HGMA 2QM0A 4XSGA 3BXOA 5GJWC 3VO1A 1L5WA 5K2OA 2FE4A 4HQLA 2FJ0A 2D54A 3DMYA 1SC9A 4JCCA 4D9JA 1PV4A 4ZHWA 1QMPA 2QUZA 3OT4A 1Y7LA 3PC4A 4HN9A 4QXAA 3NLLA 3OJ0A 3QBVA 3TB4A 1EIZA 4ZFNA 1IUNA 5DN9A 2ZYIA 1UJ2A 4OHUA 3NPMA 4I5GA 1HMYA 1R88A 4UAJA 4XWOA 5CAEA 5DLYA 4NAVA 3RIYA 1NZFA 1QIMA 4CU5A 1LK0A 3BORA 1PLKA 4X1KA 2XDYA 4Q7MB 3RTGA 1U7DA 1TUEA 4D2IA 2J30A 2VGNA 3M7IA 4LNHA 4L27A 2H7CA 1NZJA 2N1BA 2NAPA 4LXUA 1JZSA 3WZ2A 4AB1A