3VO8A

Staphylococcus aureus ftsz gdp-form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
305
structure length
305
Chain Sequence
b'ATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGFD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 109
structure length 305
sequence length 305
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3vo8A02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3vo8A01
3VOAA 5EYPB 1TVKB 5LP6B 2RHJA 1Z5WA 3HKDA 5MN4A 5CB4A 4FFBA 4ZOLA 3ZBQA 4I50B 4X1KB 5LA6A 5KMGA 3JARA 5FNVA 3WGJA 5J2UA 3HKDB 2VXYA 4X1IA 3WGMA 4O2AA 5CB4B 4O2BA 4ZOLB 4XCQA 2Q1YA 5LA6B 5JCOA 5J2UB 5LOVA 5LXTA 3ZBPA 3JASB 3JATA 4O2BB 3VPAA 1JFFB 4I4TB 3WGNA 3JAKA 4IHJA 4U3JA 5EIBC 3M89A 4EI7A 4WBNA 3JAKB 4ZI7A 4U3JB 4EB6A 3RYIA 4LNUA 1TUBA 4EB6B 4TV8A 3WGKA 5JVDB 4TV9B 3R4VA 4O4IA 3WGLA 2XKBA 3RB8A 4EI9A 4TUYB 2BTQA 4LNUB 1TUBB 1Z5VA 5IYZB 4TV8B 5BMVB 3N2GB 4I55B 1RQ2A 1RLUA 4O4IB 5LYJA 2BTQB 2VAMA 4ZHQA 4FFBB 5ITZA 5KMGB 3UT5A 5MN5A 3JARB 5FNVB 2GVIA 4X1IB 4ZHQB 4O2AB 5ITZB 3M8KA 5LOVB 4YJ3A 5LXTB 3JATB 4O4HA 5C8YA 4B45A 4F6RA 1SA0A 5CA1A 1OFUA 3HKCA 5EZYA 5JQGA 4B46A 5C8YB 4F6RB 1SA0B 4O4JA 3HKCB 4IHJB 5EZYB 5IJ0A 3JAWA 5MN6A 5LP6C 1W5EA 4WBNB 3RYCA 4ZI7B 1RQ7A 3C8LA 3RYIB 2Q1XA 4E6EA 2BTOA 3HKBA 5GONA 4YJ2A 3VOBA 5JH7A 2RHLA 2R751 4HNAA 5M7EA 5CA0A 5GONB 4DXDA 1W5AA 5JCOC 3RYHA 2RHOA 4HNAB 5LYJB 3VO8A 5J2TA 2VAPA 3RYHB 3UT5B 4DRXA 5EIBD 5KX5A 3ZIDA 4YJ3B 4O4HB 1TVKA 4IIJA 4X20A 1FFXA 5CA1B 4I50A 5JQGB 3VO9A 1W5FA 4EI8A 1W5BA 4IIJB 4X20B 1FFXB 3HKEA 2VAWA 5IJ9A 4O4JB 1FSZA 3E22A 2R6R1 5IJ0B 3JAWB 2RHHA 3JASA 3HKEB 4X1YA 5IJ9B 3RYCB 3E22B 1JFFA 4I4TA 1W581 4X1YB 3V3TA 3HKBB 4YJ2B 4U39A 3JALA 3N2KA 5JH7B 3CB2A 5CA0B 3RYFA 3JALB 3N2KB 1W59A 3RYFB 4O4LA 4M8IA 5J2TB 4DRXB 5JVDA 4TV9A 5KX5B 4O4LB 2XKAA 5EYPA 4TUYA 4KWEA 5LP6A 5IYZA 5BMVA 3N2GA 4I55A 4X1KA
chains in the Genus database with same CATH superfamily
4QQFA 3ZWAA 5CGZA 2Z2JA 4R41A 4M0CA 1CY0A 1MH9A 3HBNA 1BG6A 3PQ6A 3HEAA 1JX6A 1X8XA 1VKJA 3ZK7A 4C76A 1EUQA 4RIGA 2A30A 1KI3A 4DG9A 3AY3A 4LY3A 2Z4SA 3ZE9A 3DE1X 1WMAA 2WT4A 1NJSA 3KD3A 4JEUA 4ZYXA 1GQSA 2BPOA 3EXG1 1R6UA 1WXFA 4FR0A 4G36A 4J2HA 4JODA 5EL0A 1T3HA 1Y5NA 3LBAA 1FDWA 3ELCA 1W0KA 1KS9A 4FFWA 3T94A 4B32A 5KCZA 3DV9A 3FCUB 3RIEA 2FOLA 4EKIA 2CCKA 3IEMA 1XMOB 1U3VA 1D2HA 3HWUA 3VR5A 2DOKA 2NO5A 3EG9B 3C74A 5A2QA 1DRKA 4GGOA 2JLYA 3PUKA 1J90A 2ST1A 4AG5A 3T1TA 2QEXF 1OLOA 3L4SO 5EE1A 2BUCA 5EJ5A 5TQ0A 2Q27A 1XD9A 4LCEA 4MW6A 5JJIA 4WL0A 1QGOA 5AW9A 1ENYA 3NAMA 2DT8A 2Z5VA 3OIVA 4X3CA 2VYVA 1FQJA 2GBPA 4B6EA 1X9GA 1E5LA 2V7EA 1O4VA 3FYDA 4JKIA 2ZAUA 4HWGA 1U7HA 4QRIA 2A67A 3E2IA 1THGA 2IYYA 1CFJA 4X8OA 4XD2A 2G8NA 2AXEA 3O9MA 3WL5A 4B4UA 4JEIA 1HA3A 3ZDXB 3K0CA 3LBIA 1W55A 1JU3A 2R8ZA 3LY9A 1ODJA 4M38A 2PXXA 3O3CA 4Y2GA 4HAXA 2X0FA 5FF9A 5IM4F 1A7KA 4HGOA 2DM6A 4RHXA 4F2HA 2JBHA 3GJSA 4F4FA 1V3VA 4Z3DA 3EEYA 3SS8A 4OX9B 1XNGA 3I5AA 1UT8A 3LOQA 4EH1A 5K8LA 2IDJA 2CUTA 1RRMA 2HBYA 3H2BA 1JMYA 5I3CA 2GDJA 3EVEA 4O2BF 3AVOA 3O91A 4NK4A 3M9XA 2VLIA 1H8ED 2YIMA 4NJMB 2Q6KA 1GAXA 1Y1PA 2C42A 3BJMA 3IP6A 5CB8A 3GI1A 4MWOA 2Q4EA 2J08A 3QEKA 1E7WA 3QIVA 2O7QA 1WQ1R 5FUWA 4EHHA 5B1EA 1BW9A 1VLMA 3BG5A 3IO3A 3EPLA 2CXUA 2ENUA 4CFSA 4H17A 3T4XA 1JJIA 2JCVA 2X3FA 2XE8A 1P2TA 1Z0DA 3C43A 2X2PA 3LT2A 1DUSA 4LQLA 3SZMA 3VR6H 1X39A 2PAAA 1PW7A 5JZMA 3VNBA 1VSQA 5LUAA 2XWBF 3VAAA 3QHPA 3HC7A 1P45A 2X19A 3N2NA 2CYAA 3FD5A 1P74A 1JIXA 3B6JA 1W46A 2BEKA 2JJYA 3CS3A 1VMIA 4OKNA 3AR5A 3DJYA 1CS4C 3AR6A 3PR3A 4LDJA 5I7AA 1T1SA 4LMRA 2FUG6 2QX9A 1NP3A 1C9EA 1G3UA 1PJAA 5J59A 4BIIA 4HS4A 4NPCA 1KO7A 1E92A 1H0HA 3K32A 1ZMOA 1TAHA 4QHTA 2PQ0A 4KJZA 5FUQA 1N9KA 1J07A 3CB2A 4GX0A 1TCBA 5SYNA 3LS2A 3SBEA 4JI8B 4MUBA 4RZUA 3P1JA 5TPZD 2YXEA 3Q5GA 3K6SB 4ZZ1A 3TB6A 3TCNA 3KSMA 1DCTA 1R0KA 1FTWA 4BKOA 3HXMA 4XA8A 3L5OA 4BRUA 3BRWA 5I9IA 1E4YA 4JQZA 3IDAA 1KARA 4KODA 4JZYA 2NO0A 3FNEA 1CIVA 2WWWA 3VMMA 1BYUA 3C45A 3M4JA 1XCLA 1XZHA 1VQVA 3G0GA 4QT4A 4Q7JB 4TX1A 3RABA 1LDEA 3L05A 4JP1A 4TTRA 1MFZA 4J0HA 4ATNA 3PV0A 5DHPA 4CEIB 4E7OA 3G49A 3E03A 3PL1A 4D3ZA 2QGZA 1Y5IA 3IKMB 3OPXA 3OLWA 2BTUA 3BULA 5GOZA 5CA0F 2JJ1A 1JA9A 1E7KA 3CF2A 4P7BA 4UTOA 5FUXA 5LB2A 3VPAA 5I48A 3QOYA 1QH0A 4GMKA 4HQLA 1AX9A 4YLYA 2WIFA 1QZXA 2V54A 3RKSA 1K63A 1VSVA 1DEXA 4CF3A 3S1AA 3SHOA 4NZMA 3TI9A 3QVGA 3R76A 3VMFA 3W5JA 2H2WA 1U3DA 3KV3O 5KEIA 4WJLA 2ZRMA 2ORED 2ZVDA 3ZV7A 4TV8A 1HNNA 5J5VA 1AKQA 1RHQA 1BJTA 3F74A 3G68A 1WG8A 1WP9A 3WJQA 1RWQA 1FNNA 3IP3A 5CJPA 3M3DA 3RD5A 2CDCA 3EBOA 3EYAA 4J90A 4QJ5A 1RQ2A 1AGRA 8ATCA 1YB7A 4KDRA 1G59A 3B7PA 2ZYAA 2GXAA 1R50A 3RUEA 3STTA 5ITZA 2IPXA 3G7UA 4G01B 4HX9A 2VXCA 5EJ8A 4EJ2A 4KUHA 2CWWA 4LF9B 3FNQA 4JELA 3LQKA 1ZR4A 3REQA 1N3IA 4W5HA 1AGYA 1I8TA 3QP9A 4YAOA 4M46A 2HA4A 2D8MA 1OPXA 4GXTA 4BS9A 4F4JA 2EYQA 2C3YA 4GRDA 4F6RB 4FBLA 4URYR 2A9FA 4DXHA 4PHGA 2EKZA 5L51A 1QHHB 1SELA 4WE3A 4JX8A 3K7EA 2RE8A 2UYQA 3EZLA 1W88A 5CCBA 4UXIA 1FZTA 2XCLA 4JUCA 4XDYA 4FMDF 4IDBA 5BW6B 2WHEA 3ZK9A 1IK4A 1CS0A 1MG0A 4DMGA 1PZMA 1U7TA 2VF8A 2ZR9A 3RADC 3GAZA 3PG5A 1KOFA 1UAGA 2FLVA 3RYHA 1X1EA 5LPNA 5EP4A 2F1KA 1JFVA 5I9LA 4AZ0B 3KAPA 1QO7A 3EK2A 5JBIA 3DH0A 2VGNA 3UA4A 3EGDB 2P9HA 4NARA 4TPKA 1N6KA 3L9WA 5D8DA 5HK8A 3PDHA 4V0KA 3R9KA 4BTEA 4M1TA 1VQ1A 4E1VA 4F0JA 2YHUA 5AKHA 4C4AA 4C78A 1QVFF 3C9UA 1JJFA 2FMXA 3VJMA 3T9FA 5K20A 2Q5IA 2RAPA 4QREA 4FMCB 5JYBA 4WQMA 1Q83A 4F56A 2NU6A 4TRRA 1Q0LA 4NCBA 4WZAA 1HKUA 2P9JA 5JD3A 3HBLA 4QM6A 1H9AA 5IP5A 3R9XA 1IOVA 2R6R1 2VQ6A 3DQZA 5KCMA 6CHYA 2TMGA 4TXJA 5JNVA 3Q72A 3V46A 2EJUA 4JLVA 3ONFA 4Y2VA 1C41A 2RG7A 4UM8B 1F20A 3E27A 1DIRA 2J33A 2DUNA 2R4QA 4ZDIA 3N3AC 1ZMRA 4LPKA 4DLPA 3II6X 5JAUA 3DOFA 3KJIA 2OXCA 3V1NA 1U9YA 2VTKA 4IS2A 3K3PA 4LRWA 4U1RA 4YFVA 3Q8MA 5AR1A 3W2HA 2FPIA 4DRXB 3ABIA 3BD9A 3I9KA 3MJSA 2EGUA 2NXJA 3BD7A 2PGNA 4PIVA 3ZWXA 1BMTA 1F2UB 1XRLA 2R6FA 4GL2A 1TC1A 1UC8A 2DKFA 1Y4UA 5FJ4C 2JB9A 4O2AA 4YCNA 4UU8A 4RTMA 4LX0A 4J07A 3IQHX 2XB6A 3RUAA 3MJRA 1PYGA 3HL4A 1GHTA 1SU8A 3IIMA 4J9VA 4LZWA 4OHRA 4A92A 1T9DA 5C37A 4F4CA 5CAEB 1E5VA 1Z6PA 3C3AA 3HCPA 3JQBA 4V02A 3HABA 1A04A 1CZOA 3AF2A 3RSGA 1IQPA 4AUNA 1B1CA 2QLNA 4Q02A 4RGVA 1EUCB 2X1VA 3UMMA 3HP4A 3QXXA 4ZXFA 3DTNA 1GRRA 2PLRA 1ENPA 3B38A 4EB6A 1Z75A 4AO7A 2EWCA 3BS4A 4HNGA 2IG8A 3WNQA 4L2IB 4OBEA 4DZTA 4UAGA 2I5PO 1YT5A 3BIJA 3ZI7A 3RSHA 3TNLA 5HR5A 5J47A 1YJ9F 1VQ5F 2AN1A 2ZYGA 1SKQA 3B70A 3ENZA 2B34A 3ZHCA 2PO5A 4QOSA 4I4TF 2Z6VA 3NYIA 5KNDH 1RYMA 1CJBA 1UBRS 1BKYA 5IJWA 4BGEA 4KBFA 2Z2IA 4L15A 3K1YA 3KOYA 1YIJF 4H35A 1C1DA 4FT4A 3QFHA 4WTOA 4Q21A 2WZBA 3AHEA 2C9DA 2W6ZA 1CG6A 1D4AA 5IMSA 1PZNA 4ZZ2A 3Q2OA 4FWIB 3BHMA 1VB5A 2C2HA 3AL0C 2HTEA 1NVBA 1YFJA 1O3YA 3QUSA 3OZFA 5LP6C 4J3FA 1XKTA 1QFSA 3T4PA 4FR2A 4GF5A 4G0WA 1MNAA 3GJTA 5K3FA 3GFGA 3C6ZA 4X6XA 1L1FA 3IVGA 4L07A 3C9RA 1LRJA 2R48A 2VJMB 1JKFA 4NV0A 4UPVA 1MJNA 2IHNA 1S6YA 1NVTA 4J6EA 4RM3A 4WCFB 4JR2A 1B6GA 3PR1A 3LL7A 3C48A 3QITA 4D82A 1T2FA 3IPYA 3NU1A 1KF0A 4ZZIA 4WX2B 3ZC3A 4TYYA 2VRNA 2GXQA 1P5RA 3WL3A 3FVTA 4R9VA 3GJ4A 1CQJA 2HH9A 2WU8A 2FZ5A 2GBIA 1RKXA 1SVMA 1AKWA 2ET6A 3S06A 3CLTC 2Z95A 3P5SA 1F9AA 5H0IA 3WISA 1G2PA 5IAKA 3UC9A 2FCRA 1QMGA 2ZI4A 1WNFA 3VZDA 3NUQA 1Y3CE 4HRVA 4RHYA 3UXEA 2A88A 5EUQB 4D5EA 1VLHA 4NSNA 2C07A 4WH0A 1RRCA 4N41A 1YDWA 1G5TA 2RHHA 4YIKA 3HCRA 5IJ9B 4GLLA 3I8OA 5K1ZA 1A7AA 3HFSA 4UC0A 1JFFA 5JXIA 1OH7A 1R0ZA 3B6EA 3F49S 1IRXA 4ZHQF 3OTOB 1TEZA 3IHWA 1H23A 2BHNA 4XGQA 3V4LA 1B8OA 1ISSA 1HRDA 1QH1B 3DTTA 3GPDG 4Q47A 5HUHA 1KPHA 5A6SB 1FP1D 4X8MA 1GAJA 4DQVA 3KOXA 3NAZA 4QAJA 1IUOA 1SB8A 3W06A 1Q0TA 2XNDA 1SKBA 4WN9B 1E9RA 2G06A 2JASA 2P3QA 4ZAXA 1VBNA 1M67A 2VBGA 4ZQBA 3FNFA 2G9IA 1MRZA 4RABA 1RFGE 1NJFA 1WS6A 3IAUA 2OTJF 5K4AA 4PC1A 1FNCA 1IEXA 2RKOA 3SC3A 3L8YA 5I4IA 2PGIA 1C80A 4M86A 1I3NA 1ODIA 4C2UA 1LBSA 1QQBA 2Q3HA 2CZGA 1WL8A 3OU7A 3R5SA 5LXTA 3OE7D 3QKWA 4XLZA 4DWVA 3IRVA 5LD2B 2JNWA 2TRSB 3OQJA 5J1SB 1RC1A 3EQZA 4PGAA 5KNBA 2Y1KA 5LU9A 3RWMB 5KYGA 1JPJA 4PW0A 4CKBB 4QULA 3O3OB 4RSRA 2LGJA 1VIVA 3AKYA 3KALA 2JVKA 3H7AA 5DN6A 1LKZA 4FI3F 1DKPA 4YRTA 3USZA 2OZLA 5CCDA 5IFLA 3D2AA 3STHA 3NDRA 4K9KA 2H85A 5COQA 2V7VA 5EP3A 3QKSB 4LRSB 4ZK2A 2FZLA 1VFPA 2OY0A 2YKGA 1U9IA 1U80A 2FPMA 3EXHA 3S2GA 2UVDA 1OYWA 4PF1A 4RLSA 1ZHOA 2A1TR 1T1JA 2AFHA 2XDAA 1W9HA 2VO1A 2OBMA 4MP3A 3MVEA 4FS3A 5JO0A 4FLEA 5LOVB 1Y5MA 1NQ3A 1A5ZA 1ESEA 1RHUA 2DQZA 1N6PA 2EGGA 4GFDA 3HVHA 5IJAA 4MJLA 3F0GA 4TMTA 1KZHA 4C4SA 2VG8A 1VGVA 3OUZA 2ODQA 4OJTA 3BICA 1UDXA 1V71A 4O4JA 2QSYA 5JG7A 4UM9B 3PHBE 3RVDA 1Y0BA 4YDSA 1W19A 3BGOS 2E4AA 4QTTB 3L7OA 3O83A 1M0EA 2C9ZA 2B94A 1Z6QA 4WKBA 1GA4A 3MRSA 4GZ6A 4KLAA 5FNVF 4D4MA 3AVTA 2IHVA 2LKCA 2WSBA 3OZAA 5CNIA 2BCJQ 1FFEA 3I12A 4KNWA 3A4LA 3SYNA 1WO8A 4MRMB 3IQGX 3TW4A 5HJ7A 5JS8A 5CD9A 2PUEA 1F9EA 1A3CA 1Q1ZA 1VHDA 3GCXA 3Q7RA 4HGZA 1E7QA 2NUTA 5JXGA 1T0AA 3G6WA 1VYVA 1BOFA 2IP2A 1FFAA 2KHZA 1BFUA 1SK8A 3K35A 1HYQA 5J40A 3RARA 4CMJA 4EJSA 1DAFA 1GPDG 5DTEA 5AHWA 4MKRA 1N9GB 3E82A 4S2UA 4EEZA 2WLTA 4FLMA 2HMTA 4RYDA 3HKEA 2I7DA 2JPDA 5FI3A 2CMHA 2C5FA 4HS9A 7YASA 4D0SA 4NV1A 1GNLA 2LD4A 1ZISA 3DFKA 3ROPA 4KK3A 1ULAA 3MT7A 4XR4A 3ABOB 3D43A 3N8GA 4N9WA 4UVEA 2IY9A 3ZQ4A 4ALMA 3EDMA 2W9XA 3RS7A 4BVLA 2XUFA 3PGXA 4F4DA 4YHHB 1KSFX 1HYGA 4FN4A 4NE7A 4DBVO 3Q3GE 4ZHSA 1KZGB 2XQIA 4L0CA 5K6RA 4YUXA 5ERYA 3R7LA 4CYMA 1TKBA 721PA 1I7PA 3F0FA 1EM6A 3GP5A 5H5JA 3T7DA 3UUGA 4RD1A 5BVHB 2QRMA 4Y0AA 3L8GA 4EVRA 1NF2A 5CW2A 2A0XA 2E7ZA 1E0KA 4KGVA 4LXUA 2I4LA 3AJEA 1GPMA 2RB4A 1PYOA 5E3HA 4WK4B 1SCJA 5CFRA 5A06A 3H6GA 3PFBA 1J99A 4LTDA 4X63A 4ZVLA 4ZCQA 2ARKA 1YR1A 2QTAA 3DYIA 1YB1A 3IQIX 1E2PA 4OQQA 4RPCA 3VPCA 3ZTWA 6NULA 5AJWA 3DSRA 2QTNA 3RC9A 3B78A 5IBQA 3O8DA 5T67A 3FYUB 4H7PA 3KO8A 3RJMA 4CN8A 1CY8A 3G5MA 1EUDB 4FFNA 3GFVA 2QPTA 2XTJA 3QXGA 1V3TA 4XUGB 4CKEA 4MV7A 3ZW9A 5C7LO 3TL3A 8MHTA 4DR5B 5JIBA 4FYPA 3BJIC 4KREA 1UK8A 3T41A 3QWIA 1JI0A 2XHZA 2OVFA 1U7WA 2A9JA 3K0FA 2HDHA 1ZCFA 3GIWA 2NUPA 3FFXA 4PG7A 3WIOA 1VKHA 2VJCA 5CK4A 2QDXA 2CXQA 4C5BA 2XGOA 5I9BA 5SYAA 1XG5A 2IPAB 2CVLA 2ZJYA 2N47A 4BXOB 3SEFA 1JLMA 2FA9A 4PC3A 3IR6A 4YO8A 4AWXA 3IQFA 1BDJA 1U63A 2H8GA 1SKUA 1Z15A 3QTTA 3VDQA 4C3VA 1TF2A 3RNOA 4RTPA 1U0BB 4I1IA 2D6FA 3GDOA 1WW8A 3G2JA 4PAOA 4FSHA 2Z6UA 1U8XX 3AIOA 5DW0A 4ZALA 3N3BC 4YRPA 4G4ZA 5MN6A 1L7XA 1QVVA 1FJHA 1TA0A 3NFRA 2ZE5A 4RF4A 4W9NC 5JYEA 5KIAA 1IDOA 3PDJA 3UH1A 5I4KA 4MTCA 1Z0ZA 1T6BY 1HG1A 1KXJA 1SBNE 2OV6A 4J0EA 4YV0A 1LFAA 1K6EA 5JH7A 1XQYA 2NG1A 3EX7C 4I6JA 4CMCA 1JJ7A 1KK3A 1GTG1 3HJGA 4L5IA 4MINA 3FDZA 1ZESA 2RB9A 4PHHA 3OA0A 2Z3VA 3DOIA 3PD1A 2IUTA 3V1LA 4EVQA 3RAFC 1Q82H 5SV2A 2O20A 2CVHA 1AK1A 1HEUA 5FOXA 3PWZA 3TQOA 2EU8A 3W2EA 2AD1A 4WACA 3BL6A 3KKNA 2QLLA 4RA6A 2QX7A 3N05A 1GTJ1 2IEBA 2ZKIA 4NI5A 3UB2A 1OCEA 2CJWA 2ZJAA 4EPVA 5BXQC 3NNNA 1OASA 1XZLA 2G36A 3K2BA 5JVDF 2WAAA 5JQGB 4FGZA 4IX9A 1N7GA 3THRA 2WTXA 3U81A 5H59A 2ZJ2A 2CNOA 3BTOA 1RM3A 3AFHA 3LJKA 1M6WA 3NZEA 4JJ4A 1RM0A 5HQ3B 5JXWA 3L4BC 3AUYA 3N58A 1J56A 4BZZA 3OC0A 5BR1A 3PC3A 3GU3A 1USWA 5DBIA 1F1JA 2ORVA 1JB1A 3D0KA 5DXFA 3DNFA 2AN5A 4U39A 1KFCB 2PE5A 4ER3A 1R5JA 3L7KA 3JTEA 5FTMA 5AJZA 2YY5A 2QS9A 3N5CA 4TWAA 4KL8S 1NMQA 1F6DA 3GYGA 4YP6A 1GM5A 4OJQA 2O8BB 5KTRA 1BNCA 1Z5UA 1ZCZA 3KR9A 5DHUA 4EYGA 4P92A 1KHHA 2F6RA 2X3YA 5F3RA 1F4PA 4GBMA 1ESDA 2C0QA 4A2CA 2OGTA 4YK7A 2R7KA 1Z5OA 2ZRKA 3OFKA 1PCXA 1N8RH 2ZTSA 4NUTA 5K3DA 1KI7A 3WLFA 5TS2A 1XDSA 1DRVA 2WINI 3O82A 3IP9A 3S2UA 4RBNA 3DBLB 2FOXA 4J43A 3SBXA 3G02A 4C22A 4ZCRA 4NENA 3MDOA 1SVIA 4MVJF 4BV8A 4E3ZA 4N5NA 1UBHS 2NT3A 3DPIA 1TZJA 4OKIA 5FOSA 4XQEA 2MU1A 3IEUA 4ZCPA 1GAQA 1HYHA 2A59A 2CDAA 4KK4A 4LV6A 5JCJA 2X3UA 3C4JA 1PLLA 2P4SA 2KTUA 2XTMA 1M34E 1MTOA 5BSTA 4CFYA 1Q1BA 2BLLA 3WBJA 2AFIB 4UMDA 3PQ2A 4JI0B 2BKLA 3EJWA 3AW8A 2OCKA 3UWKA 3OLXA 5JBNA 2N0SA 5CGQB 1KC3A 5NULA 3QMWA 1WOYA 3TW8A 2VSXA 4H27A 5AHOA 3F0TA 5DU2A 5F9FA 2ZYHA 1QVWA 3Q3EA 3WBFA 5K6TA 3HAXD 1ULHA 4A8HA 4R0NA 1O4WA 4O4IA 3E0QA 4E5KA 1FPQA 6REQA 3T5MA 1YFLA 1ZNYA 1KTVA 2SECE 2XUIA 1KERA 1Q16A 2CXHA 1JQKA 3B9QA 2R62A 2HA5A 5LYJA 3ROEA 2VAMA 1ONIA 1HOTA 1WF3A 2IUUA 3RFCA 3VR4H 1F7VA 3S28A 1RJWA 2AVDA 3TBHA 2IF0A 4HWSA 5KTKA 1RBMA 2AKAB 2CEKA 4FFMA 4BVKA 5GTDA 3UATA 2PMBA 521PA 1CZKA 1H1LB 1DEAA 4NCXA 1U5BA 2D1TA 3ZY2A 2F8TA 5KHOC 2JL1A 2A4MA 4UJ3A 1KHTA 3ZK8A 3HPRA 3I9MA 1X2BA 4GZLA 3CC4F 4B62A 2JKYA 2VUHB 4YP1A 3FWZA 3LRTA 1N7JA 3ZEAA 1UDAA 1SZCA 1RXIA 2KB0A 1TYZA 2QU8A 3CW9A 4BVGA 5F51A 3EBPA 1N57A 4IHKA 3PHLA 1CHDA 1QK3A 3HU1A 5ENDA 4U4AA 1DELA 3QELB 5EJ9A 1YBAA 2GO1A 3ABQB 4MHSA 2JZNA 2WJZB 3MPOA 3I4FA 3WSVA 5BV7A 4Y2YA 4F86A 1A72A 1RABA 2DZDA 2VAPA 3LCMA 4P4SB 4PRYA 1O8BA 5GY7A 3CZCA 5LZ2A 4DY6A 7MHTA 1X2EA 2K6GA 4XVHA 4LZZA 1IULA 2H7XA 1DOZA 1R37A 3K4HA 4MCHA 2A7XA 4G1VA 5I7RA 4NH0A 4JCCA 3VNVA 3ZV4A 5E7JA 1GQFA 3E2PA 4BP8A 1O57A 2FP4A 3OBWA 1L7BA 3P0HA 4IEEA 4Q9IA 1N92A 3E3NA 1OLXB 1LC3A 4FJ1A 2HRUA 1IHOA 3L02A 3O4FA 3GRPA 1VJCA 1KQNA 2IEAA 2ACWA 3LLSA 3HDJA 3EVCA 1E59A 1U2SA 2H4YA 3AI2A 3IDQA 1O6BA 5CK5A 5LB4A 3KDSE 4GMHA 4G9BA 4R2IA 5F4ZA 3LC7O 2JVJA 1SWWA 5REQB 3IUEA 3D8TA 3B36A 1V7PC 3P45A 4KXMA 4C6TB 1R4AA 1IEQA 5D51S 2QAGB 3UKOA 4KPGA 3E7PA 1RWVA 1VIDA 4HC4A 5A7HA 3ZWVA 3OEHD 2PRSA 1AURA 2C8KA 3CUVA 1OWOA 3HDHA 3MXOA 2GWHA 1Y4ZA 2IGTA 2QZZA 3CKLA 3EUWA 4AG6A 5DYTA 1P1BA 1TCAA 1ZA1A 2KW5A 2AMVA 4B6RA 2JLUA 1RZ3A 5CB4A 4PAMA 4ENTA 1BS9A 4BFXA 3JVUA 2WVHA 4ISBA 4TZTA 1V1MB 3BMOA 4W5JA 2E4VA 1Z29A 4OSPA 4TXHA 1H85A 3IVRA 3PWSA 1GGJA 3L2OB 3SLRA 3UAVA 4AMGA 4ZJPA 1I6WA 1TU0A 1NF8A 3WWOA 4UBLA 5ALRA 2CHSA 4CV2A 3I83A 3G5UA 2GRUA 3K2IA 1VSBA 1N5OX 1XPJA 2I2DA 1FX1A 2PS1A 4IHJA 2HKIA 3CRW1 1J2EA 2WFLA 4PTYA 4QVKA 1PT5A 4YRMA 5JS6A 3U7GA 1KAQA 4D7AA 2Z83A 1AIPA 3UHJA 4H2DA 1K3FA 4HF7A 3USCS 4B17A 4OTZA 2PMWB 2QTVA 2VPIA 1LVHA 3X3HA 3DP9A 1W0JA 2OCAA 3QU5A 3BCRA 2OHXA 3OBYA 4RJKA 4QM7A 1E1DA 2XXBA 5BQXA 2QTLA 3M4XA 2XW6A 3F6PA 3KJZA 4GSKA 1VQKF 1UKVY 2FPLA 4AFNA 3HUEA 5A5FA 5BXYA 2GPWA 4KR7A 1JEYA 4TOIA 2XOKA 5KU7A 4MWDA 2JA2A 4QFMA 3RROA 4D25A 2R86A 3UWPA 2PL1A 4HVAA 2ZUBA 4M55A 1Z0KA 2QA5A 3LQYA 4RVOA 3L4EA 4UBMA 1VKOA 4WZBA 2CHUA 3NBFA 4CCWA 2XMDA 2IH2A 2BF7A 5HCIA 2H06A 4RQBA 1F2VA 1O94A 1HNZB 1B8NA 3P0JA 4ZVNA 5C1IA 5KYNA 2ZI5A 3OZWA 2HJRA 5DSXA 1KMHB 1SXJB 1U0SY 4YN3A 3K0AB 3U7QB 3DT8A 4QGGA 2VHZA 5FPTA 3FOAA 1PP4A 3EA4A 2A78A 2J9GA 3R7SA 4BFZA 4P22A 2JLVA 4KN6A 3FSGA 1XBTA 2D5LA 3VC1A 3WX0A 4CT4B 1XZNA 2XMCA 4LOJA 3LWZA 3E3LA 2D0PB 4OK6A 4WPGA 5B58T 4FYMA 4TS4A 4RK0A 3ZVMA 3N5KA 3GLIE 4JP5A 1OX4B 1KZYC 4C8GA 1IY8A 1P0PA 3PPXA 2PUTA 1QNLA 4KB5A 5ED4A 3A4YA 1NN1A 2VF7A 1MJGA 2R2GA 3UV7A 2P91A 3BWVA 2XNCA 2F4VB 2HZBA 2H5IA 1PSDA 2JLXA 1JT2A 3HN2A 5F76A 2K7FA 1VA4A 4R71A 4RK1A 3C3WA 5LC1A 2HYIC 2VZEA 2EJTA 3M4SA 4TV8F 5IK2A 4BN5A 1KMIY 2LV8A 1F3LA 5F77A 3BFKA 1FSZA 3LWRC 1U1DA 4LVOA 2GQ0A 1L7AA 5HILA 1E1QD 3R3YA 4YPFA 1DRJA 3H5NA 1YUNA 3ABSB 1UXGA 4X1YB 1TD1A 3MJCA 1QDUA 2D06A 4KZPA 1EFPB 3T0IA 2GA9A 5AMXA 1YZQA 3HHEA 1YQDA 1ZN7A 3DFIA 1VQ9F 3BHJA 2HT1A 2V6FA 2ID9A 2XJ4A 1X15A 5HWSA 1XZIA 3ORFA 5AJYA 5CBPA 1ZUNA 2FP3A 5ICEA 4NG5A 2FVXA 4Z7JA 4TYPA 2GM3A 3ZTTA 3FZYA 4U7FA 1OQAA 1SHZA 4DWOA 4MUXA 1OAOC 5CT4A 5CTAA 3MT8A 3I6QA 1IUPA 5E9JA 3ZU5A 2YZMA 3H1BA 2G67A 3HJUA 5EWJA 4X95A 1MX5A 1E3EA 2C4VA 2M1ZA 1ISFA 4CM4B 2RGNC 1P3DA 3LPMA 4G5SA 1FQOA 1QIGA 3N70A 2V7UA 1E69A 3IT0A 3EDOA 4IL5A 3PUHA 2QD5A 4BO7A 2C5GA 1YBMA 4FYJA 3WKAA 4J0JA 2C9YA 1L6IA 1G8HA 4YNBA 3T3GA 4BU1A 2BWJA 1KD1H 4HJXA 3TLCA 4RDXA 4CFZA 1YJXA 3H3FA 1C0KA 2BHTA 2CHGA 2W7TA 4IWYA 4K28A 4R6XA 4YRJA 3O8CA 2FAXA 3F2VA 2XPCA 3OO0A 3JYNA 4GLJA 4OLHA 1VJGA 4HXGA 3G2HA 3S2SA 3TR6A 8GPBA 1E2GA 3ZDQA 1SQ6A 3A36A 4A0GA 3JQ9A 2ZYTX 5BSKA 3RFXA 2PLAA 1NVWQ 1D4OA 2ZUCA 3IMCA 2BFPA 4Z51A 2PZ8A 3OOHA 2Q0XA 5FI0B 4GOND 2DLDA 4TZ0A 2OE2A 2XD9A 4PG4A 3EXFA 4I66A 4RHCA 3W5AA 1GXSA 1CY1A 1ZICA 2WUDA 2WPNA 2C0PA 1RLOA 3VPFA 2GVDC 4RW0A 2ZYVX 4MW4A 4OYLA 2XYHA 4TLMB 3WXBA 1Y1SA 3K9FC 2AEEA 2BGMA 4ALIA 3GLGA 3NBKA 3BEOA 3T7TA 4B4OA 1VMEA 2H07A 1U8FO 3LD9A 4MVJG 2H5JA 4X41A 4ZQIA 3LWVC 2ZYRA 5IN4A 1WKVA 4R0MA 1WTCA 3J81A 3EC7A 2O2ZA 5IW8A 3MHPA 4HNVA 1E9SA 2CLCX 2XDQA 3CMCO 5EKDA 3T5CA 3HP1A 3ROGA 1Q1NA 1T1RA 3O8QB 2X8WA 1PSZA 1NXQA 1WHTB 2GK6A 3P52A 1OBCA 1Q12A 2E48A 4YJGA 1UOOA 2G9UA 1WCV1 4O2AF 5DRYA 3PNBA 4YRKA 4EF5A 4L78A 1DG3A 3GUCA 4TMYA 3RHFA 4DQLA 2YMMA 2Z09A 1AZWA 3OIGA 2QN9A 3SYKA 3A1NA 1N2HA 3MAJA 5TQ2A 3O4JA 3SQWA 1ZIYA 2HSZA 4MWZA 4L50A 3ETEA 3PA6A 3DKKA 4TKMA 4G88A 2C8VA 4NBTA 4OFXA 4C6RA 5TIIA 1SC4A 4YCAA 1BX0A 1QSGA 4HLQB 4O4HB 3DGEC 4WKGA 2Q62A 1N2CB 3VYUB 3WQRA 4C9BA 4C4ZA 4E03A 5K01A 1PBTA 4YR7A 1OKKA 2GPBA 1O1YA 5HTKA 1NBMA 3B7GA 1CZHA 4RV4A 5L4SA 3A6KA 2CUKA 2WVAA 4GOKA 5JDIA 5IJ0B 1EE1A 3HR8A 2NGRA 1XHFA 2WHPB 3L1JA 3T1OA 3OZBA 5KDOA 2P6PA 1Y63A 2BR5A 2V3WA 3GQBB 3NETA 4GI7A 1MV5A 1R74A 1Z07A 3DWIA 4K9RA 4LOKA 2QKYA 1ZCJA 5B7QA 2CSUA 2P7IA 4P4TA 2ZU6A 3PUIA 4RFSA 4AO6A 1KJWA 1NY5A 2HP0B 2ISCA 2I3DA 5FBZA 3TLKA 2GJAA 2ZWAA 3ZOPA 2BBTA 4M88A 1MV8A 1KH3A 4WGFA 3RYFB 1C9KA 3MWEA 4WXRA 1E8DA 1T10A 1YH3A 2BFBA 2ZRNA 1W49A 1VLJA 3OIYA 3O8OA 2JAQA 2J09A 3PCTA 4PZUA 3LPLA 5FEMA 4BLRA 4L5CA 3EARA 1I0ZA 2N75A 2XB9A 1G41A 2ZIEA 1P1IA 1YMQA 1S1MA 2ZI3A 4DBLE 5HRCA 3PE4A 5EVCA 1SHUX 2XUDA 3Q7IA 3T0FA 4BNFA 3WLIA 4NESA 3HB9A 3IT1A 5I8PA 2R85A 1G17A 1MO4A 1U0TA 3QJGA 2JH9A 4XCQA 3B9PA 3I58A 3R6WA 1IZ0A 2RGUA 5JC1A 2HCTA 4DR4B 2GLTA 3RC7A 5DT9A 4F7WA 2PMPA 1DXYA 4DR6B 3TXYA 2X6RA 3D4IA 2H1LA 5AI0A 3N28A 3A2LA 1KI6B 2ERYA 2FW0A 3CTPA 4PPGA 4QSMA 4V0NA 3RHTA 4H16A 2G8LA 4UNSA 4X61A 2F9FA 2G4LA 1MPTA 3WGNA 3FLMA 3G7NA 3OZGA 3A4VA 1H6BA 3BL5A 3A9VA 1Y1RA 3PENA 1S7GA 2PV7A 3F97A 5LZ4A 3TMAA 5F1YA 4QYIA 2BFCA 3WWPA 3F5MA 2E1RA 2ZPUA 1V8BA 3F3MA 2NYUA 3PRYA 1IV4A 4BX3A 2WM3A 1QAHA 4RJIA 1XEWY 2BEWA 4PZAA 4QUHA 1KJNA 1RCFA 3R2JA 5E6RB 2Q5HA 1BMQA 2ZROA 4IQ0A 4GOXA 3AVVA 3L1VA 1YS1X 1UPAA 3HSSA 5BQ3A 3LL4A 1DKUA 4HLUC 3IAXA 4JLNA 4EKDA 4FFBB 3FUUA 4D4LA 2PA0A 2Y3IA 1EGQA 1S8OA 2WAYA 3LHIA 2HS0A 2PT5A 2VR1A 4UMVA 4EB3A 3S0JA 3LO5A 1A27A 2RGEA 1F7UA 1RIFA 1EHCA 3QEJA 4WNAA 3WLPA 1QD9A 1KAHA 1VPLA 2XSZD 1LVGA 1QXSA 1IOLA 2J4CA 2AQ8A 4R1QA 1VGQA 1S3IA 1SY7A 2XUQA 2I62A 4KPEC 5JASA 4TYWA 4DUGD 4MS1B 4P33A 4PSKA 3UGKA 1U9JA 3BYZA 5KTMA 2GXUA 1FZQA 4BVBA 1NW6A 1CUYA 1FTQA 1VHWA 1BCSB 5BV2P 2Q1XA 4U2BA 1DKOA 4JB2A 1EHYA 4G07A 4V1CA 2VQEB 1ST2A 5G4UC 2I6QA 3IERA 4ZIRB 3DW1X 4ZYLA 1CJKC 3B20A 3V97A 1E1LA 5LXTF 2DBYA 4UNPA 5ALYA 8OHMA 1EJ2A 2HYDA 3HCWA 1ZXLA 2DUUA 2MHCA 4NZZA 1PWHA 1V11B 3GLRA 4OO3A 1X13A 4XASA 3R3WA 2WJHA 5JZOA 1Z6TA 1SXQA 2JLWA 3K14A 2HD4A 3JQDA 2J5XA 4KQXA 2GAAA 4TWZA 4RSMA 4ZT7A 2W2TA 1EXDA 3R7DA 2YHSA 3GLTA 3KJKA 2QTMA 3O4GA 1OLUA 2Z1UA 1ICEA 3CCUF 3PL5A 3J7AC 4ITRC 4DCCA 1HV8A 3UW3A 4DLNA 1Y1LA 2WWRA 3QUAA 1IG0A 5JLJA 5IH3A 4ENQA 1U2GA 4IH1A 4MQLA 3M33A 3MCUA 3F98A 4WNYA 4MRPA 7ABPA 2VDVE 2CNNA 1EGHA 1UK6A 1AKVA 2VBCA 3R5FA 1AOXA 2BFFA 3DMNA 3AEQA 3CF4G 3DCJA 2Y9PB 3KOWA 3L7JA 1Y3FE 4HRXA 4O5AA 4HUQA 3ZLUA 3ZBTA 4LZJA 1J5PA 2ZJ8A 1UBMS 3WYBA 2WYIA 4ZHYB 1D9XA 1DBFA 1E7MA 4DNOA 5CFQA 1LLQA 5EINA 4MVJP 5HKBA 2E5FA 2ZVPX 2XR1A 2QUJA 3BIFA 2P9QA 4RK7A 3GGGA 5LN1A 2P4QA 1U2DA 1NZFA 5BSGA 3U7RA 5KQRA 1Z2PX 3L84A 4DEYA 1C7RA 4EG0A 1SH7A 3I9NA 4IZIA 1YZLA 1E64A 4IDPA 1K5PA 1M1YE 2MYUA 1DFHA 3ORQA 5E4JA 2CCJA 3KE1A 1VCHA 3BB1A 3I01A 4JIGA 4NATA 4EMTA 1DTEA 1L1EA 2DKOA 3HFRA 4B3XA 4EEKA 1Z8FA 1H4SA 3LM8A 3OOWA 4H3HB 3PUZA 5PNTA 3TKLA 3TE6A 4AQYB 4B31A 2VHWA 4LSZA 2GPSA 3T7IA 4FFVA 2UYYA 3DXYA 2ECOA 2ECFA 4D3YA 1DBVO 1VLZA 1JMVA 1UM9A 1B74A 4K86A 3ZJYA 4MVCA 5KTTA 3D1JA 2C31A 4K40A 4DMKA 1NTRA 1PEDA 4TRJA 1I9GA 1ST3A 2HIMA 2VF4X 1YZ3A 4L28A 4KLCA 3RRMA 4MQFB 3KQLA 3CYPB 4HZUB 5B4VA 3PXCX 1U4NA 4KYIB 4ARZB 1ZRNA 2N48A 3IRUA 2FQWA 1WW3A 4IJKA 4TLBA 1TUBB 5G41A 3EUFA 3FVVA 2JJ2A 3HM2A 1VI2A 3QKUA 3QJYA 2G25A 3AVYA 3S6JA 3TD6A 2QRLA 4AIRA 4M21A 2UZIR 4RPHA 3FKQA 1XOIA 2R6CA 3TLXA 1L4GA 4IVQA 3HDGA 3AUJB 1P0FA 1RNLA 4ZOLF 2HQSC 1ESNA 1QTIA 2YUTA 3R40A 4EARA 4D6YA 5FO0A 5KAPA 1R4NB 3UFXB 1E3MA 1G16A 2DFNA 4NBKA 2O2HA 3JZMA 2IOYA 1XJWA 2BEVA 1ZG3A 4NQRA 4URXR 3CMMA 4B46A 4DQUA 2DFVA 5K0SA 3FMIA 2WG1A 3EIUA 2W8BA 3HEMA 5DHSA 4AICA 5IAOA 3UPTA 4KMMA 1QV6A 1Z82A 2IVFA 2YYYA 3DOOA 1KGSA 3D7RA 3GK3A 4JKOA 4LJLA 5ED0A 2NO1A 4MW9A 1EZ4A 3NEAA 4K9NA 1Z4JA 5FWAA 3HYRA 3RUCA 1YZYA 4U8GA 2DBZA 1YF3A 1R88A 4KVGA 3DWFA 1NKSA 2HXYA 1P4RA 1XJ5A 4HBZA 4MAAA 4X00A 4Q37A 4B6GA 5G0TA 3PUXA 1GZ0A 1C2TA 3GJ0A 5THKA 3TYXA 3SMQA 5GONB 4JDUA 3EG5A 1F0KA 1PIWA 3EF1A 1XK7A 1CEXA 1IN6A 2IXGA 1CF9A 2BGKA 3QU9A 4EGJA 2IZ6A 3K9GA 5EIWA 3V00A 2WOOA 4FM9A 2E6KA 4LCBA 2AFRA 3AM1A 1RAGA 1WOMA 3I2GA 4MDYA 1EM8B 4YAGA 4QNMA 1T2EA 3Q3JB 2FRXA 1GUDA 1ORRA 5GM2A 3TRHA 4Q16A 3D6UA 2X4LA 2QY6A 3ZH2A 2QP3A 2WM2A 4CMIA 4EI8A 4F85A 4QE3A 3P71T 1G66A 4RXUA 1WXXA 3QVJA 3B1VA 3A2MA 1D8TA 4W99A 3JAWB 1ESMA 1JR2A 5DHFA 4BLTA 4RPIA 4OOFA 4Q34A 1NU6A 1CLUA 2R00C 5JLAA 3CCVF 5IAAA 4FDTA 4HDRB 1Q86H 1BJKA 1D0SA 4P38A 3L18A 1E6MA 3E1GA 3MWYW 4LSWA 3T7CA 4EIWA 2OB1A 2DB3A 4FKBA 3H6KA 1UPUA 3ZU2A 1W59A 5AHXA 2Z1NA 1SOUA 2YNMC 1PD0A 3GLHB 3DMHA 1O77A 1FPMA 4GPD1 5EWMA 3N87A 4C0LA 2B1RA 4Q1BA 1KOJA 1ENZA 2WD7B 1X1AA 3AI3A 3CX4A 3M2PA 4RKQA 5E2BA 3ZJVA 4IXWA 5GGYA 4BFTA 4EW1A 2W6QA 5G4VC 4X8LA 2CJPA 4N7RA 2NVUA 3UJPA 3BWBA 4PLWA 4JXXA 4M7WA 5JMWA 2X8JA 4FFPA 2EZ4A 5LA6B 5JH7F 4HX2A 3QEBZ 1QOQB 2BUAA 2HRRA 2V98A 1YOVA 3K8ZA 1EGVB 1IMJA 2BP7B 5I01A 1G5RA 3NK7A 4OU4A 5LCXA 5P21A 1NVUQ 2GTPA 1F60A 4HJRA 1EYZA 4NG4A 4J7XA 3KT6A 5D86A 3S1SA 3EZFA 4DS3A 5EE3A 5A62A 2HO5A 1K0UA 2SBTA 1KYYA 3IALA 3SGLA 2Q8NA 5I3ZA 2I87A 4R01A 1WW2A 1XTUA 5CVVA 3RYIA 4QFCA 5GINE 2WJAA 1JHRA 5DEIA 1P9RA 4WMLA 1DC3A 2FCAA 3OY2A 3MUEA 1YCDA 4ZJZA 5BT9A 4XQGA 1YZUA 1U43A 4GBGA 4QBIA 1DOHA 1HETA 1JJBA 3WYAA 1RXSA 1YAHA 4QTZA 3OCCA 4IJMA 3T4UA 1XA4A 2PU7A 3QXSA 2JHAA 4LOIA 1X77A 3D9QX 4DNPA 4F4HA 2LPMA 3CRRA 2PMEA 5ENVA 4Q1DA 5AXCA 3VNAA 3AKZA 4BKRA 4Q3BA 1EHIA 1KWGA 2XUAA 5JAQA 3BAFA 2ZCVA 4JOSA 4ZOEA 1NPYA 5F2NA 1T6XA 2JK0A 1EBFA 4TWJA 2QAIA 4UHCA 4ACAA 1ILEA 4BO1A 1E7YA 5LQDA 3OF3A 3E4CA 4FP9A 4DNXA 2YRFA 2QPOA 2VN8A 3VKHA 4IV8A 3LK6A 1EFVB 3NRBA 1KZ4A 1KQPA 1VCOA 1X1SA 1TK2A 2J59A 2RAUA 3B12A 4Z0NA 2Z57A 5LLSA 3UMFA 1Y7HA 3PFGA 2UZ3A 1E60A 3DVQX 4DA8A 1F8GA 3HMQA 4WOBA 5TPZA 4EYQA 2G1KA 5KAMA 3G9QA 2EF1A 1R4MB 3PC6A 4G1EB 2VQ3A 4PPNA 1EMDA 1M3SA 3ELDA 4AZSA 1ODSA 3FPGA 1GL7A 1A9TA 2EKDA 2IPMA 2W5UA 4Q9DA 4OOEA 4Y7CA 4AJKA 1JJVA 4OQ4A 5C0OE 1WSDA 3AL3A 3AVPA 3STVA 4Z4EA 2XBUA 1O6ZA 5HWEA 1AQIA 1JHDA 1FFCA 1V1RA 3AF3A 3GZTB 4GLOA 1NASA 2P40A 3PZRA 4IDFA 4U2KA 3STYA 5KREA 4O4IF 1NJ5A 1H4TA 1PFKA 3GHHA 3AQ4A 4CL0A 4EYOA 1V25A 4UHFA 3JQCA 5F7JA 3V7WA 4DVJA 1X7WB 1RCUA 4EQ6B 5LYJF 4P7FA 3SJUA 4M9ZA 3NTLA 4YGXB 4GPEA 2IWHA 1IHXA 1KR2A 3RH0A 3T1HB 2G1JA 3SYMA 1W57A 1JHVA 1M75A 3CNOA 1HNXB 1NC3A 1MFPA 4PGFA 1I2BA 1XCOA 5J2TB 2GA8A 3GB9A 3R09A 4M0DA 1JKMA 5IXSA 1Y42X 4U7WA 5CVUA 4MA4A 1NU8A 1OREA 5BMVA 1M8FA 2FSPA 3HGQA 1OU0A 3C8MA 4TVOA 3UXHA 1GRCA 2FSVC 1CJUC 1YR8A 1PJZA 2AZ4A 3PGLA 3SQLA 4MR8B 2G9NA 1TYEB 5JY6A 1EK6A 1F6BA 4R2MA 2FN3A 5HNKA 2PSJA 2I3ZA 3WL4A 2Q1YA 4MVJM 4TL6A 2XCUA 1QK5A 3C1TA 2ZSFA 1O9HA 1MMFB 4YRQA 2P9ZA 5F1OA 3WLOA 3R6GA 3ZHUA 1SUPA 1UMDA 1P7ZA 2R79A 2OA0A 1FYVA 1L8OA 2IDKA 1P8JA 1T9GS 1MHPA 3JQRA 2GZ3A 4ZCIA 1ZH6A 3KFLA 2VRCA 1TNDA 3FR7A 2O8FB 3W2GA 3O85A 2NQ8A 1YC5A 3D4BA 2J5BA 2ECQA 2JI7A 3FF4A 3PHIA 3ZY6A 3HB7A 1JLSA 3PIRA 1A4RA 1CJVC 2IU4A 5HXZA 2P1RA 2DHEA 3RIMA 4GE0A 5F1KA 4OHVA 3LRXA 1RDFA 4K1XA 5B3JC 1FTGA 4BNGA 1X1CA 1D1PA 3MD0A 3SR0A 4EI9A 1W4RA 1TQ6A 3MB8A 2AZTA 1QPZA 1G291 2BONA 3L77A 4Z7NB 4NNPA 2AYZA 1EFCA 4MLPA 4OFWA 3D00A 5TMEA 4Y6LA 1P19A 3NYWA 4IJUA 3JQEA 3VR3D 3MTBA 1U1CA 4HDKA 4IJ5A 4Q9JA 5FNZA 3ZCRA 2CLDX 5CJJA 4L4YA 2HJGA 1HFKA 3LQ1A 3B3FA 3OZDA 5FFFA 2VUTA 2C7RA 2X9LA 4KITB 1C2YA 2B92A 5HFAA 4KE7A 3SC2A 5BQPA 4KWTA 5AVYA 1SDSA 3TOSA 4RDCA 4UTRA 2ZUEA 4G5QA 4OQLA 1MZPA 3B53X 2E82A 1UKAA 3JQ7B 1W0CA 1UBFA 1XB2A 1Z62A 3SICE 2KI5A 2BM0A 2WNSA 4U9IS 1QH8B 5CB4F 2RHDA 1NXOA 2B7BA 4LHYA 4NU6A 2JANA 5TT0A 3THXA 4Z99A 3QENA 4ND8B 1CUIA 4MUIA 5DBHX 4MYUA 5G0WA 1ADJA 1CR6A 1JU9A 3H7IA 5TSDA 1UQUA 4GXNA 2JGNA 3FMOB 4R1NA 2OQ2A 1KAEA 1PBNA 2HF9A 3D3WB 3BRSA 2DRIA 3NRJA 4I1YA 3TMYA 4QBFA 4JGBA 4B40A 2BJWA 4IHJF 3OMXA 4YJ3B 1G8YA 4UDYX 3MTQA 4IO1A 2WIAA 5A2QM 2XBLA 3WO0A 4H7JA 1P5JA 2Z1FA 5DXAA 1B76A 4I1RA 2V6JA 3P4EA 4JP8A 4RL4A 3YASA 3L7IA 4EECA 2JDID 1EQ2A 1C3VA 1X0XA 4N8DA 3WY9A 1BVRA 2X4IA 2BFMA 5T4EA 5DZSA 1RZRD 2IXBA 1CR1A 2C5EA 3L41A 3OE1A 4OATA 4TKUB 4XARA 4Q4HB 1T0BA 3HR4A 4YAWA 4OQDA 3ZN2A 4EG6A 2IAFA 1Z17A 3I28A 2GARA 3EVBA 3JRNA 1QR2A 3EDRA 3KL4A 3ER9A 4B5LA 3WQQA 2WHXA 1YV9A 1PNQA 2WMNB 3ZWOA 2QV7A 2VSQA 1RHMA 2IS4A 1E89A 4R1MA 2FF5A 2W6MA 3MC1A 4MRSA 3ZWDA 3HO1A 1CQIA 3DMTA 4KE8A 2VHTA 3RVJA 1GZHB 4C0KA 3P26A 3PNOA 4FHEA 5HDBB 3RWBA 3SFZA 3EHEA 4TV9A 3MLAA 4MGZR 4BZWA 2Y1OA 3EVDA 3HVRA 1AS2A 3WIUA 4JUDX 1PJ4A 3HXLA 2BFOA 3T5GA 1M2OB 5LP6B 2H1VA 3DZ8A 1OOEA 1VYHA 2FVYA 1AKRA 3CLSD 4PNZA 4F4UA 2XAUA 1Q22A 2C29D 2C97A 3A37A 2QG4A 3FPKA 2WD8A 3FYTA 4IYRA 4OP2A 3ZUGA 4RMNA 3KHNA 4GKKB 1B2RA 2XNHA 2ZSDA 5DLDA 1K92A 4TKVB 2WIJA 4EHIA 2QK4A 3DZFA 1URPA 1U7OA 3LDHA 4G0MA 5JALA 5AOCA 5FTWA 2FR8A 1X92A 4RVSA 3V8MA 5CYPA 3H3JA 2XB8A 1B0AA 3ETLA 5ALIA 4C21A 1NUHA 2NYRA 2WG0A 4BX0A 3UJ3X 2OGUA 2PSFA 1RBQA 1I7QB 2XTAA 4EUKA 4JFAA 4MQFA 3EYWA 3SFTA 4GKJB 3SYRA 5HRAA 5IXYA 2HHCA 2DFTA 2JCYA 3WGTA 4BC0A 1NI4A 3FB4A 4Q3DA 1ARZA 3SXPA 1DQRA 2M9MA 4RD4A 4XSHA 1WDTA 5F4BA 3TPZA 4MAMA 3FMGA 3UJAA 4AMBA 3PLNA 5IT4A 5MN5A 1YNOA 3E18A 1H2BA 2AA3A 4UPEA 4V0MA 1XRJA 2H9IA 1GN9A 1JEJA 3O0TA 3PP8A 3QLUA 2EG9A 2FR8C 3E3OA 2QTPA 4MR7A 5C34B 2YYEA 1XLTC 3RSOA 4B81A 5JD4A 3GLHE 3BUSA 4NFYA 3SR4A 4WLUA 4KKXB 4PFJA 3TSWA 2DHQA 3WYFA 1DC8A 2J9YB 1PFQA 3ICOA 4IGFA 4D46A 2FWMX 5BSRA 3OX2A 3UJBA 2PKWA 2Z6QA 2JS7A 4QLAA 1LDYA 3WICA 5AUQA 5D3KA 3B52X 3M0EA 1AMNA 1X7XA 2ZVZA 1JQEA 3K1TA 3RVBA 4GH5A 1Q0HA 3C3BA 2HHAA 1HFJA 3UK1A 1CB7A 4D0LB 1QTQA 3IPXA 1Y8QA 4Z8XA 3X1DA 1AD2A 4MS3A 3SSOA 3SVTA 3ZXXA 5AM1A 1I33A 2PWPA 4G37A 1ZWKA 1NMYA 2D0IA 3HVIA 2Z4RA 2PD6A 2B0CA 2ZVQX 3QU2A 4P54A 4DIBA 4LDZA 1HT1E 3SQOA 3ETDA 3G7SA 4GI5A 2BFNA 1JHYA 2BMJA 2ES4A 3GDHA 1ELOA 5D5QA 4JASB 2WW8A 3SHVA 1ORDA 3CG4A 1CR0A 4YMGA 5HUQA 3B6IA 1G6Q1 4OXKA 1PV4A 1QBKC 4GO1A 4B33A 1YTLA 4PM4A 5JADA 4EZEA 3LY7A 1RQPA 3L0BA 4FD2A 4IIJA 2B0JA 4EA6A 2DECA 4KXYA 4C0WA 5EHZA 2I7XA 1KQGA 4EGCB 2R6HA 4XPZA 1V2HE 5T3YA 4PRZA 1COWA 4X90A 1S89A 3CRZA 1XFAA 2NYAA 5GOTA 4LCKA 4W8OA 2K2WA 2OFOA 3M1AA 2I6DA 4ZVTA 3FZGA 4UQPA 3WO1A 1YDHA 4HUTA 3LP6A 3NHWA 1THTA 3M49A 4TTAA 3PF8A 2DG2A 4HDMB 4G26A 3ONWA 1CY4A 1XTJA 1BOOA 3M6LA 4GZMA 2N1MA 1LJLA 2YBEA 2IH4A 4R3UC 1IM5A 3D0QA 1R4ZA 2UZAA 1ULUA 4M76B 2G7MC 3PT9A 3MJVA 4GKVA 4MI9A 2NZ8A 1N5IA 4ZVRA 3SZ3A 5IF3A 1F0YA 1ZW6A 4X1KA 1TDJA 2BKEA 5EYPB 5TC4A 2QUBA 4Y9RA 4YDQA 3LQFA 4MZDA 2YHIB 2EJBA 1JQLB 2FQQA 1FNMA 2GM9A 3THOA 4AJ9A 2V74B 4F8YA 3RVNA 5ABPA 4B3MB 4HMQA 1Z33A 4RIFA 4RMHA 4TMXA 2YZKA 4HADA 1A1SA 4FHZA 2C7VA 1FMCA 2F3QA 3I39X 1YL6A 2IELA 3C6XA 4GD3Q 3U16A 4XJXA 1GGNA 4RY9A 5LL6P 4C0AC 2H9YA 1ZONA 1LEHA 2HREA 1SXHA 3O3MB 5G3YA 4A26A 4KR9A 4EPXA 3SQXA 1DGQA 3GJ3A 3DKVA 1KAOA 1JFSA 3AU8A 1H2HA 3DF7A 3DHEA 3FETA 3MNFA 4JR0A 4BC1A 4E51A 3MS4A 1RPAA 3N0TA 5A9SA 5C80A 5JYDA 5DGXA 4P31A 4AKTA 2FETA 1SOMA 2ZIXB 2FF7A 4OU5A 1FU8A 4AD8A 3ZWNA 1ADYA 1IZYA 1GG5A 1OWPA 4JYAB 4LMPA 4E5MA 1JZQA 3RRZA 2FMUA 3U9SA 1KI4A 2BN4A 2IEDA 3NH6A 2PJDA 1EK2A 3HCEA 4I4IA 1WDWB 4Z1OA 2QMQA 3F0EA 2QRGA 5BURA 4KI7A 2I4RA 3M81A 2IRWA 2OK8A 1RHJA 5BYAA 2VCYA 3PE6A 5CLFA 1Z12A 4AF6A 4P4UA 3TCKA 3ZQJA 3JAMA 1N36B 2CNWD 3PC4A 3C7TA 4MPTA 3QKRB 4R0VA 2PYIA 1KJ8A 4MUGA 4YBRA 1VB3A 4F3YA 3CZ5A 1U8YA 1WA5A 1JIIA 2X1MA 1JB9A 2YX1A 4MQBA 3HNOA 4ND7A 3ZDBA 3D3JA 3I3SR 2EBWA 3H6HA 4PS0A 1ZGJA 2BOVA 2R7NA 2VNAA 2VPWA 3I7TA 2B4RO 3GBPA 3IJ5A 1Q0SA 4GPTA 4BECA 3DLBA 5HG0A 3QFCA 1VMAA 3CZPA 4B8WA 2I2WA 4LQCA 4LY0A 1OTYA 1O8CA 1TFRA 2CDRA 5JCOC 1RWXA 3BSWA 1MO2A 3PUVA 3OOYA 3CF0A 2BSQA 4CPDA 1OBOA 2I6UA 5EXSA 4HH3C 3WA6A 5HBGA 1GPH1 3GJYA 4X3LA 3BB3A 3A04A 3K09A 3U0BA 3HZZA 1KNXA 1JEDA 1Q6YA 3ACBA 1XF9A 1MOQA 1P9WA 4FILA 4AJNA 3KXDA 1TVCA 3SR3A 1ZW1A 5AI5A 4A0HA 3EQ8A 3ZJ5A 5JJBA 1D6NA 5CTJA 3U4QA 2PBFA 3PWTA 3R8XA 3E9ZA 1FFGA 5DBOA 5KYXB 4HR7A 4Q9LA 2O0LA 5IVIA 2OOKA 1TB4A 4R68A 1SIOA 4AYXA 3EDCA 4ZKDA 1GDTA 1QP8A 1PKEA 1SRRA 3ET5A 4UQOA 4X3OA 1GO0A 1PUIA 3SM9A 1ULBA 1PV2A 3TIIA 3ESRA 4PWYA 2C2KA 3F4LA 2X0IA 3JSXA 3L5KA 3Q4GA 4UHKA 4B7AA 3GC6A 4ERNA 1XNRB 1USKA 1UOEA 3BK1A 1IC6A 3D8SA 4RF2A 4PLHA 2GN6A 4EFDA 4ZMRA 1MH1A 2BV3A 1V0JA 4UEWA 5JWOA 1KIFA 3W5VA 5LBIA 3W6PA 1Y37A 4RMGA 1J8VA 3CT6A 3NOQA 5TT1A 3WDLA 1CVLA 1V16A 1II0A 3HYSA 4W4TA 1P9LA 4J9UE 1ECPA 1OHHA 2R4TA 2H1SA 1A9QA 3R3SA 3IBTA 4ZEOA 3GGJA 4ZO7A 2IYVA 1GRNA 3CSSA 4JK3A 4CMGA 5JR3A 4AKEA 3G3EA 2BBSA 1QH9A 3TJRA 3AEKB 2PYZA 1KVSA 1XD2A 1ZJJA 3HE3A 3I0MA 3EDYA 4HYYA 4IICA 1GTL1 5IBPA 3G79A 2NV0A 4C43A 3FLEA 4G24A 5DF1A 1S4QA 2KSQA 2DBQA 3K9CA 2NV2B 2FC3A 3V7EA 4D4IA 5IKXA 2PX2A 3ZZUA 2TSYB 1LZLA 1UC4B 4MCAA 2VHCA 4C14A 3M5CA 4YJHA 1Q7CA 3OZVA 3NXKA 2QMZA 3B6KA 4OMCA 2XYVA 2YTZA 2UYKA 1I4DD 1NLMA 1R5OA 2OLJA 3O26A 3P9SA 3F7OA 4CMBA 1I14A 5H83A 3QFFA 4EHJA 1QQ5A 4ZAFA 3SF8A 2ZG6A 5L3QA 1MABB 3B6NA 1AUVA 1ONSA 2OHHA 3TQQA 5CEJA 3WGKA 9ATCA 3TGPA 1UDRA 4Q3KA 1G7CA 1UXIA 5FYQA 2O2DA 1CUJA 2R6JA 1UF9A 4V03A 2Q3CA 4JB8A 4P36A 2FG6C 2OCBA 4RF3A 4RMIA 3VBEA 1KL7A 3EOBI 2W2NA 2Y8EA 4AROA 4EMUA 1N6NA 2CLOB 2I7CA 5I6DA 1PGJA 2EP7A 3LF1A 4DA7A 2DHDA 2XE4A 1HC7A 2EYUA 2QWXA 1B6TA 1TFUA 4Z7OB 4EG8A 2VWHA 2HSWA 2H1OA 2ZCUA 4XX0A 4NCKA 2PH1A 5JI2E 1S8FA 2Q2OA 1X14A 2JFWA 3DCNA 3FD6A 4EHLA 1OC4A 4W9RA 3IQXA 4TLCA 1CUUA 4A7PA 4OHYA 2FTKE 2XCRB 4GX1A 4F5EA 1Q2XA 4GYWA 3WBKA 5JTTA 1ODEA 3FUXA 4A2WA 2AOUB 2B37A 4WADA 4LYEA 2QOEA 3LP8A 4M1EA 5SY4A 2XQVA 4NTZA 1C0EA 3K30A 1TF7A 4CIYA 4GNKA 2GN8A 3PKZA 4GM4A 4H0CA 1PNRA 1UKYA 3G2LA 3NDPA 1CZNA 1UZLA 1ZWLA 2ETXA 1TJ5A 3BXPA 1UDBA 3Q2KA 4YAUA 2PKQO 4EELA 2I91A 4BBJA 2P5UA 4QAQA 1FK8A 1K8ZB 1JD1A 2GBLA 1OMOA 4Q3CA 4PN7A 2GHIA 5DM4A 2BMAA 3I3OA 3IKVA 5FPHA 5JHHB 3FROA 3M9LA 4QU5A 1ZK3A 2EV9A 4CKWA 1TVKA 2V0CA 4YQEA 3KEMA 4JQCA 5SICE 1VJTA 2IHZA 3NXSA 1ZGHA 4KZKA 1BH6A 5K8VA 3P19A 2HJHA 1SJ9A 4X7BA 3THSA 3RS0A 3EPHA 1S8NA 1GL9B 1EFRA 1EVYA 2NO6A 3CE6A 5DH9A 5EFOA 1Q15A 1R5NA 2R66A 4HB2A 4ID3A 1V48A 2CNLA 2X9QA 5JPDA 4M22A 1E62A 5E7MA 4YXWA 3TXAA 3MK31 1T3ZA 4URUR 1B7GO 1NVAA 1G19A 3CIFA 1HUQA 5HJ2A 4DA0A 3PR2B 1PEYA 2V9ZA 4UD2A 1J2JA 1MG5A 2ZBEA 4V39A 4NPAA 2A0WA 2WR8A 1GSOA 1HE1C 2DQKA 2I54A 4PG6A 4ODIA 4AWAA 2AJTA 5MDHA 5CT8A 5F7ZA 3EIHA 1AZSC 2IYSA 2AR9A 4MEAA 3RRFA 2B1GA 2OGZA 1D4ZA 2HF8A 3AB8A 5EJIA 5ALVA 1X74A 2CBGA 5AHKA 3GPLA 1O0BA 5TLSA 1WUYA 1P1RA 1X80B 3A4NA 4AQ7A 1L6RA 1FNSA 3JQ8B 3WP0A 4KQIA 3E7XA 4AZ3B 1XZCA 2VUUA 3IURA 3NEYA 4I9HA 5E1DA 2G63A 3E15A 2ZS9A 1X1QA 3GX1A 1NDQA 1VHTA 2ACEA 2Q3MA 3PPVA 3CNBA 3M34A 4KPUA 1WCWA 1C0PA 1IBRA 1XZPA 2VK4A 4LRUA 4BFYA 4A6DA 4AJEA 3JCZA 4JLOA 3U3ZA 1QZTA 4FNAA 2I3GA 3EIFA 1AJEA 3KKMA 3EXEA 3UK0A 3V2HA 1D7OA 1CJSA 4M9CA 4OQYA 3WYCA 4DV5B 3RS5A 4YIHA 1BHO1 4PZCA 3ANTA 2JBAA 5JE8A 2WALA 2AG6A 4TTPA 5AOBA 5IRCD 4C2AA 5KI6A 5KNCH 1MXFA 3VHXB 1JDSA 1ABFA 3DEJA 4LNUA 5DXJA 4A1FA 5IAGA 6Q21A 3BWMA 1IQ0A 1M2VA 2V3VA 1GOTA 3KUCA 4KWCA 1HH4A 1RAEA 2RGAA 4M7RA 1EVKA 1N2SA 3TK1A 2UDPA 2I4MA 2FWJA 5EEHA 3OZSA 2I80A 5JCZA 2JGDB 4NWOB 1LU9A 2F62A 1PG5A 3AHJA 1R7RA 2LCIA 1K88A 2VHXA 4R9NA 4DMFA 3RO7A 2BHSA 3DDNA 2D2FA 4Q3AA 5BOSB 5EOVA 5HKKD 2C7PA 2WF9A 3D7MA 3HVUA 3T1YB 2KLBA 3IDOA 1E32A 4OSEA 2OMEA 1AHIA 1AG9A 3HCNA 4REQA 2VJDA 3ASVA 3B2EA 3K1AB 3IR5A 3NWPA 5FADA 1MJFA 1TYAE 2UVQA 4MW2A 4B7CA 1S2IA 2RB5A 3BXHA 2H00A 3LLCA 3TDMA 5LKRA 3F3YA 4MLCA 3B2NA 1A9PA 2V55B 1DHTA 5THQA 4LG1A 3PGMA 4MV4A 4P2GA 3SNHA 1H2FA 4D45A 4UZEA 4M1KA 4ARAA 1QF7A 2VPXA 2OHGA 1C1XB 4R1OA 1FBTA 2WUVA 3WB1A 1Y9AA 4GZ5A 4V0LA 2IEZA 1TTTA 5HGXA 1T43A 5KINB 3MSXA 2EJVA 2OFPA 4JLAA 1C4OA 1GV0A 3V48A 5JS1A 2V45A 3K0SA 3KSRA 3TLZA 4TTVA 1GGMA 2VP0A 2H1FA 3EGOA 1IH8A 4W6ZA 4CIDA 1WD5A 1FFBA 7REQA 4UASA 5EPEA 3WLLA 3U56A 3RU7A 1IZZA 3PTAA 2IT1A 1YKSA 3ZBUA 5FWXA 4RAOA 1UIMA 1EQAA 1K7XB 3KIZA 1FTNA 1OFIA 2BM1A 3CXUA 4LBWA 4WFKA 4K03A 5AK0A 3GGDA 3KQKA 5CCEA 3LT5A 4C0XA 1DEOA 1EFTA 4X54A 4EUFA 5IBRA 3S2FA 5C1OA 5ELXA 2FSUA 3BH0A 3DR3A 3GUVA 4MLDA 4MS4A 3C9TA 3ZGZA 3NO4A 3SC4A 3IEQA 2QYHA 1UJMA 3NGXA 1A88A 3I64A 4W7IA 3RQIA 3X1ZA 4LYGA 1LBEA 3WSWA 1GILA 1GLGA 1PJBA 1VPVA 1DTSA 3B1YA 4M6WA 2GCOB 2G7ZA 1FX0A 1QFXA 2B5VA 4I2VA 2JLCA 5TPWB 3WDMA 4DPMA 5CA0B 3TRJA 4OHBA 3A4TA 4ERXA 2OC4A 1JIKA 1C1HA 5LWHA 1UJNA 2GILA 2XVAA 3CLRC 4UEJA 1EVLA 3RVQA 4RE5A 1VE3A 1XHLA 2Z04A 3FWNA 3INYA 3K2QA 1XQ6A 3ENQA 4W6QA 4YFYA 4JVOA 4E94A 2QRHA 4RKFA 4JT2A 1L5MA 1ZGZA 1K3UB 1ZHHA 2MYNA 3I45A 2ECKA 3FNRA 3JYPA 4CTOA 4JBLA 2J7PD 2VAVA 3NALA 4R8MA 4A8JC 1QVZA 4EGSA 3FUCA 3G1WA 4J7UA 1XXHB 4GZ3A 1AF4A 1Z3CA 1TO1E 5BN1A 5ALZA 4REMA 1A9ZA 3OEYA 3AFGA 1PWZA 3PUYA 3WRYA 3G6EF 2VP2A 2HPAA 3R3JA 1MEEA 5FL7D 1SCAA 2BKVA 1NW7A 4ZCSA 4B84A 4B76A 1E0AA 3AB3A 1N8KA 4NOJA 4R7GA 4TS9A 2ODEA 3SX0A 2C5BA 1IMOA 4CLRA 1XA0A 1W36D 4NBRA 4OI0A 1K8XB 3QBEA 2ZRFA 4W82A 1XLWA 1BE0A 2HLDD 2RHMA 5JBQA 3IP7A 1D2NA 1S72F 5AK4A 3EDQA 4LYJA 1C3OA 1IBCA 1XYVA 1UDCA 1U8EA 2HRYA 4UEQA 1Y1TA 5D7BA 3GT3A 3KP1A 2L69A 4TUYB 1VQNF 1FDTA 1PHPA 1RVDA 3JSAA 4G0VA 2NYVA 2NNWB 4KOAA 3WRYC 1MIOB 2XB4A 3A05A 4B3SB 1JKJA 5KMGB 3EWAA 1E9EA 1CUDA 2CW4A 3OLZA 4OKSA 5D5PA 5DE3A 5IM5A 3WKBA 4YMLA 4HDNB 3P2EA 5K6AA 4OA5A 10MHA 1GQYA 4RFLA 1NXVA 4HQ0A 3SD7A 1XV5A 4R5HA 5IMBA 5CEFA 4LHZA 2PX4A 1AHPA 1JWLA 3EC1A 2B78A 3TPFA 2JGKA 1WZNA 2AZDA 2M32A 1MQ8B 3BDAA 3O7MA 1E2KA 3CNNA 3BGVA 3ID6C 1J2YA 4PGGA 3MTJA 3IUQA 4QKQA 4ZANA 3LHKA 5BMVF 2BJVA 3PPIA 4KAXA 5CHYA 1OY1A 4JHLA 1M90H 1DUVG 2PLNA 4OPMA 4MI3A 2EXXA 3O75A 4QELA 1HT0A 1B16A 4UBJA 4E5SA 1P0CA 2JIDA 3PJGA 1LBIA 4IHQA 2ZI7A 2WABA 4CEJA 1CUHA 1FP4A 2RGXA 3KTOA 2H0QA 2WI8A 1A8QA 5CVDA 3FZNA 3FCEA 4DG8A 4F1WA 3RVSA 2QVBA 1IPEA 1W30A 1UBSB 2VZ8A 5E4TA 2CVZA 2E3JA 3ZTYA 2NO7A 3C3EA 3MAGA 4WASA 2YMLA 4V2IA 4FDUA 4DW8A 3RVMA 1ZI9A 2VXBA 4IRUB 5GIOC 1ORIA 3VSBA 4C6SA 2LCAA 3QWAA 3T12A 5JAZA 1W4BA 1X42A 2OTMA 1N5MA 5DI3B 4PYIA 5CDSA 2Q28A 3AFMA 3R24A 2ON6A 3A9RA 3HEBA 2DCUA 5CH3A 2YJGA 4R6WA 3H5VA 4O6VA 2PX5A 1HE8B 1PJQA 3PF9A 1V37A 3G59A 5BP7A 2BISA 3M6WA 1M1KH 1CK4A 1EDEA 5T4BA 3NYQA 1JJ2F 1GADO 3ONNA 3BZUA 5BQ5A 1A2QA 4A6PA 5E0OA 3LUDA 4B9EA 3CM0A 1G5HA 1NGSA 4ALNA 3MZ0A 1CRWG 1P4AA 2RGBA 4PO9A 3WWCA 5FPPA 1PR2A 3KD2A 5FDFA 1HT3A 2F9LA 4BBAA 3DKIA 1SVLA 1EXMA 4HNHA 2B6NA 2JLBA 2O9JA 3CGGA 4RVHA 1OD6A 1LLUA 2HLPA 2QGFA 2VSFA 4UBOA 4EPRA 1JBEA 5ELMA 2PANA 2YS6A 1NN0A 3FZEA 3FMPB 4X92A 4QEKA 3SS7X 4BQNA 4CR7A 3FDJA 2GCIA 4G0ZA 4I55A 4TLAA 3RTGA 3W5BA 3W90A 3GJRA 4D0NA 3WLNA 1UP6A 3KC2A 5FUYA 4C7OA 3AJDA 3OKCA 2JI9A 4CIWA 1PX0A 2QUAA 3FMVA 3ENNA 4BX2A 4C1BA 1SD1A 1XO1A 1RBZA 1XUOA 2BDEA 1TO6A 3O2NA 2ZBFA 5DHQA 1KKLA 3B1KA 4MI1A 5A3QA 4DJDC 3BCHA 2D1YA 1W0KD 3M1IA 1JQJC 1OWNA 4P9NA 3UUWA 4CL3A 4I4TB 2VI5A 2TYSB 3MQWA 4HQ6A 3EG9A 2Q3DA 1BCRB 1IY0A 1M76A 2I4IA 3JYOA 3CXCF 2QHXA 1LK0A 3VKVA 1VJ5A 4JMLA 1RWKA 1X1TA 3A3KA 2MSWA 1AXEA 3PZBA 2P65A 2C4HA 3P2OA 4LWQA 2EW8A 1AQJA 1PDVA 2QYTA 4RTOA 2QF7A 1PI3A 5ALGA 1G3RA 1XL0A 2VNSA 3IVXA 4K3VA 1XEFA 4KRYA 4LISA 3WB0A 3I2JA 4KUGA 2ATVA 3BGIA 4TLDA 2VYVD 3E1SA 1JDVA 4PBTA 4XWTA 4G0YA 2ZB8A 4LJ9A 3VNQA 3FKJA 3K8YA 2VDMB 3KWJA 4UBKA 2B6HA 2J6CA 2BZGA 2XNJA 1R27A 4BCDA 2AR7A 5DHAA 4N5HX 3VH1A 2HADA 3LCUA 4GEGA 3RT1A 4GGMX 2GRJA 4PHTA 4XDGA 3RS8A 5KB3A 1PYDA 3S4YA 2JIBA 2UVPB 1TUGA 5FOQA 4MIEA 4TV9F 4Y6PA 4FWBA 1DWPA 3ADKA 1UT5A 2H4JA 4ZRDA 1VIMA 2UXCB 3Q85A 1NDUA 3ZQ6A 2D74A 2VNJA 4LRXA 2AC7A 2QL7A 3GEEA 5K8IA 5J23A 3KG2A 4ZEWA 5ALEA 2JJQA 4BV2A 3LHFA 1N1DA 2ZF8A 1OXXK 2L19A 1ZVVA 1C3XA 4DIDA 1GDHA 2IQ5A 2ZYDA 2OM2A 4NHEA 4EPYA 2HA3A 3N8NA 2DY0A 3TIVA 2VS1A 1JHQA 2PM8A 4PLYA 4CTNA 1EB9A 1ZQ1A 1P62B 3CPJB 4I08A 4L3WA 5ELLA 4KXUA 4BO9A 1OAKA 3HGTA 1EK0A 4QPPA 2LBXA 3TSCA 1PWEA 4O2LA 1DX6A 2QDKA 5DFAA 2JFPA 2Q6VA 4B0PA 1B43A 1G21E 3GCGA 2ZB4A 3AIMA 3Q3HA 1NMXA 2CLHB 2OBYA 3SJCA 1JWAB 3C5WP 3VJKA 3KU4A 3KJJA 1G8KA 3G9TA 3TQCA 1C9DB 3KJFA 4NAHA 3WL7A 1I5EA 2C96A 2IF2A 3GIDA 5HXUA 2A1IA 1F8FA 3KB8A 3K9HA 4HAIA 2PU5A 5D85A 3MUFA 3RREA 4BKPA 4D81A 5EXTA 1NUUA 4EAAA 1VPWA 3HDVA 4BGIA 1M2WA 2OO5C 3EUEA 3PKJA 1X38A 3QWBA 5T64A 3T7SA 5KTSA 1KKUA 4OGKA 4GLFA 4BMZA 2SHKA 3IKLA 5BWLA 4Y9UA 4KIUA 4J4BA 2J9ZB 3BRWD 3VJRA 3N7TA 2XGJA 3TZLA 2EFEB 1W85B 2V9PA 3BH6A 5AIBA 3B7WA 1OJ7A 3D01A 1Z0IA 3TWOA 3VOAA 1XRPA 1IU9A 4FEGA 4LZNA 4CEIA 2WZQA 3E81A 1UFRA 1BSVA 2OTLF 5AM5A 3TQRA 3QJ5A 4Q19A 2H1CA 3B1JA 1GT91 2O2XA 5CFZA 2I7VA 3KPWA 4O1MA 4QFBA 3VR6A 4BT2A 1QYVA 3THWB 3AU9A 4U7HA 4R40B 1CUVA 2PVSA 3KR2A 2IS6A 1S2GA 3GVHA 1TJYA 3MYRA 3IP8A 1Y6RA 4TMFA 4CMEC 5A3SA 2QVZX 1E1KA 3DOEA 3QVUA 4MHOA 3IQEA 4BUZA 5I45A 1VL2A 1MJGM 1EDZA 3D02A 5KJCA 2IIVA 2VC2B 4FGLA 2X9GA 1TAQA 4PYOA 4JT4A 1WPRA 5JJ5A 2ZUFA 1PEAA 1KTIA 3H9CA 3K6KA 1M2FA 4DUGA 3PLAC 4PFQA 2OAP1 4JBGA 2B1QA 4IIJF 4CLXA 5BN5A 1LTQA 1O5IA 4RKRA 4QO7A 4FDMA 1N3YA 2ZI6A 2G9ZA 1L8QA 3EN0A 1LPBB 2EVWX 3CRVA 2IXFA 5C5DA 1XTSA 2VYNA 1TT5B 4QSHA 1BE8A 2WOJA 4RVFA 4IKPA 2E49A 2HF7A 2HGSA 3L06A 3BC1A 4CQNA 1KGDA 1GKYA 2V0GA 1C9MA 3N4ZA 3UT5A 3O8BA 5FNVB 1SG0A 1ZK1A 2ODNA 3BE4A 3ODPA 4HLCA 2I2BA 4BEJA 4C2BA 4QPNA 1Q7BA 2V1XA 4BJHB 3L9XA 1XC7A 2R0QC 2IZ0A 2XZLA 2N46A 1H3NA 2X13A 4PHCA 2FSFA 4F6RA 3ZO8A 4YUWA 2VZLA 2YL2A 4H1TA 1G5IA 2VDKB 2W2PA 5CUQA 1AVTA 3AG5A 3WGZA 5DTQA 1OZFA 3MINA 2Q45A 4OL9A 3JZIA 1ZY2A 1NFRA 4DJTA 2JFFA 4HGYA 1YA6A 3M6XA 2XZPA 2VUIB 2PG3A 4NCHA 4R7ZA 3MMZA 1ZK0A 3H1PA 3MS7A 1I7NA 3AHIA 1U4OA 4XX1A 5JDCA 5K45A 2YHBA 3EASA 4FOPA 4G1UC 4O02B 1U0LA 2I1LA 1GQQA 1XU9A 3ANLA 3MWLA 4EYKA 5LLTA 3NTVA 5AI4A 2ZRPA 3PFNA 3EGDA 1K68A 3TLGB 1R16A 4BATA 3HLYA 1TCUA 3WFIA 1XCBA 4D26A 3Q6IA 4B8ZA 2ZQ5A 3EEIA 2CL5A 1QLHA 2CJYA 3KK0A 4XVRA 3V1YA 1N2BA 4WN3A 2G3YA 3G8DA 1WF6A 2DSTA 3QF4A 1U0JA 5B64A 5L6LB 1NSFA 1Z2EA 4EDFA 1NJ6A 2GYUA 3N2IA 1DBIA 4MKZA 4LSGA 4EHDA 2OECA 1T0PA 1GUFA 2C2OA 4IDEA 2A2ZA 2CXOA 1U7PA 4BMCA 2PZFA 3K53A 1PSWA 2EKQA 4G4GA 2Y1WA 5H8WA 2TMDA 1AO3A 1U3LA 2VJAA 3UAZA 2QJWA 4IXMA 2TMKA 1GZSA 3AETB 4U5XA 2G6BA 1TTQB 5GGXA 3Q40A 4R1PA 1KSGA 2B33A 3EEQA 2GZAA 3WMXA 4B47A 1P61B 1CZUA 1EVQA 2Y2VA 4BBPA 6LDHA 2ORWA 1NMSA 1NSTA 3UMCA 5J4VA 9MHTA 3Q87B 4KBGA 2V1UA 2IBTA 3NWOA 5BSHA 4MQEB 5GANK 2YXNA 4NAUA 3ZDYB 3UBTA 1E3WB 1I80A 1RPTA 2HNKA 4N7BA 4HDSB 4LDQA 1H2WA 3BSYA 3B89A 3OFVA 4A0RA 2Z01A 2QMEA 3J81M 1F2UA 1FRNA 1KNQA 1QE5A 2QRKA 3LNCA 3O4VA 2EIXA 4IIYA 2O5VA 3G13A 3R77A 5BSMA 1X7PA 4QD3A 4MA0A 1IBKB 3CLVA 3H11B 4PGMA 3DAHA 3PD7A 1QGDA 3RWOA 2XMSA 3O6VA 3VQTA 1Q57A 4LJRA 2NP7A 5ALQA 1M0TA 4EFNA 5CAEA 1Z08A 5KWJA 3JATA 2IITA 4BN0A 3DDCA 4HQNA 2PYDA 5CJ2A 3PYLA 1EUCA 3ILSA 4LI0A 2IQIA 5BN3B 3COVA 1ZDMA 1MA0A 5FA5A 2GOYA 4BP3A 4OHWA 4RLFA 5BSUA 5BYBA 5EXEA 1IHYA 3D4NA 4L2IA 1XTVA 2JFBA 5EZQA 3KX2A 2V7QA 4XB2A 5FTKA 1UBNA 2OAQ1 1WV1A 2CHFA 3F6EX 1C0LA 1COZA 3A70A 3G1UA 4FIDA 2XGGA 2X7HA 1LWNA 4GVLA 3W5CA 1R18A 2FGKA 3I09A 2J45A 3NJRA 4BVJA 4QBHA 1EG7A 1YS9A 3I76A 1DQYA 3N2GB 2ONZA 2VK2A 4EPTA 2HUNA 3IGFA 4YT5A 1H6DA 4RKEA 1DQNA 5GJCA 4IRMA 4L8GA 3CVJA 1H66A 3GJ5A 3BSSA 4B87A 2D7JA 1E94E 3DXZA 3AJRA 1ORWA 1UFOA 2ONCA 2NU9B 1KEPA 3WA7A 2CLSA 2J3HA 2BJHA 4UVGA 4OJNA 1CNFA 1LGYA 2YMQA 1K4KA 1CF2O 3G2OA 3NDIA 4GPBA 4BGDA 1EH5A 4MVJH 3W34A 5IVPA 4JUIA 4ACBA 3KZMA 2QR3A 4JI4B 3U4MA 3U37A 1N5RA 1WCIB 4RHFA 1HEIA 3IHLA 1Y3HA 3NBXX 2W2MA 4H0NA 1ECFA 4YASA 2FDRA 2M6SA 2QI9F 3IOBA 4DNQA 4FWTA 2G1UA 5KPDA 3OZIA 4PSCA 4NOKA 1PQYA 2IUYA 2K87A 4KN8A 3VH2A 4EJFA 2F3PA 3T5PA 221PA 4AG3A 3MHTA 3RF6A 2A0KA 2C58A 5TY0A 1WB6A 4QYMA 1LPMA 4O0MA 1LI4A 2D1QA 2QZPA 5G0VA 4H31A 2XWQA 4NJEB 5AJXA 5C81A 3TN7A 2ZR7A 5A5VA 4UNRA 4D41A 2P3SA 1HE2A 2EZ9A 2E9SA 2YWRA 5T4HA 1CEYA 1TQDA 1U2EA 4NU8X 3PD0A 2QRVB 4IFIA 1JG4A 2Q3FA 3A9CA 3GT0A 3FCYA 4YRGA 1L4KA 3KE8A 5KNDA 4DKJA 4FS8A 1VBFA 3V8NA 1W5BA 3EHDA 4MCIA 5IJ9A 2YXPX 4IXNA 3CNLA 4IOJA 1QS0B 3EAQA 4H1UA 1LB1B 2EX0A 2FQ1A 3SOPA 4RH1A 1GUAA 1XN1A 2EERA 1NATA 2IXEA 4R2WA 4D9HA 4WCFC 4E1AA 1V8OA 3C39A 4I99A 1ZUHA 4EFKA 4WOKA 3HKBB 1QH1A 4BASA 1I7SB 4YX9A 5A6SA 3FPCA 3U0OA 1TM4E 2DERA 5GAPK 1LLDA 4OHFA 5EUMA 1XTPA 4WN9A 3T7AA 1V47A 3MT0A 4L51A 3QTBA 4AJPA 1B1AA 2V7WA 4A9AA