3VOAA

Staphylococcus aureus ftsz 12-316 gdp-form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
307
structure length
307
Chain Sequence
GHMATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 114
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3voaA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3voaA01
1W5BA 5EIBC 5JCOC 3RYCB 2BTOA 2RHJA 3WGMA 4B45A 4EB6B 5J2UA 4DXDA 5CB4A 5J2TB 3JAWA 5JQGA 4FFBA 4F6RB 4X1IB 1TUBA 4U3JA 4I4TB 4EI9A 5GONA 5JVDB 5IJ0A 3N2KA 3VPAA 3JAWB 2RHHA 4E6EA 5KX5A 4IIJB 4O4IA 3V3TA 5EZYA 3R4VA 1SA0B 4IHJA 4X1YB 3WGLA 5JCOA 5CA0A 4O2BB 3VO8A 3JARB 5IJ9B 3JALA 5BMVA 4I50A 4O4HB 5MN6A 4M8IA 5LP6C 3JATA 4O2AB 4TUYB 5KMGB 3M89A 5C8YB 3E22A 1TVKB 4ZOLA 5LYJA 3WGNA 4U39A 1W581 3JATB 3RYHA 1FSZA 3HKCA 2XKBA 2VAPA 3N2GA 1RLUA 3VO9A 5LYJB 2VAMA 4YJ3A 5J2UB 1W5AA 4EI8A 4WBNA 5CB4B 5IYZA 5JQGB 4ZI7A 4FFBB 1JFFA 4YJ2A 5LP6A 1TUBB 1Z5WA 4U3JB 5JH7A 5GONB 5IJ0B 3N2KB 5ITZA 4O4LA 2R751 1RQ2A 5LP6B 5KX5B 4O4IB 3RYFA 5FNVA 5EZYB 3JASA 2R6R1 5ITZB 4IHJB 4O4LB 2RHOA 5CA0B 3UT5A 3ZIDA 4X1KA 4EI7A 3JALB 3HKDA 4KWEA 4LNUA 4O4JA 4I50B 5BMVB 1W59A 5CA1A 3VOAA 4TV9A 3UT5B 4I55A 4HNAA 3ZBPA 3E22B 1FFXA 4DRXA 4TV8A 4ZOLB 2GVIA 3RYHB 3HKCB 3WGKA 3HKEA 4ZHQA 3JAKA 3N2GB 4X20A 3RYIA 2BTQA 5EYPA 4YJ3B 5LOVA 4WBNB 5IYZB 4YJ2B 2Q1XA 5LA6A 1JFFB 4ZI7B 5LXTA 5JH7B 3RYCA 4EB6A 3RB8A 5J2TA 3CB2A 4F6RA 4X1IA 4B46A 3RYFB 3WGJA 1W5FA 5FNVB 3VOBA 3M8KA 4I4TA 3JASB 3ZBQA 1OFUA 5JVDA 4IIJA 3C8LA 2VXYA 4X1KB 3HKDB 4LNUB 1SA0A 4O4JB 4X1YA 1RQ7A 2RHLA 5CA1B 4O2BA 4TV9B 2Q1YA 4I55B 3JARA 4HNAB 5IJ9A 5EIBD 1FFXB 5MN5A 4DRXB 4O4HA 4TV8B 2VAWA 1W5EA 4TUYA 4O2AA 5KMGA 3HKEB 4ZHQB 3JAKB 1TVKA 4X20B 5C8YA 2BTQB 3HKBA 3RYIB 5EYPB 2XKAA 5LOVB 5M7EA 4XCQA 5LA6B 1Z5VA 3HKBB 5MN4A 5LXTB
chains in the Genus database with same CATH superfamily
1N9ZA 3L01A 1V96A 1XTZA 3UAYA 4MULA 2ABWA 1FYWA 4EG7A 4AWBA 1KIMA 1D2HA 4MLDA 4BFWA 3JCMM 4IXMA 1U7UA 2ZEJA 2XGGA 5IJ0A 1T0HB 4UAUA 1EVLA 2V0CA 4EX7A 5EMNA 2Z08A 5LQSA 4M1MA 2V8OA 3KOYA 3O74A 2NT3A 1KOJA 1FPQA 1OA1A 2SKEA 3FCOA 1GPMA 2FPLA 1HBJA 4IS2A 5F2NA 1K86A 1OGJA 3U7JA 4IHKA 2VYCA 4DVJA 3CX7A 4X3LA 4O4HF 4IDAA 3M6MD 3PZRA 2PNJA 3RS8A 2P5SA 5J5CA 3B7PA 4MWDA 5IDWA 3N2IA 3PEYA 3TBFA 2EKPA 1UAYA 1KH3A 2B4AA 2FU5C 4KFUA 1J5EB 1RU3A 3FX2A 4NE7A 3O5AA 4FYJA 5LYJB 2P78A 1YL6A 3KYBA 4YQEA 2JI7A 3DXXA 4OHZA 3FI9A 4B3BA 5BV7A 1Q0TA 3T3GA 1SHZA 4HF7A 1HETA 3CX8A 5PGMA 2IV7A 3RJTA 2VSYA 3FLBA 3ER8A 2R6AA 3G5TA 3RT1A 3DCIA 4RKEA 2O23A 1UDBA 5GQSA 4OXNA 5KTOA 4ARCA 4EQ6B 1PQUA 3H9GA 3L0CA 1QCDA 4CHTA 2BH9A 3DKVA 1PV1A 2VCYA 1G7SA 3G49A 1YBFA 4J0EA 4PPFA 5K8VA 1L8QA 1OH7A 3LKZA 4RPHA 2JRLA 1BTOA 3JQAB 3OHMA 1XRLA 3B3JA 3H1BA 3E5MA 3F7MA 3V55A 3CXUA 5J58A 3W2IA 3V7QA 3GJQA 1V35A 4UUBA 1KHTA 2ZYWX 4G07A 2QTCA 3WLOA 4DDHA 1TEHA 1QU3A 4QYIB 3L7MA 1G5QA 3FCYA 4I55F 2AOWA 4BATA 2G88A 1CUSA 3OIUA 1CUAA 5BUCA 4BRUA 1MJ5A 3R3WA 3GVHA 4G1MB 1YHYA 5EYPA 4IMRA 1PFUA 4NOMA 4Z3KA 2OTMA 3X1ZA 4PC7A 2XITA 2QT1A 3AOGA 2R7NA 1FP6A 3OLWA 1OZHA 2Q46A 4O0MA 5FTKA 3TW8A 5LXTA 2YV1A 4KLNA 4U2DA 5JMWA 2C4TA 4Q7LA 2XWQA 3CVYA 3GGJA 5KYUA 5T8KA 3S70A 4X3PA 1JE1A 3SVZA 3O8BA 1NMXA 2C3YA 2X8JB 5IG2A 1EP1B 4EP1A 3KJHA 2R8OA 1FE8A 1VL5A 3M4ZA 2AUNA 1EUCB 3K0EA 1JWLA 3BMOA 4Q12A 5HUQA 1G291 2H92A 2WILA 2XT6A 2CHSA 2WKWA 3KWJA 4D41A 4LDRA 1W0JA 5TSDA 3NATA 2IPAB 1A7AA 4XTCS 2CBXA 3FPBA 3IODA 1ZVKA 2ZUEA 3N2EA 4J1TA 4M38A 3P0EA 3RS7A 1JAZA 4GPD1 4HG2A 2XMBA 1WQ1R 4DA4A 1ZQ1A 5DNYB 2HMTA 3VSAA 1YA6A 1SZCA 4RNDB 5CX1B 1J23A 2H8GA 3R8FA 1MV5A 3QSGA 3MWDA 2XQVA 4IV5A 1E2UA 4WXRA 2PFSA 3S06A 4OHPA 1RAHA 1EGVB 2P35A 4BZWA 4CIVA 2R8ZA 2H1VA 2TMGA 3N6VA 2FMFA 3CLTC 4KXLA 4GGOA 4M0PA 3L5OA 2C5LA 3M1LA 1X9IA 4OFBA 4BCCA 5A5EA 2C98A 1RDFA 4G65A 1ACJA 5DASA 2HMYB 3FCSB 5JSFA 1Z6ZA 1IZZA 1CJUC 1MGPA 2BDUA 3EGCA 3VHRA 4F91B 1C50A 4KXUA 1TU3A 2WWGA 2ZI4A 1ZNYA 4NMXB 4AX8A 3ER9A 3L7CA 4Q3LA 1QTRA 4K88A 1L7MA 2O0LA 2G9NA 3H04A 4YUWA 3ZOPA 2VXOA 3HJAA 1CQZA 4QU9A 3TLYA 3ESQA 5H4GA 2B4RO 2I1VB 4URXR 4L5BA 1KK1A 2Y67A 3HGQA 5KQRA 1Z88A 2QKYA 4LRQA 5JYCA 4GNRA 1TM5E 2GQ0A 4BNNA 3UJBA 4LBYA 2DUWA 4WZAA 2CT8A 3ELUA 1TT5B 3QXHA 3VV3A 4QUJA 1NW8A 4G4YA 1HRKA 4KE9A 3N75A 1HR0B 1VLQA 2QY6A 1XDSA 1S4QA 2JLSA 3R23A 3QHDA 1QZUA 4TL9A 4XIJA 5CT5A 3E53A 5KYTA 1X2EA 3RYHA 1X9GA 2AKAB 2W8ZA 5J1SB 5GINC 3CF4G 4NHOA 1Q19A 4BMVA 4OQ4A 5E1BA 4BNKA 2WMYA 1YQWA 3KIPA 3EOAI 5FRDA 5HJEA 2PKWA 3JZDA 4PLYA 2XI4A 1QYRA 2QVLA 2MR6A 1ZINA 1C29B 3E9DA 4G4IA 2PRYA 2RH5A 3UJPA 2XVAA 2QRLA 1K6XA 2J9XB 2VPXA 2WUGA 2PT7A 1YA4A 2OG1A 3EN0A 3I2KA 5I4KA 4BGUA 2W6QA 4IL5A 4L85A 3WSVA 2AEFA 2CK3D 2D13A 3CH5A 3L8ZA 4BNGA 3ZDYB 3B3FA 2C9MA 1YNSA 1ZWLA 1O8BA 3GEEA 5EERA 3Q6MA 2H1FA 1DKRA 1R12A 1H2RS 2WHRA 4KWEA 2MIIA 2MSNA 3FYHA 4HATA 3K53A 1DO8A 4DLWA 4WACA 3ZWAA 4CW7A 3HA3A 3QLUC 4EFLA 4KPEC 2C4VA 4QBGB 1FJXA 1AG9A 3S1AB 4M76B 3SLGA 4GZ5A 1RXUA 4Z7JA 3DNFA 4MH0R 4C43A 3C9UA 3E4CA 5TDHA 1Y34E 1C2YA 3M2TA 5LUAA 3OT5A 3T38A 3DLBA 3NDBB 5G41A 3ZVKA 1CY6A 1VLZA 1KNXA 3PRHA 1Q7TA 1AHHA 3CISA 1VK3A 3UMVA 5IDQA 2BKLA 5KYWA 4WSOA 3COSA 4S0ZA 2PQMA 2H9YA 2Z1DA 3C85A 3H3FA 1GPDG 2XD9A 1M2FA 2EF1A 1B8PA 3CN7A 3HI4A 1DQZA 3DFMA 1EX1A 1EXMA 1O57A 3CF6R 4IG9A 3T7EA 3VUEA 3JWEA 1WAMA 1Z68A 1XRQA 3FOWA 2OYCA 1L7EA 1K8ZB 4A03A 4F3TA 2IHZA 1SA0A 4V0ME 1OPXA 2H9IA 3CONA 3QA3E 2X8LA 1NN3A 3TW0A 3JRNA 3CW8X 1ZXBA 4HUTA 3ZIUA 4KREA 1GU1A 1MVLA 3O1JC 4MCIA 3MWEA 3MD0A 3VO1A 4GNKA 5IHPA 1NT4A 1GKYA 1WUKS 2B8WA 5DBIA 3VPCA 3RYIB 1XVLA 1YULA 3S8YA 2PZFA 1GG8A 2WT9A 2IDMA 2XUGA 3RPEA 3HNOA 3SJBA 2C77A 1M5UA 1NI3A 1K8XB 1P2VA 1J7KA 1VC2A 2PVSA 5BQXA 1SIUA 1V5WA 1NX6A 2IVFA 4L6IA 2GD0A 2J59A 5AKYA 1BCSA 3MTIA 5FTNA 3GDFA 1IVSA 3OQMA 1CUBA 3I6MA 3FMVA 4AY5A 2ISCA 1R4MB 2C95A 3GT7A 3TSCA 1V4VA 5JVDB 4F96A 1RVV1 1J0BA 3DOOA 3VBCA 3M6UA 4AN1A 2C4UA 5B3JA 2OCKA 4N03A 4XE5A 3TBKA 5TVKA 1Z38A 3B51X 1ZUD1 2JIRA 4F5ZA 2ENUA 2HCFA 3QVOA 1R3DA 5I6DA 4N3NA 1WVGA 2QBYB 4JZYA 3FZYA 2ZBRA 3VR4A 3U16A 2XOKA 2CFOA 3O47A 4JBHA 2G0TA 3L5KA 4QBKA 5B64A 4G0QA 1KZ6A 1E2KA 1Q6YA 5JXIA 3L18A 2CCKA 2IEAA 4N7JA 1YAHA 3VTAA 1QTIA 3KLBA 4C03A 2IX9A 1H47A 1GPLA 2JJ1A 3CLRD 3HI6A 1T5OA 3J7AR 1Y42X 2YMMA 3IEIA 3OBWA 3PPIA 2PGAA 4LRTB 4LJ6A 3JD0A 4KPGA 4QOHA 1JA1A 2ZYRA 4G85A 2HWUA 4IIXA 4MEAA 4WBNA 1M33A 4P22A 3RUHA 4F84A 3LHIA 1H9CA 2E89A 1C0PA 2VXBA 3EXG2 3Q98A 1JKFA 4FOSA 2R44A 4Q15A 4S05A 2RGCA 5GONB 1NYRA 3IULA 3KDPA 4QJ5A 2EZTA 2QPTA 5I45A 4NABA 1KMCA 2WTUA 3TD6A 4O4LF 5H82A 3R0IA 2PBZA 3QLVA 4LOLA 2A1UB 1VLLA 2NZUG 4DLNA 3K5WA 4RZIA 3UT5A 1GPBA 1RLTA 3HUEA 2ZSFA 1QG0A 3H5LA 3NBXX 4QGHA 4R6WA 4JQCA 3ANXA 4LE2A 2AG8A 1LDBA 3FROA 4FIDA 4DMGA 4KFSA 4DADA 1A88A 4RHAA 2O2DA 4EUFA 1OXVA 1KC3A 1U3WA 2AXQA 2BY4A 2FWAA 4F4IA 4F3KA 4QOEA 1KBZA 1O54A 2ZRMA 1QF9A 3M6WA 2VNKA 4LSGA 4RTKA 3OW2F 1QSGA 2D2FA 1T1GA 2W4QA 5HQJA 3IUBA 1JPVA 2H2DA 3OSUA 3BE8A 3S8EA 1YZTA 2Z8XA 4OQPA 4C4TA 3BK7A 3DBLB 3MTGA 2UZIR 4C1NA 4D7AA 1EFVA 2EL7A 1K7CA 2V7XA 1P6UA 2RB5A 2BFOA 4FNMA 1J7HA 3TW6A 5BOSB 1RYHA 3IBSA 3VOBA 2IXGA 4D4MA 5KWSA 3LUBA 1UBCA 3KLPX 3WR5A 5JD4A 3R9XA 4YMWA 1T43A 2OE2A 3UJHA 4K03A 2XB9A 4ZODA 2DKNA 1E1DA 2QSUA 4KQMA 4TLBA 2TYSB 2J0UB 4MGHA 5JS2A 4BRSA 2RHLA 1IULA 5KOIA 5EO3A 2WWXA 4JOBA 4KQKA 3TQSA 4B9AA 4KX3A 4Q3NA 2UUOA 5CLQA 2BBTA 2JIQA 3IMPA 3AYXB 3BCUA 4Q1EA 5BV8A 2W5UA 4RQTA 3P0JA 4A2PA 3FNHA 5MN5A 1S2MA 4IICA 4DVGA 4LOHA 3QQPA 4MGKR 4U2FA 2VEDA 4DCJA 4DR5B 1YZQA 4UAJA 2ZE6A 5AESA 3AEQA 2QI9F 2CLDX 2V4UA 3TN7A 5K3EA 2PG3A 4DV4B 3OU7A 3PFIA 2WNHA 3PVSA 3ZY4A 3DVAA 3IQDB 1FNKA 4QPDA 2C5BA 1I2ZA 3ADOA 1W46A 2EIXA 3DWIA 1K5PA 2I1LA 4TSKA 4WECA 4X95A 5ECGC 4RSRA 3MCAB 2HQOA 1Z28A 4PYKA 4F93B 3KSBC 1OY1A 2KWIA 4HQFA 4X60A 3R3HA 3Q7PA 1TMKA 4M1QA 1JQKA 4NVRA 4Y6RA 4R9SA 4YRRA 5DX8A 4OD0A 5CB4F 2ZP1A 3PFGA 2JLAA 3OIYA 1K66A 1ZCJA 4LC0A 3WG9A 5BV2P 1ZMRA 2VPIA 4M3NA 3SG0A 3OIWA 5ALTA 3C3AA 3VISA 4ZJYA 2O8FA 3BRWD 3A1EA 3E2IA 4L76A 2R79A 1C7QA 3MPUA 4PZDA 4M9RA 3BJZA 3ZK9A 1XKQA 4P7JA 2XYGA 4BVGA 2FGKA 3R5XA 1FJGB 1QGYA 1WMEA 1AQ6A 1JLHA 4GM4A 3SWWA 2X14A 4I5DA 4Q3EA 1HG1A 4DMCA 1RC8A 3ZHQA 2X9VA 4ZVMA 1JLRA 3E3LA 2QNIA 1BRMA 2IOFK 4A5OA 1D2RA 1O5IA 5EAIA 1A8QA 1XVUA 5TT1A 1FS6A 4F5DA 2AJTA 2IEIA 3FDIA 5ALDA 1R8QA 1HQKA 3JQ9C 2WMNB 4TN1A 5EXSA 3JVDA 3DFUA 3AM4A 4X8HA 1IZ8A 3WDKA 5BWLA 4DR2B 2HRUA 1GLNA 2GA9A 2OBNA 3A3KA 4GZ3A 1Z5WA 4RPIA 4B3IA 2I67A 4IZOA 2C5FA 2X6TA 3B1JA 3RIHA 4QU8A 2NUAA 3U3RA 2HFKA 2I7XA 3QJYA 3WHLA 4BBAA 1CLIA 3H87A 3LHFA 4E32A 3QUTA 1HY3A 3C7CB 3FYUB 5BNZA 2BR4A 2ZANA 3SR3A 2HB6A 4Q16A 1DV1A 4CQMD 3EDYA 1FSSA 3H86A 4XWWA 1Z2OX 4XLLA 4TGLA 4CM1A 3EFEA 3VUFA 3R41A 4I50B 3E1GA 1MX9A 3VOAA 1RHKA 2OSBA 2KW5A 4BV3A 3NIGB 3L7IA 1L4KA 1U3DA 4G4ZA 2VGNA 3QV1A 5E6RA 1FFXA 1MPXA 4DRXA 5A7GA 4EUSA 1H8HD 3GEHA 4WCFB 5KOJB 2BO1A 1XBIA 1D04A 3AP1A 1T2VA 3PKZA 4QJ4A 1QM5A 2AFHA 5HF6A 4LRUA 3ZOKA 1TW2A 1D2CA 3UKDA 4P35A 2GLTA 2V74B 5SZHB 2O8EB 1G5RA 5AFSA 2H65A 4INPA 1JBKA 3N8NA 4JJKA 1KC1A 3KVOA 4ZALA 3WGVA 1ZU4A 4Y2VA 2UVPB 4EHLA 4R69A 5CXUA 1SBZA 2I03A 1UP7A 5ARBA 2BEUB 3TBHA 2W11A 5ALUA 1QX4A 1FX0A 5JNVA 5AVRA 2MYNA 4JJ4A 1FJHA 1O9BA 5CFNA 4GYJA 1PR1A 3DBHA 4IDGA 4P31A 1DBIA 2EYUA 3AMVA 4N8SA 4S1NA 4C21A 4FT2A 2H11A 2AX3A 2Q1YA 4QTTB 4X7RA 2V3CC 4C2TA 3WYGA 2Q7XA 4QFCA 4B6PA 5J47A 2FVXA 1HSZA 1GCGA 1NQXA 2QZSA 2V0NA 3EW9A 1JI0A 1LW7A 1ZONA 4II3A 3LBFA 3Q9LA 1G8KA 4JX9A 2QP3A 3PV0A 4V0OA 3MAJA 1LLCA 1GRVA 2NNLD 4NYJR 2RHMA 2X4LA 4I99A 5CJPA 3JSXA 4WDRA 1UINA 5F4BA 3RC3A 3TFWA 3WIVA 1BGXT 1D4OA 4B8WA 2JA2A 4HEQA 1YFZA 2YOHA 4QPCA 4XIFA 2Y76A 3MINB 1ELOA 3QLTA 4TVBA 3UJ7A 1W48A 5EWRA 1YCFA 4ZTBA 1L3BA 1BWRA 3TKLA 1Y63A 2QN8A 3L8YA 2RB4A 2ZJ1A 3AV0B 3BDVA 3Q40A 3QE2A 3U1BA 2SKDA 1Y1PA 3WB2A 1NZDA 4ARZB 1D7OA 1BGWA 2O8DB 2NPIA 1DWUA 1A1VA 2Y2VA 2I3ZA 2HLDA 4D9FA 4MTCA 4G4GA 3DE3X 4O4IF 3NWJA 4HCJA 1IV3A 3R7WB 4ER5A 8OHMA 1Q20A 1Q82H 5IJ9B 1PLKA 3G7SA 5IC6A 3HHPA 1H2HA 3RFUA 1VPWA 1QK5A 2XQGA 2YY5A 4UFOA 3ASUA 5CIQA 4AS2A 4MITA 4E22A 4ID9A 2IL1A 1VRWA 2N75A 3LP6A 1V9CA 2E2WA 3LK7A 4Z8YA 3SC2B 5B58C 5AQ1A 4XB2A 4KQIA 4XTRA 3L46A 2UXCB 3N2YA 2RGYA 1YOVB 1G21A 2VJMB 4R1SA 2PKYX 4CKEB 4OYYA 1ENPA 4F04A 3HDHA 3QYJA 4H77A 4GPZA 4WN3A 4MP3A 3HK2A 2BN4A 4FSXA 5CFPA 3ZD8A 3IUQA 1DJMA 1ZGHA 4TLCA 2IXEA 2Z01A 1YXMA 1ZJZA 1G64A 2VK1A 1OI4A 1QZXA 1EQUA 3BXHA 1J9ZA 1LUAA 2NSDA 2OMKA 2QROA 5D3MA 5BN4B 4BNUA 4GU5A 1KGSA 1KI1A 1SBNE 1UBJS 1DKOA 2I3AA 3HB7A 5KJ6A 3ZWOA 5HG0A 1XQVA 4A1FA 1H66A 3QGMA 1IMJA 1TMGE 1YJCA 2CXXA 2W2LA 4FDAA 1XVVA 3GLHB 4EW1A 4ALMA 1GTRA 1O0SA 3W1WA 4BHTA 1KI6B 2QE7A 2FUG1 3RU9A 2AHOA 1L7VC 4CMCA 4XYMA 1NUQA 1WCWA 3I32A 2I0FA 1AS3A 2ZREA 3PQFA 4J0GA 3A70A 1CRLA 2DBYA 4L8GA 4NENA 4MLPA 4PCVA 5EJFA 2Q8NA 2UYQA 1F3OA 1XMQB 3G0IA 4DAEA 4GSKA 4DL9A 2VGMA 4RGBA 1F6BA 1S7CA 2Q8QA 1ZMXA 1NE2A 2HLHA 1ZW1A 2YYEA 3QLUA 1QV7A 4OJNA 4UHFA 2C54A 1RCTE 2RONA 4CM5A 4EMTA 2M6RA 3OPYA 2BC9A 2VRNA 4LXIA 3I04A 4JL6A 4HTFB 2XHZA 1WP9A 3HG7A 1RWOA 5FV7A 2ZRDA 1HDRA 3DEZA 3P4XA 1L5HA 3DHNA 1DTWA 2YUIA 4LX8A 5LIRA 4RMIA 1FUYB 1YTLA 1GLGA 4RH0A 3W7BA 1ZJJA 4OSOA 1ZICA 1E1NA 3V7UA 4N5NA 2QY9A 2HF8A 4X1YA 5H3LA 5TQVA 3EIHA 4TXMA 4XQCA 2CEAA 5FBKA 1WY7A 5FUQA 3GFBA 2XLBA 4JB2A 5JAMA 5GY7A 1T15A 1ZGAA 2FOIA 3SSNA 3IESA 3H16A 4C76A 3G3EA 1NW5A 3EEIA 2NZVG 3WWOA 3ZDXB 4ZT2A 3G71F 1FEZA 1DAEA 4DLXA 3L9WA 5EJ6A 1K6IA 2CZCA 1I3CA 4LDQA 4QBTA 3D6TB 1MENA 4HDMB 2BW0A 2UAGA 5LBTA 2JBWA 1WXHA 4EVIA 4CT0A 1P1BA 3CMMA 2AMLA 2QRKA 3KJEA 1NBME 3H2YA 4NESA 3TTVA 4MRNA 4CTMA 3WHIA 4C6TB 4GP7A 4Q7JB 3SYTA 1H85A 1PNVA 4MVJG 1E77A 2JCSA 1V11A 2Q5LA 3PQ5A 1RZUA 3AEKB 4H4DA 2JVIA 5ANRB 1NR5A 3W34A 3HDQA 4TLLB 4ERNA 4BB0A 5KKCA 1AC5A 2C2XA 4X7MA 3VO8A 5ALFA 4KXFB 2YW2A 1MRSA 1M67A 2GN9A 4H17A 4OSPA 4P0TA 3S5JA 2JFGA 5A2QA 1RHJA 3GQBA 1BS9A 4MW6A 5ERYA 2ZUTA 5A6VA 5EIXA 4OJTA 3EIXA 2GFIA 3P19A 4XZ3A 2V5AA 2PS3A 4MUIA 1E58A 1O77A 4CE6A 3S0JA 5A62A 3ERNA 3AHGA 2FF5A 2IP4A 2P0AA 2WT4A 3FKQA 1L5NA 4HYTA 4DJJA 2RKWA 4GP6A 3STYA 2NTNA 2ZU6A 1YS7A 3A2LA 2PSEA 3A6HA 4C7OB 3EX7C 2V6GA 3D3WB 2WA2A 4FS3A 1FFHA 1V7CA 4K2HA 2HRYA 3FLMA 1PG5A 4HPWA 1J7JA 2BR3A 3R0VA 3FKJA 4AM8A 1U63A 1AF4A 2CDRA 3CEPB 1SU6A 4UNPA 5DV9A 1VYUA 4XYEA 5ALYA 4PNHA 4PO8A 4DQVA 5A9SB 2BLLA 4IQGA 5K7SA 4MWSA 2E37A 2EJVA 2F9LA 1D2NA 2OYSA 1QS0A 3T7SA 2WD8A 1YJ5A 2XZTA 2NV6A 3Q0IA 4LQ4A 3LWZA 1K7XB 3Q7RA 3QSYA 2QJOA 2GD6A 1YIJF 1LJUA 1KI7A 2XYQA 4FILA 3SC4A 2NO6A 2ZUFA 4HWSA 4ZVVA 4UARA 1E3QA 1TIPA 4LZWA 1J5XA 1PHPA 2E82A 4L3VA 2WD7B 4GMKA 3RBVA 1E6LA 4WV3A 5JATA 3TCKA 1TYAE 2XUIA 5CPBA 4BGDA 2G07A 4G5OA 5AM5A 3YASA 3OFKA 5FEUA 2FUNB 3O3NB 3PNQA 2OPBA 2W6CX 1JEQA 3QXXA 3QZUA 4LXXA 2WALA 1JQLB 4EB3A 4F72A 1XWFA 3WWPA 4A2WA 3B3AA 4K40A 1XEWX 1C3EA 3CMCO 3BFJA 4OMCA 1UWLA 1W4BA 1G6Q1 2Q3MA 1B8NA 3PC4A 1FLNA 1S2IA 5KOHA 1PZHA 3G2MA 4F12A 1QAHA 1W47A 2W83A 1ECPA 3NBZC 4RA6A 4O8ZA 5AIAA 4D9MA 2QU7A 3B1XA 2J9YB 2Y6VA 5T41A 4Y0VA 2E5LB 5JZ9A 3RKUA 4RJLA 4QRHA 1KS2A 2IOFA 4JC8A 1C30A 3EUAA 2VQDA 4XWYA 1EFAA 4EJMA 5L3SA 4LNUB 2YINC 3HDJA 3MC1A 1FVHA 2NV0A 3HCOA 2XE4A 2ZS9A 4AMUA 1UOPA 3KVNA 3R0QA 4HN2A 1CUUA 4B62A 1I2BA 1TJPB 3HDGA 2YN4A 1EEHA 1P9NA 2CL7X 2YXBA 3D4LA 3HBNA 3WMGA 1T9BA 5K09A 1F7UA 2GJKA 4WJKB 1KSHA 4J4TA 1U1IA 5B2EA 2FN4A 3TXYA 2UUBB 4YUVA 3CUTA 3VJLA 4UM9D 5JO9A 3GO4A 4UZEA 1HFJA 2XIJA 4ZOQI 4J0KA 4HYQA 1XZKA 1Y7HA 1JWAB 4JEUA 1D4AA 3G2KA 3OJXA 5HR5A 1XU9A 3C9SA 3WGZA 1PGPA 2P9QA 4HXEB 1IQ0A 2R97A 1Q15A 3IQFA 5KVVA 3CNHA 4NEHB 2I29A 3A1FA 3B6KA 1CZUA 4PZYA 2B8EA 3KEFA 1M2VA 5KVAA 3I4LA 4GL2A 5KX5A 2A0KA 4FX2A 2YWGA 2Z9CA 1J8DA 1P2BA 1UBLS 1X7WA 3EEQA 4HH4A 1EZ1A 5DLYA 5AW4A 2QTHA 3HDVA 3IEKA 1N0UA 1HUQA 4JI3B 4IHJF 3SI7A 2G76A 4MRRA 3SSMA 3WYEA 5CTAA 2PEZA 3SOZA 2GKSA 3QU7A 4BRWA 2JFNA 2Q5HA 5EWMA 1XHEA 4BRZA 4CLXA 4S35A 3N76A 3OOYA 1F8UA 4WOBA 5K8LA 4L8WB 4TQUS 3OJOA 1I13A 2WUVA 5K6TA 1E92A 3HCAA 2C9CA 4KN8A 1SUDA 2QB5A 2XNCA 1XRMA 3O0TA 4PSVA 3PNSA 1LTQA 4QFMA 1T29A 5CFRA 1AQUA 1DLJA 1SG9A 3LY8A 5GPBA 4KXVA 3A1TA 4KHPB 3FUCA 1MB4A 3IURA 3VU1A 1ODKA 4U6QA 1Z6YA 5EMKA 1XZFA 1CXZA 4DLPA 3PA6A 1T36A 2PXCA 3UAXA 3DDWA 2ZRJA 2FW8A 3OZEA 1HQDA 3JQ9A 1W1UA 4KWTA 2RI6A 4RFLA 5FNVF 3CE6A 2WDZA 4KXNA 1YI0A 2FCRA 4HQKA 2VZ9A 3MGBA 4KR6A 1VKJA 2PVPA 2YYAA 1TK2A 1ZDMA 3O21A 4HY3A 4R54A 5DBHX 5F1OA 1DRWA 1IHXA 1LWOA 2FOLA 3MRVA 8ADHA 3R9IA 1ECGA 2PLNA 4JI2B 2AKEA 2J7PA 3SX2A 1SCNE 4YRKA 4LYGA 3ESXA 1PJCA 3KB8A 3GJ4A 4OCZA 1VLJA 4ENUA 4FJ2A 4ZZ0A 4UDOA 3I5MA 2YWFA 5B3AA 4XJXA 2X0FA 5M2QA 3L7AA 1SXJD 3OZ7A 1FW8A 1WEKA 3GUHA 3ILHA 3R40A 4PBTA 5A71A 3AETA 5B36A 5IWCA 2DLNA 1ISPA 4QU0A 5JZOA 4NH4A 2QSJA 4E07A 3DQZA 3OCWA 4NR0A 2H5LA 3WK7A 4A4DA 5A5VA 4HNTA 1WF6A 2ZSIA 3LPDA 3IOMA 1IOVA 1UT5A 2VDUE 4AXXA 3Q5GA 1HMYA 3NC0C 4E94A 3KXKA 4JODA 5D6OA 4ZQBA 2JBHA 1SC3A 2QW1A 5GV7A 4AMZA 3JQPA 1A5AB 2HJRA 3NOVA 1EUDB 1M1KH 4HNAB 3PDHA 4LHWA 1XCLA 4MQEA 2HS0A 3FOCA 1B4DA 2Q4RA 4YIKA 1Z15A 1WULS 3DT9A 2N0SA 3OE4A 3L1HA 5TEWA 3L82B 1CY7A 2Y1OA 1FNSA 2Y0EA 3ROEA 2Y27A 1PLJA 3C3WA 1KNKA 3MA0A 4D4GA 5IUKC 2PT5A 4TUYF 1M1NB 2V96A 2XMQA 1GVNB 2GPTA 2VI5A 1PF7E 3FUUA 2J3KA 3NZEA 3VPHA 2ZVDA 5FP0A 1DINA 1NP6A 3R5TA 3ITKA 4XGKA 4Q1FA 1UMCA 2H51A 1ZCBA 5TF0A 4EJ0A 4FFRA 4DXDA 3DM5A 3ITDA 3TQCA 3TPZA 1VBMA 4FT4A 4DC9A 3DEFA 4UCFA 2PJUA 3J7TA 1VMIA 3IOEA 4PZZA 4F38A 1RJ9A 2XBUA 3P9RA 5BNWA 2TS1A 2B92A 3DTTA 1NUTA 3N0VA 4OHFA 2C00A 5ESRA 5C7IO 4PX5A 5TMBA 1P74A 2ZVYA 3OPQA 4R0MA 4G89A 4CM9A 1O4WA 2OZPA 2RCNA 1QHHB 1QYVA 2GJ4A 1RM4A 2B4TO 1PDVA 3DMTC 4JB8A 4IZ6A 4KU4A 5HFJA 4HFNA 3FWNA 4BX3A 3W5DA 3PQ6A 1BH2A 1ZRSA 4HQ6A 5DTQA 1ZN2A 4NDAA 3AJEA 1Z4MA 5CCEA 4LVUA 4MUMA 3LRPA 1PNQA 4LRWA 3E58A 1FBTA 1ICIA 4B4KA 1DJQA 1IE3A 4E5NA 4G1BA 3WV4A 3JYHA 1P0PA 4BCDA 3IOBA 1XEXA 1WJGA 2AOTA 2FA9A 3EH2A 4MS4B 4KP7A 4UPEA 2NUPA 5CIWA 1GQ2A 2X0DA 1AMNA 3F73A 3WE7A 4V0SA 3TLGA 1RJWA 3EWAA 1QWSA 2GPJA 2JAOA 4QM6A 4RJJA 4X91A 1NP3A 2PUHA 3LZ6A 1UBKS 2M32A 1U1EA 2OFWA 3ZDEA 1YB6A 3GT0A 5FOWA 5LQMA 5C1OA 2QVCA 1F4PA 3JVEA 4FFVA 1BC5A 4NECA 5GGYA 5K5EA 1Z5NA 2DHDA 1KJZA 2WOOA 2F9MA 3BXEA 2QMYA 2RC5A 1YR6A 1LS1A 1O8CA 1R9GA 3KNZA 3NDRA 2IU0A 2QG4A 3BD7A 4XFKA 3KKNA 4FBGA 2D54A 4PEVA 3QXJA 3NIDB 2PD6A 3OJ0A 4BEJA 5FPKA 1W59A 2J4FA 3QEKA 4IRXA 2BHRA 2PR7A 5LZ8A 5AKXA 5DHTA 3JQBC 3GIDA 1UP4A 1YQNA 4Y2RA 3ZBPA 4ENPA 1HT1E 1KOFA 4B3CA 1EDBA 4C07A 3QVVA 3K9NA 4KIUA 5JOQA 1DWQA 2YYSA 1BRTA 1PG0A 1R1DA 3S0YA 3QWIA 4I4IA 4MI9A 4UJ5A 5IBRA 3U62A 3ZHXA 4G0VA 4C7KA 1QC5B 4KGVA 2PZLA 2W6JA 4LWOA 2ZWVA 5DVZA 1P4JA 1PJRA 1TZKA 3AH8A 3AR8A 4E3ZA 1FVOA 2R9VA 3JS5A 3NWBA 2OZKA 1ODIA 4MXDA 1OYOA 5HEKA 1VPLA 3EVBA 4Q3BA 1NL3A 2DM6A 3NVMB 4BNZA 3OA2A 2IELA 3MB5A 5F5NA 3Q4GA 3WX0A 2QA5A 4GX0A 3ND5A 4KL8S 4YJFB 2X41A 1G0OA 1P19A 2VXYA 1KA9H 3SX4A 3KUCA 1X7ZA 3HLYA 1VHQA 1V8OA 2KS6A 1XT6A 3FM9A 4O02B 1OBVA 4A0GA 1CVLA 3FDXA 2OBLA 1MV8A 3U3ZA 1SUAA 3V1TC 5KCZA 2P2YA 1SVKA 5AVXA 4R2MA 2VDNB 3DSRA 1HFWA 5AOVA 3SE0A 4C3ZA 1C3VA 4KYVA 5JV5A 2XKAA 3V8VA 5DN6A 3NTOA 4C7VA 5M7EA 1VBKA 3ZE0B 1RAFA 4CZ2A 1IWBB 1T4BA 2PJZA 3JRWA 1FP1D 1PK9A 2ZBVA 4LXUA 2C57A 3IAS1 3FUWA 4CL2A 5BQ3A 2C2OA 1EVZA 1SOUA 2J46A 2QN2A 5EEGA 1KMHB 3O7WA 3AW8A 3WZMA 4A0HA 2PX3A 1JEYA 4H7HA 1JHUA 1U8CB 5FL7A 4MWEA 2IXAA 3LVFO 4GYWA 4AIIA 2R66A 3KV3O 3LUJA 4G5SA 1PGOA 1YRWA 4K9PA 4NHEA 4Y7DA 4BO5A 2PX4A 5TPWA 3ETNA 4BXOA 1K88A 5KWJA 3A58B 4E14A 2Z43A 3ZHYA 1NM5C 2A4MA 3PGXA 4RYDA 1XZMA 4D79A 4K7JA 3FNGA 3MGCA 3PFCA 2B33A 3B1YA 3WYAA 4E2YA 4I1RA 3LQFA 1LLDA 2M6SA 1B74A 2M98A 1R2QA 5FL3A 4S0XA 1XKXA 2AHRA 2EWWA 1E1RD 1OFVA 2F3SA 5HS6A 2JD1A 5B7PA 3R3XA 4PHGA 4YROA 5JZSA 2O0MA 2WE8A 2V5VA 1R9MA 3NYQA 3P26A 1WCXA 3PTZA 1E4EB 4MW1A 4AKHA 3HXKA 4DPLA 3MQ2A 1ZUNB 3AW9A 3H8JA 4ZCQA 1K0FA 4JJFA 1X25A 3WIOA 5K8IA 2E3JA 4PVDA 1FMTA 1N8SA 1SHKA 1RC0A 1VL8A 2VA9A 2E9SA 3IO5A 3AHIA 3MJEA 1QHXA 4UEWA 4CHGA 2BGWA 1RI2A 4BQOA 2FN8A 2XMSA 5CGQB 4ZZ2A 3VPFA 3U6KA 3OPXA 3C6XA 3D7SA 2BM8A 4JKYA 2A3RA 5EE5B 3L4EA 2CLOB 1N5DA 3OH8A 1BVRA 1CD5A 1K73H 2J6IA 4HH0A 3LYLA 2JEOA 3O0DA 2FFRA 2YRWA 3AF0A 4N82A 3W06A 5DRYA 1IV4A 2CNNA 4BC0A 2QLLA 3MS7A 1CDEA 3QVUA 5FAKA 1XNQB 1E7KA 1E3LA 4M1WA 1O96A 3E23A 2P8JA 4NZOA 3ZCPA 4XCVA 3NOQA 2ATIA 2HPVA 1X15A 4LNHA 3AB7A 3ROMA 2ZBGA 2LE0A 5LOVA 1G2PA 2N1BA 2MMCA 2WG1A 2O3UA 4RA9A 1EFCA 1RPJA 3EFHA 2D1SA 2Q07A 3MXOA 4F9GA 1GPWB 3NMUC 2X13A 1FP4B 4Z7NB 2WAAA 1YK1A 4WNCA 3SICE 1KDPA 3DQPA 4FYWA 3FNBA 4I4TA 3QPDA 3WL5A 2QJFA 3WJ1A 2VH2A 3KYCB 4W5JA 4ANFA 5BURA 4L4RA 2VRCD 4C4RA 3H13A 4D42A 5K99A 2ANBA 2PL1A 4Y1RA 1HRDA 1OXKB 5AHWA 1M73E 3OJLA 4L0QA 1DEAA 3IVGA 3JWPA 1F0PA 3VU9B 1IN4A 1CR2A 1LF5A 1WNFA 4HLUC 4PO1A 4J1SA 4BMOB 2N48A 1QMPA 1B1AA 5EXEA 1LQUA 1CK2A 3DULA 4P58A 4V0MA 3RARA 4MWTA 3MUFA 3V80A 3ZWKA 4E51A 5C37A 2BMJA 5E7IA 4Q4JA 2EFHB 2JFOA 3KUUA 3R6TA 4E12A 4F86A 1CUHA 5K8UA 1ABFA 5C35A 1GRQA 5DM60 1ONBA 4F3YA 3HKBB 4IFIA 4AO8A 4OPMA 4RACA 4X8MA 1LBHA 2BI8A 1YB2A 4G1EB 3LBHA 3QQ5A 1VMAA 1NMUB 2RHWA 2VNJA 5GJCA 5DYYA 2C0CA 3QBDA 2KSQA 4NV1A 1Y9EA 4ZHVA 1QU9A 1VQLF 1MC4A 2JKVA 3BHMA 4MMYB 5DJ5A 3RC1A 1EWQA 4JNCA 4NNJA 3WLKX 4HD8A 1QGDA 4FOOA 3S7ZA 3TTYA 1R6UA 3OBIA 3QI7A 4B3JA 3R3ZA 3UB3A 1FXWA 2CYBA 3CTMA 2XXAB 5BQOA 4DSAA 4H08A 2QTNA 3CW9A 1YL7A 3DONA 4PBSA 3FBWA 1DNPA 3C98A 4LMPA 5KYKA 1HDEA 1XMPA 2UYNA 3EYWA 1IOLA 1JG7A 2VJNA 5EZQA 1CP3A 3BSFA 1J07A 5J4VA 2Q9CA 2H2IA 4R9NA 4LQLA 2CL6X 3DL2A 4HNRA 5H68A 1E5QA 2P3OA 4JP8A 1E4VA 5C8YB 2HEGA 3DTVB 1A76A 4NV0A 2FZCA 5CNMA 3BTSA 4B79A 2NYAA 4GPEA 4NS1A 1JFVA 3IKFA 1UKYA 2IUSA 3ZKAA 4WQMA 5LPNA 1AMUA 1MLDA 2DP4E 4CI9A 1JDZA 4ZOEA 4BFCA 3A9SA 2MSEB 4WLVA 1I7DA 3R09A 1AUVA 2G5PA 3FETA 4PQEA 1NPDA 1OROA 2K4MA 3RTDA 3VTZA 4KNYA 1L9XA 4ZZ3A 4UE6A 1WZEA 3VPGA 3R7LA 5LP6F 4NMMA 3FPIA 2YR0A 4WESA 5EOVA 5EZYB 3GFOA 1E94E 4A8TA 4GXNA 5JAOA 2VP5A 4MW9A 4CDNA 2TMYA 1JD1A 2ZWAA 4PSDA 4REMA 4RS4A 4ZQEA 4ZCPA 3TD9A 1BA3A 3QTBA 3IP8A 2V7PA 4IBOA 4U2KA 3T3HA 1A2QA 1PUJA 2QX7A 4M8SA 1HNWB 1A8PA 1BWPA 3E4DA 4G0PA 5J40A 4C0SA 1U31A 2L2QA 1ZGBA 4X3MA 1EFRD 2HIGA 2RAUA 2UYGA 4IGKA 4DJDC 1PDOA 1RYZA 2VDLB 4B5CA 3BRSA 5BY2A 1U40A 3ZHRA 3STXA 2VTEA 1XD2A 3V7FA 3ZR4B 2GAAA 1TAHA 4BMYA 5F3WB 1RWMA 1VP3A 2GJ9A 3PL1A 2P2CA 1L5WA 5IM4A 1DBFA 1UQUA 2I8LA 1B8VA 2WSSA 3F47A 3BE5A 3HBJA 4U2CA 3HFSA 3JPYA 2ON6A 3QVMA 1HKUA 1J09A 1Y7IA 1QIJA 2OECA 2AN5A 2B7LA 1X0XA 2GM5A 3CLUC 4BVTA 1L5FA 4TZZA 4UVDA 4D8VA 1GNQA 3S7TA 2VP2A 3UUGA 1W6RA 2X1VA 1EVKA 1K8QA 3K15A 2CLMB 3RU2A 3N8GA 3U9LA 4FEAA 4FFSA 4F5EA 4GLOA 2O2ZA 4G2NA 2PHNA 5DE3A 3SGLA 3SM3A 1HSOA 3TLXA 1C0LA 1Z36A 4TXNA 3BH6A 5A05A 4UBMA 3T1TA 1BFDA 4HH1A 4JYZA 1MQ9A 2QD1A 2HC9A 3CSDA 3F3SA 2J5KA 3H4MA 4E7PA 4UBNA 1BCRB 1SGWA 3FSGA 3CGWA 1GP2A 3PC8C 1C4KA 3HVKA 2B94A 2CHFA 1P2TA 2VPPA 3FH0A 4Y9DA 5LNK1 3DZDA 1NX9A 4ZVSA 3AKCA 2GT1A 3OHPA 3Q12A 3RM3A 5AW3A 1NATA 4HUQA 4KAAA 1PWEA 4BKRA 2DPGA 4MHOA 2WJZB 3LY9A 1DWPA 3Q7TA 2DT8A 4CKXA 4YAJA 4L0DA 2HHJA 4XCQA 1DLIA 1P1KA 1J2RA 3KQTA 4Q93A 3OICA 1VHTA 4RD0A 1G66A 3QFRA 4HYEA 2Y1DA 3FFAA 1FK8A 2BTOA 3E5RA 4Q7EA 3I1FA 5K0LA 5CFLA 5JQGA 3CT6A 4CNQA 1HDZA 3ABQB 2H00A 1L4LA 4GLLA 4PZUA 4MUHA 4PPGA 2FRXA 4HPXB 3PEEA 2OCAA 1PNTA 1CZNA 1SN7A 2PWPA 1MUUA 3NV9A 1Z06A 3CZMA 1DBRA 1CUWA 5E4JA 5FTWA 3NNSA 3BE6A 2O2HA 2AXNA 3U5TA 3S1SA 3TCNA 1P2SA 4Z0TA 1WDTA 2J9FB 2WNIA 4QC2A 5CDHA 1G3MA 5IAAA 1X77A 2XZPA 3BMXA 1UK9A 4GMDA 4OHRA 4HVCA 4UUAA 1GO2A 1Y3HA 3BDIA 3FZEA 3H0KA 4F3NA 2C61A 1M76A 3H9BA 4BVRA 1E2LA 2R8XA 4OHKA 1EE1A 2B99A 5EY5B 1I1OA 1QH9A 3VYUB 1W2WB 2CW4A 4PGGA 3X3HA 3G89A 4F8YA 2IS2A 3DYIA 4WIAA 2G5CA 3RDPA 5IDXA 5IJXA 3WJPA 2Z1NA 2HWXA 2OZLB 2HDHA 1O0BA 3N2GA 1VQ9F 1NFFA 3DMTA 4PPYA 1T1EA 4S04A 4KFCA 5TGDA 4A73A 3BSSA 4DTIA 3KE8A 2A0WA 2ZYVX 2Q4DA 4J7XA 3IQGX 4HAZA 4KQCA 5FLXA 4LJ8A 3KR0A 5JBNA 2B5VA 3R9WA 2V6JA 1BDJA 1IXRC 2E4WA 1EFHA 1AGPA 4EEZA 5DNEA 4ZP1A 4BNXA 3I01A 3LGSA 4X63A 5DNCA 3L79A 3TIGA 1MIOA 4LBZA 5AMXA 5KNDD 1QNFA 4J2OA 4KVFA 5KAMA 1G5IA 1RNLA 5C31A 3MZ0A 3EXHB 4GM1A 2BI7A 3N0TA 5FBZA 1ZFNA 3JALB 3OMLA 1CZRA 4US0R 4OX9Y 4NONA 1RQXA 3VMFB 3PSAA 4X93A 1R9NA 4EYOA 1QF7A 2HFJA 1USKA 3A6EA 1HF3A 2P6UA 2IOHA 3BWCA 4UVEA 5CVCA 4WEOA 3QVKA 3H65A 3SQOA 1NPTO 4KW7A 1MXFA 1XNRB 1ECLA 2JW5A 4OO3A 2ZCVA 1OAAA 4MKHA 4H1VA 4HH3C 3EDQA 5TJ9A 1Q16A 1H5QA 1M5RA 3A1VA 1XCJA 2O3TA 3GAFA 3HE3A 3KZ1E 3MFYA 4G9BA 4D43A 3LGAA 5D86A 4LRSB 1W36B 1YDWA 2PS9A 5E6UB 4C05A 1JTEA 3F6CA 3BXZA 3CU5A 3FYSA 4ZAWA 3JQBA 3OZFA 4F2DA 1VPVA 2KBEA 3QYAA 3L0SA 5BSTA 3B89A 1XYVA 2J6HA 4FYHA 1G20B 4D0SA 1RZRD 1ZM9A 2O59A 3TQFA 3I52A 3GUZA 4H59A 1U5AA 4ZI3A 3OC6A 2ZBEA 2VRBA 1VCOA 1NJ8A 1T35A 2WJ4A 1C8KA 3CT4A 2GZ1A 2ZM6B 3QWAA 2C7RA 1P33A 3GCZA 3MOSA 4Q9IA 3WFZA 2A9QA 5AQEA 3GL9A 1O4VA 1DQRA 1Z56C 4Y1FA 4Y2YA 4AZWA 2Z3VA 3QMPA 4KJXA 3B48A 2EW8A 4GKKB 1FMCA 2A59A 1U8FO 2O07A 4IGIA 5DXAA 4DCMA 2OC4A 4YUAA 3Q11A 1TKBA 4K9NA 4UUOA 3NP7A 2H18A 4V39A 1VQVA 2LCAA 1ZRMA 1Z0JA 2PMPA 1E1QA 3FOFC 4WKNA 3F49S 4ZA2A 1CC1S 4O2AF 3BWBA 4N4AA 2GN1A 4FYKA 3IERA 2VHYA 4EMSA 3HVRA 2OZBA 4R9UC 4GBED 5EIBC 5K0BA 2QTWB 1YV9A 2P75A 1D09A 1HNNA 1FDRA 2QTLA 1DU4A 3CNNA 4HZUA 2OD9A 1A2OA 1IIBA 1U7PA 4G36A 1XZHA 3HBMA 2XE7A 3I1YA 4JI5B 3UGTA 1KQOA 1ZMBA 3CZ4A 2VRWA 3REQA 1T2DA 3H5RA 4GVLA 1R64A 4I9UA 4NNPA 3HU5A 5FLEX 1JR3D 1RC1A 1W4CA 3AF1A 2BCEA 4J75A 2GYYA 3SLKA 5CG2A 2CN1A 2W70A 1QIDA 3CNLA 3MBMA 3E15A 1HOXA 2G77B 3PC3A 3W7VA 2XOKD 5C51B 2JIMA 1B0ZA 3IAAA 1UT6A 4NZYA 3HHEA 5LLSA 1JH8A 1R0ZA 2PSFA 4EVQA 4E4TA 5I7HA 1FY2A 1ORIA 1RBQA 3Q9SA 4LZOA 3UMBA 2IZ5A 1XZ8A 2JGLA 2PRZA 1XXHB 2CVOA 4XWTA 2ZIFA 4RV9A 4LGVA 4L78A 3DUFB 3FKSD 1T5IA 1TEVA 1ZJ5A 3GGGA 3AX6A 1SBYA 4IDEA 5AVSA 4JP5A 1DQNA 2WJ6A 1JYEA 1JVBA 1L4NA 1WZIA 3BPSA 3OQPA 1JLMA 2CJXA 4IJ5A 4RGYA 3GZJA 4TKUB 4BMSA 4DIDA 4N47A 3VZQA 4NPCA 1DQSA 1NM5A 4NZNA 2JHCA 1YA8A 5DGCA 5IYZA 3VU0A 5L6LB 3NW9A 1ZXXA 4KGDA 2GHRA 3GLHE 4MQ5A 4PXSA 4AZ0B 3RA6A 1G42A 4BT6A 2GH1A 1TA4A 3BJIC 2J48A 1NLUA 2ORVA 4XUEA 2ZF8A 4M0LA 1BMFA 1VSQA 4ZDWA 2NGRA 4ROTA 4AJ2A 4EUNA 2JI9A 5JW6A 5ILOA 1K9MH 4OK3A 1L4HA 2O2JA 3JASA 4MW2A 1E1KA 4KI7A 3SFVA 2MTBA 3IVXA 3ZQUA 4MJ3A 2F3TA 4L5JA 1MD9A 4AF8A 4CCSA 3A9RA 1DEOA 2I2XB 2O20A 3PU6A 1FRZA 2IU4A 3T4PA 3M81A 4MB0A 1ODCA 3AVYA 3QUBA 1XPUA 1X1RA 2OBYA 1A71A 1UBNA 2OOSA 2QG6A 3HMQA 5J59A 4G0WA 4H6XA 2G1JA 1IHUA 5I4CA 5SICE 4XFJA 4KX5A 1P3JA 3RRFA 1IJKA 3H2IA 3IEQA 1VXRA 3Q8WA 3CVVA 4BWFB 1FP7A 3VR5A 2FETA 4TV8F 1U9JA 1YMUA 3P0ZA 1P4RA 2PS1A 1Z0ZA 1C9MA 1OC4A 5AKKA 3AL2A 4MVJF 1ZZEA 3HFGA 3K70C 1Q7CA 2P5TB 1X8LA 2GBFA 3JXEA 1MW9X 2C1ZA 3G9QA 3LW8A 4LBVA 4ZVRA 3SQDA 2LWIA 4EX6A 1D1SA 1BKYA 3DZHA 1TVCA 3JYPA 4LZPA 3U09A 1ONIA 1AZWA 2E7ZA 5CUQA 3IPCA 1U11A 2O19A 2HWKA 4Z3DA 1Q1ZA 1E9BA 3QEJA 4MVJH 1IBLB 1ORVA 3O75A 5CHEA 4OI0A 2YXPX 3OIDA 1ZMOA 3FWYA 3ZQ4A 2AOUB 4ICIA 3A6FA 4OMUA 4HAVA 5BW6B 3W3ZB 2I9PA 3FVRA 2AG5A 3DD1A 1HDGO 1JT9A 3BD8A 4I55B 1H2BA 2L42A 3E9EA 3AFIA 4H1TA 2FE4A 3CH4B 4RKYA 4UPVA 5GOTA 2V6BA 1XZLA 1NJSA 1CQIA 3V2IA 4QOJA 2KE5A 4HB3A 4C0LA 1I2MA 1D6SA 3QITA 3QMMA 1TC1A 4ER6A 5JCPA 3TD3A 5KNBH 2JCBA 4G0NA 1GSHA 4PFSA 2I6UA 2NXEA 3ED5A 2GR9A 3I8SA 3BB4A 2H16A 5IAJA 2I22A 2ZXUA 1FSGA 1IH8A 3NEYA 1OTXA 2H6LA 3V2HA 3F1LA 1CQWA 5KSOA 4ZVTA 4HLUA 3QX3A 1V1RA 4JLPA 4RTMA 1JIQA 4NCXA 3RUPA 3QY9A 4XD7A 3F5SA 4JJ6A 4KIWA 3UK6A 4KLAA 1BOFA 2NUTA 4LDAA 1U94A 4F0JA 3FFMA 1KFKB 3V46A 4WKPA 2ATEA 1S2OA 4UTXA 3HWUA 2K5UA 3LBYA 1BEZA 1V5GA 2IOYA 5DYWA 4DBLE 4PIMA 1DX9A 2E18A 1QCZA 4IG4A 1NBMA 3HCDA 1N4AA 2NT4A 3C70A 4YVFA 3FHTA 1JECA 1O58A 2GKOA 4JGGA 2AYXA 2QD4A 4L9SA 1S89A 2XHEA 4O2BB 2BKAA 2MU1A 4GH5A 1LPOA 3IELA 4YFVA 3FVWA 2G63A 2WJHA 2A9KA 3D81A 3THXB 3H3JA 2QQGA 3UPDA 3Q9UA 1N7JA 3VJMA 5LJIA 3IL2A 3WGTA 4Y1EA 1IBMB 5LN1A 2YY7A 1JPUA 4NE2A 1OI2A 2JFPA 3CM0A 3IHKA 1W581 4PCUA 3EEBA 2IPNA 3MDOA 1GDTA 4HN4B 5AVOA 4JHLA 2GAIA 4LQCA 4UDNA 4ALIA 5JNRA 4P81A 3PPWA 3CH6A 3V42A 3VSCA 4E88A 1LZLA 3DFZA 2BP7B 1EFLA 3HR4A 2JVKA 2QYSA 5IPFA 1XUOA 1HQYE 4ZPXA 2PL3A 4AAYA 2Q62A 3MJSA 3PVZA 5FWXB 3HV0A 2XSZA 5DP2A 1RLMA 2F43B 1NRIA 4B1FA 1L8LA 2V7BA 3C39A 4WADA 2GVZC 1B7GO 1TKCA 4JROA 3PYLA 6REQB 2UVQA 3QYPA 1YHNA 4BVLA 4A15A 4QTXA 4WW0A 1X19A 1E1LA 4I81A 4AZ3A 1WPQA 1VE3A 1UZNA 3TOVA 3ZHUA 4CN8A 1QK4A 2F17A 1Z2CA 2JIZA 1K5HA 3P20A 3KD2A 3P0HA 1RWBA 4FDLA 4UVIA 4UXHA 2HGZA 3IDFA 1YH3A 1GYRA 1M34E 4B3SB 3I9KA 3FAZA 4ZDIA 2OFXA 3ETEA 3I39X 1O94D 2Q3HA 4O0LA 1KMIY 3QEMA 2L26A 2HF7A 4BTLA 1Q91A 4LA4A 5H02A 4Q66C 3HNPA 4D4JA 1MABA 2AJ8A 3HTXA 4NJMB 3WLRA 5LA6A 3RUCA 3EGIA 5B6PA 4F45A 3IC5A 1KI2A 1AKNA 2G7ZA 2JAUA 3IAM1 4WNYA 5EHGA 2X0NA 4PINA 4J91A 5CITA 1V5IA 3ZGZA 4D6PA 5J2TA 2ONCA 3TIIA 3U56A 2DCUA 5CLGA 5LXTF 4BE9A 3G88A 4B46A 1DKUA 3QF7A 3THRA 1OXMA 2H7VA 3FRJA 4YO8A 4CMHA 4ESEA 1MNAA 4YHBA 4RC9A 4Y6LA 3B20A 3IS3A 3L49A 3K0AA 3LQKA 2FY8A 3EZNA 1SKAA 4JEIA 5GANK 1I4TD 2PL5A 5FI3A 1KKMA 2AFVA 2C4HA 1ENYA 4ZRDA 2BE9A 2ZTHA 5C3MA 1I94B 3GJTA 1DDOA 2YVLA 4HAIA 4HYYA 4LFAB 4MYRA 3E20B 4M1OA 3FSEA 4U2EA 3ZGYA 3BWVA 3JQAD 5ES4B 1YBAA 1H5NA 1K7SN 4KYTA 4GR5A 2EKDA 4M7OA 3TUJC 5HCUA 3IKJA 5LKAA 1A4UA 2QZPA 4HGYA 4HS9A 3U7EB 1E4YA 2CSUA 1S8AA 1SULA 2NTYC 2WF6A 2I78A 2J31A 4AC9A 4ECEA 5DM70 4PYMA 1W44A 3IV7A 1A97A 3PC8A 1PSWA 2Y9MB 4B45A 1AB5A 2HSDA 2QTFA 2ZBDA 2BGRA 2OB1A 4L9RA 4OFZA 4PWYA 2AN9A 3DDHA 4TN5A 3WBFA 4X1IB 2FF7A 4DNXA 2ILTA 3H19A 4P92A 1R4NB 2JAHA 2YJTD 1CPYA 4IIDA 4MAFA 4QUKA 5CXXA 3JD1A 4S24A 1TU4A 3I2YX 5TQJA 4YHHB 1ZJYA 5M29A 1S3GA 1FTQA 3SYKA 4CIAA 1ADYA 5LZ4A 1C0KA 2C8VA 4IZIA 1LK5A 1X38A 4WKGA 3CUYA 4QEDA 3HYLA 1Q17A 3IUSA 1SELA 4BO3A 2G71A 4LE1A 1B8UA 3D3EA 5NLLA 2NP6A 4KSCA 4EFMA 1UWCA 5L45A 1I3MA 4LKOA 1MFPA 1UK7A 5G4KB 4WXMA 1ZJ6A 1IUNA 3LP8A 4Q4LA 3TAUA 2GXSA 4FHEA 4N9QA 4XRRA 1FMFA 2B9EA 1OZ0A 1V2GA 3I05A 3O2QB 4EKYA 3C43A 5EVJA 4KTTE 2PBFA 3VZSA 2UYKA 3T7CA 1ZGGA 3HY6A 3VMMA 3C4JA 1KDYA 2A4KA 5AW7A 2PGNA 1JLLB 1TCUA 3KPJA 4JEMA 3GRYA 3A04A 3LDUA 5FLYA 3LKBA 3EF3A 3NUZA 1P7PA 2NU8A 3ETGA 2ONJA 4EKIA 2YWRA 1U9YA 1X42A 2QN7A 3HR7A 2X77A 2QSYA 1QVGF 2OV2A 5DPMA 2OV6A 1N6KA 2PMKA 3WHKA 1VXOA 5B55A 5HRUA 1TA0A 2V9ZA 2WTNA 2JPDA 2HKIA 4DLTA 5J4YA 5CB0A 3SZGA 4EHAA 1GILA 2EYQA 3AILA 2P5YA 3CSSA 4JXZA 2PU7A 1F8XA 1U8XX 4AJOA 4KQHA 3MOGA 4KQ1A 3K0KA 2AK2A 3VSEA 2HMAA 2JJYA 1VKRA 3B53X 3P9IA 2E85A 5GJVC 4DUPA 1AQLA 1AA9A 3VR2D 3BEDA 3NHMA 4B3TB 3F0GA 5HMLA 1KYZA 2I87A 2YS7A 4B4UA 3C8MA 3OZXA 3IDSA 1QPGA 4YT5A 1SIOA 3HZHA 2VHCA 4KCGA 1X7YA 4DANA 1NNSA 4II7A 2BMAA 1JVNA 5TS3A 3SJUA 4OY3A 5AK4A 1PJZA 1BWQA 2AH5A 2VWGA 3H1TA 4BAGA 4XVCA 2V3WA 4W6QA 4C14A 2A84A 1RKBA 4IGEA 4MV7A 1F9EA 2EW2A 3KJKA 2JLYA 4YECA 3U17A 1IQUA 2BBWA 2VPWA 4KRYA 4L5CA 4U6NA 4F6RA 4O59O 4AT1A 4DAOA 5IFLA 1TQ4A 3OKAA 3PIDA 1C8LA 4GFDA 1CTQA 2KG4A 5HIKA 3C5VA 3ACCA 2J3DA 3D6VA 1E0KA 4BB5A 4HOYA 4RZSA 1X92A 2XF2A 5DP1A 1W73A 4E46A 4YAEA 2BDEA 4EAQA 1A8HA 1KK0A 2ORIA 4LXGA 1E9RA 3SXJA 3UTCA 4IXTA 4FCWA 1IHOA 1Q44A 2QTAA 4YK7A 1SC6A 5HFNA 1CE8A 2C3PA 2ZIAA 3ZE8A 3ZX4A 5IASA 1J70A 3U7QB 1U2TA 1T4GA 1DEKA 1E2FA 1ZS9A 2BVNA 2Z3WA 3DEJA 4TTPA 2VHVA 4FZVA 3ZI7A 2OK7A 1U2SA 1CQJB 3MIIA 3PFWO 5BYJA 4RXMA 1MJHA 1JKJB 2XTJA 4FX5A 1XA0A 4LEIA 5AK3A 3Q8KA 5LWQA 1YZFA 3L04A 3SYMA 1IEWA 1RI4A 1RM5A 2PH3A 2FP3A 1N2CE 2GCGA 2O3SA 4KAFA 1ZD5A 2Z5GA 1ZW6A 2P2GA 5E9WA 3SQMA 3IR7A 721PA 3LAWA 2ZWOA 3L0YA 3ICEA 5JMOA 2O7VA 1P31A 1HT0A 1V39A 4L22A 4KUGA 4OGGA 4N3AA 4UEQA 3SXPA 3EZ9A 3UGJA 3M5WA 3ZVLA 1CRPA 2D4AA 1PBTA 1WP4A 1ZH6A 3C7TA 5J43A 1R1MA 1LSJA 3I6ZA 3GZNB 4XQ9A 4ZIRA 1G3RA 5BVGA 2QGNA 3PVCA 4JC4A 3ET5A 1Z9BA 1LJLA 3AR9A 4A8HA 1YQGA 2RG7A 4RUKA 2J1LA 5HZKA 2V0GA 4R51A 2BFNA 1CS0B 4YP7A 1MH9A 1S2LA 4GR4A 3J81M 3HA5A 3LC2O 2ZIWB 2EKLA 4MKIA 2BEVB 4UU1A 5LYJA 1RFLA 2ZJ7A 1BKSB 4PLZA 2VJPA 4U39A 2FC3A 5ESWA 3SMVA 4ADSG 3MCZA 2ZB2A 3E2MA 3RT7A 2PDAA 1ZO8A 4L75A 4MP6A 1WZNA 5JG7A 2QNBA 1SKYE 1CRQA 4ZYVA 4UU8A 5CB4B 3AKDA 4GZLA 4J9UE 4OMFG 1H2FA 3SXUA 3T9CA 1OV4A 1EVEA 4WBNF 4J4HA 1WUTA 3QRWA 4QDKA 1LVGA 2GB4A 3WY9A 4YCLA 4RK6A 1NOIA 1QHEA 4W6ZA 3RK4A 4CMIB 4CKCA 1IQRA 4CUKA 2V7QD 3KELA 5KQMA 2X3YA 1UIRA 2FB9A 4AUMA 4B4OA 2V03A 4OP3A 3H42B 4B76A 4UZFA 4YRPA 4D9JA 4DIFA 4KR7A 3T3IA 1OLSA 3AG6A 4KBYA 2NVBA 2YXEA 1TT7A 3H9JA 1F06A 1QO7A 5C7LO 3VJRA 4AFNA 4PYQA 3QVGA 1TVEA 2FPIB 2WVHA 2CDNA 1WXEA 2KTUA 4N41A 1CWUA 2FZWA 2P62A 5GIOE 4C2UA 2H4JA 1GWNA 3E5NA 1NMQA 1OZGA 1Z07A 3O31A 2G8NA 4J4BA 2BTQA 5K0ZA 3UXYA 1G6OA 3K14A 5HXZA 3PXUA 4KRFA 1R6TA 5I5GA 5A0FA 4KPUB 2NX2A 3TFQA 4R5MA 4ND4A 3UT0A 3N9IA 2UZ0A 3R3UA 4B2IA 4Z4FA 621PA 4PWTA 4HDKB 5I9LA 2J6CA 2YNMD 3FCUB 4V0QA 5EJ5A 3DC2A 4FXPA 4JSYA 5L8VA 3Q1LA 4LSWA 1Z2AA 2YZGA 3AM3A 3A2NA 1G8GA 2VBFA 4EL5A 1FYEA 1UMBA 3KYJB 4JQSA 4QAJA 5AK0A 3SJAA 2AE1A 3BZUA 2GZDA 3TMAA 2RHRA 1NVBA 4Y8VA 1NN1A 1OFTA 4BFSA 4F4CA 4ETMA 1KXJA 5BP7A 1YB4A 4PAQA 1MQSA 4OK6A 4YRAA 1YIAA 3DJYA 3RSGA 4GBGA 1ZCZA 3I72A 3KJZA 4M21A 4Z0NA 3BD6A 3HN2A 5IT5A 3WXMA 1DMSA 3AESA 4A6DA 1Z6QA 4O4HA 1Y6FA 2I6SA 3HV2A 4E7OA 5JCZA 1JFTA 1ESZA 2QM3A 2H1LA 3GUYA 4ZK2A 1K3FA 3I23A 2O2YA 1G5PA 4GBMA 3GV0A 4EW3A 1Y5NA 3KSMA 3CJRA 4MYSA 3N4YA 3FJOA 1NSTA 3DFIA 4KUEA 4MV9A 3RHFA 1A98A 1H2ZA 2FZEA 4KWIA 2XCSB 4OREX 1Z8DA 4TVOA 5DOZA 1Z12A 2PUWA 4PC1A 2WOJA 2QK4A 4MPDA 3C41J 5JAHA 5JXGA 2VDVE 3K9BA 2EGUA 4AP9A 1HLGA 3FFBA 2TSYB 3QOYA 1J8VA 2DG2A 1HYBA 2YASA 2DR0A 4KYIB 4M6WB 5TQ2B 4CF4A 2WFZA 1CY8A 1GKIA 2IY8A 3AEUA 3RVMA 4LMBA 3WK4A 3PLAE 2JAPA 3FTQA 3D01A 4R8VA 2GPWA 3E03A 4QQFA 5JQWA 3TECE 1FDIA 4K2AA 1YMQA 3A1NA 1GITA 1ZVJA 3I0ZA 5C4IA 4F7DA 4JGIA 3PA8A 3GUVA 5AKZA 2GNPA 3E81A 3LECA 3LY5A 3GLGB 3G0HA 4EENA 1TXGA 1B93A 3SS9X 5ALMA 2YJ4A 4AICA 1MG5A 1XTPA 6PFKA 2JGDB 4D3SA 3GT3A 2BELA 1RXEA 2CMDA 1F4LA 3FTPA 3LT0A 5DT2A 2W00A 3MK31 1XN4A 1PT8A 1X9HA 1U5BA 1XROA 3KB1A 4HFMA 5FPQA 4C0KA 2AA3A 2X0EA 3UAVA 1HNZB 1WCIB 2D2VA 4IH1A 4KOAA 4H7KA 2JFYA 3W3AA 3KUXA 3GBSA 4G81A 4AKSA 1P2FA 2C88A 1S2NA 3L1IA 2FPOA 3VR6D 1RI5A 4WCDA 4Q21A 1E18A 1PYDA 3GGSA 4F9FA 2JLRA 4E5SA 4I36A 2FPPA 1E3IA 1OZFA 4O4IB 3K9CA 4NP6A 2WHPB 1XF1A 3JQ6A 1I2AA 3QHQA 5DX1A 3ON1A 4MDEA 4PG6A 1L1RA 1MB2A 2IZOA 1E0SA 3F97A 3GPDG 3MAAC 2ZK7A 4EPRA 4MKZA 1T0UA 5IMBA 4KN6A 4C3VA 5JY6A 2Q4TA 1IFXA 1MJFA 3E2PA 4JLBA 4CR7A 3OTIA 1R8JA 3KEOA 4FMBB 4CEHA 4POOA 2FFBA 3N05A 4G1VA 4CQLA 4DV7B 5DNWA 1VYTA 3GRKA 4CLRB 3OWOA 1UDAA 4P9NA 1U2EA 1FQKA 2B20A 4PRLA 2DBQA 1JZQA 4H1UA 2ZOVA 3QUWA 2EQAA 2F67A 2PR2A 2IEGA 2C5SA 4NSNA 2ZYIA 5IBPA 1P4AA 1AUOA 3KOOA 2GXUA 3AHDA 5IK2A 2GBLC 5DM4A 4B0PA 5C5DA 1K1EA 5FXMA 1BFKA 4GPTA 4F85A 2WU1A 1ILWA 1XTVA 1XB2A 3I6YA 3LUHA 5TV2A 3EC1A 1E3EA 3UMRA 2DFDA 3REGA 2CKDA 3KK0A 4MP8A 2YHBA 2EVWX 4M7RA 1WDLA 1E2EA 3INNA 5EJAA 5IXSA 4KQFA 1QH1A 3IUPA 4YC7A 3O4FA 4U2GA 3U49A 3OFVA 5CBPA 1F0YA 3P9XA 4EK9A 4JA2A 2O2EA 4F9TA 2HR1A 4RHXA 4CTNA 5TB5A 121PA 3GRZA 5CM8B 3T41A 3TGPA 4X65B 1NG9A 4BY9D 1UT8A 3OOEA 4B6FA 4B40A 1BE1A 4IHAA 4KFRA 2HI0A 3SNHA 4WX2B 4XGIA 4KDFA 1SB8A 5IBCA 4WY5A 4RCZA 3GK3A 1WSAA 3E1YA 4J9VA 3S02A 1GGNA 1RRPA 4X44A 3JU3A 3AKZA 2A92A 3C8UA 1QJCA 2DB3A 3AR3A 3S3TA 5EJMA 2D5CA 1JY8A 4JVOA 2C5EA 4GRIA 4DABA 3G5UA 5TPZD 2JCVA 2C1XA 4I9FA 5FFMA 2X5JO 3GJXC 2VDWA 4MS1B 3RODA 2OV1A 1II9A 1AKVA 1QIKA 4OKSA 4DBLC 4UE2A 2IPXA 4DSUA 2OO7A 1NONA 4I9HA 1E62A 3O3MB 3X1XA 2WUFA 2A57A 3V4FA 2B8NA 4LNAA 4X85A 5JD6A 1WHSB 3QHAA 4WHMA 3C14C 5DFAA 1EKXA 3IEMA 3SKVA 5CYFA 5I47A 1Y7LA 3FCCA 3PGJA 1U04A 2ZBUA 3EDMA 5PNTA 1L5QA 1KR5A 5KYYB 1NBEA 1WR8A 1DIHA 3GR6A 1JTVA 3C6YA 5CVTA 2ALJA 3W8EA 3U13A 5KPJA 3NYRA 3RTAA 3OIVA 3KUDA 4YMUA 5KYGA 1WXGA 2IDZA 1ADGA 2ZJ6A 2EJCA 2VYVD 5EJ9A 4BFUA 3VKGA 1SQ0A 1UI9A 5G3YA 2HU8A 3H1PA 3O8QB 2GEDA 2VT6A 3WQBA 4EYEA 4PG8A 3ADCA 2JLCA 3PT5A 3V6MA 3LLVA 3G2NA 3H11A 3WADA 4M1TA 4QKQA 5FI5A 1D0IA 1SQGA 2JAQA 5CU7A 4UHBA 4A9AA 1MAUA 1U3CA 4CVNA 3VH1A 4G84A 1NTRA 3W5JA 3KFVA 4LHYA 2JGIA 5JCJA 4Z1OA 1KFBB 1WTCA 4FD2A 4N8EA 3U0OA 1JNYA 1L7QA 4P5EA 2HSWA 3GNLA 2A1UA 2MINB 2BF4A 3TD4A 4JBLA 1E7SA 2BKXA 4N7BA 3MMNA 5B8FA 2CXNA 5DSXA 2Q3BA 1T8WA 2YIVX 2E0IA 4YCNA 2QMQA 3L7YA 2Z30A 2ILVA 3LNTA 4YMSA 3ZDZB 2QJRA 3FVQA 2DWPA 3U7GA 1Z47A 5DHFA 3M4NA 1K97A 1P0MA 1X7XB 4C2AA 1SZQA 4C81A 1HEYA 3W2EA 2Y0BA 2QW0X 8ABPA 4HJXA 3FHCB 3PWKA 4MVCA 4HRXA 5T64A 1JHVA 4DKXA 1M6YA 1T3SA 2CUKA 2X0IA 2X1LA 3UMGA 1OX4A 1ZGJA 4OGLA 1DC6A 1ZX1A 3WQSB 4B2PA 3TSAA 1OAKA 2HRRA 1UMDB 2JI6A 4OEHA 1DEXA 2WWTA 3HRIA 5KU1A 3QE9Y 5C3UA 2YJ6A 4OHUA 3NK7A 2C8KA 4MZXA 3AUFA 1CNMA 1GG9A 1ODJA 5BSHA 5HUHA 3GHZA 1D1TA 1E9SA 3OPNA 1KVUA 3ENWA 2XECA 4Z9FA 4H4EA 1EGMB 2GDJA 2X19A 4LHZA 5DMXA 1NAHA 3U3KA 4CV3A 2YFYA 1MDBA 2AJLI 3M8KA 5LD2C 2J41A 5KDLA 1OAOC 2WTAA 3P2YA 4DSOA 3BGVA 3KR9A 5F1YA 1YRYE 1CEYA 5A1JA 1Y1SA 2OGWA 3SHQA 2GGSA 3KQWA 3KFXA 1E7WA 2HX1A 2Q3LA 3L6CA 4WA8A 1GN8A 1QUEA 1Z39A 2BGLA 4RV4A 1KYTA 4FSDA 1IY9A 2CB0A 2BI4A 4URVR 3F5QA 1KY2A 3WL8A 4HDSA 3UJCA 3OT4A 3QVLA 1CB0A 5ENZA 4IIBA 5KYXA 1NIPA 5LVAA 1NUPA 3N8KA 3B1FA 2W8BC 2BMFA 3ISJA 4CMBA 3U5ZB 1BO6A 4WCVA 3MWFA 5F1KA 3VPDA 1NG1A 4AXBA 1ISRA 1XLTC 2Q29A 2V4MA 3LWPC 3ISTA 1F14A 2EBUA 4P83A 1TZBA 4I1IA 1DVRA 1UKAA 4FFWA 4HLNA 5BR7A 2IU3A 3F0DA 2A9OA 4FJ0A 1FLVA 4R3UC 1X3SA 4MGIR 1JA9A 2YWDA 2UUCB 1HX7A 4FFBA 4EABA 3OMWA 5HKKA 2Z95A 4Q4AB 1AKRA 1JDVA 2D62A 4YCJA 4B09A 5AKLA 2RH9B 2BFDB 5EKXA 1B6SA 3V7NA 4G4XA 4E6EA 4BNTA 4EO4A 1HLPA 2BKUA 4GBJA 5I8ZA 2AMYA 3OFND 2JGAA 3HXLA 5EB0A 5EA2A 5FI0B 3WYNA 5F78A 4L8LA 3VOSA 1MA3A 1ML3A 1OQAA 3KCNA 4HDNA 3SR0A 4PZLA 4KV9A 5AH0A 4H3HB 4QNNA 3K2QA 1E1CB 3FWHA 5CXSA 3PENA 1N78A 1XMVA 2Y4NA 3WXBA 5CCBA 3OM1A 4H31A 2W0MA 4KR0A 1KRXA 4XDZA 3GI1A 1Y3AA 1G63A 4C0XA 2XQFA 2X8AA 3NKFA 4LX0A 3O91A 1E3WA 2EEZA 1IXZA 3DV0A 2GXQA 3AVVA 2IUFA 3TDNA 4GT1A 3SBXA 4DV6B 1A9XA 5D1HA 2ODEA 3GGPA 3N39C 5IT0A 2HIHA 1CW2B 2X2FA 2K87A 2J67A 2YFQA 3EGXA 1P6QA 3CN9A 4I4LA 1H1DA 4DMRA 5L4SA 3OP4A 3KHTA 1IV1A 1R4ZA 3HXTA 3LPAA 1L4MA 4LHEA 4L51A 4RY8A 2Q7DA 2VK2A 3I9LA 1MOQA 2VT3A 1GNRA 1B23P 1LCIA 4FGJA 5JADA 3TUZC 2DTDA 4R8KA 3GVCA 4KR3A 1X8JA 1G9TA 5JXWA 1K8YB 1EESA 4N49A 3NNDA 3ZDRA 4IHJB 2Z1TA 4D26A 1W85B 4U5XA 4Q02A 4CT5A 3UFXB 3AL0C 1I3KA 4G4VA 3PITA 1IXSB 3S29A 4ZARA 3W9YA 3DBRA 1MOPA 2PHZA 3DTNA 3K4HA 3PQ4A 3DHYA 4I5GA 2WB4A 4ZQGA 2CFRA 4AJJA 3G2QA 4YDQA 5TGZA 4AJLA 4N12A 1EK1A 4ZV7A 1J21A 4BQSA 4WZZA 2BR5A 2CBGA 4W7SA 3B6NA 3NHPA 4WNAB 4DCGA 4MDYA 3HB9A 1XYGA 2A35A 1JPNA 3LWBA 3GRUA 2QI2A 1HE8B 2O3QA 3KJIA 1DXQA 1KAQA 2Q6TA 2OWDA 3R7DA 4HXGA 3JQ7B 4EA7A 4HS4A 1E7RA 3QXCA 5BWNA 1BD3A 1JQDA 1EZ4A 1JFFB 4K9SA 5KBYA 4HGZA 4K0RA 1H0HA 4QG3A 5JT1A 5AW1A 5J5AA 5H81A 5JSZB 2V3VA 3LMEA 1HDIA 3BD9A 3W5AA 1US8A 3KXDA 2PUJA 5FNVB 2Q99A 3NB0A 4MUNA 2QRJA 3VA7A 5FO0A 1NYTA 4UEOA 2Q6LA 1U2QA 2AN1A 2CWDA 2IU6A 2IXFA 2NQ8A 2AUMA 3ETCA 3EPJA 2JFQA 5K4GA 1FYFA 2RGXA 2D2IA 1INLA 1JDBB 4CIXA 3AI2A 2P0EA 4HSEA 5FEMA 1VCHA 2XTNA 3KLOA 4GQIA 2H2FA 1SUPA 5BQ5A 1KOGA 5J4LA 3WNZA 3UO8B 3V32A 3FYDA 2PUVA 1XQYA 2HWWA 4OAPA 3RC7A 1L5KA 1DBWA 1OJLA 5KMGA 3LCUA 3K4PA 4OLAA 1WW3A 3LYHA 4UNQA 2NV2B 2P2ZA 2Y6UA 2E48A 3N28A 3I30X 4Q9JA 5J3JA 3L4KA 3X1JA 2P9JA 1L5ZA 3N86A 3L8CA 2LRHA 4NG5A 1JIKA 3VHXA 1ZR2A 4EATA 1J39A 1OU4A 4L7VA 2H9AA 3AUKA 4F5WA 2VWQA 4I0WB 4UNSA 4HX5A 2Y0PA 3FTNA 2OXTA 4X97A 2A33A 3TDMA 3V4OA 2WJPA 1KP2A 2QOEA 1ZEJA 2A58A 2HBYA 3A7DA 3CYPB 1DKNA 1PSZA 3D6AA 4G5GA 1U0OC 3LS2A 4L02A 2JFUA 4KH1A 1E8DA 2HU5A 1RWNA 1A9OA 2V65A 3MMPA 3WJAA 4ZTUB 1IC6A 2X3UA 4X5OA 1EP3B 2A5GA 3O9MA 1UBFA 1GCUA 5KX5F 4YI3A 3GMIA 5H0IA 3LO8A 3UF0A 1BHJA 1BEUB 2GZMA 3L0BA 1UUFA 1H1TA 1ZXLA 3D9QX 3L6RA 2GCIA 2HU2A 2GPNA 3P1JA 2XMGA 2X9GA 3MXTA 1KAHA 4TUYB 2EDAA 1S8FA 3RWOA 2C7QA 3M1YA 4YRGA 3MT0A 3GLFB 4WLUA 3GY0A 2DUMA 1TQDA 2A9VA 3KETA 4C0QC 5ELLA 4J43A 3EGDA 3KEQA 1PW5A 3ZUPA 4KO4S 2OBXA 1FFSA 4ZTZB 3CUUA 1FMLA 1O6CA 3IUYA 3TLJA 5HSGA 3ZD7A 3JX9A 5JH7A 2EX1A 4Y98A 2XCTB 1UBOS 3GLTA 4XGRA 2C2GA 2B8TA 2F1OA 4TRNA 4DHWA 3T3EA 2XRZA 1W30A 4F2PA 3T1NA 1NVTA 3TZKA 4CIBA 4DUGA 5LQJA 3QH4A 3GG2A 1VQKF 1WPRA 2WZBA 1BS1A 3O93A 4UUPA 4MV6A 1BE8A 4TLAA 1OKKA 2ONKA 3BCHA 3L77A 1BMDA 1JG1A 3ABRB 3H9CA 4Q37A 3IBFA 1VRCA 3LQ2A 2HM7A 5GIOC 1OH5A 1SZJG 3T7AA 2CWWA 2GLUA 1MAWA 2V8BA 1TF5A 2HPAA 3T7RA 2I91A 3ECCA 5AHOA 1M75A 1YDMA 2MSWA 2XUFA 3IJ5A 5A4DA 4CG1A 2ZAGA 5HJ7A 4P7KA 4GI2A 4CV0A 4W5QA 4FDTA 2OXRA 2KLBA 2I66A 3PUKA 2P0YA 4V3BA 4CCYA 1KTVA 2C92A 2I2CA 1TTPB 3BGSA 3G0OA 3D7RA 10MHA 4BPRA 4D1YA 4GC5A 2ZXFA 4LOKA 4HTFA 1KNQA 3CHYA 5JEDA 1M1XB 1XVAA 5HMMA 5CD1A 1T2FA 1WE2A 3LQRA 1ONOA 1PAUA 1D6NA 4IDPA 1S7GA 1Y8QA 2G5GX 1NGSA 3CA8A 1H2AS 4BZZA 2CVZA 2OZVA 4RE6A 4LV5B 4OQMA 3AY6A 3WK6A 1X2BA 3A6LA 2F4VB 1ZISA 2HDWA 3EZLA 2GZLA 3JD4A 3RVPA 1YZUA 2PZ8A 2YV4A 1OFUA 5LR6A 2ZAUA 1FNCA 4IIJA 2BGJA 2R6HA 2GBLA 1N6NA 2XDQA 3NPMA 4IH4A 4TYYA 3HKDB 3UYKA 1IAVA 2ZE8A 2IYUA 2VYNA 3KEGA 3JQGB 1QO9A 1A77A 2C83A 4O1HA 5THKA 1XR3A 4FNGA 2ZTVA 3KD3A 4QLOA 4ZGGA 1VCIA 1LBSA 2NPFA 3LGXA 1IPHA 3LPCA 5GIPE 1JDNA 3P9KA 2OBFA 1DT3A 1FQOA 4G09A 2CNDA 3HCRA 2IYOA 2F8MA 2OV4A 3ZJVA 1FFWA 1O03A 4GVXA 1H69A 3ITEA 1E2DA 1GYPA 2PWYA 1ZR4A 4IXDA 2F62A 3A9VA 3DAPA 4G3XA 4M9CA 3S2IA 4CEIB 3F46A 5DIZA 2DAPA 1J6UA 3K30A 4OTZA 1L1FA 1WUHS 1H6CA 4KDEA 1DIGA 3OZIA 4PRKA 2LCQA 3SOPA 4B6JA 1XZQA 3PICA 3OEYA 3CCRF 2X40A 2HP3A 3PLAC 2OORC 4IPTA 5C1IA 3SSOA 2Z9BA 1FUEA 3TNYA 3DE7X 4X71A 2GTHA 3ESRA 1N9GA 4R2KA 4RJ2A 3U7IA 3GLIB 2WF9A 1JIVA 2ZQZA 3PKIA 4EH1A 3O03A 2UYOA 3DZBA 1JUDA 3I42A 4GAEA 5FLKA 1DUIA 2FSUA 3RJ5A 4TZ6A 1QE3A 1PD1A 1SC9A 3C3BA 2KI5A 3H3XA 3LXMA 2JH3A 4GYYA 3MTEA 3QJGA 4QGAA 4RANA 1HI9A 4EB0A 3FFTA 1JJVA 1GPYA 4GI1A 4V0RA 3NUQA 3RO7A 1AKUA 3HCBA 1P0IA 1EQ2A 4LY6A 4OL0A 4BQNA 1J25A 2GBIA 2QR3A 4U1RA 5DO9A 1GFZA 1QGUB 4FTWA 1U3UA 1WSDA 1XJWA 4ZT6A 3ZU6A 4EEXA 2PT6A 5BR4A 4ZHSA 3AI1A 3C6MA 5K0TA 3GLVA 4DIUA 5DWQA 2V9CA 3KZMA 1Y7TA 3FBAA 2IZ0A 3WB0A 4A2QA 5CVUA 3I5AA 2R87A 1KJ8A 3LWNA 3KWFA 4MW5A 2ZSKA 4JC5A 2VDQB 4QDZA 3RASA 2P3QA 4QOSA 4HL6A 1CSEE 2CDAA 2ZR0A 4MLZA 2OHWA 3EGOA 3S5UA 3N2KB 4YA6A 3WFJA 1HE1C 2QLTA 2RI1A 2PWZA 3PUXA 3GN2A 2VDMB 4ZO6A 5J4KA 2VUIB 4PFKA 4LJ9A 2IYTA 5U9CA 3BT7A 3W7AA 1RABA 5BSMA 3FDZA 1K5GA 4UTVA 4MUFA 4UUMA 1JXOA 3AL3A 3H5AA 2P2SA 3QUQA 4DCSA 5CA1A 2QTZA 1JYFA 1MOZA 3KG2A 2C59A 2YV5A 3JPWA 3TCXB 3HAXD 2HMSA 5CVJA 4NOJA 1RAAA 9LDBA 1O0CA 4BDTA 1YJAA 3DP7A 3MF4A 3N87A 3OE5A 3SSAA 4G24A 4CUJA 5E1OA 5KJCA 3RAGA 3HNRA 1G6HA 3C16C 4JLWA 421PA 4M1KA 5TR9A 2R6ZA 4JNKA 2A78A 2V55B 3OQJA 1M34A 1CUDA 4C22A 4ZO8A 1U0EA 1B0PA 4R40A 4DR3B 2QRVB 1QAQA 4NBUA 4ZEMA 4XH9B 3OZBA 3O8OA 2DX7A 2JARA 2PJDA 1Q7RA 2WI8A 1KS9A 2YHIA 4KKVA 4CEJA 2FG5A 3EQ6A 1N1DA 1Q7GA 3ME5A