3VOAA

Staphylococcus aureus ftsz 12-316 gdp-form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
307
structure length
307
Chain Sequence
GHMATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 114
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3voaA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3voaA01
4B45A 4TUYA 5IJ9B 4O4HA 3R4VA 4ZI7B 1FFXB 5IJ0B 5KMGA 5J2UB 3RYIA 3N2GB 4EB6B 2VAMA 3RYCB 3HKBA 5LXTA 4TV9A 2Q1YA 2RHOA 5LYJA 4ZOLA 3CB2A 4DRXB 5KX5B 1TVKA 2R751 5BMVB 5ITZB 3ZIDA 2R6R1 4F6RB 4ZHQA 5CB4A 2BTQA 3M89A 4X1YA 4IIJB 4I55B 3WGKA 3WGNA 5JQGA 5MN5A 2VXYA 5LOVB 2RHLA 4O2BB 3VOAA 5EYPA 5LA6A 1Z5VA 4DXDA 3JARA 4X20A 3JATB 2XKBA 4O4JA 3JALA 5IYZB 5JH7A 5LP6C 5EZYB 5JCOA 4YJ2A 1W581 3E22A 4O2AA 4X1KB 4O4IB 4HNAA 5JVDA 4O4LB 3WGLA 3V3TA 4U3JB 3JAKA 5CA0A 3HKCB 5FNVB 4X1IA 1TUBB 4LNUA 3ZBPA 3HKEB 5C8YB 4FFBB 3UT5A 1RLUA 3RYHB 4YJ3A 4EI9A 4E6EA 3N2KA 4I4TA 4IHJB 4WBNA 3JATA 3JAWA 5J2TB 5CA1B 1JFFB 5LP6B 3JASA 5GONB 4TV8B 3VPAA 5IJ9A 3WGMA 4ZI7A 1FFXA 5IJ0A 4XCQA 5J2UA 3VOBA 3N2GA 4EB6A 3RYCA 3HKDB 4I50B 1SA0B 4LNUB 3RYFB 1W59A 4M8IA 4DRXA 5KX5A 5ITZA 5BMVA 4TUYB 4F6RA 4O4HB 2BTOA 5KMGB 4IIJA 4U39A 5EIBC 4I55A 3WGJA 3RYIB 5LP6A 5LOVA 2VAWA 3HKBB 4O2BA 5LXTB 4TV9B 5LYJB 4ZOLB 2VAPA 1TVKB 1W5BA 4EI7A 5IYZA 4ZHQB 2BTQB 2RHJA 5EZYA 5CB4B 4X1YB 3ZBQA 4EI8A 4X1KA 5JQGB 4O4IA 5EIBD 4O4LA 5EYPB 5LA6B 4U3JA 3JARB 1RQ7A 4X20B 5MN4A 4O4JB 3HKCA 3JALB 4KWEA 5JH7B 3RB8A 5FNVA 4YJ2B 1TUBA 3E22B 1FSZA 3HKEA 4FFBA 2RHHA 4O2AB 5JVDB 4HNAB 5C8YA 3RYHA 3VO8A 1W5EA 4IHJA 5J2TA 5CA1A 1JFFA 3JAKB 5GONA 4TV8A 5CA0B 5JCOC 1Z5WA 1W5FA 2Q1XA 4X1IB 3UT5B 3C8LA 4YJ3B 2XKAA 3M8KA 3N2KB 4I4TB 4WBNB 3JAWB 3HKDA 5M7EA 2GVIA 4B46A 4I50A 1W5AA 1OFUA 1SA0A 3JASB 3VO9A 1RQ2A 3RYFA 5MN6A
chains in the Genus database with same CATH superfamily
2R6GA 2E6UX 4NYMQ 4HEA1 4HMOA 4E21A 5CDUA 5HQ3A 3FOEC 1I94B 4RESA 3U0OA 1WX1A 3FUCA 4Y98A 3GUVA 2DJIA 2ZR9A 5K3FB 1U3PA 2KW5A 4FBMA 4F2DA 2HZBA 4V0RA 5K4AA 1S02A 4X1OA 2G63A 5K3AA 3GNQA 4UTRA 2Q3JA 4RD1A 3BD8A 1NN1A 1GZUA 4Y2JA 3VU1A 3MJVA 4B4OA 3I0ZA 4FKZA 5DF1A 1BH6A 4A2WA 1Z17A 2W2VA 1P5FA 3SYTA 4CMBA 1J07A 1I7NA 2X9NA 5K1ZA 2WILA 1YAJA 3E3NA 4GECA 4YI5A 4YCCA 3K6SB 4JU9A 4YTEA 3W5DA 2GAAA 4N0QA 3EVDA 4O2AA 3AW9A 1DBPA 1VI6A 1ZMOA 2B21A 2XYHA 3KJKA 1CB7A 3OTWA 4D0NA 1DIOB 4U7HA 5JZVA 3E4CA 3LX5A 5L7WA 5AO9A 5T3UA 3DE4X 1YQXA 3C3PA 4BPBA 1WXWA 1Y8RA 4WAUA 2OPHA 3OCJA 4AAYA 3R41A 5AI0A 1V5WA 5JUWA 2RJNA 4XJSA 1XU7A 4L9SA 4ZV7A 1O95A 3D8UA 1P0CA 3HYSA 4XD2A 3HCEA 3UHJA 3WMGA 3A9UA 2K87A 4B0OA 1S72F 3ZY3A 4B09A 3TQSA 5DV9A 1TYEB 4NJMB 2CZWA 3B5JA 1CVIA 4C6RA 4IYJA 3M5DA 4RPKA 4C6HA 4ENRA 1NVMB 1GG5A 1MO4A 1E4EA 2SECE 4KXNA 3KT3A 4TSKA 5G3YA 2FPKA 4UNNA 1Z16A 2F43A 2O1XA 3WWDA 5DWVA 2DXIA 3FNFA 3H5WA 1KH1A 1SCNE 3DDSA 1C2TA 3ORHA 3W2GA 5LB4A 1HYQA 1NVUQ 2JRCA 1DAPA 2NPIA 3R7AA 4IJ6A 4URZR 5K4GA 1QRUA 4W1PA 4RTMA 3WKEA 1F2TA 2NN3C 4R1QA 4FTWA 3VYRB 5JYCA 2GEFA 1TM5E 3CUYA 1W55A 4TMFA 2VJPA 4YCJA 3CR7A 5TMPA 1ZSYA 4G0QA 3KUXA 4DXAA 2PUJA 2WSYB 5IKEA 3PITA 4RL6A 3UGKA 4EDFA 2DPYA 4NL4H 1KJNA 2O0MA 1TIBA 1UWCA 3L1VA 1JDJA 3PR1A 4B81A 4C5CA 3R5HA 1G18A 1KEPA 1JAHA 1NW6A 4EI8A 1DXOA 1T3LA 2J48A 5M3BA 4I1PA 1C9KA 3VZQA 4YDHB 5JAOA 3K4PA 3QNUA 3U4HA 1K97A 2QPTA 2Z04A 4Z1OA 4B4KA 3THWB 1YJQA 3T1NA 2BZSA 5GV7A 5I7RA 3X44A 4RSGA 3KYDB 1E2JA 1UPUA 3S8YA 3V8QA 3KVRA 1QE5A 1QIKA 4PPNA 3UKDA 1WE2A 5K99A 3F7MA 4FEYA 4Q4AB 3LMEA 4ZN6A 1ZH4A 2X1HA 3MMPA 4Y1GA 3OY7A 1FEZA 3LQFA 2Z3ZA 1R2QA 2Z2KA 1OV4A 4LYFA 4DKJA 3GQBB 3K9WA 4BMOB 1GAEO 1GL3A 2Q9CA 2XF8A 2ZSJA 1SCJA 4QXRA 4TS9A 4WEQA 1A5ZA 3COSA 3QX8A 4A6XA 3CVUA 2BN4A 5IXJA 2ZDHA 2E0IA 4MA0A 2YHIB 1RXCA 3GPIA 4EG1A 1R18A 1J56A 2BEUA 3DA8A 3DPSA 1JE0A 1EQUA 1FDTA 4HDOB 4INAA 4NIMA 2ZG6A 1SD2A 2CBXA 1YB5A 4RBNA 1JXOA 3HJGA 5EUQB 3RU7A 3CURA 3O6VA 5K0EA 4BASA 4AQYB 5SY4A 2PKCA 1JEDA 3M1LA 3Q15C 3GJ5A 2HMTA 5FBQB 3QQ5A 3CX7A 4MHSA 4GICA 4YUYA 1XHOA 1GN8A 1Q0ZA 1TCCA 4OA8A 1VYHA 4BFWA 1D2MA 1Q7CA 2FH5B 3H5AA 4BCBA 3VKUA 4UU8A 2XNJA 3D9QX 2IOYA 3L0ZA 4LXQA 4W82A 4BNVA 1RJWA 1PLKA 4BKOA 2GXAA 1V5FA 2P3LA 4EMTA 1UOPA 5ALXA 4QNMA 3S03A 1P7VA 4YRBA 4JBHA 1KPHA 1R50A 3DXFA 2CYCA 2WOOA 1AK1A 1LBEA 3ZHUA 4ZODA 5CFLA 4E2XA 2GUWA 1Y4AE 3KQWA 4P3NA 2W37A 4XD7D 3FH0A 3EDYA 2O20A 2WSLA 1BEUB 4WZZA 4PZDA 3JALA 1XZQA 2F9MA 3OPYI 1YHYA 2I54A 1OAAA 2DWQA 3WRXA 4X1KB 1LXCA 2HRBA 2HLDD 3CM0A 3EHEA 3F8WA 3CNHA 4EFDA 4F1KA 5BR8B 5F9HA 4GYYA 1M6EX 1CRLA 4PO8A 4EW1A 4PGMA 3CEMA 1AQNA 4TLMB 1O6ZA 5CD9A 1DMRA 4HWPA 2P7IA 4DYDA 4P3OA 3WQBA 2ZVDA 2B1GA 4X1IA 2FFAA 5HZHA 1R0SA 2DBVO 4DFDA 3IVAA 2E82A 1LVGA 4FILA 1NFQA 4EAAA 1HDRA 1NURA 4IIBA 2AMJA 2GDZA 3MWJA 3QEKA 1VFNA 2C5GA 2NUBA 4HYEA 3IB6A 1SQ6A 5HIJA 1XKLA 4ID9A 1OU4A 2W8BC 2JF0A 1Q50A 1HM5A 2JGDB 2FX3A 1BKDR 2JK0A 4IILA 5AUOB 2PGAA 2O0JA 4YCBA 4W5RA 3E35A 1KJQA 1Z29A 2B78A 5AI5A 4HDMB 4JI1B 1ZW1A 4I1RA 3KSBC 1R4AA 1UP4A 2AHOA 4M0FA 4QU5A 1H6BA 3QX7A 3P0JA 4TL9A 3ZW9A 1EKXA 1GO1A 3GJ0A 2CLDX 4TKVA 1TF5A 4WDQA 2NAPA 2FR8C 1OQAA 4M8SA 1JSLA 3QH4A 4LYHA 2V98A 4HY3A 3E9ZA 4O8CA 3DBHB 1N6NA 4YAEA 3QU4A 4BVQA 1ZS9A 3AM5A 3QNWA 4MPJA 3ZZMA 4KL8S 2GM4A 1WQ1R 5B6JA 4DCVA 5CB4B 5AD1A 4ABYA 5CW2A 1UK8A 2VYVD 1O2DA 3IJ5A 5AXBA 1YE5A 4CGYA 1OLSB 2Q6TA 3D3JA 3FMGA 4JH0A 2JG3A 3EFBA 1TQ8A 2P3QA 4R6XA 2O7VA 2FZLA 3DAHA 1ONNA 2XRYA 1EESA 3F7OA 3RU2A 5BRJA 2V6MA 3THYA 1BQ4A 4FDTA 2RHHA 1RWXA 4JAVC 3LO5A 4INOA 1GFZA 2COUA 1PK9A 2HCBA 2JANA 4RSHA 3UH1A 4ZMBA 3O85A 1C4KA 1WPRA 4Y2YA 1R0WA 3IDSA 2WHEA 3VTZA 3FZNA 4JQYA 2AR9A 1SWVA 2P90A 4EG7A 2O59A 4TLBA 5C1OA 1RIIA 2Q1TA 4AN0A 1ADFA 1OAKA 1Q20A 1QUFA 1A98A 1B93A 1W2HA 1YU9A 4WCFC 1Y3CE 3NBAA 4PQRA 5B6IA 2F8TA 1GUYA 5DBGA 3R40A 3TOCA 1C0KA 2L17A 3U60B 1CP3A 5LNK6 1PGJA 4DVGA 2IV7A 2I3DA 2HH9A 3AUXA 3R4VA 4RDHA 1INLA 2IUTA 1ZK3A 4CMIB 2OP0A 4GI3A 2AZ4A 3BGWA 2R1UA 3G59A 1NVFA 1QRDA 4Q9DA 3X1WA 4EI2A 2VQSA 4GMXA 4EVRA 3P9XA 3MGKA 1IN1A 1BXGB 4JLMA 2G1JA 1ZUNA 1JR6A 2PMWB 3D02A 4IKPA 4OG2A 1P2BA 4OREX 1GTRA 1NY5A 2JHPA 3VVMA 2MINA 3WYNA 3C6XA 4KBYA 4QVGA 2YXBA 3PC4A 1KTVA 1Y5RA 4V0QA 1XWFA 2GARA 5D8DA 1SZPA 5JCZA 5I8ZA 1OLOA 2VPXA 2P78A 1YQEA 3OFVA 4GOOD 3SJZA 1K4YA 1MX3A 2HDOA 2PKRA 4P0TA 2CMKA 5D3MB 4GEKA 4IIVA 4LA4A 4ZQBA 6LDHA 3DPIA 2WI8A 5SZKB 2EJWA 3BFPA 3D8NA 3JWGA 3L79A 1VYTA 1J24A 2W71A 3NFRA 1IMOA 3KHNA 3ILYA 3QBJA 4FMCB 3SXUB 3T41A 1S4QA 2BMEA 3K05A 3CMCO 4FBLA 4GAEA 3GX1A 1GZ6A 5K0NA 3LWPC 2CMFA 2G9RA 3I42A 5CHYA 5CFPA 2PGNA 2V6BA 3NANA 3KEOA 1CUCA 1R9GA 4MRMA 3IP9A 5J2TB 4AQDA 3PIDA 3ZD6A 2OG1A 3EAGA 2IIPA 4D9GA 2B99A 2O2DA 3U7GA 2V8OA 4E94A 2PJZA 4POAA 1N34B 2P5UA 2VHQA 1UMKA 2ZIEA 1NVVR 1SNYA 3FI9A 5HF5A 2ZJ3A 4L2IB 2PWZA 1YB7A 3WQRA 1SQFA 2BFNA 5G4KB 5EESA 1AKUA 4M8IA 4G4SP 3T4UA 4QECA 2X8BA 3RVMA 1I1OA 3L82B 1WUYA 1Z2PX 2V4MA 4AKHA 3I09A 1K3FA 1B0UA 5HIAA 4AI6A 4GOXA 1ZAYA 1Q0RA 4QL3A 2FW9A 2A78A 3EXG1 3KUCA 5M34A 3GPBA 3OC6A 1C7RA 1BOOA 2VHWA 4BE7B 2QEXF 4XPIB 3TLMA 3WYGA 4CV1A 2B36A 3PPWA 3EGDA 2MSLA 2X8JA 2Q5QA 2F1OA 4GQBA 1M2OB 1T0PA 4Z0PA 3E3OA 4G1FA 2WWIA 2HIAA 2F67A 2ZI5A 4ND2A 5E2AA 5H70A 5CH5A 1JDTA 3AGKA 1AHNA 4PO3X 1GV1A 1TIPA 1QCYA 1UKYA 4F4FA 2VF5X 2WFAA 3IP7A 5FWXA 1VQ7F 4LI3X 2XT0A 2ZT7A 4HDNA 4UD6A 3ETLA 2YYEA 3SBOA 4PYRA 1OFUX 3F96A 3JV7A 3TX2A 2QQ5A 5EWJB 2DPHA 1L5HA 1J0DA 1SUWA 2PS3A 5H3HA 3E22B 1JKXA 2QX8A 7MDHA 3HRHA 3Q3HA 3KJNA 5AIAA 2P35A 3SHFA 5HK8A 3JSAA 4QXAA 1DJOA 4KE6A 1JQBA 4DCMA 3HZOA 1O5IA 5CA0B 1OBOA 1UEXC 2DKFA 3KQPA 1Z5NA 4DQVA 3OKAA 1KEEA 1HE5A 2QRMA 4G65A 3DV0B 4LDAA 3BE6A 1JKFA 1HQCA 1NGSA 2E7ZA 2W90A 3B9PA 3KWJA 4FT4A 3JQRA 2JIOA 4WBNB 4BFUA 2JBWA 4RH3A 1N7HA 5ECWA 5AW2A 3I6MA 3PJDA 2ZBUA 3IHKA 5DHQA 2GDJA 2XZLA 4OGWA 3DL7A 1MAAA 3CG4A 1YDMA 1MAUA 8AT1A 4MPRA 2X0EA 3KYCA 3N2GB 3W5HA 2VAMA 5GAPK 4CIWA 421PA 4CKEA 4E88A 2M1ZA 2QTVA 4UEOA 3RS5A 5BT8A 3RCBA 4ZOLA 5G02A 2QAIA 3PYLA 3MM4A 5LZ4A 3DH0A 3RAGA 1VXRA 1Y34E 2YUIA 3I1FA 3OEHA 1XZPA 5FOWA 2PWAA 5K3EA 1AS3A 3I01A 2O05A 4JVMA 4PU0A 4ML3A 4R81A 2AMVA 5BSKA 2YWHA 5HNKA 1L5SA 1GPAA 1NNI1 2DOKA 3A3OA 1VMEA 2Q3FA 3C8MA 4JKOA 5D7NA 5KVQA 3EJWA 3GD5A 1KE2A 1K92A 2X41A 5JH7A 3BN3A 4XX1A 1VK3A 2BCGY 2WKWA 4R83A 4B4UA 5AVUA 3X1MA 4PVCA 1GXSB 2WFLA 3ZGVA 4C7JA 1QIIA 3QUCA 1RYYA 1ARZA 1W94A 3IMEA 3VPBA 3LK6A 4DVJA 2ILVA 4CCSA 3ADBA 3TYXA 2AYYA 2CNBA 4IUYA 3GMTA 4D9MA 3HHPA 1Y7PA 2HSDA 2L42A 4RMJA 1FRQA 5J5VA 4LZWA 1ISHA 5AJHA 3ZWOA 2CWWA 2XUHA 3F6BX 3IIEA 3PNSA 4INJA 4HUQA 3ZQKA 3CS3A 4DA6A 5HS6A 4YUXA 4KQMA 2CSXA 3KUDA 3F2VA 5AM5A 2EGUA 2Y66A 4JODA 1S5PA 1U9YA 3LYHA 3WBJA 1Y5IA 2V6IA 3G2MA 2B3DA 4PSKA 1G1AA 2QHXA 3I58A 2XNHA 2ZJBA 1G8PA 1DCKA 4R0VA 4ZO7A 4ARSA 2ZBEA 3OJXA 4Q9AA 3MLBA 5E2BA 2X23A 1QVAA 5H68A 1T5LA 3RJ9A 1P80A 1UZNA 1J90A 1N7IA 1W8DA 3TLZA 5I7WA 4BKPA 1I24A 2BPOA 4I66A 1SAYA 4G88A 3LGXA 1XHEA 1UT6A 4XRRA 2YN0A 1EXDA 3TEFA 3GLIB 1NTRA 2FW8A 3REQA 3UG6A 3NHMA 3QQPA 5THQA 4L22A 1BXRB 3MNFA 1XLTA 5AI8A 1RW4A 5BYAA 4MI3A 2QJTA 1U7OA 2IODA 3NIFB 4BP3A 3E9QA 4CHTA 1OKKA 4JYCA 4K8OA 3TOXA 3GB9A 1QE3A 4P5EA 1QYCA 2VDPB 3CRNA 4YYEA 5KYXA 2D1RA 1RXSA 5CITA 1O6FA 1PFUA 2I99A 3EDQA 2WJGA 2JLSA 3D8HA 3LUPA 4PNEA 2CJWA 1E7MA 1L4UA 3QUQA 2QJRA 2A5DA 3HCAA 2XKKA 5IKOA 4MEAA 2Z1FA 5BWBA 3C39A 1OZGA 1M2JA 1P73A 1Q0PA 1JQ5A 2I2WA 3HR7A 4QBGB 4EY8A 1F8YA 5T8KA 5B7NA 3K09C 1P60A 2A4KA 2H18A 3K9HA 3LWBA 4HRYA 4AUMA 2C9OA 2BYTA 2OHOA 3F46A 4LRUA 1QH0A 2FCAA 2OESA 4TMZA 4X24A 4EL0A 2PJRA 4XQCA 1H3NA 2FZWA 4RK4A 1WB6A 4I3FA 2G1PA 2IQ5A 4JNKA 3HDQA 2PHNA 3MTGA 1WQ4A 5FPPA 2YJ3A 3A05A 3SJBA 3EUEA 3IP3A 1S9DA 4J1QA 3HYCA 3EGXA 3RTAA 3F47A 4F5EA 4CR7A 5M7EA 3TQCA 2YR0A 1LNZA 2BDTA 3GJSA 3KWMA 1RQRA 1ZK0A 2R25B 2ZVJA 3A9TA 3HXTA 3OZCA 4M8KA 4EMUA 4F06A 4F21A 5B64A 4BATA 2WJIA 4B6PA 2Q1UA 1I4DD 1CW2B 3DL2A 4UUNA 4F3KA 5J47A 1J0BA 2L2QA 3WV5A 4G0YA 4GMFA 1SCUA 4JA2A 5IFLA 3FVRA 4R40A 1UAAA 4HMQA 1XG5A 2DEUA 2WJWA 3E0XA 3M4SA 3M4NA 4LJKA 4CHGA 4AK9A 5KVSA 1GG9A 1JWLA 4TV9F 3WP0A 3F6PA 1CY6A 1N4AA 4D4GA 4F97A 3E5NA 5JNRA 3SKYA 4YMIA 5LCXA 2EF1A 1NPDA 1EUDA 1HFEL 1M90H 2J3LA 4XUGB 2C5EA 2FEAA 3R6DA 1SVSA 1GQFA 4FZ3A 4UREA 5H3CA 4D97A 5A1JA 4DR4B 4BMXA 4QREA 1ECLA 4XD7A 3LPAA 2PIDA 3RNOA 2ZJZA 4GGMX 3CPWF 3TK1A 3WLQA 5IDWA 5BXYA 1JIUA 3J81k 3WDSA 3WJRA 3MBKA 3IMKA 4MIYA 2HLDA 2HMVA 3KPUA 5EMHA 3ZCVA 4TQ9A 2HHLA 4PVDA 3V4FA 2IV3A 4IDNA 2TMGA 3T7EA 4RTJA 4W99A 3T3MB 2JKZA 10MHA 3T4XA 2VTVA 3F3MA 2VQDA 4QX6A 4YP6A 1HFKA 3LHKA 4HAOA 2IYUA 3QPVA 4JFAA 4MUGA 4ZI3A 1TF2A 3K9CA 4P22A 5CLIA 1OREA 2GK3A 5AYVA 2VS1A 4QZVA 3T3NA 1ZRMA 1SULA 2QR3A 3LUDA 1CUZA 2HBRA 5HDQA 1FX0B 5IM5A 5GADl 5KO2A 1KYVA 1BMQA 2VP3A 2ZRPA 3BEOA 3IKEA 3A6HA 4RLQA 1KZHA 3SICE 1T29A 3LVQE 1U9ZA 1YJ9F 1R4NA 3MB5A 4Z0TA 3ZCSA 4ZMRA 5IZCC 2UVDA 3NYIA 3WGMA 4BNGA 2D1YA 3BL5A 4Q3DA 3VV2A 4F3TA 1CV2A 3MELA 3HI4A 2VDKB 3EUAA 4LHZA 3T0FA 3NTOA 1OB2A 2IUYA 3O8OA 3BDIA 4G4WA 4KGZA 1JKIA 2PSSA 4KW7A 2C03A 2C1EA 4KGDA 4H7KA 4PHGA 2RK6A 2Q7DA 3VAAA 2M6RA 3II6X 5GGYA 4KVFA 5DM70 3LRTA 3UAYA 4BAGA 1OZ0A 4CU2A 3D5EA 4FDVA 4C22A 2GA9A 1EG7A 5GGXA 4DSNA 3LBHA 1DX9A 1NQTA 1X0XA 4YRRA 4MLZA 1U80A 2I6TA 3L8ZA 3ODGA 5JS8A 1IPAA 2WF5A 2C7RA 3KXLA 4HQKA 1DAMA 1PU2A 4XIYA 5E7QA 1NC3A 3WJQA 5IYZF 4OYLA 3TLBA 3AFHA 1NP7A 2QXYA 1GARA 1UOOA 3FZQA 3INGA 4OFXA 3OJLA 1QPBA 4G8JA 3IV7A 4L78A 5DT9A 4Q4JA 1ST2A 4PN3A 1WMBA 5B1EA 1PW7A 2JCSA 2YWEA 4DJJA 5I9LA 2UYPA 1H5QA 1R3UA 4KO2S 3FCAA 1RYEA 4L50A 1EWQA 4ARIA 4TMXA 5C7YA 1FVHA 1SHLA 1J97A 1Z36A 2G04A 2VBFA 3C7KA 3FRJA 3NGLA 1KQSF 1AKTA 1TUBA 2F1IA 2GHQA 3OX3A 4NZNA 4RKYA 3IV6A 4YRLA 5IEBA 2CXTA 1AKVA 5CIYA 3CY6A 4BGDA 4HLUC 3P20A 1T26A 3FOZA 4XPZA 2QTGA 1TCBA 3S5UA 3A4LA 2EP8A 2F1HA 5FL7A 4Y3UA 3B5IA 1GM5A 3EVNA 3F0EA 4BDSA 5AVXA 1UAYA 1KVRA 3ECSA 4PPGA 5KC9A 3GNSA 1OTHA 4IOJA 4K9KA 5CDTA 1XRNA 3C3DA 3M9LA 1YCFA 2IQQA 4PSAA 3VKGA 4TM8A 1BWPA 3UJPA 1CUWA 4IGEA 3ZE6A 2VP4A 2WLTA 3ZDXB 1C7JA 5EQTA 3E8MA 4O4HF 1TD1A 1OZHA 4WFQA 3SI7A 3ZLTA 1T5HX 3T4PA 1GZSA 3HJAA 2ZODA 3DT6A 3PX2A 2HSJA 2J9RA 3STYA 3TR6A 4PC7A 3AF5A 4BMNA 4CG2A 3FVVA 5LYJF 1P75A 3DBOB 1MFPA 2OCKA 1U6JA 3CB4A 3OQ6A 3QVSA 4KHZA 4IGKA 2WP0A 3AHFA 2AH5A 3WB0A 2AFIB 1VJGA 4JP8A 1GTMA 4CNQA 4IG9A 3VCZA 4B40A 4ZHVA 4W8GA 1KMHB 5AOCA 3NETA 1AMNA 4OQQA 4X20A 2E1PA 2HX1A 2ST1A 1K73H 4Z49A 4TTJA 2EZUA 2ZOVA 1GR0A 2CXSA 1Y9DA 1JD1A 3AR8A 1M34B 4AY2A 1G55A 2BHSA 1MABA 2I6GA 3CH6A 5JVDF 1PW5A 2G9UA 2P2SA 3WGLA 4YREA 1HFWA 5JE8A 3FYUC 2R00A 3H9BA 2Z5GA 5E3HA 1GGKA 1H0HA 2JGKA 4CM8A 1V1MB 2HOQA 1V3UA 1L4GA 3N1UA 4RWZA 1TA0A 2JA1A 3C98A 5KYUA 3C1AA 4BZZA 3JVDA 1KZ9A 4IIXA 3LHIA 3UUGA 3WL7A 3GMDA 1RWKA 3M0EA 2HCFA 1ANKA 2IPAB 3ZN2A 1EA7A 4OJKA 2VBCA 3ACBA 4Z0HO 1A72A 1H4SA 4GKBA 2HPHA 2O5RA 2PDAA 1OAPA 2WIJA 4K3VA 4LE0A 4S12A 5AKLA 2GKGA 4C7XA 3I5MA 5ADUS 5J2UF 2ILTA 4IUBS 4K6HA 2FPOA 4IGAA 2ZVZA 2G08A 3C8HA 4J2OA 2OWDA 4MP8A 3HR8A 5HQ3B 3HO6A 1BD3A 5LMCA 4GKAA 1WOYA 1H2XA 3DKVA 2DZDA 3H42B 3MS4A 4JUAA 4DGQA 2A1IA 2G09A 3KSMA 3LFHA 2WIBA 4LJLA 5KSWB 1E2HA 1NVAA 3UJDA 4AWAA 2J59A 3KR0A 1OXXK 3HEAA 4JUDX 5DASA 4E03A 1D0VA 4OVKA 5A2QM 1LPMA 3F1LA 3IGFA 2HHCA 3P9CA 3BB4A 2Y1XA 4A0QA 4NYJR 3BXFA 2Y9PB 3QW2A 5SV2A 4RMGA 5A1TA 2Y0PA 1JYEA 1EZZA 2CYAA 2RI6A 5F3WB 3V2HA 4KQCA 4MV4A 5C80A 2PMCA 5DCUA 2JVIA 2JFGA 3OHSX 1E7SA 4EENA 2Y1WA 4NMMA 2JIDA 1U5AA 2MIIA 1TMOA 4H3SA 5FNVF 1XHFA 4O2AB 5LBTA 2Q5FA 1J21A 3UM9A 4NENA 3B53X 1F6DA 2JAQA 4KQIA 1FNMA 3CUSA 3ICPA 2ZQZA 3R3UA 2JJ8A 1KGSA 1JTVA 1ESCA 1Y8RB 4JS0A 4U5QA 2PUGA 4TZZA 3K0EA 5G4LA 4BLQA 2XI4A 4AX4A 1VMKA 3MCQA 3RH0A 5KKCA 2JIZA 3QJGA 4P4UA 4F9TA 3MMXA 1AN0A 4HFJA 4P2BA 2UZ4A 5DIFA 1BCSA 1RHRA 3A2LA 3KD2A 4IOKA 3TW4A 2FDCA 5I45A 1Z6TA 3B12A 4BV8A 3LKZA 1LW6E 1LPPA 5JPDA 2AQIA 1C3VA 3WGQA 4FU0A 3K96A 4JJFA 1E4EB 1SWWA 3HCBA 4A0GA 3VAYA 3FPHA 2F43B 4M22A 2AF4C 5AVMA 3EN0A 5DYNA 1KMIY 3CYFA 2MSWA 1V9LA 3UUWA 5CVUA 2QRKA 2CNKA 2IT1A 2KM1A 2WYIA 3KUKA 1Y4ZA 4TTSA 4AMYA 4DQDA 1TO2E 3RRYA 1HDIA 2VWGA 5B3AA 4RVOA 1JB9A 2Z9DA 1C9NA 2LGJA 1VIMA 2N42A 4TL6A 1SBHA 4ND6A 1Y8ZA 3EWNA 3EQ6A 3TSAA 3ZK8A 4F2PA 1RI5A 2N1MA 1W35A 2YWBA 5PGMA 1TW3A 5KJ1A 1T15A 2GNPA 3WL5A 5ITVA 2FEXA 3RVNA 4KI7A 5CVVA 5ALMA 3QXGA 1YRWA 1UZMA 3QPUA 5C3MA 2H00A 2VZLA 1CY7A 2BBOA 1AKQA 2JGIA 1M8KA 3B3FA 2B20A 3AWDA 4TTIA 1NMXA 2CMHA 3QK7A 5EEGA 2H8KA 2VDMB 2XUIA 4YBRA 1E2GA 5CURA 2DPXA 3U0BA 1LJ8A 4XCVA 4JBWA 2HI0A 2WSMA 4ARZA 1CD5A 4U8GA 2FZCA 4AL4A 4L5JA 4MW1A 1WU8A 3QF7A 2I80A 2MHCA 3NH9A 4LXXA 1DPFA 2AUMA 2QZZA 4ND1A 4R3WA 2XUKA 4EGAA 2X9GA 3LX6A 1F7VA 2OCBA 2QPOA 3KWFA 5IASA 3U7JA 4JYMA 1ZH2A 4DDVA 3JAWA 3NMUF 4TLCA 1CVLA 2QAGA 5AIBA 3EX7C 1Z33A 2EFEB 4R2IA 4XVQA 3N0XA 4RS3A 1SHTX 5TS3A 3Q85A 1OXMA 5BN4A 1VJDA 5AHXA 1O97C 3FPFA 3GEDA 1GYRA 3H2ZA 1EP9A 2BEUB 1NI5A 5ALEA 5EJ7A 2JGRA 1E6WA 2R8XA 2WB4A 3OOJA 4EUFA 4JGGA 1DRVA 1KIFA 1MJNA 2EIHA 3M81A 3RJTA 3A4MA 2F8SA 3FD6A 1IV3A 4V0LA 5YASA 3NZEA 3CX3A 4P84A 3TTVA 1WMEA 3MJ4A 5B6PA 4UTVA 1F7UA 2YIDA 2Y92A 4CGZA 3OETA 3TZEA 2Q0QA 4FB4A 3M3HA 4AKIA 1P61B 2V3VA 4NZ9A 4CKXA 3RT9A 3HMKA 5I9BA 1IHDA 1FDOA 2XECA 3KHSA 4REOA 1WXFA 2F1RA 3N5KA 4I4IA 3EMVA 2N46A 5J4HA 1X9GA 2HW8A 5KYVA 1XZLA 1US8A 3HUUA 1T91A 1U6IA 4GI2A 1R0BA 4UE6A 3ILSA 5J40A 3L6OO 4DLNA 2ZUBA 4GWGA 3N76A 3K70D 3BE8A 3KKZA 3NVDA 3K0TA 1IZZA 3PNVA 3JALB 4KWEA 2ARKA 5HIKA 5T6MA 3VBEA 2P6RA 4D3YA 3VGPA 3WYAA 4U7PB 2Q5LA 2R4QA 3HNRA 1DUIA 3VO8A 1ETHA 5BV1A 1RQNA 3VTIC 5B3LA 2LCFA 1PL8A 4IHJF 1OSNA 2W8ZA 2EKLA 1FVFA 5CA1F 2WAMA 1NMQA 4EHFA 2MTBA 1JSXA 2GESA 3GL9A 5MGNA 5HQTA 4X1IB 3WPXA 4J0FA 5EIFA 1XK7A 1E1LA 2CVQA 2JIBA 2OK7A 1P1FA 3CKKA 3GMIA 3IFSA 4NS4A 3AY6A 5JG7A 1Q95A 1XJQA 4PPQA 5CDGA 2XZOA 1R15A 3SSNA 1YRAA 4JFRA 3ZU5A 4I50F 1WBJB 1NQ3A 4RSMA 1Q0UA 2Q45A 3TQHA 3FCYA 4WOCA 5ITSA 5JDCA 221PA 3E81A 3OO1A 1U7UA 4ISCA 3KOUA 2SNIE 1SIWA 4YFVA 4EHKA 2BUCA 4P7KA 3HC7A 2FGKA 2E3JA 2WM3A 3ZGNA 3K9GA 2VPQA 3J7AC 3AJEA 4TKVB 4NOKA 4D9HA 4YRKA 1GPYA 2PLFA 3P2MA 3IVXA 2ZRAA 3GP3A 2BJVA 3JVUA 5LIPA 1POWA 2CKDA 4DW8A 5ARBA 1PUJA 3ORRA 1IVYA 1ORRA 3CH4B 1EJ0A 1Z5VA 4DXDA 3EZFA 1Y7TA 4NU5A 3THSA 2PL1A 3JD0A 2X14A 3AB8A 1GQSA 5ICFA 4GQAA 3W2IA 4TRMA 2FQYA 2PZMA 4MWSA 1XP5A 3TIFA 3MGAA 3CRZA 4MUJA 3JQ9C 5G4KA 3KK0A 3IVCA 4TKUA 2DBQA 4IZHA 3R0PA 3OZEA 4UEJA 4Q9KA 2CHFA 4HFRA 3G8CA 4IQ8A 1QAHA 1N6IA 5IAAA 4OHCA 1F5SA 3THYB 3TMYA 2CDRA 4QRHA 3IOCA 4LXIA 1DHRA 2QB5A 3JYPA 3Q9LA 3IEWA 5DSZA 3U16A 1W42A 4CMEA 3V2IA 1XLWA 4ALLA 5BR7A 4RIFA 5EHGA 3OA2A 1XRMA 1DDOA 4KREA 4IJMA 3HJTA 4HRAA 2H4JA 3UOWA 5CFQA 5KSYA 4KFCA 2Q2OA 2ZBFA 2YBEA 3OURA 1DIRA 4BN5A 3RK4A 4XCQA 3DMNA 3IMCA 1RACA 3PGMA 5ALPA 4ZYYA 4PLFA 1JLSA 4YALA 4G0UA 1VPDA 2OBLA 5C2JB 3W06A 4DT1A 4ADSG 3BORA 3LSYA 4B0PA 4CT4B 2AG5A 1X8LA 1UBJS 2HM7A 2V96A 5DSTA 1ONIA 1I5RA 1LZLA 1P0IA 4ZCLA 4XR4A 3IESA 3NORA 5I7EA 3I28A 5LMZA 1JGTA 3M6WA 4B6OA 2QUAA 1VKOA 2AJ8A 3HVIA 3VYSC 2FNAA 2P0EA 2X2EA 3L8CA 3FTDA 2YUTA 1QIEA 3H84A 4N48A 1PT6A 3BXOA 1EFPA 2WJYA 2R8YA 3L4SO 1U2RA 3RC9A 1ZUNB 1UOEA 1VMAA 4E09A 1Q83A 3FWHA 2UYOA 4OMDA 1R4ZA 6GPBA 2MINB 1C4WA 2DUMA 2VZ9A 2DFLA 2AUTA 3OLZA 3PA6A 1L8QA 4GZ3A 4P5PA 3RRMA 2A9QA 3HB5X 4CFZA 3TR0A 1JQJC 4RZQA 1I51A 1AHIA 4I3GA 3OWOA 3D6JA 2RBEA 3R5SA 3ITKA 4NKRA 1XL0A 4UCXA 2O4UX 2O2XA 2FSPA 1UDRA 5EWMA 3ER8A 5JXHA 1AA6A 3BMQA 4MR8A 5AXAA 5AHRA 1Y9ZA 1BZYA 1FSFA 5CT6A 4MVCA 5EPOA 1Z22A 3LNTA 3GPCA 4L0MA 3HCRA 3MB8A 1JVBA 4HX5A 3CA8A 2QVXX 4PLHA 3QG5A 4MRMB 5ILGA 2K7FA 2GVIA 1Z0ZA 3KJXA 5AK4A 5JMWA 1HLFA 1AZWA 3WGNA 2JFBA 2YWCA 1UC4B 3MD9A 5T4EA 1HYGA 4II2A 1XMJA 3WS7A 4DJTA 2D5LA 2P40A 4YT2A 1LSOA 2OHHA 1Z39A 1CPYA 1TUIA 3I9LA 1AMOA 1TQHA 1QG4A 1RKUA 2FPLA 1Z0DA 1WSBA 3GFFA 4BC0A 2E87A 3UB2A 3LP6A 3QVWA 4DLAA 4HVLA 3CEPB 1UC5B 4AQ7A 3DEAA 2XKJE 1CQWA 3LD9A 3NHRA 1WR8A 3TUIC 4L8LA 1ZN7A 1ZHFA 1MB0A 2OVBA 1KK2A 3SVLA 4L9WA 2H59A 1W93A 1E3LA 1WCYA 5GJVC 2GGSA 3EARA 3C5CA 1IXKA 2P9HA 3OIUA 2YXEA 1PJSA 3QOWA 3I3OA 5KYGA 1E3IA 3WIVA 2ZZMA 1H1DA 4MWBA 2AXNA 4XH9B 1P7WA 1HQYE 4FOPA 3STVA 1ZMRA 3EGDB 4XX0A 2X8JB 4RF3A 1F8XA 1QHYA 1E9EA 2J08A 4OSOA 5TF4A 2JFUA 1YSCA 1D09A 1VECA 5IWCA 4HNAA 2FMXA 1QAOA 4GDFA 4RK7A 1LQTA 1ODLA 4DWWA 3PF9A 1XD9A 5FWXB 1VQKF 2W2KA 4QODA 2K2QB 3QYPA 3ZW8A 3ILVA 4HDNB 4RLHA 1TVEA 1M2WA 4J1TC 1PJCA 4ZMSA 1A9RA 1U0RA 3QE2A 5CTAA 2NSYA 1L5HB 3NK7A 2PKXA 3NVMB 2CGEA 3KEGA 5CVEA 1DARA 5FUVA 3K4HA 4W1RA 3RK0A 3IUSA 1C2YA 1PF7E 1I9CA 2QRHA 3OEED 1LVUA 1RVDA 2DLDA 2OHXA 2QQEA 5D7BA 5ALIA 2OCGA 3SX4A 2V3WA 3MWKA 2YFQA 4L85A 3GT7A 2ZJ8A 2PSHA 2ZIZA 2PX3A 3R24A 1KEEB 2VXCA 5EPUA 5G1OA 5IARA 4NXMB 4M1EA 4PAGA 2VJCA 5DWQA 2JAWA 3REFA 4ALKA 1PWYE 1VP9A 4JSTA 1VZ2A 3NM5A 1QIFA 4G07A 5TNXA 5CFZA 1EDEA 1UBOS 5KQPA 1RMYA 2C9ZA 5FXMA 1X1TA 2XYRA 4DHWA 5HHTA 1T0IA 4JP2A 1M1KH 5EN4A 3A4NA 2C7PA 3C5WP 1BVYF 3AI1A 3C8UA 2MQEA 2ZJYA 3PV0A 4QGBA 1FX1A 3WGJA 1DOAA 2AFRA 3KYCB 4QQNA 1UK7A 1VGRA 2HV8A 4D6XA 3LWOC 1OMOA 2WU3A 2Y93A 2ZWIA 5CJ2A 3RHFA 2QTVB 4CKEB 2BGLA 2ZUDA 3VC7A 1Z12A 4DLZA 4ZOLB 3K70C 4BO5A 1IZ9A 1G9SA 2XCIA 1BDIA 3PGVA 4HWTA 1U02A 1E9SA 2QP3A 4XJVA 1H42A 5HKBA 1ZPDA 4YB8A 3W5CA 1TMKA 3CCLF 3AR4A 3FYTA 4G0NA 1Y37A 1ZJJA 2R2GA 1LSSA 2VP2A 3GGDA 4HH3C 5TY0A 4FC7A 4YR7A 3JQ7A 4ZO8A 2B8NA 4HN2A 3SFTA 1PV2A 5CLJA 3HU5A 3GBPA 1RRFA 3K5PA 1K4KA 2PUHA 4I08A 5JCJA 5JH7B 4ISBA 2Z1DA 2YYSA 1OT3A 3OBIA 4KIJA 4MJLA 1XCLA 2WFLB 1FLDA 5CAEA 2FPPA 2OCIA 1A5SB 3GELA 1VJCA 3HU1A 3ENZA 1QM5A 1D7OA 4IQFA 4BB6A 2PRIA 1Y1RA 2QL9A 2WYUA 3HXLA 1BGVA 4RADA 3C3MA 4IVQA 4B3RB 4L5BA 4HUQB 5C37A 1TYZA 1DJLA 1JRLA 3CJQA 3HSKA 3K2QA 1NQVA 3M2PA 3IEMA 3VU3A 1OX5A 3ITNA 1C7QA 2IXAA 5HEKA 1TJPB 3R74A 4LNHA 1PJ2A 4NQZA 5HSGA 1RPTA 3U4CA 5KMGA 3KP1A 4O1IA 4Q7JB 3L0IB 1S8FA 5AVVA 1DQYA 2J46A 4GLLA 4F11A 2ZE5A 3ELYA 4TV9A 1QK5A 2Z5VA 1G8GA 3PAFA 2P2GA 5COQA 1KE1A 3UW1A 1T4MA 4N7JA 4ZRNA 3OI7A 4KN9S 4UU0A 3REQB 1JHVA 4JYPA 4RVDA 4BGUA 1A2QA 4YY3B 4IEEA 4MQUA 2CD7A 4FYJA 4BUZA 3LUKA 2D3TA 1YR1A 3ZJ4A 3KCQA 1CDEA 1ZSNA 5KYXB 2BP7B 1E2QA 2QZPA 4IVRA 3LZCA 4PIMA 4A91A 2LBPA 4DADA 4CQNA 4YRZA 1DOZA 1VE7A 3CSDA 3U31A 4B2IA 3Q8HA 1CWUA 3CPHA 2NV0A 2VK1A 3HE3A 2CJWB 4QSMA 3DO5A 2IPLA 3E7XA 4X85A 3LYLA 2BONA 1OOEA 3AM4A 1T9DA 1TK9A 1FFDA 1XZDA 1J1IA 4G0PA 4PR0A 1YHZA 2WWWA 5IJWA 5EL0A 4MIEA 4XASA 3I5YA 4HVAA 1QHIA 4JR2A 1NF8A 2V7GA 1JMYA 1DRUA 1Z74A 2XQVA 3NTXA 1D07A 1TLTA 3JXEA 2FC3A 4E6EA 1NN0A 1W44A 1YQTA 3JATA 3F5QA 4K9OA 4W7IA 4H35A 5LUAA 3BGVA 4N39A 2BIFA 3U3MA 1KQOA 2DUNA 2VBIA 4LZPA 4WFKA 1F4PA 1T4GA 1X1DA 3LO8A 1CFZA 4Z1MA 4LBZA 4H6XA 4DR6B 3SSMA 4KO1S 3WO1A 4IVPA 4HDQB 1SVKA 4V38A 3LW7A 3RFVA 4EJMA 5JJKA 2RONA 3EGXB 3AVYA 3Q3EA 1TRHA 4RGYA 4B3SB 3OLCX 1KKLA 2EBUA 5L4LA 1Z4KA 1OBCA 2ACEA 2OORC 1J5XA 2FQXA 1UFVA 3P2IA 1ZU4A 3AYXB 4XGIA 3I9V6 5AVKA 4OBWA 3U40A 2BAGA 1RWPA 5J4KA 1Q14A 1EK5A 1X1QA 1XQVA 2HU2A 2LDXA 2WIFA 3AHEA 2F4VB 4MLCA 1SCUB 3G4SF 2WWGA 4R40B 3VH4A 3DZJA 5H83A 1VSQA 2CY0A 1EZ4A 4UHHA 3H0CA 4M0UA 2DHRA 4YRIA 2VHUA 3BXZA 2GF9A 3K72B 4ZQHA 4AXXA 1UBCA 3F74A 3G02A 5IYZA 1YZTA 3PUIA 3FYSA 2AVNA 3GYGA 4B3CA 3PJRA 1EUDB 5CLQA 1L7VC 3FAZA 3U3OA 1Z06A 3VVBA 5HJ2A 1ADBA 1UADA 4D81A 3JYHA 4C0XA 3C41J 3FF4A 3A27A 2JGLA 4CUKA 1QFZA 5IK2D 3LIPA 5FAXA 1QF7A 1TK2A 3UICA 4BVSA 1IOVA 1LQ2A 4I14A 1VRVA 1C0EA 2GI4A 1F6WA 3NWPA 2CE7A 4RTRA 3KLOA 3IOEA 2REXB 2FWRA 1QVRA 1FS4A 4G0OA 3PLNA 1RTTA 3RC1A 3KZKA 3TFOA 5JROA 1T5TA 4PSCA 1GTZA 4U63A 2FEMA 1NIPA 3PIRA 2R6HA 3B8EA 4AXBA 1T9GS 2R6JA 3QYAA 1P4HA 3BA6A 2HKIA 3QV1A 5CYGA 1D2AA 1V48A 2A9FA 2NO5A 3ZJVA 1Z7GA 2PGXA 4Q4DA 1GGHA 1M2FA 1R4NB 2QJWA 4UZFA 5CX4A 3SC6A 3ZQ4A 2JFQA 4F12A 4O4HA 3FTNA 2OMEA 5J4VA 1LBSA 2CXPA 4LY9A 2HWWA 3FBAA 3B6NA 2ZI7A 3QKUA 4TSFD 1TAHA 3O8OB 1O0CA 5LYJA 2C77A 1ACMA 1PJQA 1NYQA 2H0QA 2ZJ1A 3HADA 1FYVA 5IH7A 2P1DA 3F98A 4QE3A 2FXVA 1TOAA 3O0TA 4HTAA 3IAUA 5C31A 1YFLA 1NG9A 4HN4B 3CLVA 3K12A 3CVJA 5JS6A 3L84A 4DR2B 5MN5A 2OM6A 1GA1A 2XVZA 3L7YA 3R3YA 5FTNA 1KBOA 2FZGA 5LA6F 4C01A 1U8UA 3T5AA 1Q92A 2AWOA 1ESNA 1PR3A 2B94A 3L3BA 1XDWA 3PBKA 3TE7A 3O4FA 3PENA 4JBGA 1NUAA 4IGIA 4MAFA 5CM8B 1VE6A 1IBRA 3ESDA 5JVDA 3HCFA 1NVEA 3L46A 4Q4JB 5AMXA 4QGAA 5IXYA 1ZGAA 4X61A 3FIUA 3FVQA 3AR9A 4V0ME 3UHPA 3K94A 1HDZA 1CLUA 1FDRA 1VLMA 2FUG1 1C81A 2WW8A 3B85A 4HQ6A 3K9NA 1FXSA 2WBLC 1TUBB 4MW2A 2C20A 4NMXB 2PZ8A 3DGEC 4KPYA 1CZNA 1KAHA 1UL1X 4G0ZA 5A06A 4MVJI 5JAIA 2Q99A 3LRXA 1HNZB 3UYKA 2VUUA 3NEAA 5IP5A 3PU6A 1YVEI 1GGVA 4KITB 3L7CA 2QTPA 2I6UA 4RNCA 1U8ZA 1HDOA 5J2UA 2P9ZA 2QUIA 4F6CA 2EJCA 1IN7A 2PVPA 1T13A 1XNQB 2OLKA 1QO9A 2VJNA 2QD4A 1TLLA 3A70A 1Y4SA 5ADVA 2IPOA 1JDBB 2AWNA 3ENWA 3GEPA 2UZHA 3UH0A 3UFXA 3IDFA 2NO0A 3OJEA 4TVSA 1EFDN 4AYXA 5A6SA 3K0BA 1ND5A 5JRZA 1ZXXA 3DTYA 3A1TA 3E48A 3AHHA 3Q6MA 1H2RS 1BH2A 2L69A 1EHCA 1OYWA 3RRXA 3V55A 5BUSA 5LD2B 1KZGB 4OHKA 1FP1D 4A2CA 2AK3A 5KUTA 4F92B 4RMHA 1VQPF 2PNJA 1G3MA 3DEZA 1AZSC 5TPZA 4CT0A 3KR2A 1VQ5F 1DL5A 4F56A 3MVEA 2LTAA 4P53A 3PUKA 4BNTA 1UQRA 3F6SA 2JRLA 3FFTA 1TMYA 4I6GA 3E70C 1V4BA 4GQIA 3EY9A 4NDAA 4X20B 1U28C 1ZRHA 4KK4A 4TSRA 3X2EA 4AM8A 4WLNA 4JI0B 4I2NA 5FNVA 1FYFA 2GXQA 3ETDA 5EUBA 1EUYA 2UYHA 4QTXA 5JANA 4QA9A 1U0JA 1MABB 4DMGA 4K9RA 2WTNA 2P2NA 1W4BA 3BFXA 4CF4A 3WA7A 1HE4A 3L7IA 4OHZA 5HRUA 5AI9A 2FN3A 2FWPA 5P21A 1QGDA 5GONF 4KG7A 1J8YF 2UZ1A 4MYTA 4C4AA 4Y2RA 3SHOA 4CM8B 4Q47A 3EXAA 1N2GA 3PFWO 1XZ8A 4RD2A 1RYHA 4N3BA 5KYUB 3SOZA 3TEMA 3TD4A 4B46A 3EODA 4LV5B 4R8RA 3T7RA 4LQCA 1A88A 4Y6RA 1SUPA 3IQDB 3HV2A 3ISVA 4X6UA 5K5EA 1X25A 4PYQA 3K14A 2CW5A 3T9DA 3IUJA 4IKOA 4C0JA 2I7DA 4DLWA 4HQLA 1S2DA 2PKQO 5DGCA 1HSOA 2ZYHA 2QUJA 4C05A 5JZ9A 4PXAA 2R751 1UBLS 2BOVA 1VFPA 5A5FA 2QTCA 2EP5A 1P18A 4CNBA 3WK7A 4A9AA 2ZT8A 4MKXA 3G23A 2G1AA 3L8FA 4BQQA 5FADA 3QLJA 1Y3FE 3KOMA 3TUJC 3ZLBA 1E4YA 1BHQ1 2WKQA 2CNNA 2R8BA 3PHHA 2Z8YM 3ULKA 1TFRA 1NA5A 4BO1A 4COOA 1QYVA 2VDOB 2EBWA 3AJ9A 4GYWA 3KD3A 3J7AR 1UFOA 3GLGB 2HK8A 4FBGA 1CKEA 3MGBA 3D5QA 3INYA 1DB3A 2QT0A 4A6DA 2XA1A 5LQSA 4EATA 4W5NA 4DRYA 2YINC 3EBOA 3FUTA 3JR7A 1T9ZA 2HQBA 4DTIA 2OP1A 4P0PB 5HY2A 1VCMA 2VHZA 2XB8A 2OTJF 3BXEA 4LZJA 5EKUA 2R6FA 2FEKA 4KFUA 4YRPA 5DNEA 3W05A 2UZ0A 4P9NA 2AVDA 2IP1A 1BS9A 2QMEA 4NENB 3TZLA 3FM9A 4AO8A 1ELOA 4CV0A 1RE0A 3F7NA 1J5PA 3PQCA 4YQEA 2VT7A 2NG1A 1ZIXA 2AFHE 3QMWA 3FHJA 3S2IA 4LYAA 2Q4BA 2IRWA 1RQXA 2FA9A 2HIHA 1LK0A 2IUFA 3FBGA 1JJ2F 1AKYA 4RKQA 3QVJA 5T57A 4E4RA 1J20A 5AJUA 1Z0JA 3ADDA 3UMMA 4W9NA 2IOQA 3OPXA 3ZZNA 1BCSB 3EXG2 1G66A 5A9SA 4XR9A 2VL7A 4HX2A 5BUCA 3G2PA 1WQ3A 3EAFA 4KRYA 3TTXA 2NU7A 2QLNA 2EYUA 3NWJA 2PGJA 1FPQA 4CFSA 3OP4A 3P2JA 2JNWA 1L5LA 3KTDA 4GVPA 5A3QA 4X3PA 1OA1A 1HE2A 2ZVYA 1YBVA 4PYJA 4K40A 2MWMA 3DLCA 5G0SA 4BP9A 4OAOA 3QUBA 4G26A 1Y7LA 4GGOA 3ITDA 2Z8XA 5GINC 2X2FA 2EX1A 3JQFC 3JD4A 5K8CA 2O2JA 1LLDA 1YZKA 4CF3A 1SXGA 3GJYA 1NXVA 1O89A 4OXXA 3WLSA 2BL4A 2ZLBA 2ECQA 4K6OA 3ZGXA 3DDCA 5HRCA 3IULA 4HXEB 4K46A 3C3KA 3NP9A 4QYIA 4WA8A 3N2YA 5MN4A 3QX9A 1ORTA 1X8KA 2QQFA 3ZZTA 2Y9MB 1ZOPA 2D5IA 3L5KA 2XODA 1FP7A 3EQ2A 4JBIA 1Z0IA 5BV7A 2ZVQX 3WK5A 1YKSA 4A8HA 4IHJA 2QMYA 5FX2A 1Q7TA 5CA1A 1V8BA 1G60A 4ARZB 1R7RA 1OV6A 4CI9A 1NN5A 4TWBA 4OQZA 3V1TC 4DQLA 1FMTA 3AL3A 5DGXA 4NE7A 3T38A 2ZSFA 1F48A 2GVNA 1Q0LA 2JK1A 3KJQA 4P4GA 3DLIA 4NFSA 4TTQA 4W8HA 5KWEA 3JAWB 4MGHA 2WA1A 6PFKA 4TMVA 1XA4A 3OX1A 4I50A 2QAGB 3L4EA 1FYWA 4GP6A 4S04A 4DV3B 1P91A 3ETEA 3HYTA 5BN4B 4DCUA 5E8RA 4KODA 3Q9UA 3TKYA 1NXTA 4ZVPA 2IS2A 2Q0HA 3D0OA 2BFFA 2ODNA 1UK6A 2Q6KA 2VFAA 1ADJA 4TX1A 1A9ZA 4Z3KA 1EWVA 1LJUA 3IQZA 1UPXA 1YTUA 1M1XB 2R7NA 1KRXA 1H6CA 3E9DA 4UXHA 1GGNA 1HOTA 2QK4A 3HFRA 2ZROA 3RS4A 2JAUA 3AVTA 1D2RA 3LDUA 5HP8A 2NO4A 2A59A 2IUUA 1L7QA 3ONNA 1DKUA 2I03A 4TN1A 1Z83A 4YRFA 5B1IA 1K7EB 2HS4A 1O96A 3MF4A 2LNDA 1D2NA 2Q5JA 1YQUA 4LXYA 5I9TA 2HREA 1NI4A 4QJBA 4IGFA 2CKMA 4HL6A 1UI9A 1OIVA 3LM8A 1EM6A 1OW3B 1S2GA 2R5FA 2R79A 2HIMA 1JHAA 4PICA 4Q1FA 4Y1RA 4PY2A 3VM6A 3QI7A 4EZEA 3VA7A 5HY0A 2PQ6A 4C0QC 2BFEA 3VI6A 1UINA 1XVAA 2IYAA 3QKWA 4LBYA 2FMIA 4JWTA 3NCHA 4N18A 4OXYA 1JLMA 4PEVA 1US8B 2OV2A 4R7GA 4EF6A 5BR1A 3SZUA 1J9EA 1UR5A 4KQWA 4C4XA 4CEJA 3M9XA 3N8HA 1T0AA 2WQ6A 3WXBA 3NTUA 2VLIA 2J4DA 1P8AA 1RRPA 2VYCA 4WKBA 4D5GA 1DINA 4MV3A 1XZGA 4PBTA 4IMRA 2F8LA 2ESRA 3KEMA 4KN6A 2YXPX 4MV8A 5AHOA 1WRBA 3FMVA 3UA4A 2C5BA 4EAQA 2X5OA 5CIWA 3RROA 1FF9A 1YGPA 2HU8A 2VRWA 3IH5A 1B8NA 2DETA 1NL3A 3HJWC 2AG1A 3IPAA 3BWXA 4LZNA 3VUEA 3ZNPA 3L1UA 4XRGA 3R5TA 4WADA 3DV2A 2UYCA 2GAIA 5IJ0A 3AV3A 3I23A 4Q24A 1E79A 3UMRA 3O74A 4QRIA 5AJTA 5FJIA 1X80A 3FA2A 1U8CB 3PNMA 5IHXA 2UZAA 3QPAA 3KEFA 4IP0A 3P9IA 2CMGA 1IOZA 5ITZA 1ZNYA 1Z45A 2Y1GA 2HA0A 3MD0A 4QFMA 4CTJA 3RKSA 2EOAA 1RLOA 4DGSA 3QW4B 2BLNA 1R6AA 4C6TA 1SD5A 1AGNA 1V45E 2PD4A 4PIVA 2DWPA 5CFRA 1T1EA 3IDOA 4YRCA 1RHJA 2ZYSA 4ZAZA 4TWAA 4DM7A 1WULS 3K9QO 2XUPA 1KDZA 4Z7NB 2W4MA 2NUAA 1A2OA 3GUHA 4X97A 3GAZA 4PPYA 5DRYA 3ZI7A 3KQKA 3AZOA 3D8RA 4XQGA 4M9UA 4OPMA 1Y6GA 1N5RA 1JPJA 4WASA 3ND6A 1ENYA 1UC8A 2QXUA 3GJ8A 5HUHA 4KPUA 1QG0A 1XLVA 2XTAA 3P94A 5IK2A 1RAGA 2JCVA 2DCUA 2DFTA 3B5EA 1SVUA 2NWQA 1UFKA 3TL2A 1IV2A 1O5TA 4C7MA 4RZSA 4NBVA 4IXNA 4X3OA 1FJ2A 4MR9A 3CBGA 2I8CA 2WPDD 2WIAA 1I1QB 2WHPA 1CUHA 1NASA 2BUBA 4JLAA 4MJ3A 4R31A 1LTHR 4TKUB 4RQUA 4BDTA 4D0GA 4YRAA 3CVXA 4PYKA 1T3SA 2XB6A 4EUNA 3NEYA 4CCYA 4DR1B 1W49A 5BVGA 1AUOA 2IYSA 3LX8A 3SBXA 2ONZA 4CQJA 1RHQA 4BX3A 4Q7LA 2OVFA 1LY1A 1EEXB 4DREA 2H29A 3DO8A 3Q5DA 3GLVA 4MYDA 4LI0A 1KDRA 3I30X 1WUTA 1U8YA 1E8NA 2XMRA 1B4DA 4K2HA 4K5QA 4ZEVA 3HVRA 5J1SB 4GKJB 3WIUA 5FRDA 5ER6A 4MV0A 3BBPA 3T1TA 2J0SA 1P3Y1 2EFDB 2I4NA 3TPZA 4URXR 4DCTA 4WOKA 5C5DA 3RO7A 2JW5A 3S8EA 5EA2A 1T5IA 4CKBA 4C4WC 1FLVA 4ERXA 4IHKA 5KDLA 4XTRA 2OENG 2W8BA 5DRTA 5JR3A 1AOXA 3KE1A 1WMDA 4MITA 1LCIA 4DT1B 5CDHA 4N0MA 2VRCD 1V8ZA 2FOIA 1GO0A 3EEQA 4MWEA 3ANTA 3EDRA 1KH2A 4MGKR 2Q8PA 4RJKA 2R7MA 1QVVA 5G53C 1BD4A 3R6LA 1ECFA 1Y1LA 5JJLA 2P9TA 5EKXA 4M55A 2DECA 2ZPAA 2ECFA 1KHTA 2V7UA 3TDKA 3SP1A 2CLSA 1RAHA 1U43A 1GNQA 2FPRA 2MYUA 1KDOA 4LVCA 3Q41A 4P80A 3ESYA 3V97A 4IINA 1GSAA 2FR8A 1A69A 1KNKA 2XUGA 2ENWA 1EFPB 3N2IA 2I6DA 4AS2A 1OUMA 1GAWA 1Z5OA 2EJUA 4N7BA 2X77A 4NTZA 1IHOA 2BKEA 3LUGA 4PC6A 5A7FA 1XMOB 1FU4A 3ZWNA 3AM1A 3F0DA 1FBNA 3EZLA 5HKAA 1T5OA 3CRRA 3C43A 4YONB 1POXA 1XCPA 2C4NA 5DHAA 2MCFA 2D2XA 2O2GA 1EFVA 1J8DA 3O8QA 3SDZA 1YGYA 1GTJ1 1V6AA 4H17A 2LV8A 4ME6A 1G3QA 1M2GA 1R0LA 3FZEA 3L04A 2IHUA 4FS3A 2JH9A 1H8ED 5EWMB 2H5IA 2FEWB 3U4AA 1JECA 1XTQA 4D7AA 1E3SA 2QV7A 3BMQB 5CT9A 3VHQA 3WMRA 4V1CA 2ETVA 2W22A 3L8HA 4MR8B 5K09A 4RA6A 3M7IA 1ZJ6A 1TEHA 4V2IA 4NLLA 3ZE1B 1G6Q1 2GBPA 3M1AA 3COZA 4V0MA 3Q0TA 4IZIA 9GPBA 3I52A 4W5JA 2QW1A 2O8FA 1VHJA 4MCHA 2ZYUX 1ZD3A 3CZRA 3PXDA 5JSHA 4ZAWA 2OYRA 3AF3A 1KIMA 3V8NA 4BBJA 5C4MA 2QQ0A 1V1RA 3ZCRA 5LQAA 2I6RA 4BY9E 5EZSA 1PAUA 4G09A 4WCFA 4BEWA 4KRFA 2Q3EA 2ZB7A 3L6UA 2H06A 1BJKA 1DIHA 3ZE2B 1TZMA 4WOPA 5BW6B 3ELWA 3OOWA 5LFAA 3PTZA 4HAWA 3RBZA 2JCBA 3V7UA 4AJHA 4QQ8A 1FLAA 2BWJA 2BSAA 3KRTA 3E05A 3PUXA 4WVLA 1VKZA 3T5TA 1H4TA 5HTKA 1W48A 3VR4D 5F1YA 1LW7A 3PHLA 3ZYCA 3K0KA 1V7CA 4XX0B 4JROA 5G0UA 3F5DA 4BY9D 1NJGA 2BFCA 2FDRA 4OIFA 5EHZA 1R5OA 2HA7A 1FDVA 3OEWA 2P9JA 5EXTA 2BTUA 3AUSA 3KZNA 2I55A 3VVCA 3CO0S 3WLIA 1VDZA 3COYA 4HNAB 3M33A 4ETMA 3PYMA 4YUWA 4ZCIA 3QVGA 5FJJA 5E4TA 1XZMA 4ACBA 2COKA 2W2KB 5HM6A 2QN8A 4MEJA 5E3IA 4F96A 1KJ8A 5CR9A 2Y99A 1GPNA 3WKDA 3IEVA 2W6JD 3G2LA 1P7ZA 4AWBA 1XMPA 4UOQA 2ZYDA 3U4QA 4UAJA 3BVPA 3S2ZA 4F71A 1F9AA 4GPD1 3BF7A 4RANA 4E11A 1AK9A 4CYMA 4DWVA 3L8MA 1M1ZA 3DSRA 3RSQA 4JP1A 1Q2UA 3DFZA 3P27A 3FUUA 4LNUA 1DSSG 2RH9B 2Q07A 4FX5A 2DHEA 3DVQX 4M1YA 4EA7A 5K2OA 3WJPA 1X7OA 2O7SA 1P6QA 3T1HB 5F1KA 3VR5D 4QBHA 4U2GA 4HEQA 1EGMB 5JFOA 2W43A 3CW2A 4MZDA 2FOLA 4B73A 4K1LA 2OC9A 4L5IA 3EULA 4NECA 1GNVA 3GC6A 4YI3A 3W6NA 2BGTA 4EQZA 1CG6A 5K8VA 1DXQA 2OCDA 2VSFA 3A1NA 1OGYA 5FF9A 4B8ZA 4JX8A 1QK4A 1QIGA 4GWLA 4QUIA 4RVHA 4ER3A 3VPHA 1G59A 4BTEA 1ZA2A 1YZNA 5DISB 4TTRA 1DTSA 3NAZA 3UATA 1N8SA 3ZJYA 1TADA 1C1HA 1JF8A 1JFVA 1D2EA 1F9EA 1XTUA 2Q1WA 2Q8QA 3B38A 1FNSA 3R6GA 4KYIB 5ICSA 3MTAA 2RGAA 2HXGA 4M21A 5B3JC 3Q40A 3BF8A 1EFRD 3JQ7B 1LLFA 3LUJA 4TGLA 3RSCA 3T7IA 1QQ6A 2WU8A 3C5VA 3O3CA 5FBVB 2FN8A 5K8IA 4CTNA 3AHIA 1FFEA 1UWVA 2BM1A 2P5SA 5DGIA 3R75A 3T5BA 5JARA 4DXHA 4DEVA 2Q50A 1PSZA 1YMUA 4S2UA 5CAEB 2FPPB 4D82A 3I37X 4UHCA 4CETA 2QROA 1II8B 2ZJFA 4B4DA 4U2BA 3RA5A 2WQ7A 2HRQA 5AHWA 2VK8A 2QJOA 3AIKA 3D3WA 4ZOCA 3K6RA 2JH8A 4YP1A 1FXUA 4BVEA 2HZ7A 3REOA 5H7XA 4O1HA 1ORHA 3SZ3A 1XLUA 1FK8A 3GGGA 2WMOB 1DX6A 3K31A 4KXFB 1Q77A 2IIQA 2F3TA 3ADOA 4Q48A 4A8JA 4B47A 5JNSA 3K6JA 4MLDA 5CP8A 3WZLA 3IAEA 4ERNA 4MW0A 5C52B 5KMGB 1RRVA 2AFHA 5AM0A 3FPGA 1YB6A 2OHIA 2HP0A 3HVJA 3ZDRA 3DHVA 3G2JA 1ZOSA 4TV9B 3JRWA 3LUHA 5K6AA 2H1LA 1RMQA 3HA7A 3UJBA 3TNFA 1AQ6A 5HE9A 5JTTA 3HQ4O 1QC5A 3PPXA 2VR1A 1NC1A 2FLVA 3V1LA 1IULA 1NQWA 4ZVQA 2QG6A 5F76A 3KM0A 4IDQA 5CM2Z 2BFPA 4Z3DA 3FB1A 5EIHA 5CDYA 3I4LA 1PZXA 1SCDA 4QOJA 4RPJA 2X5KO 3TVDA 4FGZA 1P0PA 3LPCA 3BYQA 3M49A 3VIUA 1O6BA 3PFNA 1LUAA 4E7OA 3DS8A 1GWNA 3P0RA 4FQ8A 3R3WA 2X4GA 5AVYA 4U00A 3U9LA 1P39A 4XWKA 1E61A 4CZ2A 3DJFA 4PN7A 1CBUA 1VBKA 1JEQA 3NXKA 1Y3BE 4ND3A 1GGMA 1JQ3A 1G8SA 1WHTA 1Y8QA 4WV3A 4Q6BA 2RHBA 5FAKA 5LQUA 3FFAA 1XX6A 5IRCD 2ZI4A 3B6IA 4R01A 1MX1A 4KJZA 3GGPA 3V7NA 4FW8A 1KFCB 1ZWZA 4NESA 3RVRA 3DYBA 4GLFA 2CHUA 3OQOA 4IJ5A 1ATIA 1GVNB 3GGCA 2E4AA 2C4KA 3ZLVA 1BW9A 1PTJC 2Y77A 1W2BF 3LWNA 4PLZA 2X1MA 1W3EX 4CQMA 4D3DA 2H92A 3GOQA 4MP6A 5EE9A 5I8PA 2C00A 3TRDA 3LL4A 1BMTA 4ZTZB 5DK6A 1G8HA 4R1LA 1ZNZA 5AKJA 5DNVA 1VRCA 4BCCA 3CZCA 2FE1A 2M6SA 4WBXC 5FB3A 4FOOA 5IHPA 5L3VA 5F5XA 2XMGA 2Q4DA 4RTSA 1I3NA 3IQHX 5HE8A 5BSFA 5LA6A 2QN1A 3U4MA 1IQUA 4LMBA 4BMPB 4FSHA 2IDJA 4R1UA 3ZBUA 5IYZB 4YMVA 5LP6C 1W88A 3A6KA 2CMDA 3VNBA 4DA4A 3H1AA 4HKTA 4BLTA 4B74A 1Y9AA 3WGZA 4J0QA 2XTZA 1N6KA 3A4IA 4Q9JA 2WT9A 1WXEA 2ORWA 3L02A 4QHTA 5D86A 1H2EA 2VO1A 1JFSA 3OEYA 3KKNA 3LBAA 5TQ2B 4D3XA 1C9MA 1O57A 5E9JA 4PCAA 2DFVA 1I9GA 4AYWA 5IZ4A 3G9TA 3J81A 1L8AA 2HN9A 4UM5A 3WNZA 2ZGVA 1HH4A 1DBSA 1XYVA 4KH0A 4JYAB 1H94A 4J4BA 2Z95A 1ZIYA 5FHQA 1CF2O 1T0UA 4EJ6A 1HT1E 3UPUA 4RS4A 3PWSA 3CU5A 5BMOA 2WSIA 1QNFA 3ZHBA 5ENZA 4J0GA 3BMNA 1VSBA 4X7RA 5B57C 1L3IA 4FKBA 2JA2A 3AVXA 1IUKA 1P17A 1GRNA 1Y5LA 2ONCA 2ZWAA 4LK3A 2IPXA 4OP2A 2QRVA 5AKYA 4B35A 2AJLI 3TCXB 4O4HB 2IXTA 4AICA 2J32A 5IULC 5JOQA 2E85A 5E95A 1UCFA 1BX3A 2VXOA 3CCFA 5LYJB 2LCQA 2QI9C 2EP7A 3D4PA 1MQ9A 5GP1A 4YROA 2C0QA 1DCFA 3CCBA 4IM7A 5B7QA 5ESDA 4O6VA 4BQRA 1QPZA 2P9BA 2YJZA 5DOVA 4PG8A 1CY1A 2ZJ7A 4JR1A 2XVAA 1IONA 3EEYA 5IN4A 4W9MC 3WK9A 5F4BA 5DDIP 4IFTA 4XVCA 5ERXA 3I2IA 1E1DA 1O9BA 1QKIA 5IUNC 2WWXA 2J85A 1PT5A 3NP7A 3PHGA 2QRJA 1CZOA 1L5OA 1ZN2A 2GYVA 1D9XA 4BYGA 1C3OA 1FSZA 3PUYA 3CLUD 3WLFA 4ED9A 5JVDB 3IR6A 4YECA 2FMTA 1X92A 1QYXA 4QDOA 2V74B 5FTWA 3S2EA 3N0RA 3PFBA 5GONA 1CR6A 1HLPA 4PE5B 1WM1A 1Q7YH 3ASYA 1VB3A 3D7KA 2ET6A 2D59A 1R6UA 1DT5A 3FLAA 4IDOA 4M37A 5H1YA 1ISMA 4IIFA 4AG6A 4ETWA 2I5PO 1FNCA 2I7TA 3EWIA 1IY1A 3CZQA 1CZKA 4MRRA 3TOVA 1SCKA 3OQHA 1WS6A 5E9QA 5AUPB 1CP2A 1FVOA 4ZZ2A 4DJDC 1BMDA 1ST3A 2EAUA 2Q3MA 3PR3A 4AKSA 1EFCA 1WVMA 2GK6A 1N5KA 4YXWA 5FWYA 3P0ZA 4MVJG 5JDIC 2ZBPA 1KVUA 2M6KA 2FR1A 1E62A 3F2IA 1YKGA 3IO5A 2J0UA 1VM6A 3DKIA 3JX9A 3FYHA 3O7MA 4L3VA 5J2UB 4LJ8A 3EYAA 4QBTA 1E9VA 4GD3Q 1EUZA 3QKTA 2P2DA 1KSGA 3RLIA 3KQSA 5JD6A 3ZP7A 3GEBA 1Y81A 4CG1A 4ZZIA 1J2YA 1LSJA 2DR2A 2EJBA 3GLTA 4GVLA 4LYGA 1FDSA 2CEKA 3QU9A 4ZT4A 3V8RA 2P68A 4PR3A 3VYTB 3WL4A 3UFXB 4XFJA 4WACA 1Z6PA 4H7FA 4MMYB 4NBNA 5A6SB 3RUFA 4Q1AA 1RWNA 2I34A 3RIXA 4RWEA 3B2NA 1N1MA 3G89A 3LKBA 3JARA 2XTJA 3RWOA 1G3IA 2BM8A 2YVQA 2JKVA 3C70A 4JGBA 4JK3A 4JHXA 1H85A 5L3RA 8GPBA 3AETA 3U17A 2GZHA 3NB0A 4JT2A 1IHUA 3VPCA 3NDPA 1TZBA 2R1VA 3A3PA 2R8PA 3PGXA 1LF5A 1IUOA 1Q22A 1XTVA 1HYEA 2DQKA 2GR9A 5DNAA 4F5DA 5FIUA 2XCTB 3R3XA 3FETA 1IM5A 1UIRA 2IE0A 3I1YA 5FNVB 1VTKA 3W77A 2VNAA 2QNBA 1P1JA 1YVDA 3NHFA 1I7SB 3L1IA 1HPLA 2IY8A 4PO9A 3JQAD 3WLRA 1U7XA 4PYLA 1NXPA 1I5EA 1UJMA 2J9YB 4N12A 3I76A 3E5HA 3WAKA 1IZ0A 2EKPA 4GXRA 4NSNA 5JAHA 2EERA 1WO8A 2UZ1B 3L4BC 5JXIA 5CK4A 2ORED 3SZOA 2OZBA 2AA3A 1ULZA 3AO0B 4LVUA 1HT3A 2IEIA 1IPHA 1ZGGA 2YRWA 4JB8A 4D2IA 3DC2A 4PNZA 4U7GA 3WLAA 4IDEA 3VTKA 3KEQA 5EJ4A 5F2NA 2OXIA 3OA0A 5IDVA 1LK5A 2PZGA 2EZ9A 2IVZA 1AD2A 2NVUA 1UBNA 3IVRA 4F2WA 4ESOA 3QWBA 3NWEA 2WE8A 2YZGA 3JAMA 3BXGA 4UVEA 5LR6A 3OZAA 2YQ5A 4TT8A 4B43A 2B9VA 2WC1A 2B1QA 4I8IA 4FUTA 2WAXA 3H1EA 1L4KA 4PX5A 4UMFA 4O2RA 2QNRA 2HXSA 3FJYA 4YUAA 1HDXA 5E4FA 2GWRA 3ZU6A 2WRZA 2OR3A 3A0RB 3ZYZA 4PXSA 3AJAA 4IRMA 3CYPB 2ODPA 1Q16A 1ZOIA 1A7KA 4YWHA 4KN5A 5JLAA 1TC2A 2CK3D 3DHYA 3ZHVA 1ZIOA 2G4CA 4L4RA 5EIAA 2O5EA 2H5JA 4O4LF 1LLUA 2PZAA 1RRMA 4LFCB 5T4FA 1XJ5A 1H6DA 2H4HA 2X58A 4NDNE 1JXQA 2HSGA 4H7DA 3CG6A 3EPJA 1BG6A 1WEKA 3FWPA 1NSFA 5K8JB 1Q0HA 4HLCA 4G4IA 4M9RA 3OE7D 1NU8A 1V39A 1XPJA 4JLNA 2B2CA 2JJ1A 5T5QA 3GRYA 3H04A 3PD1A 4XDGA 1EIZA 4A8PA 1KQGA 1NZJA 1LS6A 4YQFA 1AKWA 2PX6A 3M6AA 2QTRA 1Y42X 4Q1DA 3R3HA 4C88A 2NXNA 1KSJA 4XB6B 2HS3A 2FQWA 2P0AA 2XKAA 1ZR4A 5G2OA 2H5LA 2X13A 1E3DA 4ESVA 3R8XA 4E46A 4DBLE 1FMJA 2DRIA 1JN0A 3UN1A 2P65A 4OQNA 4OI0A 2XUOA 1PZMA 2ORYA 1SXJC 3G68A 2LDBA 2BE9A 5ALWA 1XTPA 4XXHA 2V9YA 1CN7A 4FEEA 3PGKA 1RZUA 1Q84A 5JMOA 2HRCA 3QUSA 3R44A 4YCLA 5HCUA 3TLCA 3TD3A 1K9VF 4YIKA 4N8DA 3LBFA 1NNSA 3T94A 2A57A 3IDAA 5A9SB 1JLKA 1WUKS 2AOXA 4WZ6A 4QASA 2NU7B 2QQGA 4JMPA 3ROPA 5AW8A 1I33A 1Z5PA 3IP1A 1ZI6A 1E94E 2Y27A 2YFYA 4G4ZA 1U3CA 2AEJA 3WY9A 2DUUA 3KL4A 4JYBA 2V1XA 1G2PA 1TX4B 3VOAA 2G7MC 3HBNA 1PV1A 3QBDA 2FN4A 4XARA 1DBQA 1B41A 1NOJA 2C7GA 4DV5B 2DYKA 1VQ6F 4CM7A 5BV0A 1N36B 2CW4A 3KO8A 3SYKA 1EFRA 1ZVMA 4ZYZA 2NZWA 3BFKA 1QU9A 1VG0B 3I7TA 3OPYA 4BLPA 3LYAA 1ENPA 2I2FA 2A5GA 4QYIB 1ZC4A 3ASZA 3MT0A 5ALGA 5KWJA 3MAGA 2LZ0A 2PRYA 3KYIB 2AOWA 4QUKA 3T3EA 3PQ8A 9ATCA 1TYDE 5KCMA 3N4ZA 2J67A 1G42A 1YI0A 3A1DA 3MGGA 3C9UA 5K20A 2FSVA 1GU7A 1HC7A 4IHJB 1E9AA 3DOHA 2FP4A 2Y1FA 3IX7A 3BTUA 4B3JA 4QYXA 5CA1B 1PE0A 1N3LA 4DZZA 4MI6A 3JASA 1ZVKA 1GKYA 1THGA 3NJRA 4Q1EA 2NLOA 5CFNA 2ANBA 4PLTA 2Q9UA 3BULA 4P32A 2VP9A 3NOXA 4Y9TA 3IAS6 1DQSA 1NE7A 3GUCA 5BP7A 1DI0A 5CRIA 3T5PA 4RE6A 4MI9A 4Q02A 2P79A 1NW5A 4LY3A 1X3LA 2CLEB 1HZZA 4Z9AA 3TJZA 4MUYA 4CLHA 4I50B 2DERA 8ATCA 2Q1SA 5FWAA 5H16A 4B7AA 3RJZA 2JFYA 2L18A 3UXEA 2FOXA 3FPLA 1JY8A 1E6LA 1FUUA 2KG4A 2BFFB 2NZYA 2XVXA 3QE4A 4N5HX 3WL3A 3WKBA 3ER9A 3A6PC 1A7JA 5FORA 4RACA 4NG4A 3MLAA 3LQ4A 1H48A 1X7ZA 3QHPA 3ZTYA 2AMLA 1A82A 4O1MA 4F4IA 2JIRA 5C18A 5FLXA 3HDTA 2IE8A 1F14A 1O08A 3CLUC 5EZYF 2XOXA 4PNHA 3KALA 1M1YE 3R0ZA 1O96B 1I6LA 1Z5UA 1EE1A 1C7IA 1NI4B 3OZVA 1JQLB 4AUKA 4DE5A 4R8VA 1I7DA 1E63A 1WZCA 2HMYB 2W2PA 4Y1RB 4LW8A 4TMKA 5EMMA 2GMWA 2LIVA 3LG2A 3CVWA 4G5GA 1OC2A 2OG2A 1LV7A 4JP3A 4E14A 1U8XX 2A6PA 2IYPA 4FS8A 4O0MA 3TAUA 3WNVA 3IBTA 2Q2VA 4BXOB 1LDGA 3CCMF 3VUFA 1HV8A 4JELA 4RMNA 3IMPA 2JLCA 2Y67A 4GG1A 1BMFA 3MWDA 1GTSA 4E4YA 4CEJB 5E9AA 1B00A 1E98A 3DAOA 2AG0A 3V33A 2OV3A 5TMEA 1C9JA 1XRSB 1FFCA 1GGEA 3LU1A 4NCHA 4F1JA 2V7EA 1JQAA 4DLLA 3MIIA 3VYUC 3M8KA 3D0QA 1Q7EA 1XQ6A 2CUTA 2YWGA 4HEA6 3ZV7A 4JXXA 3EDCA 3IAM1 3SC2A 1B6GA 4OX9Y 3LLCA 4EPXA 1VQLF 4UMEA 1TEXA 3PVSA 1KXJA 4AJ4A 3GARA 1KZ6A 1FQKA 5IAOA 1RYMA 4JJ8A 1UEIA 4CN8A 2PUFA 1E2UA 5FWNA 5IJ0B 3IELA 1IL0A 1A5TA 1ZKMA 3OCUA 1V8DA 3PPVA 1X80B 2VTEA 3B2QA 1QV6A 2DH5A 5EXXA 5EP2A 5EUCA 3ICEA 4PYMA 4TLAA 2A4MA 1AUVA 5ITZB 4AP5A 3L7LA 2YBDA 1TD9A 2PZKA 1ZH6A 3AFNA 4PQEA 4EG3A 4JHLA 2RD2A 1SD1A 4C6TB 5FTLA 2CB9A 3WGKA 2HDHA 3LBNA 1VPLA 3KQVA 3EA4A 1PEAA 4GXNA 3COPA 2X19A 4ARVA 2ZS7A 1CIJA 2NUAB 1VA5A 3ESBA 1DADA 1EGAA 4KSBA 1TJ3A 1NZDA 5DTIA 1RXUA 3GJRA 5H9WA 4BKRA 7REQB 1XNHA 3MTQA 3B6KA 3LWVC 4N5NA 4KPUB 4F1WA 3PEVA 4F4HA 1GG2A 3WL6A 1H22A 1YZQA 3GLUA 1MW9X 3SM9A 2GPYA 3DEJA 1QRRA 2DP4E 1U5BA 3D6UA 4UCQA 4CM6A 1SXPA 3N70A 1IOWA 2C7BA 2VLBA 1ND6A 4IDAA 4MR9B 5AW5A 3TWOA 4D9JA 2WHPB 2FE4A 2YY5A 1N2XA 3JQBC 3SBDA 4B62A 3I3FA 2J4CA 2VC2B 3B36A 3MK31 2C0CA 1KI6A 1M2KA 4M8LA 1VLJA 1Z75A 2BMWA 4YP9A 3FR7A 3RSSA 2KTVA 4IL5A 4Y6PA 4CCYB 1WJGA 1XEWX 5BVGB 4LHVA 3G88A 4HNTA 4Z4GA 1RHMA 4J94A 2IXGA 5BYBA 2HLNA 1BHJA 5AKXA 3LOUA 4TXJA 4N03A 4FNAA 2BE7A 4BW0B 1HDYA 3P8ZA 2XHEA 4QUDA 4R8SA 4F46A 4OH1A 5C7OO 3NI2A 3KKMA 4LJ9A 5AWFC 5CLHA 3HJRA 3NG1A 1HTBA 4CKBB 1JDVA 1NBWB 3OZTA 4PZZA 2A0KA 1VPTA 5SYNA 2W8BB 1JR3D 2ZR0A 2IH5A 1GVHA 2X7HA 1W7AA 2FLKA 3I8XA 2PZFA 2NZ8A 3T9FA 1Q5PA 4H27A 4R0MA 2B8EA 2C2WA 1C1YA 2YXNA 1Z7EA 5FOTA 1SG6A 5EWLA 4UPDA 4CCAA 4CDNA 1JZSA 4JI6B 3AXTA 1B1AA 2HHAA 3LQKA 3B89A 4GX2A 5K05A 4YYZA 1H2FA 2V59A 4LOJA 5KIAA 1R9JA 1VQMF 4RK5A 2Y1CA 4WN3A 3O94A 4YR9A 5C8YF 2JIPA 3DAPA 2ATXA 3JU3A 3UW3A 1KNJA 5KU7A 4G0MA 1BU5A 2Q6OA 2BGGA 2AMTA 1Z2DA 1YIAA 4HC4A 4M2LA 1FW8A 2ZZNA 3L6RA 3CC7F 1EFVB 2H65A 3O8QB 2VJKA 3JQ9A 4QXPA 4JXZA 4MTLA 1KSFX 3ZWVA 5FA6A 1N9KA 4AG3A 1T2DA 1J8QA 2WMDA 1JDNA 2QX9A 3RHZA 2AR0A 4QEDA 4PONA 5CW1A 3ANYB 1W4AA 4V1CB 1O94C 5ESRA 4GL4A 4RA6B 3DWIA 4P33A 2J5KA 1BKSB 2ZBDA 4B85A 3IAHA 4TQGA 2VATA 3IS3A 3W2TA 3QLUC 4Z2AA 3G7UA 2O8FB 2CV0A 3P1JA 3MOIA 4Q00A 3D2AA 3A9SA 3H9QA 2BDEA 1EGHA 1DGQA 2XZPA 3A4TA 4RK0A 2R6R1 1KPIA 1P4RA 5JT1A 4Y1EA 1V1RB 2OQ2A 2AN1A 2O2CA 3MEQA 1F2VA 2HGZA 5CTJA 1M8GA 3KOOA 3WB1A 4TRRA 4WCFB 1RI2A 2C59A 4UNQA 3PSAA 2FMFA 3PYXA 3W8NA 2YY7A 3OF2A 1U2TA 4WE3A 5HZGA 5LU9A 1I6MA 1EX1A 4DQXA 1U2GA 2XKBA 3ZY5A 2JDID 2QSJA 4OHMA 2ETXA 4MKHA 4DR5B 1GCGA 3PQ2A 5I7VA 1S9HA 2B4RO 1Y9JA 5FI3A 2Q27A 2HK6A 2OTCA 5HUJA 1A9XA 3K35A 2Q3LA 1COWD 3CW9A 3QTTA 4QXMA 2O19A 5JI3E 2BFCB 3W90A 1AQYA 2QRNA 4KBFA 4AS3A 1ZL0A 4FSXA 1JXAA 1N5OX 1GNSA 4J7XA 4DMHA 4QNNA 3THXB 1Q82H 2EJVA 4DUGA 2LVBA 1RLUA 1TFUA 2ZYWX 3CRMA 4EI9A 5DTJA 3VSAA 3QVGB 1WEHA 2Q4OA 3QELA 1XQWA 4LQLA 4MWOA 1P9WA 1XAJA 2HCRA 2GPBA 1T9GR 3IKJA 2RBGA 1E2EA 1L6RA 2LUOA 4I19A 2FG6C 1M6YA 1LLCA 4MRAA 3UOAB 3U4QB 3ZGZA 2NO9A 2JD2A 4OQ4A 3DUWA 4X8MA 4BNJA 2WTAA 4CR6A 1YIOA 5GOTA 1NQOA 2R6AA 4MP3A 3B2EA 4JN6B 1NAHA 4LNUB 1NLMA 3I0NA 3V1UA 1OC4A 3PJFA 1G6HA 4AJEA 3HXQA 4JCOA 3SVTA 2JAHA 1REQA 3LF2A 4E5PA 2OOKA 2GB4A 1KEUA 2QY9A 4LKOA 4YRTA 3VR6D 2CUZA 4DR3B 3PX7A 2I87A 4GSLA 5HXAA 3UTCA 1NYRA 2GZ1A 2H57A 1OAOC 3DOJA 4KGXA 2QM8A 3QHQA 4FIZA 4LMRA 4WJLA 1E7YA 4C2AA 4LF6B 1PGNA 5D1HA 3RF6A 4OFWA 1UFYA 2J3IA 2BFBA 2AZDA 1EDOA 2IOHA 1CUDA 3DV9A 3N0WA 4J2HA 4OQXA 3HM2A 3A1UA 1XTTA 3RANA 4BQSA 1UFQA 4BB9A 5B4VA 3SHWA 4S3MA 1H2AS 4FE7A 4F4JA 5IUKC 4ZCRA 3KHUA 1P44A 2F90A 1GPLA 1DRJA 4PTLA 4DUPA 1LPNA 1M2EA 1NYTA 3LGSA 5IX8A 2VG8A 1MJGA 5LWQA 3N8DA 1GKUB 1LLQA 2BR5A 3LW8A 2C2GA 2X0DA