3VOAA

Staphylococcus aureus ftsz 12-316 gdp-form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
307
structure length
307
Chain Sequence
b'GHMATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell cycle
total genus 114
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3voaA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3voaA01
1FFXB 4I50B 5EYPB 3M8KA 4HNAB 3VO9A 4B46A 5CB4A 4M8IA 4O4IA 5IJ0A 5JCOC 3RYFA 5LP6B 2XKAA 5LYJB 5JCOA 5C8YA 5MN4A 3CB2A 2XKBA 2RHHA 1W581 4EI7A 3ZIDA 4TV9B 3WGNA 4X1IB 4ZOLB 3JAKB 3RYHA 4F6RA 5IYZA 2R6R1 4LNUB 4X1YA 4WBNA 3HKEA 4U39A 4ZHQA 4IIJB 3ZBQA 2Q1YA 5J2TB 4TV8A 4DRXA 3RYCA 3JALB 2RHJA 1Z5WA 5KX5A 2GVIA 4X20B 4EI8A 1W5BA 1SA0A 4I55A 4YJ3B 5CA0A 4E6EA 5CA1B 5LXTA 5EZYB 2BTQB 2RHLA 4TUYA 4EB6A 5JH7B 3ZBPA 5MN6A 1JFFB 2VAMA 1RQ7A 3N2GA 1TVKA 4O2BA 5JVDB 5EIBC 4ZI7B 5LA6B 5IJ9A 4DXDA 3UT5B 1TUBA 4I50A 5EYPA 4X1KB 4HNAA 5LP6C 4O4HB 5JQGA 3VO8A 4O2AB 3JASB 3HKCA 5LP6A 2R751 1RQ2A 4I4TA 5LYJA 4FFBB 4O4JB 1OFUA 4B45A 3WGKA 4TV9A 2RHOA 1RLUA 5KMGA 4X1IA 2VXYA 3JAKA 3JARB 4ZOLA 5IJ0B 3WGMA 4LNUA 5BMVB 4O4LA 4IIJA 4YJ2B 5J2TA 3JALA 1W59A 4IHJB 3M89A 3HKBA 3WGLA 5FNVB 5GONB 3RYIA 4YJ3A 4KWEA 4WBNB 3HKEB 5CA1A 5LOVB 5EIBD 3N2KA 5EZYA 2BTQA 1FSZA 5ITZB 2VAWA 1FFXA 1JFFA 3JAWB 5JH7A 3C8LA 4ZI7A 5LA6A 4DRXB 4U3JB 2Q1XA 5J2UB 2BTOA 3UT5A 3HKDB 3JATB 3R4VA 5CA0B 4X1KA 3RB8A 4O4HA 5LXTB 3E22B 4O2AA 4TUYB 3JASA 1W5AA 1W5EA 5IJ9B 5CB4B 4O4IB 3WGJA 4FFBA 3RYFB 3E22A 5JQGB 5C8YB 3VOAA 5M7EA 3VOBA 3JARA 3HKCB 5BMVA 3RYHB 4I4TB 4X20A 4F6RB 5IYZB 4XCQA 4X1YB 4ZHQB 4YJ2A 4IHJA 5JVDA 5KMGB 5FNVA 5GONA 4EI9A 4TV8B 1Z5VA 3RYCB 5MN5A 5KX5B 5LOVA 1SA0B 5ITZA 3JAWA 4I55B 4O4LB 4EB6B 1W5FA 4U3JA 2VAPA 3N2GB 1TVKB 3HKBB 4O2BB 5J2UA 3HKDA 3JATA 3VPAA 3V3TA 3RYIB 3N2KB 4O4JA 1TUBB
chains in the Genus database with same CATH superfamily
3DZIA 1QK5A 3R3ZA 1OGJA 1U2EA 3EHEA 3L8GA 3MCAB 1J2UA 1ZJ4A 4M1ZA 4P2BA 2R1TA 1XX6A 4B46A 4WZBA 3THXA 1QHEA 2R7AA 5E7QA 1PQ4A 2DBYA 2HMTA 5IM4A 3GJRA 4MX8A 2C9CA 1Q3HA 2II6A 5TGZA 3GQBB 5AKHA 5CP8A 2HP0B 4DDMA 3S44A 3DLTA 4R40A 2QROA 3R3VA 1E1QD 3DTTA 4G56A 2D2FA 4JXJA 1JZQA 1Z17A 4G2TA 4B40A 1H47A 2HREA 5F35A 2B6NA 3ZNOA 1QYDA 2I34A 4O1MA 4OPMA 3V7QA 4Y6RA 3KBOA 3OLYA 2BSQA 5T4FA 4E6EA 3EXEA 3PZRA 1Z68A 1NRIA 1DAMA 4WXPA 2ZJFA 5F7ZA 3WLHA 1ENZA 3SF8B 4IJVA 5LA6B 1KS9A 3NAGA 5FRDA 3ZWPA 4R2WA 4DXDA 1J8VA 1JNXX 1HT0A 2OUKA 3UT5B 1PQYA 1TUBA 3BA1A 4FFSA 4DB2A 2FGJA 3K72B 2VIIA 2VNAA 4I9UA 2JLBA 4KXNA 4NP6A 4YRDA 5F23A 1YRLA 2FP4A 4HZIA 4R1LA 2L18A 3AHDA 1Z88A 5H70A 3FA2A 5CLIA 4M0KA 1RHUA 3EOBI 2P77A 5A3VA 3H2BA 4HX2A 1KEKA 4F3TA 3Q0IA 4ZO6A 4RDXA 1F8FA 3REQA 1GEEA 1NVAA 1YS2X 3H86A 1MA3A 1R10A 1GAWA 1GCGA 4UM5A 4BZWA 2DXIA 3SYMA 3K12A 2OORC 3NT5A 4FIZA 3EZXA 2IYWA 3GGCA 1K6EA 2V7BA 3QOFA 4N4AA 5JSYA 1DJOA 1DBIA 1GKIA 3DOFA 3M2TA 4IJQA 1Z26A 4ZVUA 4LYAA 4DMFA 3KSBC 1UOPA 4G1BA 3QNUA 4ZD6A 1RA4A 2L42A 1QIFA 2EKLA 2G36A 1T2NA 2OPBA 3C5VA 3EIEA 1NWHA 3NP7A 4R9VA 3LPMA 4CQNA 2Y27A 3ANTA 4M76B 4ZT3A 1W40A 5P21A 2FW9A 1W55A 4B8YA 3HXQA 1E2JA 3QXGA 4HH0A 1NAHA 5LIRA 1JA0A 1SXIA 3WNVA 4OKNA 2P4UA 3RHSA 3WB1A 5JSUA 1E3IA 1G5TA 4M9CA 1UQUA 4MARA 3F3YA 3TSZA 2IYEA 3H17A 1NQAO 3KEFA 3STWA 5JT1A 3A4TA 2FRVA 4Z4EA 3UPDA 3RTCA 1VDMA 3CC7F 1HRKA 3NDJA 4A2CA 1CTQA 4RGYA 3HTXA 2FSUA 2WTBA 5AW7A 5LQNA 2ZYDA 4Q9IA 1KE1A 3ZD7A 2WALA 4IPTA 1CUGA 4EO7A 1LBSA 1LPMA 1Y6RA 2XQKA 1OLSA 4YI3A 5B1SA 4CLXA 2TS1A 2GUGA 3K4PA 4BUJA 4YJ2F 3L02A 3FWZA 1L5HA 5A9TA 2EGUA 3PT5A 4G0PA 3TZLA 1YRAA 1LS1A 5F98A 3ONVA 4MWGA 4QU0A 1P7ZA 3R9XA 1YBAA 5MN5A 4JP1A 1C3LA 4HAWA 4B35A 1FPQA 5JMTA 3KQVA 4HHEA 1Z8FA 4F06A 1CRLA 1GZ4A 3AVQA 3E84A 4M88A 3FSRA 4RK7A 3HB7A 4WFIA 2VPXA 5LQJA 1NUUA 1GU7A 1SHTX 1WSWA 3KETA 7MHTA 2DM6A 4AL4A 1FFXB 3LLVA 4CM5A 1ZU4A 1DKLA 2WHXA 5A02A 2CV2A 1BZYA 1I0IA 4UUPA 2CMFA 3UO8B 1Y1TA 3BXXA 1V6AA 3G88A 3EB9A 4QO7A 2BC9A 1ZD2P 2EIHA 5LYJB 5C8YA 1JU4A 1U80A 2PX8A 2QU7A 3MGKA 1JLRA 3I6MA 3IE0A 3MRVA 3O93A 4ZOBA 5EEHA 1IXZA 3PC2A 3RSCA 4BT4A 3N86A 4YRKA 3VGPA 1BX3A 5B7GA 1TM7E 1SC1A 3LWNA 3FZEA 3CCBA 1BCRA 1MJ5A 2ZI6A 3FRJA 4R2LA 5BYKA 1I2AA 3C6KA 5IHXA 2IS6A 1KFKB 2WAYA 4ZV9A 2Y0BA 4BNHA 1CDZA 5JISA 1OH8A 3TOVA 1MU0A 2WTNA 3FGZA 1D3AA 4M1WA 4IEIA 4IVRA 1SG0A 3IQZA 2REQA 2PZLA 4Q3AA 2OZLA 3MWEB 4MQ5A 2CVOA 2C1ZA 2M1ZA 1UK8A 4MRVA 4WH0A 3K8YA 2CUKA 3T15A 2WWYA 2PUAA 3BC1A 2JFBA 1SD1A 1RI3A 4BLSA 5IP5A 1L8OA 5C1DA 3OO1A 3HK2A 5BYAA 3SQOA 2F7SA 1NW5A 2HM7A 3PE4A 1C7JA 1YRHA 2VT6A 3HZOA 1WF6A 1X80B 3R40A 5INTA 4GDFA 3WLLA 1CUWA 5JE8A 4LDJA 1N9KA 2G88A 4URYR 1Y3DE 2IPNA 1OA0A 2LBPA 2O1SA 3HDGA 1JTVA 3EG9B 3P0HA 1RLUA 4DXAA 3H75A 2QZJA 1KY2A 2DPHA 3W1VA 3D8BA 2ORYA 1ZY2A 3LQ2A 2FSGA 2JIQA 2XBUA 4HUQB 1GGHA 2Y1EA 4IIJA 4ZDIA 3B5IA 1H0HA 5LQUA 3ZOZA 3H19A 3GVIA 3FYDA 3Q9LA 3LC0A 1GZ6A 4OM7A 1R3DA 1F12A 5EGNA 2I1LA 2RJ3A 2HQBA 1RXWA 3D0QA 4OSOA 4ZI7A 3H9JA 4P35A 3N2ZB 3ZWDA 1RP7A 5J2UB 2YTZA 1RKQA 4FI3F 3CG0A 1CKEA 2DOKA 5J3JA 1E8DA 2H0AA 2PR7A 2YWXA 3WPWA 3TW8B 3JVEA 4DJEC 3DCNA 5MFZA 4AXXA 1CS0A 2PVPA 2F8SA 3DVAB 1WULS 4MO9A 2BZGA 3EJ6A 5CVVA 2AIFA 3WZLA 4KPFC 3QTLA 1TU3A 2AC2A 5B1EA 3OC0A 3L2OB 4MIYA 1P1BA 4URZR 2WE7A 3P9SA 3A4YA 2ECFA 5AWFC 1VLHA 2JAXA 2G5CA 5I7EA 3HSYA 3KTAB 4XIYA 5M04A 2W6OA 2YIVX 5ER6A 4BE4A 3GP8A 4C7BA 1ZUHA 4WX2B 4YV7A 3RLIA 4B62A 4KODA 4XDHA 5J1TB 1V4VA 1H0RA 3GGDA 5H9VA 1Y8RA 1FW8A 1B93A 5AHRA 1Z2DA 3WGOA 1MDBA 1Q0ZA 2FTKE 2JARA 3TW0A 4EHHA 3E18A 5FR1A 2C8LA 2UDPA 3QYPA 2R0QC 1ZJ6A 2C9BA 2BIFA 4NV0A 1E9CA 2FSSA 3S2GA 2PTGA 5FJ4C 3RIYA 3D31A 5DI3B 1SD2A 4LKRA 4BFSA 2OK8A 1N75A 4XYGA 4M1OA 3NVDA 2KWIA 1PLJA 4DAOA 2FFRA 2Y4OA 1ZR2A 1YKGA 3DFKA 3KZNA 3IB3A 3P1JA 4RLQA 1TLFA 1FUYB 4DT1A 4MW1A 5IKPA 1Z82A 2XDQA 4X90A 2PBFA 5B53A 1AMUA 2JGNA 3CPWF 4AJ4A 2HRQA 2AJ8A 2HB6A 1Q7RA 1UC8A 3PUYA 4AFNA 3EBPA 4DLSA 3VDRA 2YMPA 1KQNA 3R7WB 5IABA 3GVCA 4BNIA 4LUCA 2CE7A 4ZQFA 1JTFA 2C7BA 5G4VC 2OESA 3KD3A 1XQXA 4XASA 3UFBA 4FHFA 1KZYC 4MHSA 4DLXA 4LXYA 3KKLA 5E0OA 3HBAA 1UL1X 2KX7A 4ZU3A 3T5MA 2H1OA 3ODGA 1BO6A 1HDOA 1FQJA 3N2GA 4FMBB 5DTEA 4MCAA 5HBRA 1ORHA 2IE8A 4E1BA 1D2MA 4L5AA 4DR4B 4MWZA 4MWBA 2V58A 3W05A 5AVXA 4K0KB 5F4BA 1UKBA 4GZ3A 3D4IA 1NVVR 2DQSA 1K7SN 4OAPA 5ECWA 2SCUB 3QEMA 1GRNA 3PHHA 3TN7A 3ONNA 3EFOB 5F1OA 2EFYA 1SK9A 3ZH2A 3M7IA 1FJGB 2OZVA 5HQ3B 1FBNA 2HGSA 3KZMA 1X0XA 2FGKA 2J9FB 2HDOA 2ZJ5A 4L4SA 2R6ZA 5FF9A 2ESRA 1TTHA 2VHUA 3C3BA 4FR5A 3TLYA 1N77A 2FSHA 2B5VA 5KU1A 3F4BA 4NCHA 5AI5A 5IC5A 3UXEA 1JBQA 4JUFA 1J99A 3HCOA 2O7NA 1IZ0A 4YO8A 5AHWA 3CNBA 1QZTA 3JPYA 4F2WA 2EJBA 4W1SA 5TLSA 3SPXA 5HIIA 3IUPA 2WZBA 2FMUA 1SVIA 4XM2A 1N57A 3ADOA 4ZEMA 4DDWA 2ODBA 4Z7NB 4MV9A 4WXHA 4XARA 5JBNA 4CF5A 2D1RA 2ROQA 2VOJA 1II9A 1K8AH 3QPAA 3PCRB 4QYIB 4F9TA 4CN9A 4UFPA 5DK4A 5AIBA 3PJRA 4U3JB 4G6ZA 1OXBB 4I1RA 2OHOA 4EO4A 4EB0A 1WY5A 1Z45A 3OPNA 4NV1A 5D86A 5LXTB 1YOVB 4MQEB 3A9TA 4TWJA 4YBRA 1JIKA 2EKBA 1GCOA 2BP7A 5CTAA 1TJ5A 3VAZA 4QU9A 5TF4A 1QSGA 3CNEA 4I1UA 5CGQB 1ZWZA 2VJKA 3IO5A 4O5AA 3BTUA 1Q2UA 3GLRA 3HBNA 4BZXA 3ECSA 3GHYA 3PGA1 5FBHA 1G7CA 4EO9A 2WW8A 4MS1B 4BMSA 1AUOA 5CDGA 3S4YA 2I7DA 1IUKA 1ESZA 1Q0LA 1VYVA 4YDQA 2BBOA 4JXXA 4NBNA 5H4HA 4OUKX 1DSSG 5BMVA 1VKZA 2V0CA 4Q93A 1J2EA 4EKYA 1HDRA 3TG8A 5KS2A 5A71A 4IIGA 4HNVA 4YPFA 1ONBA 2P5UA 1TL7C 3EIHA 4PZEA 1Y4AE 3BXPA 3DHVA 4RMGA 1UXOA 2JA2A 3H9EO 2ZZKA 4H7DA 2FN4A 3CCFA 4P3YA 5FTWA 5K0ZA 1WZIA 1JXAA 1T0KB 2JW5A 2G82A 4O2BB 1OZGA 2WYOA 3DFZA 3KU4A 2KBEA 4S2EA 3RRXA 3V42A 4EF4A 1R4NA 5ABPA 5U1PA 5AW8A 2OGWA 5I7VA 4PAOA 4NOJA 4PLGA 2XUGA 3ZHOA 2BUCA 1VRCA 5JCJA 1X74A 1XELA 1SU4A 1VK3A 4BP9A 3W9BA 4GLOA 2AD5A 3LT5A 1YWGO 3L8DA 2C54A 1V8FA 5BN5A 2HRYA 2EFJA 4OV6B 4WKPA 5G4KA 1RYBA 1X7PA 1FTSA 3JQFC 3QPVA 4KN6A 3R9IA 4EYKA 2QTZA 5E95A 2XCRB 2ZRQA 4FUQA 2ZJ1A 1FF9A 2PMWB 2BM1A 4DLBA 4CEIB 4G4ZA 4FMDB 5B36A 1E3MA 1OV6A 2FYTA 4WNIA 1T9AA 3UFXA 1Z7BA 4K1XA 4Q1CA 4W9RA 5E2AA 4NQZA 4P33A 2Y1WA 1EXWA 1QMGA 3F6YA 5I7WA 5I4IA 3G5TA 2Q5JA 4G24A 5AI4A 3AM1A 3PENA 4YDSA 1Z5GA 1OXMA 5BO5A 3ZE0B 5AXBA 1EQAA 4L95C 3BMNB 5HDQA 3A25A 1YC2A 3JY6A 5BSHA 1KO4A 2PVCA 3PDWA 4N47A 3L4BC 3K14A 1GLVA 2XE6A 2Z8YM 4R2KA 3VFDA 4ECAA 3KJKA 3IGFA 3SN6A 5CLHA 2IPLA 821PA 1QS0B 3KBBA 4I4TA 3CLUC 3GI1A 1NVGA 1TXGA 2H4HA 2ODEA 2IP2A 4W5TA 2C61A 2HMVA 2G70A 2CYBA 3W4KA 5F1YA 4MK4A 2Q4OA 2RGRA 4ETWA 4RTOA 3TQTA 3ZS9A 2ZF8A 3A1NA 4B71A 3U4HA 5HKOA 1OH5A 1P3JA 1EEHA 2R86A 1JBKA 1N2JA 1RXSA 1Y6ZA 3BRCA 3DLBA 5ENVA 1KO8A 2LW7A 2OORA 3H18A 1U8YA 3LBYA 4OHUA 4ZYYA 4ENQA 4XWAA 1PNRA 1JG1A 4ENWA 4NZNA 3A7EA 3FMFA 2PRSA 4DLPA 2BZSA 2P67A 4QGAA 3LGXA 5AJXA 3CURA 2J3KA 2Q6VA 1V9LA 3I5XA 3LDUA 1U7DA 1JEYB 2XOKA 3H2HA 4IBOA 4WEQA 1E7RA 1OJLA 3EISA 3VKUA 3R5HA 2PRZA 5J58A 2CF6A 1I3NA 1G7TA 2C2XA 2VBFA 2WIGA 3TH5A 2OGUA 4MWDA 4YRCA 1K5HA 3ZCVA 4FFBA 3MVEA 2UZAA 4N5DA 3D7MA 4I36A 1HH4A 1N5DA 1PJLA 2ZW9A 2PYZA 3MOIA 4MTLA 3WFIA 5L3QA 4XJSA 4AKEA 4MP3A 3L4EA 3CVVA 4XDYA 5HK8A 3NDBB 3WWDA 3VR5H 3U3JA 4L8FA 2Q0XA 2WKWA 4PW0A 1NQ3A 1KI4A 4MP6A 4U2BA 4MVJD 2Q5FA 1PHRA 4MTCA 3T61A 5EJ4A 3MT7A 1TF7A 1EP2B 4JOSA 3X1MA 5DKFA 4RM2A 4I1SA 3DV0B 1C1HA 2JA1A 3EEFA 1VE6A 4FOLA 3OJFA 5CH3A 3UENA 1JVSA 1RCTE 3BE6A 4Q7MB 3V8RA 1H8HD 3ETJA 4ONEA 3N8KA 4Q4JB 4J16A 4JVOA 4O2LA 4UXIA 3ORRA 3DDOA 3QX7A 4FBLA 1HE3A 1LJ8A 4NEHB 3GLTA 3RVKA 4Q7KA 1LWOA 2H92A 4KXUA 2GSDA 4KR2A 1V5EA 1IAVA 5K0FA 3O26A 4GOXA 1XJ0A 1XZ8A 3PNQA 5LBTA 4NECA 4C06A 1NVWQ 4IV8A 3AEXA 4IF6A 3CU5A 1NMEA 5COAA 5F7JA 1F2UA 4LJYA 1WHSB 4X92A 2VDWA 4BT3A 4V2IA 4MVJG 2HBQA 4ZJZA 3VU9B 3REFA 5E4FA 3MM4A 3KXIA 2D5IA 4W5JA 3WLOA 3L1UA 1L5KA 1Z63A 3EULA 2VYCA 3WTCA 2EZ8A 3OX4A 2FWPA 4HQ6A 4DV1B 1JVBA 4QIHA 1N0IA 4LZNA 1DB3A 1NYQA 4O0LA 3VVCA 1LRLA 1SXJB 2ENUA 2FJ0A 2PR2A 2I3BA 4BNJA 3H9UA 5TDHA 4XX1A 1Z0ZA 4RF4A 4JI2B 1KQOA 2ZUBA 2VO1A 3CUWA 2DKFA 3MSCA 1MX3A 3X1DA 5I9IA 1IZ8A 1LX6A 4C6TA 3FOZA 3LT0A 5FI1B 4QYTA 3SVTA 2AVNA 3ZZ1A 5BW4A 4JDUA 4Q47A 1LBQA 1Z33A 5JANA 3T35A 4TMXA 3LA8A 5LWHA 4G0YA 1X13A 3RGWS 4DJAA 4HJXA 2PHNA 4UNQA 3FR8A 4E03A 2FHSA 4BN0A 3WGTA 1NP7A 4UTVA 3QE4A 2GS9A 2GM4A 3IVMA 4TTQA 4BUCA 1VZ2A 1CUUA 1YDHA 1A9YA 3NM6B 2NNLD 3MCQA 5F76A 3RUHA 2HC9A 5G3ZA 3S55A 2ZM6B 1J00A 1NNEA 1W3EX 5TR9A 2MYNA 2A4KA 4LMPA 1PV2A 2QTBA 5DSXA 1HA3A 2XOXA 3M1IA 4Q9HA 3OM9A 4YRSA 5B5SA 2G9IA 1PEKE 3UB3A 2X0JA 5KMGA 1NOJA 1WDWB 3EH2A 1KR5A 4EL0A 3K9GA 3OBIA 4MGKR 1P45A 3GD5A 1KQPA 5DCUA 3BF7A 3QEOA 4F2HA 1RRMA 1F2VA 4BN5A 4MEJA 1CY8A 2BFNA 4OHRA 2WTEA 3WSVA 4D8VA 1SEVA 1K3TA 4BO1A 1ZA2A 2PSFA 1V0JA 4PM4A 2BO1A 1ZHHA 3GEDA 3Q6IA 2GD2A 1U81A 3QH4A 4JLBA 5D51S 1ONPA 3S8MA 4DJDC 1CNEA 3KSRA 4EW2A 1KMCA 4XSVA 3L8HA 3PITA 4HGYA 3EX7C 1II8B 1HQCA 3IP3A 2PUFA 4CMAA 4F97A 3R20A 2Q3JA 2FUCA 5LNK1 1JN0A 2ZBRA 3RT9A 4NAHA 1QTRA 4ZXPA 3FZNA 1PEYA 2OLKA 2WJIA 3HA3A 4FFMA 1KFEB 1F0YA 3RROA 5G1PA 3QF4A 1ZJZA 3GNQA 5FR2A 3M82A 4TXJA 4F6LA 3W6ZA 4E5VA 4AJNA 1VL5A 4N41A 3VPGA 4IJ5A 4J0IA 4CU2A 3HL0A 1SK8A 2WKPA 4I9FA 3DFFA 4RADA 2BFDA 2F1RA 5DYIA 2BFFA 2HPZA 2GTPA 3TLJA 3I61A 3NBXX 2BYTA 3CV3A 4N5IX 4AMZA 1LDBA 2GO7A 2HPVA 2PT5A 4PSCA 1XJQA 4CLEA 5DNVA 5F77A 1QRDA 3SF8A 1BVUA 5C7LO 3P5SA 4NCBA 3I6QA 4C0KA 3ZNNA 2DJ5A 2P6PA 3STVA 2EWWA 1QDEA 2HL6A 4LF7B 1JEOA 2IXAA 2O8CA 5L45A 1ZUIA 2EGGA 2FMIA 1W47A 3JATA 2M9MA 1ISRA 1M34A 1PP4A 1PJ3A 4WY8A 2I6DA 2ZUSA 2C95A 1TJ3A 4D6XA 3LWZA 2JKYA 4GL4A 4N18A 1ZUD1 4LE1A 3P9QA 3T7RA 1YR7A 4AUKA 1UM9B 4WOPA 3FBGA 4TRNA 3AFHA 4QPNA 2J48A 4K3VA 2PQ0A 4BVHA 1EVEA 1Y8QA 1UQRA 2WHYA 3RS4A 1FNBA 4QU8A 3OQOA 4RHAA 1H2RS 1QVZA 4GXQA 3KJQA 4QOSA 4UEQA 3HCEA 5I7OA 1YBVA 1I36A 4BTLA 5BNZA 2F4VB 2GEVA 5EEGA 5AOBA 3EW7A 1EVJA 4G5RA 2WUGA 3V8PA 2XKKA 2QE7D 2GXQA 4H6WA 1WMAA 4QE3A 2BKUA 5FO0A 3DM9B 1Y6JA 2EDCA 2IEZA 2OCBA 3I55F 2PH5A 2JVJA 1VLJA 4KV9A 2ECQA 5AHXA 1YXMA 3MUNA 4I3HA 1Z3CA 3BBLA 1UBKS 1THZA 3GCWA 4OP1A 3EGVA 3RD5A 3SU8A 3EWNA 3H8JA 4Q7LA 4EPYA 2ODQA 4QDJA 3PQDA 2GI4A 1G18A 1I0ZA 3BCUA 3PWZA 4JLJA 3HVRA 3VJRA 1WABA 2IFTA 3I76A 3QVGA 1C0KA 3W5IA 1XI2A 2HO5A 2HKIA 4GXTA 2HFKA 4RK6A 5AP9A 3V00A 3G3EA 5K8LA 2XMQA 3V4OA 5ITWA 3J81A 2OCDA 1FTGA 4GKJB 3EY4A 4WUVA 5FULA 3L7LA 4JC5A 5FA6A 1SGWA 5I3CA 3FY4A 3HJBA 4G0QA 4PXYA 4DLKA 3FPLA 3QW4B 3JR7A 4GIBA 3ZH9B 3ZU4A 5FBVB 3C7TA 4HNSA 2C7VA 2H7YA 1RZRD 1VKOA 1ULZA 2YYAA 3RIXA 3ZTWA 1JHZA 1XMVA 3GMDA 1U11A 4TTIA 4MR8B 4B33A 1TUEA 3AUXA 3DCJA 1Z4PX 3BMCB 2WUVA 3C8DA 4RETA 2JEZA 1ZNWA 2QVXX 3BWXA 3VGJA 2E89A 3LPAA 3MG9A 4PXSA 4LCKA 1P1RA 1MB4A 3MCUA 1C4WA 3C3PA 4MIKA 5CDYA 3TD2A 1W57A 2WKSA 3GRVA 2J3QA 3UB4A 3UOAB 3VAYA 3WIDA 1WCIA 1JSXA 2JHCA 3INNA 4FR0A 3CVYA 1W2GA 3IBCA 3ONFA 4MAMA 2ZS8A 3LVFO 1FFXA 4HWTA 3KJGA 2XGJA 4L3VA 3W1EA 2XW6A 1T4GA 3GXBA 3QG5A 4DSOA 3I5AA 5ADUS 2CVZA 3BMXA 4IZIA 4DDVA 3VPXA 2V4UA 4PNEA 3F0TA 3V1UA 1QKJA 3ACDA 2W2KB 3LNTA 2QUAA 4AK9A 1G8JA 4YMGA 3Q8LA 1R0SA 4PZZA 5JIBA 4KMRA 4UVDA 2QN6A 1E58A 1I33A 4BCDA 2MQEA 4QG7A 4BO0A 3AJDA 4TZZA 2I65A 4KNWA 3EWSA 4Q1DA 1AV7A 1TJNA 2A57A 1XMSA 3KHKA 1EGAA 2IYSA 2QI9F 3HJRA 3MWJA 4MYRA 5C8ZA 3KALA 2AMYA 3F3SA 2CLKB 1IUNA 4FGWA 3WG9A 4JT4A 3IQDB 1NN3A 4I7EA 1VMAA 1NBIA 2QGZA 3KJNA 4BO5A 1VPWA 2E21A 3WJ7A 5HMMA 4C76A 1TAUA 1KSJA 1H0KA 2HF7A 4Y6OA 2OP1A 1P5ZB 1K9VF 4OY3A 3V2HA 3F3KA 1ZUNA 3EODA 3D5TA 1JSCA 2WWXA 1FYEA 3ZCTA 1I24A 3FUCA 3WLNA 3U3RA 1O94D 4I50B 4KR0A 4QHSA 4EY7A 1GM5A 1W8DA 2D2VA 4NVRA 1Y8AA 1FYDA 1XWWA 3FCYA 4M8IA 3OWXA 4B5LA 3RBAA 3LBAA 3D6TB 4X7RA 4QHTA 2QVCA 1IEXA 5CJPA 2Q0SA 3CKYA 3SBOA 1JB9A 2ILVA 1HYEA 3MIIA 4MWTA 2C7OA 4HDOB 3WL8A 1V3VA 4JBHA 3C24A 4F6RA 3JQFA 5E1OA 3FF4A 3M6IA 4KWHA 2P7HA 1GPAA 1QHFA 1SZJG 1ZNXA 2CNLA 3QPDA 3SOPA 5IU6A 1OC4A 3QQPA 5A03A 3L0DA 4NEQA 3II6X 5IBRA 2JKZA 3DHEA 3R0VA 1ZGAA 1DRJA 1XP5A 2ATCA 1GTVA 3N8DA 1KYYA 3OCXA 2V97A 3ENKA 4MHTA 2EYUA 3ILVA 1MH1A 3KT0A 2ZSIA 3LUHA 1PUXA 1X3SA 3F6EX 2BSXA 1Q91A 3TW8A 1Y0BA 2Q6LA 4BECA 4C81A 1N8SA 4ZVMA 4ZT5A 2C4MA 1P5HA 3H5WA 1XLVA 3P4XA 4FGUA 5EG5A 3PGMA 1JQLB 3QXHA 1X7DA 3F90A 1KJWA 4J43A 1SZPA 3JQ7A 3LDHA 4LRXA 4L08A 4JC4A 4XVHA 2H06A 2QYOA 4O2AB 2DFKB 5LCXA 1ZWKA 2V7QA 3IIMA 4DIOA 2WDPA 3ISJA 3Q85A 5EZYF 2JKVA 1DAIA 3ENVA 4N3AA 1QAMA 3PPWA 3L4BA 5T6BA 1R9MA 1DWUA 3NBQA 2A9OA 2VFAA 4IYJA 1RMTA 1SELA 2RI1A 3VZQA 3OEHD 2XYPA 3QIAA 3JARB 2IYYA 3DDZX 3FCAA 1GVHA 4MQFB 3W5CA 5DM60 1JW9B 2JLSA 5BSFA 4TLDA 5JCXA 5JZVA 1J90A 4NU6A 3DXZA 2J3MA 5HPYB 1A8IA 2LXNA 1FYXA 3WGLA 3O2NA 1V71A 3RKUA 5EE9A 1KBQA 5B8FA 5I01A 2I4NA 2VKQA 2ZTUA 1A8HA 2BR5A 5JQWA 4LXTA 5HF5A 1NULA 2EDAA 4ZQHA 4DADA 3OTIA 1UJ4A 3ZUGA 4G65A 5DEIA 4DA6A 2O07A 3AVUA 3QM1A 4MDEA 1J0DA 2TYSB 4FFVA 3V4LA 2C8KA 1U8XX 4QQNA 1JDNA 1QR2A 4XFJA 2RD2A 1A5SB 2F1OA 1SHUX 2HBYA 4CL2A 1VIMA 4HZGA 1JPJA 3M1AA 1QB7A 4UHFA 4LYGA 1Z2EA 2WZQA 5C18A 4W5QA 2A92A 3P8ZA 5I9SA 3IRVA 3LUAA 2OVBA 1MNQA 4UOZA 1FU7A 1XZKA 2HA6A 4YLGA 4LHVA 1TZBA 5I4BA 1Z4NA 4FMCF 2V0GA 4JLWA 1UI9A 1C2YA 2UAGA 1EE2A 3AEYA 1YGPA 1IVNA 2GZHA 3KT6A 4GX1A 3TD6A 1TF2A 2HS4A 1YIOA 3RT1A 4D3ZA 1CYEA 3G2LA 3U7QA 4YRNA 1Y6QA 1LWNA 1LXCA 3PRJA 4NENB 4TWAA 3TM4A 2PUGA 5AICA 1VL6A 4PQFA 4ZCLA 4M1MA 3ILHA 2B0CA 1N78A 4XQ0A 2H1VA 3E15A 4M60A 4JKIA 3RSFA 4N7RA 3MJFA 1IBKB 5HIMA 2ZYVX 3RFCA 4LY6A 3ROZA 3KOMA 4EZEA 1H8ED 2W71A 3D8NA 3K9QO 3N39C 4CTMA 2BFMA 3MBMA 1SQ5A 3MPOA 1RAAA 4TRJA 3WA6A 1JQJC 3GVPA 2I6FA 1NBHA 2F9FA 3UK6A 4OMDA 4L74A 1VI5A 3FSJX 1MC1A 3HEBA 5CIYA 1JALA 5FBWB 6GPBA 4UHDA 4N3CA 1MW9X 1AU9A 3K0EA 4IHKA 4B17A 4JVMA 3O75A 5BSVA 4TQAA 4LOJA 4EIWA 3OOYA 5A0FA 2DHRA 4YQFA 3CB4A 4ZYUA 2BMEA 4XB6B 1DG1G 1PFVA 2PZBA 2OBYA 5DRYA 1CVIA 3VR5A 1OKKA 1M5RA 2C8JA 5JATA 1N9GB 4D0SA 1IH8A 3L43A 5KHOC 3O4JA 2FWRA 1IZ9A 4LRSB 4DCJA 4HT3B 7ABPA 3ND6A 3RYCA 2M1XA 3AEQA 3R6WA 5E9QA 4U2GA 2Y1GA 1RHMA 2XWSA 3DE2X 4S35A 1L5YA 3FCXA 5LXTA 1YOVA 3QHDA 1GPUA 1EX6A 3FVQA 1S2IA 2C9OA 2QSJA 4XUDA 5AM1A 5F7XA 4RLSA 3VVMA 3MGGA 3USCS 3TUJC 2R2AA 5DM1A 3PL5A 2Z1TA 5EUMA 5LP6C 4P53A 5JWHA 2NUTA 2IUFA 4TKVA 3MN1A 5LUAA 1BN7A 1W85B 5DBIA 2FSFA 2GF0A 4U1RA 4E32A 5AFSA 3TQIA 2WG1A 2XMSA 3TLEA 2G1PA 3DTYA 3T3EA 2H2HA 4JOQA 2ZANA 1X1SA 3WGKA 1XVVA 2F3SA 2H57A 4K5QA 1ESEA 1PW5A 1L4LA 2JGDA 5CX1B 3W6PA 4BP8A 5IEBA 3NHLA 3GJSA 5EJ6A 3EK2A 1XTBA 2V54A 2XHEA 4R1OA 5L3ZA 2PXXA 1C7ZA 1S9DA 1X2BA 4KI7A 4PYNA 4WLNA 4XFKA 1K0FA 3EEYA 4OHWA 2ZPTX 3TINA 3WAKA 3CCUF 3AUKA 1AKMA 1CF9A 3S70A 3T38A 5K20A 4O3MA 3P2YA 3K8OE 2FOIA 4PANA 3HCNA 4BEBA 4PZCA 3BD9A 4TZTA 4A2WA 5MDHA 5JH7A 2AFHE 4R84A 3R9WA 2YS7A 4BAGA 2CUNA 1M10A 4Z1MA 5CLFA 2BTOA 1F0KA 2JBHA 2AYXA 1U8CB 2JDIA 5DISB 4ZTUB 4X1KA 2B34A 2VHYA 1AXEA 1XUOA 2QLBA 4Z9BA 1UXHA 2C5HA 2D1TA 1LY1A 3F7NA 1AN0A 1LPBB 1NRJB 3A9CA 2ZR7A 3K9NA 4CEIA 1TQ2A 4BO8A 2WT9A 4KXYA 4B5KA 5E2BA 1ZA1A 1X14A 2XGMA 1ACMA 1A8PA 4RHEA 1RTTA 3PD7A 4JDPA 1R8XA 2QN7A 1O97D 5TS3A 3M6LA 4C3UA 4L78A 2GN6A 3T80A 1XVLA 4H0CA 1KRXA 1X7HA 2BI4A 1N6RA 4Q01A 5H1YA 2ZI5A 1DZIA 1QMPA 4K9SA 2CWJA 2OBNA 4Q3OA 3GO4A 4BNFA 4DDUA 2OD9A 1KAHA 2FR1A 4CFZA 1M1YA 2DUWA 3AUJB 2YDXA 3OEYA 1JHRA 3VPAA 1ZGJA 3WIBA 2MSWA 1R9NA 1M54A 2OAQ1 3EC7A 1K86A 4O8ZA 3KL2A 5CM8B 3PC8C 3NAZA 3T5CA 1DQPA 1SM4A 3KL4A 5LBIA 1IEVA 1KJIA 3ESQA 3OO0A 1OXTA 1VOTA 4HAUA 2QD3A 5GAPK 2Q6KA 5I7RA 1E77A 4KOAA 2R48A 1NF3A 4RDIA 4Y7CA 3MMXA 4DLLA 4ENSA 3JAMA 1CERA 2VXBA 2X58A 2YIDA 1KAQA 2P2NA 4AM8A 2V1UA 1K2WA 4R0VA 3HY3A 5E7IA 4UVHA 4B3RB 4XOIA 4WXYB 1BOOA 3ICVA 1G9TA 5FBRB 5JXHA 3DEHA 3KKKA 1QTNA 1Z16A 4I3GA 2PQ6A 1U1GA 2MR5A 3EVAA 2Q2WA 2GJ8A 3NH6A 4CKEA 2Q4DA 4ZVRA 3AFOA 4UAUA 1NA5A 1YTUA 3LRXA 4HS9A 1VJ1A 4JBWA 2QSZA 4QNMA 2AOTA 3JWHA 4V2UA 4QLBA 2IY7A 4POAA 1KARA 1A2BA 4FYMA 3UK0A 3U3KA 2G9UA 2N9UA 1LTHR 1P7VA 2J6CA 4Q3LA 5A2QA 1X7XA 3Q0EA 1SVNA 4TL7A 3CNOA 3C6BA 2JNWA 5K09A 2W8BC 1YI1A 2BUBA 4FZ3A 4LHSA 4YT5A 1QTQA 1FVXA 2SKDA 2E18A 2M6KA 3H9BA 2AZXA 2NO4A 4RMIA 2ZWPA 2WSMA 3BMQA 1R16A 1ZD8A 5KKAA 4OIMA 4KWTA 2QUBA 3TTTA 1XG5A 2HGZA 3A3KA 4Y2VA 4BVQA 4FINA 1SXQA 4EVIA 1PEAA 3H11B 4F71A 5JYEA 4A8JC 1J07A 2KMLA 1EUCB 1L1QA 4Q4JA 4XH9B 5EPUA 3H2SA 1KKMA 3HUDA 3M3HA 5IS2A 2AUNA 3AF0A 5E6RA 2C0QA 3I42A 3NZEA 3L5OA 3RIMA 5CFLA 2VPPA 1EP1B 5D8DA 3DE0X 2B99A 5KTOA 4F21A 5BORA 1ORVA 4CM8B 3EGDA 1QLWA 4YAUA 1ITZA 3Q0TA 2VYVD 4TTVA 1DP4A 1GSOA 3WK7A 5JVDF 1RLOA 5E7JA 2DZDA 3SYKA 1CE8A 4CIWA 1WXDA 3A3OA 1P9RA 3UHJA 5IT9A 1TM4E 1XKXA 4G1MB 4AXBA 1C8BA 1KVTA 3DT6A 4FKMA 4ARBA 5B7NA 5EHZA 5H4GA 3MWDB 3E5HA 3H0CA 4J0HA 3PIRA 1S9HA 2P4HX 1SXJA 2HLPA 3PGKA 3M1XA 4FPXA 2CV1A 3VOAA 2FPPA 1DIAA 1UFRA 3H42B 3TG2A 2I8AA 4B6OA 3DL0A 4I66A 4MKXA 1YJCA 3JQAB 5CMLA 3TTVA 5EXXA 4QT4A 1AA9A 1E0KA 3NORA 3E5NA 2G40A 1KI9A 1PQWA 2YMMA 2IOFA 2YWFA 4KR6A 1EZ4A 2LCIA 1PZMA 4NBVA 3D7KA 3S03A 3G49A 3PNLA 1MOQA 2EX1A 2RH5A 4IXMA 2SECE 3IDOA 4YRFA 3T1VA 4CT0A 3R41A 2VA9A 1YGYA 3QE0A 4TPKA 4GBJA 1Q21A 3AHGA 2PO7A 4WK4B 2J0SA 3WWZA 2IBMA 3PKZA 4I8IA 2WIDA 3EXHB 3GJZA 3LIPA 3RVPA 4AU1A 3A9RA 4WN3A 4CIXA 2AXPA 2XGGA 4FBGA 3LP5A 5FFFA 3OMXA 3H2JA 1XGKA 3GLGB 1DTSA 2WLSA 2Q3EA 1JLHA 3F67A 1EFRA 5IC6A 3K0CC 3DNPA 3R6GA 1R50A 2A67A 4YMHA 4GPTA 3C4VA 2H1IA 2WOJA 3NGXA 1NDQA 4A1FA 2ARKA 3M4XA 2XXAA 2FRXA 4FLMA 4HQNA 2AI1A 2ZU6A 4MULA 4O2RA 3RTEA 4DWJA 1XU4A 1C30A 1POXA 1HXHA 3PPXA 4CIAA 2VTBB 4IDEA 1UJBA 1II8A 1G6HA 2H00A 3BGSA 3AR6A 3OZSA 4UPEA 4PICA 4RKYA 2PXAA 2C3UA 3GFTA 2BJWA 3ACCA 1XLUA 3VTIC 4F91B 5KKCA 1R15A 3KKPA 1Z0KA 2H2IA 2DH5A 3QV2A 5A4DA 7MDHA 2I71A 3AHFA 4WNYA 5J2TF 1MO2A 1DHTA 1E66A 2GJAA 4TT3A 2CNWA 4UOEA 2O2YA 2OV2A 1REQB 3EGIA 3K71B 2JANA 3P71T 4LQCA 3RRBA 5LMNB 3B5EA 4KTVE 3WMEA 1JAZA 4QXQA 3DONA 5EWLA 2QT9A 4ND4A 4RCZA 4OEHA 4JBNA 1QRAA 4PQYA 2A3NA 2DWQA 3ZE6A 1GQSA 3S2SA 2Z1MA 2DX7A 1KA9H 5C53B 2OSBA 5IZCC 3ZE9A 2HSJA 1JQ3A 2P90A 4H08A 4D8WA 6YASA 3SQNA 1OD6A 3JD2A 4QPZA 1X7WA 4DDTA 4GECA 4G5OA 3W2GA 2NX2A 3T4UA 2EWCA 3IQFA 3ZHQA 1CEXA 3V4PB 1DV2A 1QHXA 3LV8A 1GTRA 4X24A 5F9HA 4AWBA 2P0YA 1W73A 2HHAA 1GNQA 1GO2A 5E9JA 4CWAA 4EY4A 1D0SA 3A9SA 5JG7A 3RF6A 1CV2A 3LUFA 1UM9A 3EJWA 5FAKA 4P86A 2VXOA 1NXTA 4LXGA 5IAGA 4Y2RA 4FZRA 5CK4A 4OI0A 3TL6A 4YGXB 3LVRE 4PGFA 3K9FC 4B73A 3ZOPA 2ZRBA 3OX3A 1N6HA 3I92A 2WK1A 1KJJA 3OIFA 4KVAA 1HQKA 3NIFB 4P4SA 3NOQA 4RS3A 4ZU6X 1GTSA 3NBMA 1YUMA 2XH8A 4RF2A 5F4ZA 1RBZA 5JQGB 1TC1A 2EL9A 3OEEA 2QUIA 4AJJA 5KVAA 2NO6A 4WY5A 5AOAA 1OWPA 2X23A 1NN1A 3QITA 5T64A 1PG2A 4HWKA 2PE5A 1MMFB 1CJBA 2HYDA 2KQUA 2YUTA 2ZR8A 1ISPA 1GTJ1 1O77A 1RHJA 2Z8XA 3KT3A 5DI9A 2IYUA 1VMDA 3DBLB 4JYCA 5JALA 5GONA 4DA9A 5JYBA 3H2IA 4DE5A 2X3YA 3B52X 4K9QA 3VNUA 1Y81A 3WWYA 4OQXA 4DHEA 4DG9A 1IPEA 4R7TA 4YAOA 4PYMA 4I81A 1D4OA 1QUEA 1Z35A 2L2QA 2HEGA 3BFVA 4LV5B 3RS8A 4ARAA 1IN7A 1IN6A 3ZP7A 1WQ4A 4RTLA 1LDMA 4LHWA 1YNSA 5SICE 4TXLA 1R66A 3N8HA 2DUMA 4V0RA 3S29A 3P52A 3OFNA 3NQ41 4A8PA 2FPGB 2B7BA 3I2KA 4MA4A 1CNFA 1XFDA 3BMOB 3Q3EA 3VDNB 4DV3B 4FZJA 4UU7A 3H6GA 4KR9A 1N2CB 4YNBA 1I3LA 5I7HA 2PRKA 4BFZA 3KD2A 1PJTA 1ZN8A 2ZSKA 3NM5A 1E5XA 3TZQA 5A4MS 3D8RA 2I87A 3W34A 1Z4QA 1D0IA 4Y1RA 1X1CA 1KI3A 2ZVJA 2RCYA 1EXVA 3EQ8A 3AF1A 1CY0A 3ET4A 3C16C 5ALHA 5BWBA 5DMXA 3CIFA 1X9GA 3K70C 3LY7A 4C6HA 1FZQA 2Y92A 1EFVA 2ZAYA 2YVAA 2W7TA 4QGFA 5C3MA 1L7XA 1GZHB 4RL6A 4BWFB 3L8FA 4A0FA 3C5CA 1QIJA 4NMLA 1H48A 3F49S 1UWVA 1T24A 2IH4A 4M0DA 5DLYA 4P4UA 4C2BA 4X7MA 1ZP6A 2WRZA 1IZYA 1Z7GA 1I7NA 2ZT7A 4GW3A 1KFCB 2OE2A 1Z29A 2Q41A 4M53A 3TTXA 1K89A 3H1PA 5REQA 4XPIA 3BIXA 1LI7A 2XVYA 4IUDS 3H3FA 3UBTA 4IEEA 1DE0A 5DDIP 3TLMA 1EHYA 5C8XA 3EVFA 4DKJA 2HHLA 2PN1A 4G8DA 5LP6A 2X2OA 2BISA 5FWDA 2R751 1V3TA 1N6IA 4KIJA 2FPSA 4E31A 1FP4B 2JJMA 4RW0A 5BY2A 3T0IA 1DLIA 3IAUA 3PVSA 1B14A 5SZJA 4JYZA 1YS6A 3ADCA 2VXYA 2ZTHA 1ZD1A 2V8BA 4ND5A 1U0OC 4QC2A 4EPTA 4MCHA 2Q2OA 2JB9A 2VHCA 2B8JA 3DCIA 1JFVA 4JZYA 4DWWA 2ZQYA 3MLBA 3VCZA 1BGVA 1PX0A 1U0HC 2CLLB 2FI1A 2H51A 3L41A 2WVJA 5FPPA 4CJXA 2UYHA 1Z3IX 5C31A 3GUVA 1GKKA 1RWQA 5BUCA 1CEYA 2VA8A 4WVFA 5EI5A 3M1LA 3NHJA 3PUZA 3FD5A 1U3DA 4IJKA 2A84A 3I04A 4EPXA 1FVOA 3OD5A 2EARA 3GUYA 2ZJZA 4F4CA 4GXRA 4M8SA 5DYGA 4B7AA 2JJ2A 2YN4A 2GN2A 2QUKA 1KEWA 3DAPA 5LM3A 1GXSB 4D5GA 1AC5A 1EK2A 4A6PA 1TAQA 4K0RA 4N0QA 1GRQA 4KDEA 4OGGA 5TNXA 4BTEA 1E4EA 4M0FA 1ZM4A 1D2AA 2XUFA 4YN3A 1DG9A 5GGXA 1WXHA 2H52A 4KXFB 2ZQ5A 2IUTA 3NEYA 3LKDA 3QOYA 1MA0A 4UC0A 1UAAA 2PRJA 4HRVA 3KVOA 1G64A 4UMVA 4MV0A 2GHTA 1DIRA 3E9NA 3S2EA 3G6KA 1BJKA 1SHJA 2ZFUA 4EL5A 3PXEA 5B1IA 4KVGA 5JBIA 2FCAA 1FEZA 3IYLW 3T7IA 1QPGA 1ZLXA 2DHDA 4G26A 3GEGA 3GR6A 1QRTA 2GH1A 2QP3A 4ZGBA 3O3OB 5LZ4A 1MT0A 1WUIS 4ZTBA 4L85A 4OI1A 3RWMB 2HXYA 1S3SA 3EZ6A 3ZIUA 3B1YA 4C5CA 5FUMA 3KOZA 3KQKA 3DVSX 4MVCA 1E5TA 1EWRA 2AQ8A 2CLEB 3EZLA 4FFDA 5GZ3A 1UCFA 1PJSA 2YN0A 2R3SA 3MTGA 4KDRA 5C4GB 1VI2A 2CXTA 1NX6A 3C43A 5C52B 1XF9A 4WAUA 3PC8A 4EG7A 3WHPA 3PEWA 2DYYA 3MINB 2SKCA 3JPWA 4KE8A 2XUPA 3L1VA 1XTVA 2OXRA 3HVUA 3WB0A 1XTRA 3PJEA 3NTLA 3CMAF 4KW7A 4PCVA 5ICMA 2G08A 2WJ6A 4JI6B 1TZCA 1ADGA 2VPYA 4LOIA 2RG7A 4XYMA 4RV4A 3WSWA 5JI2E 2JFPA 1MB9A 4OO3A 4D56A 3AUSA 3RAGA 5LQRA 4LF6B 1PJ4A 5KTYA 3IA7A 4B79A 2JH8A 3DEFA 3NMUC 1M7HA 2V9ZA 1J8DA 1JE0A 1J39A 3LX8A 1TZMA 4FGKA 4L0CA 4GX0A 4J49A 2W2OA 1TJ4A 4OFXA 1WD7A 3MLAA 1YJ5A 2IHUA 3ACBA 3ODPA 2WD8A 2A9FA 2J41A 3K09C 1TRHA 4EMUA 3H5IA 5KOHB 5EIBC 1QNFA 2XHZA 4OGLA 4KL8S 2PU7A 3RW9A 2H2AA 3S27A 1Z62A 2P4QA 1D6MA 3FPEA 1YQTA 1NJFA 1N34B 1O6GA 1NJ6A 2OG1A 3B9QA 4MKIA 3RSHA 1YZHA 1G3UA 1I3CA 2IHZA 1G63A 2OHWA 2WJJA 2YXDA 4QSMA 2IEIA 2CHUA 1HEYA 3RSQA 4CT4B 3PEFA 4B82A 5IN4A 1TM5E 3Q7PA 4GZ6A 4NC9A 4HDCA 3PEYA 2JAOA 1LDEA 1I5OA 2W8BA 4ENRA 2A9QA 1WL8A 3R1IA 1QWSA 3O94A 2VF2A 2M6RA 3PUKA 3ZY5A 4A15A 2CLMB 1F20A 4P4LA 4QICA 3GN2A 2AZTA 2IHYA 4PZUA 4UNIA 4XDGA 1KKLA 1TA4A 1GPKA 3N8GA 4FCCA 2IV3A 3WLSA 1CUEA 4MICA 4MPRA 2HLHA 1YUBA 3TYXA 1Z34A 3IP9A 3D7NA 4C22A 4FW8A 3IKMB 1O3YA 4ZWNA 1KDZA 1Y3FE 2WBLC 3W2IA 4D9JA 2KG4A 2H3HA 2PLFA 4A8JA 2HLDD 4NATA 4OYHA 2UXBB 3CGGA 1JJFA 1G21A 2GHRA 1R0BA 2CB9A 2D1QA 4F60A 2PMPA 3UJPA 5I7FA 4JVSB 4Q02A 1JFFA 5EXSA 4YRZA 3OHPA 1P0IA 1X8LA 1IY0A 1Z4MA 4RUKA 4Y2JA 3VRHA 2WF6A 4R8VA 4LBWA 4NZOA 1CDDA 3HKDB 2Q29A 3MQ2A 3FOBA 3CA8A 3OU7A 1UZUA 3COZA 4CKWA 1PAUA 3K9WA 5JW6A 1A5BB 3ROGA 2HRZA 4B4WA 2FG7C 2FWNA 5TX7A 4CR7A 4YUAA 4QGBA 4EEZA 3G4SF 1N7IA 1XCMA 2C2KA 2QW1A 3C5EA 4XDZA 5A7FA 3QVWA 4MUNA 4AULA 1EFAA 5AW6A 1P0FA 2QAJA 2WFLB 2FUKA 2PM8A 3HCBA 5JJBA 1M74A 1EGHA 1KH2A 5AJZA 5DO9A 3JQ8B 3N2IA 2D7JA 2HEIA 3KWLA 1BKYA 2D62A 1TAGA 3K6JA 2UXDB 4HG2A 4ZAGA 3ILSA 1C8KA 2WWTA 4O59O 4QJ4A 5DF1A 5KSZA 4NQRA 4QOFA 1PVOA 4EFMA 1TX4B 4KFUA 4PINA 2QLJA 4WECA 1PL7A 2KGWA 2QXTA 2DYKA 3I83A 2G9NA 1ILEA 3N6XA 3UGTA 1XKQA 1QF9A 3UWMA 4FFWA 3RADC 4M49A 1P6UA 3WX0A 4BVLA 6NULA 4MPTA 4YJFB 2GILA 3R8FA 4AS1A 2HNKA 5HG0A 3CLSC 4A16A 1QQBA 4EYEA 1QANA 4UREA 2DU8A 3N2KB 1KNXA 2DTXA 4M9ZA 2Q2QA 1IJBA 4IQGA 2OTMA 4HNAB 1KO7A 1DOHA 2XV1A 4LOKA 4YJHB 3SEFA 3C8HA 4EHJA 1MC8A 5CB4A 5EMHA 5JC8A 4BC0A 3AR4A 2B21A 2JK1A 1B74A 3RYFA 4ND7A 4ZARA 4CV2A 1HLGA 3AK4A 4PVDA 3F6SA 1JJBA 1WZNA 4PF1A 3DTVB 1KY4A 1M2NA 4RJLA 3K0CA 3W5JA 3R3SA 1F7VA 2ASVA 2FVXA 1WA5A 2QMYA 3C4JA 1Q0QA 1VSBA 1HDYA 3SR3A 1G4UR 3GT4A 4LGVA 3CRMA 2J6BA 1DX4A 2OA0A 5KYTA 3GLFE 7REQB 2B4KA 3W77A 2W6CX 2CHQA 2WFAA 3SC6A 1Y63A 4MR9A 2FX5A 1ZS9A 5FL7D 5K6RA 5FYQA 2WNHA 1FNNA 2BZ0A 4L7VA 3QVXA 4O3FA 4NESA 1DBRA 2NZVG 2DQZA 1D04A 1XPOA 2B82A 3ZXUB 1EFPA 3WKBA 5EB0A 1ZGHA 3K0AB 4O25A 1J70A 1MD9A 2NXWA 3OSUA 3UAYA 2C2WA 4HWPA 4OSPA 1NNLA 3AJ8A 2GX6A 3AUFA 3AUUA 4BVGA 4OX9Y 1JV2B 1IPFA 1G8PA 4MRMB 2FFBA 2D7DA 1SRQA 2HI0A 2VG8A 4ZRDA 3LFOA 1VKRA 1XZAA 3JW8A 2PL1A 4JI5B 4D4HA 2DUUA 4CTJA 2ACKA 1U9ZA 2P3OA 1KVRA 3D7SA 2QPTA 3LPCA 4LJAA 3GLSA 1SPBS 4CQLB 4TTPA 4X8OA 5AOCA 4PQRA 1N9ZA 4PX9A 3ZZTA 1D2CA 1KIAA 3ZGVA 2ADOA 4KQ6A 1MJHA 4LY0A 4OGFA 4W63A 2EWMA 1WLYA 2CYCA 4WLUA 3WDSA 2RK4A 3L7CA 1EA5A 4RZHA 4CLOA 4GMFA 5IZCA 2O3JA 4M9QA 4IOJA 2VBCA 3MMNA 3TUIC 4OQ4A 1KXJA 3K2XA 3OQJA 2DLCX 1DXHA 2NN3C 3ZVRA 1E9RA 2PDAA 2OO3A 4M0PA 1NBOA 3ZU6A 2RH9B 4Q5IA 4X3PA 4F4IA 3V7FA 1P2TA 2PLAA 3TW6A 3B85A 3RM3A 3DKKA 2NTVA 3U26A 5JECA 4MLDA 1K3UB 4ER7A 2Q50A 2ZIGA 3HYTA 4GGPA 4QA9A 1UC9A 3H5TA 2WFMA 4MR7B 3RB8A 2A35A 2CK3A 3IUJA 4OMUA 2X14A 3Q3HA 4U7JA 1NJGA 4A3SA 4YI5A 4NTZA 4DJ5X 2EKQA 5CGZA 3QOXA 3EF1A 3KS9A 2I2DA 2YNMC 3MFYA 3BPSA 1DAEA 4P58A 4PPGA 2KW5A 1T1RA 4QTTB 1VCHA 5DHAA 5BQPA 3WXMB 1VRVA 4J1TA 2P2GA 4V0QA 3KAPA 4RY8A 4C0SA 2QVYX 1ODSA 2QZ4A 1A7KA 3PU6A 1R00A 1MRSA 5JOQA 4OM8A 2ZBEA 4TKUA 1U7ZA 2E4WA 3G2JA 1A5AB 2L69A 4MJ7A 1LBEA 3I2IA 3DWFA 4RSHA 5JNWA 1UP6A 3S0HA 5KB3A 2IIVA 1GQ2A 2Z9BA 3CUUA 4ZANA 3SC2A 1PZNA 5IH3A 4AURA 4EA6A 5BPFA 4JMPA 3HI6A 1NVMB 3CHYA 1JTEA 1XCGB 1EB9A 2XTMA 1RLJA 2P5TB 2CLIB 3OIWA 2WAOA 4ZPJA 5FLEX 3HVIA 3SWWA 3SY8A 3WIEA 1DMRA 2BMWA 4PSKA 2Y0PA 4RKFA 3M4SA 2R87A 3TSYA 2NTEA 1AGYA 4P6VF 4D9BA 1YCFA 4JOCA 1NXWA 3C7CB 2JHAA 4L9WA 4RENA 5HRCA 3FDFA 3DKIA 2W6ZA 2AWNA 1M8JA 4WZ6A 2JCVA 1DFIA 3NH9A 1RXEA 1OLUB 3EQ9A 3MRXA 3PXUA 4V0MA 3INYA 3PDIB 3ZX5A 2JLUA 4MIEA 1D0VA 1LBIA 4EVQA 1KVSA 1F6BA 2D0IA 4JR1A 2IHNA 4IIEA 2J3IA 2RBGA 5LDDC 2EBUA 1ADBA 4FT4A 1IG3A 1US8B 5CCBA 3GP5A 1PUIA 2ZIXB 3F9RA 1G5FA 1LPAB 2JJ1D 1FFDA 1K4YA 4ALIA 3OU6A 4LISA 3KYJB 1ECCA 2GVIA 3JRNA 4WLVA 4C04A 2Z3WA 3VVBA 2HQRA 4YCMA 1SCIA 1RPTA 3THWA 3R3YA 5EZYB 3FPGA 1CQPA 1U7HA 2GF2A 2QX7A 3L0CA 1SXGA 4TYNA 3LDTA 1E2IA 3CYFA 4ER0A 2E37A 3IEQA 4OAQA 3ROTA 5M5BA 5BOSA 3NMUF 3PC4A 1NQUA 2HDHA 3MWDA 4Z99A 3RJTA 4V1CB 2DB3A 2BFCB 1LBTA 1C7RA 1ISFA 1BVRA 4O29A 1DQRA 1X7OA 1CVRA 1E9DA 2BAGA 3OE5A 2AE1A 2V7QD 2X0NA 4MUJA 1FRZA 1XE3A 2B4AA 2H1WA 4IIFA 4PSUA 4L8WB 4HVCA 3HDHA 1DAPA 2AGVA 3WBBA 1D1SA 1GPWB 3JQAA 4RVDA 1YCDA 1A1SA 5GVSA 3AU8A 5FTLA 1T4BA 3VA7A 2DBRA 3G9QA 5BW6B 1SQ0A 3KCNA 2NP7A 2O2ZA 2HWKA 3VC3A 5J1SB 1TTPB 2Y93A 1IQRA 1Z25A 2E4YA 4AJKA 1H4QA 4DJFC 1UBJS 3M6MD 3VZRA 3OCVA 2OR3A 1M0SA 2FPWA 1V16A 4PSAA 4L6CA 1XAIA 3C7KA 4OBWA 1T5DX 3I09A 1OIXA 3ZTYA 1C3XA 4RXUA 3GCGA 4YJ3A 2VZ9A 4QDKA 4WPGA 3SJ7A 3ZNPA 1E5DA 1W36C 5CPFA 1I10A 1T2FA 1UPBA 2VAWA 1KXZA 2IXBA 3DUWA 1MO5A 4QOGA 3PAFA 1VSVA 2OHFA 2XYRA 3T95A 5BUSA 3Q2KA 2PL3A 4KITB 3CE6A 2Q7DA 2OWEA 4QGSA 3DE3X 1CUAA 4I1OA 3CPQA 1GNRA 3CCJF 3HZRA 1RWMA 2Y0EA 3HLKA 3HZHA 1A04A 3KZXA 2OCIA 3AUYA 2YHBA 5KSPA 1F9AA 1NMZA 1RPZA 1SUPA 3SM3A 1R0XA 2NUBA 2AH5A 3T1NA 1WB9A 4W5NA 1T8WA 1CDOA 3GTZA 4NYIQ 1Q6ZA 1Y7TA 1M2EA 3QU5A 1GT91 2E55A 2YIMA 4IH4A 4JL8A 4NOLA 5T6MA 3SGLA 3VMFA 2WA1A 2A5FA 4G0OA 3E82A 3MTIA 4IINA 1X42A 2X6TA 2WTMA 4BKPA 1M6WA 1W30A 1VYTA 1H9CA 3GELA 1M2VA 1U6KA 2ZOVA 2H4WA 3IIKA 2QZPA 2FJUA 3KB8A 4QJ5A 4BCBA 3G0HA 4H15A 1H2WA 2PWZA 1M0WA 3GWGA 2WZDA 1M33A 3R0PA 2WU8A 3HDVA 1SPXA 4RD4A 4DPMA 2QQ5A 1BHQ1 1PZGA 4IGAA 5JU6A 5JMPA 2AW5A 4ZHQF 3MJEA 1XJWA 2ZJAA 4HWOA 1CR4A 3D0OA 4HPJB 3HCRA 2HJHA 1J7JA 3FGOA 2XQVA 3SS9X 4AJPA 1V1RB 5CBKA 2OVFA 5EWJB 1DBQA 4BFCA 4DSZA 2DETA 4B3HA 2CLCX 4Q9JA 1EESA 3MTAA 2DG2A 5DFAA 2JVIA 1VBNA 1ZRSA 1M7BA 1QG6A 3CR7A 4Z51A 5M34A 1ZM2A 4AZTA 1SD5A 4AROA 3DDNA 1QHGA 1Z6XA 2R11A 1APBA 1GUFA 1AKYA 1Y5LA 5A5EA 5KQGA 3JAKB 3N4YA 1E2DA 3VR5D 4F84A 3H8SA 3KIPA 2ZQZA 4MYUA 3P45A 3SFZA 4QDXA 3U3ZA 2EW1A 3LH5A 5CX4A 2VP6A 3F73A 2QSYA 2P6YA 4MS4B 3EEOA 5DB4A 1V8BA 3TOCA 1GDDA 2HK6A 3SXUA 1U4SA 1KSHA 1P1CA 4UDOA 2QR5A 1IJFA 2UYNA 3KELA 4ISBA 3EF3A 5TJHA 3L7OA 3OPYB 3KEOA 3K09A 1RJFA 3ZV4A 1RJEA 1GGNA 1T0JB 2YFQA 1GUBA 5JQGA 3C1UA 1AD2A 3V1MA 3NHZA 4BVJA 1T5OA 4C5BA 3OLXA 3SBDA 4MYCA 1PR0A 4RHTA 3NUQA 3WYGA 3SNKA 3K1YA 4LZPA 3S68A 4NBRA 2X8WA 4IOKA 4YRPA 3JZIA 1GTL1 3OZFA 4MUGA 1OB5A 2P0AA 4UATA 1IB6A 3P97A 4TRRA 1JDBB 4D80A 3MOSA 5LYYA 4QHYA 1P7YA 4FFOA 3BJIC 1FYVA 3C1OA 3D6FA 2OXFA 1QHYA 2ID8A 3DXFA 4LI3X 4MW5A 4XWGA 3RC9A 3Q8MA 4ECEA 1FUIA 2XA9A 2ZRAA 4BGDA 3EUFA 2OV4A 5EIFA 3ZV6A 1ZUWA 1VIVA 3AM5A 1UJ6A 2F43B 4HUTA 4CF3A 4EJ2A 4B9EA 2QM8A 1T5HX 2J07A 4DN6A 1GILA 4JP8A 1DBWA 5TRTA 2FEMA 1HT2E 5DZSA 1DXYA 3H16A 1ZD4A 3EPLA 2E6KA 1X8JA 3K05A 4G4XA 3ET5A 4QUBA 4HBZA 4J7CA 1N2CA 4ZV7A 1Q8RA 5DGCA 4BQEA 1WHTB 2P62A 2QTVB 5KYYA 3M5WA 4QXMA 4NS4A 3HAXD 1DELA 1PT9A 1R5BA 2AQKA 2PNJA 2V5VA 1YL5A 3KHNA 3QPUA 4BU1A 1JLLB 3RDPA 5LU8A 3ZHBA 2WJWA 1FP2A 3RODA 1PQUA 2WILA 2FZVA 1DAGA 3I62A 3ETGA 3PWSA 1JH8A 2FWMX 4K8OA 4C4WC 3GA7A 2OLEA 4DLAA 1MHPA 4QOHA 2I2BA 4LWPA 1DC8A 5B1DA 3WWPA 3ES9A 3QE3A 2F1HA 1CZHA 3R9KA 5HS6A 2PSSA 4OQNA 4OUDB 1P62B 3E5RA 3WV4A 4X97A 4EMBA 4E30A 4Z0NA 4UHHA 2D7CA 4NNJA 1TYAE 2HCRA 4JLUA 3EVDA 4Z3DA 3W06A 2Z6UA 3N7TA 5DTRA 5ALJA 2F8LA 4GP7A 3FETA 5CTJA 2I4TA 1QHHA 4FYKA 3K9HA 3MJCA 1OE0A 4XA8A 1KK2A 4KR3A 1HYHA 3R8XA 3QFHA 4OJNA 3TQHA 4A82A 4KMMA 4DVJA 3GFSA 4PPNA 3VC1A 2VJCA 2FFAA 3LCVB 2R85A 2GJSA 1Z2CA 3WMXA 1CJMA 4JVLA 3QVKA 4QUKA 3TMKA 3ON5A 1MXFA 5BN4B 1N6KA 2GYWA 4V0KA 5C8VA 3U61B 3HEMA 4XYLA 2XKAA 3D6NB 1NR5A 2OC4A 3NV7A 5MN4A 1OFGA 2H7VA 3OKAA 3PHGA 4Y0NA 5HY1A 1Z5UA 1Q7CA 3PQEA 1LK7A 1T25A 2PXHA 3QPBA 3OKCA 4RKEA 3V8NA 2B4YA 5L3VA 3BCHA 3E61A 5AM4A 2X8JB 3ZEAA 2RIRA 1PGOA 3DGFC 4EUHA 4MMZB 3H4MA 3PBKA 5B3AA 4AN4A 2CCGA 2ZM5A 2UUAB 3U19A 3IUMA 4RTRA 3V6MA 1WMEA 4K26A 2DR2A 1E2NA 2ZIVB 2I78A 2PGXA 3FSGA 3QLJA 4IJUA 3DZCA 5J43A 5JNRA 2VZ0A 5K8JB 3HXPA 4A5OA 2KYRA 3IVCA 2GZLA 4UTNA 2WSSD 1MAHA 5KHLB 4BGEA 1F8XA 4BFTA 2Z4TA 1NTOA 3FCEA 2BWJA 5FI5A 1SIOA 1RE0A 2DBQA 3DMPA 5CURA 1G5RA 2IW1A 1BVYF 3JTEA 3NRBA 3LRPA 4M89A 4IGIA 1HMYA 1C5KA 1T8PA 1C9MA 2UVPA 1RI2A 1XN1A 3H2KA 1RPNA 2OB2A 3DYBA 1J1ZA 4O02B 4XLTA 3MBKA 4Y2QA 4RULA 2W9XA 3V7EA 2H4ZA 2BHLA 1JG3A 2GJ9A 4HFNA 4OU5A 3PI7A 5T3YA 3X43A 3FNIA 2A33A 2PYDA 2QL9A 3Q10A 1IPHA 3MDOA 4BKOA 4XIJA 4C30A 4XYEA 4DIEA 2MYPA 4LE2A 1OAPA 4D0LB 3HGMA 4A2QA 1E7WA 5JCPA 3ZWCA 1JIJA 3WP1B 8LDHA 1QBKC 1U1EA 1XVIA 3KEMA 2N75A 3LD9A 4LW8A 3V7UA 4B0PA 1BTOA 1U2ZA 2RH4A 4BRSA 2Q07A 3SKXA 1D9XA 3ESBA 2X8AA 4Q16A 2QQFA 3DC7A 3NB0A 5E3JA 3AH8A 3JYHA 1NOIA 3UMBA 4D74A 1ZW1A 1BWRA 1QGDA 2BT4A 4MGYR 4GOLD 3AT1A 3PL1A 5IVIA 4Z1OA 5C46F 3R3UA 3DP9A 4ILEA 4CV0A 1N8KA 4DCTA 2CZWA 3V97A 5IK2D 3TGLA 1YR8A 3WPXA 4O1HA 1TTTA 3AY0A 2GAJA 2RH8A 1VECA 1FMJA 2QM3A 2AN9A 4TWBA 3AP3A 2XRMA 3ROEA 1FS4A 1T0UA 3G59A 1F0PA 4Q1VA 4FQ8A 2VUHB 2W37A 2Q5EA 2V3VA 1SXJD 3ITKA 2P1RA 4Z0HO 4H77A 2D1YA 4G8JA 1CBUA 2XQJA 3VOBA 3IPRA 3FOWA 3ZLUA 5G1OA 1ZDMA 3DBRB 5DP1A 5F5LA 3ETCA 3TDKA 3BFJA 2ZR0A 3F5MA 4E5KA 1BXRB 2G8NA 2OBMA 3PLAC 2VWGA 4OFBA 5ALMA 5DTIA 4B6PA 3GMIA 2QVZX 3CY6A 1NUPA 3IILA 3PNBA 1IIRA 4IHQA 2HYIC 1HDIA 1Z75A 4JR0A 5G1NA 3SZMA 2HR1A 1PJCA 5GIOE 1T9CA 2UYYA 3CVXA 1I2BA 1H9BA 2B5OA 2DT5A 4PC2A 1U31A 1XP8A 2OG2A 2QTMA 4P54A 4Y0AA 1FRFS 3AW9A 3LWVC 5JRZA 2FQQA 3P9IA 2R6GA 4TQ9A 5SV2A 6CHYA 4NV3A 4IIYA 5JARA 3CR8A 1NATA 1Z0SA 4M37A 4Q4HB 4A1OA 4H7KA 4P1ZA 1JIQA 1SBNE 2YYYA 4M0CA 2YOHA 2HUPA 3DOIA 3GEHA 3V48A 3GB9A 4FCVA 4GE3A 4PR0A 2BGWA 4DWVA 2Q4EA 3DDCA 4WEOA 2QBYB 1F6WA 2VWPA 2RHHA 3T54A 1TFRA 3FI0A 2P2CA 3AYXB 5JJKA 2VPQA 3JRXA 1TZJA 3OPQA 2C00A 3WKAA 3C9RA 1T6ZA 3I0ZA 3NTXA 3BGIA 4LIPD 3A1CA 3MJ4A 1YF3A 4A73A 2LCQA 3P0FA 4EEKA 3F71A 4PO8A 1SCJA 1B1AA 1P19A 4OG2A 2ID7A 1VLLA 1XQ6A 2ABWA 3I2HA 5J2TB 5JD4A 4BO2A 4M0UA 4F04A 5F2EA 1W41A 3ZW9A 6ADHA 1FYWA 1DGQA 1CN7A 1C3JA 2AQHA 2X41A 3ILXA 3ORQA 3HR4A 1JWBB 2PMKA 4OLBA 3AVVA 1E94E 2QJRA 3BEOA 3DAGA 4DM3A 4KRXA 4D9NA 5CNJA 1YHZA 5L53A 1U98A 3NNDA 2ZBVA 2CNWD 3OY2A 2G5PA 2ACWA 5KI6A 1GUZA 1HKUA 3Q2OA 3P9PA 1E2EA 4EB3A 1HC7A 1J9GA 5EPOA 4C7VA 421PA 4UUAA 4GUAA 3AL2A 3WLFA 3ZGLA 4TV9A 2JHGA 2FJPA 5BWOA 4BVTA 3ZJYA 2D13A 1PS9A 3G2PA 4QWWA 2RAPA 5FQNA 1LRKA 1O0BA 3CW9A 1QGAA 2DWPA 4XB1A 1KSGA 4BLVA 1ZISA 5A3QA 4ZZ1A 1VI6A 4FCWA 3GAZA 3N0TA 4EFLA 2FUG6 1G41A 4LC0A 3TGWA 4EJ0A 3T3PB 4RJTA 1W9MA 2XEXA 1UEJA 2GKGA 1Q0UA 1OBVA 1VLVA 1Y3IA 1DNPA 2RC5A 4N8SA 4E0BA 1ABBA 3N2KA 1QVGF 1DIOB 1M6HA 2QLTA 3GOHA 1JH9A 3FNQA 2Y77A 3GARA 1NP3A 1EFTA 3IDZA 4N54A 4YJHA 3ME5A 3QYAA 4MYTA 5GINE 1P7WA 1R5OA 1CUFA 2DRIA 3BXGA 1EE1A 1E1CB 5DSZA 5FNVF 5HTKA 4GVLA 5MGBA 1ZI8A 5BQ5A 5JROA 4HP8A 4BYGA 4CEHB 1XHFA 2IDZA 2ZJ2A 4ZKDA 2YBEA 3L7JA 1WZUA 2DR3A 4XX0B 1V5IA 3O92A 2I29A 1O4WA 3K6SB 3JQCA 3LTEA 3EASA 4OATA 2Y67A 4P92A 3DEIA 1ZSYA 4YV2A 3I5MA 3KUKA 4ZVQA 4YK7A 2GA8A 4ARSA 4E51A 3GN1A 4G81A 1HE8B 2J3EA 2YMQA 4XWWA 4LX0A 4OHZA 1GZUA 2A0KA 3IP8A 5G02A 3NIBA 5HUHA 1G19A 1K75A 4D44A 4QBFA 3VDXA 4G4VA 2H16A 1KAMA 1V3QE 4BC1A 2I2XB 3ZY2A 5AVWA 4JEMA 3GOQA 3QTTA 4NE2A 4N9QA 4C4OA 2P68A 2GCGA 3L7NA 4YP1A 2REBA 4NHEA 2HA7A 4P2GA 5I51A 2NW6A 3KQLA 4N76A 1PKEA 1MGPA 2R60A 3OJWA 1U5BA 2KTVA 1TYZA 1FS5A 3NWPA 4Z2YA 1WZ2A 2D2IA 1TD1A 2R4UA 4MS3A 1VZ3A 2WAAA 3Q7IA 3BK2A 4FYIA 3CISA 3N76A 4RAOA 2CXPA 3IVGA 4UXJA 2NUPB 1YZQA 3D4PA 2GPBA 1X3LA 2JFYA 3UKDA 5M29A 4EY5A 2HJWA 1WU7A 3MRTA 3O90A 1ZMBA 1YITF 1SB8A 2WG0A 4PLZA 2HS3A 2XKBA 2ZIAA 1CULC 3Q8WA 4PZAA 5CM9C 4D8YA 2CCJA 4EUEA 4YCJA 3ON1A 4P3PA 2QPOA 5DOVA 5I47A 4JSYA 4IDFA 3A1UA 3ICWA 2YFKA 3S1AB 4P7JA 1MEEA 2OZBA 3KUCA 5ADWA 1SN7A 1A9OA 3UOWA 1ZICA 1OU0A 4UEOA 3GJ8A 2NU7B 1IQPA 2X4IA 5JXWA 3PQ8A 1H6AA 2ON6A 3CTMA 3AKZA 3IIJA 1NONA 2ZWMA 4NZMA 4ZCSA 5BSWA 3QY0A 4B4KA 5KJCA 1BXKA 1PL8A 4DGQA 4MR7A 5IG2A 2G04A 3U44B 4MA0A 3X1KA 1C4XA 1BW9A 3QHPA 3TBHA 1SVWA 3CKMA 4ILKA 4Y67A 4DANA 3VR1A 2I1VB 3A1VA 2X6RA 1Q81H 2HCBA 4G2NA 1QYIA 4LSGA 1T9GR 3UMJA 1RT9A 5FTMA 4ETIA 1TTQB 4B2PA 3LQFA 3AKDA 4PZPA 4FYHA 4NOMA 3D3WB 3IAHA 3LLCA 4IXNA 3IMKA 3FDXA 4JU9A 4LQLA 1Y7LA 2O2SA 1BEZA 3B13B 1NFRA 3A4MA 1X1TA 4UBJA 4V0LA 4X00A 1SUCA 2BR3A 5EO3A 4HGRA 2KS6A 3H87A 1C1DA 1IM5A 1ZM9A 3GT0A 5K3FB 3C3MA 3WGIA 3RPEA 2CFOA 2WB4A 4YMLA 5F64A 4ZCPA 2IBSA 2QRLA 1ECLA 1N2EA 2ORED 4I5DA 1PGQA 3IHWA 1M76A 2QD1A 3JQ6A 3ZCSA 4ZK7A 4ZEOA 4BS9A 1GCIA 2BDUA 5ELLA 3ZDXB 4EFDA 3H3XA 3OOSA 1AHIA 1F2TB 1RQRA 3EIUA 1SCBA 4KO8A 3AP1A 1ISMA 4JL5A 4W7IA 4Y7DA 4WSOA 1H66A 3OJOA 3WLTA 1AK1A 4KQKA 3OQIB 5KWEA 1CDEA 4ZYZA 4QTXA 4E2YA 2IELA 4YXFA 4AKIA 1K08A 4RHCA 4D4KA 4C7OB 4C3OB 3UAGA 3CG4A 2WF8A 1U40A 2C96A 1JDVA 2Q3LA 2NU6A 1NXSA 3Q5GA 2F00A 4HYYA 2WD7A 3SYRA 1S2NA 2JLRA 2P2ZA 4J0JA 4AYWA 5LU9A 3HN7A 4P9NA 4R83A 3RARA 1TQ4A 2H8CA 2B30A 3CKLA 1NQWA 2QRVA 4DY4A 4EUNA 4NF2A 1XMQB 1FE8A 2IBTA 2IZ6A 3SJAA 4Q82A 2QMOA 1JBEA 3PE3A 3MS2A 1H0SA 3ASZA 4NPHA 3STTA 4DWOA 4N9WA 5MF6A 1DZ3A 1FRQA 2H4YA 4B6JA 3DQZA 4WOCA 4BQIA 3ZZ0A 5JS6A 3LF1A 2A94A 4EY6A 1UJNA 4RKRA 2OHHA 1ZM3A 4POOA 2J8ZA 4EI9A 1QAOA 3HWSA 4Z9AA 3I64A 1W35A 3KAQA 3IQGX 1X2EA 4IV0A 5SY4A 4V1CA 2BFCA 3C14C 1WEHA 2PA0A 4EOGA 3PDUA 5C9ZA 1Z5ZA 2Y3IA 4PCAA 1OR8A 3SLGA 2XCLA 5JC1A 5GVRA 4UU0A 4F85A 2XVMA 3NC0C 2R2GA 4WZAA 1BRMA 4OX9B 3T99A 1QVRA 2Z6QA 3CO0S 3IT0A 4QSHA 1IFXA 3G89A 3AEKB 4FHDA 3CLRD 1E79D 5FEUA 2JIZA 1FL9A 3HXLA 1T6NA 1R6AA 2E4AA 4YALA 2WJPA 4P80A 3SMQA 1N8RH 2HQSC 3HU5A 3TM5A 2DBVO 3FF1A 4MZXA 2GHQA 5EXDA 4CKCA 3E5MA 1NQ5A 1BQ3A 4HF7A 3H65A 2GAIA 2DH6A 2IQQA 2WHQA 4P93A 4DQKA 3KE1A 2ZRNA 3DNMA 4FHGA 1XPRA 3QOWA 4Y98A 1W49A 2HF2A 4FN5A 4JI7B 3GFFA 2C78A 2VSQA 1CQIA 1NMUB 1OBHA 2C92A 2A86A 2FWAA 4OJTA 4E6PA 4CLRA 5C0OE 2A5YB 4LRTB 4XUCA 3RSGA 3IBGA 1I1NA 1FY2A 3PHLA 1O95A 1BAPA 5FBQB 4BNUA 5C32A 2KBFA 4P3OA 3RFFA 1NVXQ 1OSNA 2Z3VA 1FU4A 4WKBA 2KSQA 2V7XA 3P9XA 3FR7A 3LFHA 4TYQA 2RCNA 3QVTA 1RBMA 1FB5A 1XQWA 4R9SA 4IDQA 4OH1A 3IUNA 2CHTA 3L7QA 3A28A 5E6UB 3SJZA 1WLSA 3UYKA 4G85A 4F45A 5ICFA 3UPTA 4C21A 1FNSA 2FKNA 1YH3A 1TT5B 2VDKB 3CW8X 5DBOA 3F2VA 4XM0A 2FZLA 2VI5A 5GAJA 1PF5A 2XCSB 2UXCB 2OQ2A 3CEMA 3GEMA 1WNFA 3PEEA 4D46A 4DIMA 4K8RB 8MHTA 2A1UB 4LYFA 3J80A 1URPA 1ODCA 2E5WA 1AGRA 2MJLA 4GSKA 6PFKA 2R8YA 1NY6A 3B6ZA 1J6UA 3SHTA 1EUYA 4CLDA 2QYTA 2ZEJA 2A9VA 2XADA 3C3YA 2HXGA 4IKOA 3GYBA 2Z98A 2B7CA 1OLXA 3M4JA 1Z15A 2NIPA 3R6LA 2FPXA 4DLZA 1E0JA 4KXLA 4DQLA 4BZPA 2UUPA 1B6RA 3HKEB 3R0IA 1IE3A 2OC9A 3UYLA 2LCFA 3VYVA 3WJRA 5A9SB 2VYNA 5KOJB 5JRJA 2R8BA 1I4LD 3VYRB 4MW7A 4C1NA 4EGAA 2F48A 3FYUC 1I80A 1FTWA 5LMZA 5L6LB 1FXWA 2VSFA 2E82A 1PG0A 1SBYA 4YECA 5BXYA 1Z5OA 2ZPUA 1QYCA 4JP2A 3LL7A 3WO0A 1OGIA 3EIFA 4HVTA 3VZSA 3ZY4A 5CG1A 4ACAA 3U2QA 1C7EA 4BX2A 4C6RA 2VPWA 4H6XA 1M8GA 4XLLA 1WBJB 2LNDA 2OMEA 2RHCA 1ADYA 3H7IA 3SI7A 4AIRA 1W46A 1CZRA 2GN1A 1G8HA 2PWBA 1UMCB 2AOUA 3B1ZA 4GI5A 4HDRB 2QIPA 4LOAA 5JYCA 3GLGE 3A2LA 4G8BA 2GM5A 3BH6A 3P4UA 1ZCJA 2I6UA 5AI6A 3STUA 4M7RA 2VJAA 3ZHRA 3E7XA 1V35A 2AV6A 1XD2A 2QOEA 2D3TA 2GVDC 3W8FA 2IUEA 3LWQC 1SU7A 1CZUA 1GGEA 1IM2A 1N5MA 2ACEA 4HEA1 4ARZA 1XL0A 2BW0A 1YI0A 3ER8A 3BHNA 2B37A 1LQUA 3P9NA 4LZLA 1KYWA 1NZFA 2KJQA 4S1TA 3ZHXA 1DARA 1O0SA 3G8DA 4PYKA 4HRXA 2VHZA 4J0FA 3JTMA 1RACA 1RYNA 2FFHA 2J7KA 2GCOA 2P9CA 4ZZIA 2HS0A 4YUXA 3V3TA 4PYLA 3B12A 3W8EA 2QYSA 3VI4B 2Q27A 1SCQA 2R8XA 2Y0CA 1D4AA 1USIA 3LW8A 4LDAA 3VISA 1K27A 4ZQEA 3UHAA 3R44A 2C5BA 2R5WA 1JEDA 3HBFA 4AVYA 5JNSA 3Q8HA 1KMMA 1MPTA 2Q8NA 3N0VA 3P94A 2XWPA 3CZ5A 3RHFA 4AKSA 2WWGA 1RABA 3L6UA 4E94A 1G8AA 1FNJA 1HNNA 1HFWA 2ZXUA 4MUKA 1UKAA 3L1IA 1TIBA 2E49A 5HP7A 3SDBA 5ENZA 1YR1A 3UBMA 3OVMA 1GSAA 1Z5WA 1QZUA 1P29A 1UDBA 1HSOA 3X3HA 3FNHA 4A7PA 3NDRA 4C0HA 1DTWB 1DUIA 2CL0X 4Z9XA 4HR7A 4HKTA 1QH9A 3HBLA 1ZXXA 4LVUA 3UMCA 3WADA 2N46A 1L3BA 3NX4A 3QUTA 2O2XA 4X93A 1SBCA 3I05A 3RQIA 2A9PA 1RLMA 3AL0C 4Q05A 3C5WP 1P5RA 1IJEA 1JR2A 1FDUA 2CDRA 4GR4A 4E2ZA 2C0PA 3BIFA 3KM0A 1V1MB 1ZI9A 1H1LB 3EGWA 1GTMA 4MUBA 3QVOA 1XZCA 5FWXA 4ZI3A 4OQPA 1P4JA 2AE2A 3CXUA 5DTMA 5AXAA 1UOEA 2RAUA 3G9UA 1MIHA 5EHNA 4CMKA 1G9XA 4U6SA 2QP4A 3ONWA 4XCVA 4KIUA 5AW0A 1DWOA 1E1RD 3H6KA 3VOSA 3KHTA 2ZDQA 2XTJA 3ZDZB 3G2NA 2C4NA 1L8LA 3AXSA 2I7TA 2RGDA 3TF5A 3OU2A 1BYIA 1SUFA 1RQGA 2C88A 3LA6A 2GAOA 3I01A 3KLPX 2WUDA 4FJ1A 3T9AA 4PNPA 3IKJA 5EJ7A 4GQAA 5IKEA 1WD5A 4OQLA 3PTAA 4MQBA 3TQQA 2IUUA 4M1SA 1NW4A 2Y0DA 3CZQA 1GAXA 3QJGA 1ICEA 2H5JA 3FDJA 5K6AC 4NXMB 2DE0X 4CMCA 4KI0A 1E2QA 4BEVA 4E46A 4ZCRA 3BULA 2Z2XA 1XRQA 3V80A 3GLIB 3ZWKA 4ND8B 3I12A 4MQLA 6ABPA 2GOYA 5HBGA 5J5AA 2WV9A 3FKQA 3HG7A 4GKAA 5KYWA 2IL1A 2FMFA 3CJTA 2OHXA 3TSAA 3HWWA 4AY6A 4NL4H 1F7UA 3IT1A 3PPVA 2VLBA 2YYSA 3MT9A 4Q4LA 5DNAA 1L7AA 3D6VA 2FQWA 2ECPA 4ZYVA 1GTG1 3TIIA 3FLEA 3ZYZA 4R3NA 4JZKA 4CCYB 2ALJA 2ZSHA 4HDKA 2EEPA 2JCSA 4TMKA 4UUBA 3I5UA 5J47A 5EE3A 2V6FA 4I0WB 1GPDG 5CLLA 4L1KA 3QJ5A 4G0WA 4ROTA 4C2AA 2W4MA 4O4IF 5DT9A 1NMXA 1W0JA 1EFUA 2CLSA 3PQ5A 4JQSA 3JX9A 3S06A 1KEEB 1OVGA 1XRMA 1UMDA 2BY4A 4MPJA 2ONKA 1E1QA 2HMWA 3I8OA 2WTUA 3M9LA 4GM0A 3GH1A 1T2VA 4PLVA 1H6CA 1T2DA 3KTOA 1DCKA 1L1RA 1V6CA 1L7QA 1KEUA 1AUPA 1BXGB 1FFBA 1MDFA 3HUEA 3KLMX 2PZAA 3ZUPA 3GIWA 2JIDA 2Y68A 4AF6A 1RAHA 1ZN9A 3PSHA 4RLHA 5MHTA 1IHDA 3TR0A 3AP2A 1XCPA 1N3IA 3IKLA 1KO5A 1FFYA 3HUUA 3ZZNA 3TXYA 5CR9A 3Q7TA 1O7JA 1OI4A 3S7ZA 4R0MA 4CHGA 5IMBA 4YY3B 2R4TA 1JKJA 2VTDA 5COBA 3MOGA 1W4CA 2E1RA 5HR5A 4KE9A 1UMBB 5CBPB 3QGMA 2HCJB 3GDFA 3N28A 2OXCA 4O0MA 4YUVA