3VOAA

Staphylococcus aureus ftsz 12-316 gdp-form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
307
structure length
307
Chain Sequence
GHMATLKVIGVGGGGNNAVNRMIDHGMNNVEFIAINTDGQALNLSKAESKIQIGEKLTRGLGAGANPEIGKKAAEESREQIEDAIQGADMVFVTSGMGGGTGTGAAPVVAKIAKEMGALTVGVVTRPFSFEGRKRQTQAAAGVEAMKAAVDTLIVIPNDRLLDIVDKSTPMMEAFKEADNVLRQGVQGISDLIAVSGEVNLDFADVKTIMSNQGSALMGIGVSSGENRAVEAAKKAISSPLLETSIVGAQGVLMNITGGESLSLFEAQEAADIVQDAADEDVNMIFGTVINPELQDEIVVTVIATGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell division protein FtsZ
publication title Structural reorganization of the bacterial cell-division protein FtsZ from Staphylococcus aureus
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 307
sequence length 307
ec nomenclature
pdb deposition date 2012-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00091 Tubulin Tubulin/FtsZ family, GTPase domain
A PF12327 FtsZ_C FtsZ family, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1330.20 Alpha Beta 2-Layer Sandwich 60s Ribosomal Protein L30; Chain: A; Tubulin/FtsZ, C-terminal domain 3voaA02
3.40.50.1440 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Tubulin/FtsZ, GTPase domain 3voaA01
5LP6C 5ITZA 2R751 2RHHA 5IJ0B 5JCOA 4O4IA 5J2TA 4TUYB 1W5AA 3HKCB 4TV8B 5J2UA 1FFXA 2Q1YA 2Q1XA 4LNUA 1TVKB 2RHLA 4YJ3A 4F6RA 5LOVA 4XCQA 4ZOLA 5EZYA 3RYHB 1FSZA 1RQ7A 4X1KA 3ZBPA 4FFBB 4O2BA 4B45A 3VO9A 5M7EA 4HNAA 3JAKA 4EB6B 5JH7A 4TV9B 5IYZB 3ZIDA 1W581 4I55B 2BTQA 4U39A 5GONB 4X20A 5JVDA 4ZHQA 4ZI7B 4O4JA 5LXTA 4IIJB 5LYJB 5CA0A 3JAWB 5EYPB 1OFUA 5IJ9B 1JFFA 5FNVA 4DRXB 3UT5B 5CA1B 5KMGB 5EIBC 4X1IA 4U3JB 5IJ0A 4EI8A 2XKAA 3N2GB 4O2AA 5C8YB 3HKEA 4X1YA 3V3TA 4WBNB 2VAMA 3HKDA 3E22B 3RYFB 5JQGA 5KX5B 3JALB 4I50A 4DXDA 5MN5A 3RYCA 4I4TB 4EI7A 1SA0A 4EI9A 5BMVB 1Z5VA 3WGJA 3JASA 5ITZB 3HKBA 3RYIA 2RHOA 3ZBQA 1TUBA 4O4IB 5J2TB 4IHJA 5J2UB 3N2KA 5LP6B 4YJ2A 5LA6A 1FFXB 4LNUB 3JATA 3JARA 5CB4A 4O4LA 5LP6A 3CB2A 4F6RB 5LOVB 4ZOLB 5EZYB 5CA1A 5MN6A 4X1KB 2RHJA 4KWEA 4O2BB 5MN4A 3M89A 1W5EA 3WGLA 4TUYA 4HNAB 4TV8A 3HKCA 3JAKB 2GVIA 5JH7B 1TVKA 2BTQB 4E6EA 5C8YA 3RYHA 1RLUA 5JVDB 4ZHQB 3RB8A 3VPAA 4FFBA 4O4JB 1Z5WA 5LXTB 1W59A 5CA0B 4EB6A 4O4HB 4TV9A 5IYZA 1JFFB 5FNVB 4I55A 3WGKA 3WGMA 5GONA 4ZI7A 2VAPA 4X1IB 5EIBD 4IIJA 5LYJA 5JCOC 3JAWA 3C8LA 5EYPA 5BMVA 5IJ9A 4O2AB 4YJ3B 3M8KA 4DRXA 3HKEB 4X1YB 3UT5A 5KMGA 2VXYA 4M8IA 2XKBA 3HKDB 4U3JA 1W5BA 4B46A 5JQGB 4I50B 1W5FA 2VAWA 3RYCB 3N2GA 3VOAA 3VO8A 3WGNA 3R4VA 1SA0B 1RQ2A 4X20B 3JASB 4WBNA 2BTOA 3HKBB 3E22A 3RYIB 2R6R1 3RYFA 5KX5A 1TUBB 3JALA 3VOBA 4I4TA 4IHJB 3N2KB 4YJ2B 5LA6B 4O4HA 3JATB 3JARB 5CB4B 4O4LB
chains in the Genus database with same CATH superfamily
4HWTA 1M2FA 2LBWA 1ZCBA 4RQUA 3JVVA 2H0RA 3ETEA 4GPAA 3QWAA 4MJXA 4GSYA 3NAZA 1YL6A 3FJYA 3FLMA 4MJLA 1DIHA 2I34A 4PX9A 3D7SA 5KNDA 5EWJB 2IYTA 2WHPA 3KWFA 3L7OA 4WGFA 3STYA 2V9ZA 4AWBA 3AUTA 3OECA 3E7DA 4TVBA 1XDGA 3VVMA 1Y37A 3G13A 5AW4A 4QOEA 3LJKA 2YWGA 2RGXA 4DUPA 4Y1EA 3Q1KA 1ZNWA 2RGRA 1SVIA 2VP9A 2BM8A 1GPDG 9ABPA 1HYQA 1V6SA 2XECA 3A1VA 2QMEA 2XBLA 1W40A 1Y1KE 3LGXA 2I6GA 4MPDA 3TZ6A 1OH5A 4TSFD 2NNLD 3RFTA 1JG6A 2VTVA 1OLSA 2CXPA 3ABZA 1E0DA 3ZVRA 4PAQA 3GYGA 3O4VA 5I01A 4HVAA 2YYSA 3KJGA 3WLAA 3HABA 4AZ0A 3T1TA 1YBMA 1XRMA 2EKBA 3HV0A 1U2ZA 4AJNA 4DM4A 4F4JA 5EKTA 1RACA 4CR8A 1RJFA 1JQJC 2EKZA 3MAJA 1G7RA 1TFRA 3JQAA 5JSYA 4OHMA 2JEOA 5K3SA 2V0GA 1II9A 1KH1A 2C31A 1EVKA 3GU3A 3K0CA 1U0HC 2EC5A 3NUQA 2QMHA 3CSDA 5JZVA 4Y98A 3NAQA 3C7CB 4BRZA 1CZUA 1XEFA 1XTPA 4FQ7A 3P0JA 2OSBA 3OE7D 2WU3A 2E5LB 2DFNA 4PRYA 3WOHA 3W1EA 1Q21A 4OL9A 4G4SO 3BCHA 4UBIA 2JGIA 3CLUC 3OQ6A 3P9RA 3HUUA 3QXCA 4Q7EA 4V0SA 4DUYB 5M34A 4F6RB 2AZXA 3DBRB 4L0MA 1X94A 4TTVA 2WEKA 1RRVA 1A1SA 1VLLA 1VQ1A 3A14A 1FFHA 2WJ6A 4KRYA 3IPYA 2HHAA 4WVFA 2AE1A 1J5XA 4FFDA 1N0VC 2PVCA 5BV0A 3OQHA 3WYDA 4LVOA 2I9KA 3QTBA 4Q21A 4BVGA 1ZRSA 2RI1A 2FKNA 5ALLA 5F7JA 8ADHA 1NBMD 2MSLA 3GTZA 5I5GA 1V3TA 2BEWA 1NC3A 2OOSA 2RGUA 5ALYA 1GOTA 2IE8A 1G19A 1YVUA 3L6OO 3OTQA 1E5VA 2OV3A 2R7AA 2W2OA 1Q83A 5LBTA 1X14A 5FADA 3VTIC 1VJTA 2O3JA 3SNHA 3WGKA 1OFTA 4EB8A 5J4LA 3F5SA 3LQ4A 2P9JA 1SOVA 4ZZ2A 9LDBA 1CQPA 1LBHA 2WTMA 4LFBB 1ESEA 3WKEA 1GAXA 4BNLA 3BX1A 2WJ4A 4BE9A 521PA 2DUUA 1XRGA 3QEMB 3D6JA 5LZ4A 1E77A 2OKGA 3F67A 2HQ1A 4TKVA 1Z3IX 4BE7B 1NYLA 1KDOA 2CNKA 4Y2XA 3KQNA 4BWYA 3NORA 5A4AA 3R8FA 3W5UA 1E1CA 4PYQA 5AJUA 4I50B 2BFAA 3T3NA 3K35A 4NS1A 1WB4A 5FL7D 1PZGA 3HCOA 3GFBA 3QE9Y 3QK7A 1U8TA 1JLLB 2EQBA 4RPHA 4YTEA 3WP1B 1YZYA 4I1OA 2OV1A 4BO6A 4BB0A 3ESAA 4KZPA 5FBLB 5CH8A 3WAGA 3PG5A 3PF9A 4RK6A 3WFZA 4OO3A 3SLRA 4Y0AA 3HYSA 3UB2A 3JZAA 3GMTA 1FSGA 1ISHA 3F9IA 2KI5A 3SX4A 1ZIDA 1M8KA 3AG6A 2IV3A 3NWEA 2RKBA 4I2VA 5DCLA 3KBBA 5CAEB 5EE1A 3LY8A 4JI8B 4OUDA 4IGAA 1QVAA 1SIBE 2IV2X 3KVNA 2QTMA 2C82A 2E6UX 3GFTA 2ANCA 3AHIA 5AM0A 2GILA 3FFWA 1QBGA 1Z06A 3CVOA 5COBA 5E1DA 5HKLA 2WSYB 4KSCA 2NSYA 1BU8A 2X19A 2I7XA 3K0FA 4P4LA 4DADA 4OI1A 2X15A 1J6UA 4JBHA 3OBIA 2NADA 2I8AA 3HCCA 1OW3B 3E9MA 2YHAA 3QY0A 5CVDA 4ZI7B 1R8JA 4X7PA 3N0WA 4PG8A 4NYIR 3U7EB 4LMPA 1AG9A 4AN4A 1YS1X 2C2GA 4CM6A 1B0PA 3MT0A 4ITVA 1ZUD1 4R2WA 5JZSA 3A6PC 4WXEA 4BO4A 1ZXBA 3C8HA 4PGAA 3TRKA 1GN8A 1G3MA 1QHNA 1WXFA 1Y7LA 1JFVA 3DO6A 4BVLA 1R4MA 4AZ3A 4XTCS 4RHCA 3VKUA 2FMFA 5I9IA 2O0KA 4QA9A 1VHDA 1W36D 2NTEA 2RMKA 3DV0B 3G2MA 3EZXA 1OJ7A 4HADA 3IQXA 1E2MA 3AR2A 4G4WA 1WHTA 3CPJB 3GNSA 5CXUA 2R47A 2VXCA 3CMCO 3NU1A 4CQJA 1MORA 1ZHHA 1SU6A 2KW5A 1R18A 4EHFA 4FMBB 4I2NA 4ARBA 4IIGA 4UUNA 1OIVA 1XBIA 1E0SA 3R6LA 2QEXF 4JBYA 4AMYA 3H7IA 4YP6A 1XMOB 1Q84A 4GQAA 3VYUC 1Q22A 3EGIA 3HEAA 2IV7A 3IEMA 3IR5A 2CHTA 5CCXA 4H7PA 4OJKA 4FFVA 5TV2A 3EORA 1FSPA 1S7CA 2POQX 5LP6A 4NENB 3RJTA 3WNDA 3O1LA 5JR3A 1TLTA 2ZTSA 2XDQB 4RY9A 2PKQP 4W7SA 1X6VA 1T9DA 3RU3A 2E2WA 4ML3A 2H48A 3GRRA 3ZU2A 1BHO1 1TYBE 4Z9XA 2HK8A 3T34A 2ALEA 3CY6A 3PVSA 4J1QA 3TRHA 1T0PA 2ZT6A 3O92A 2F6RA 4TRNA 1WETA 4OHKA 4M0KA 4XFKA 2QK4A 4F5EA 6YASA 1DINA 3AF1A 1QHIA 4J0KA 4AXXA 3A4TA 4LJ6A 3E5HA 2XUIA 2ADFA 2QDXA 4PYKA 4YRNA 4BBJA 3K9FC 3C45A 3WA6A 5CFZA 1T8SA 3AUYA 4BNJA 3QELA 4N03A 4B48A 2IXDA 4GOND 5KNCA 4B2LA 3C2QA 1TIPA 3G6WA 2QL7A 4IGKA 2FOIA 5I9SA 3O8CA 3I2JA 4PWYA 3GRAA 2PLWA 3LLSA 3M6XA 4LBZA 1B76A 3UOGA 1BO6A 2HCTA 3BIFA 2HPAA 1Q7GA 4LWPA 2GM4A 4JI7B 4EX6A 5CB0A 5JIBA 1U40A 1NLZA 2J3MA 4DZZA 4E6PA 4RJ2A 2QF7A 1Y81A 3OC6A 3W2TA 1NLUA 4TTIA 3SYKA 1RFLA 2ZXUA 2BJHA 3BTOA 4WKNA 5FWYB 4HXFB 4M1QA 5EJ7A 4RDHA 1R88A 4NH0A 5HEKA 3M6VA 1J25A 3WL4A 1ZJWA 1J2RA 3EFBA 1JEJA 3RRJA 4RAQA 4BTVA 4KQIA 1IB6A 2AC7A 4CTNA 4BNNA 3CNBA 2G3YA 3O9MA 1EAMA 2O07A 4L0QA 4ESOA 2D6FA 4GKVA 1WNFA 3WRXA 4PYNA 3QXSA 1P39A 1PBNA 2GARA 3OQ1A 4MDHA 2VPIA 4OGLA 3IEIA 4JROA 1ZM4A 1GRQA 2CXOA 2QX8A 3AUKA 4UBKA 5AI0A 1PEAA 1OWOA 4FNGA 3IR6A 1ESMA 1PQUA 3SHFA 4W8OA 1UP6A 3AY7A 3GXBA 4M9ZA 3HXTA 4YJ2F 2IIVA 3RUFA 4I9UA 4FI3F 2K1SA 3D5TA 5EJ4A 5KB3A 1N8TA 2FG6C 3VSAA 1T3GA 1M6HA 3FNIA 4GVPA 5ALGA 1HMYA 3DT9A 4IDNA 1IPFA 3WWPA 4JP5A 5JAQA 2XCLA 3OZIA 1CJSA 3PXCX 5AOBA 1JSZA 3FDIA 1XZBA 4DIBA 5K0FA 3Q8XB 3CCRF 2UYYA 5F2NA 2F3TA 4GG1A 1O7JA 2WKPA 3LM8A 2D4HA 2C2OA 5AP9A 1T9BA 1I2CA 2C4WA 3EDOA 4A23A 3V8NA 2IU3A 4V0QA 4KMSA 2XGOA 3T3EA 5I7EA 5E7JA 2Y6UA 2HH9A 3BXPA 1BHJA 4Q4JA 5AJTA 4D80A 1VLVA 1OX4B 2B8JA 4FZJA 4WCDA 4E08A 1KIAA 4OQYA 3OESA 4OXIA 3QWBA 3DE7X 3U37A 4ABTA 3ELWA 1G21E 1AHPA 4JI0B 2XOKA 3UAXA 4PXYA 1VIYA 4OYHA 4K81B 1E5LA 3UYLA 4N7BA 1FVFA 3N2YA 2SCUA 3VSEA 1E2FA 3IE2A 4U2CA 3FYSA 3WP0A 4K87A 4MP6A 2BBTA 3I61A 1VI5A 3O94A 2V0NA 4TRJA 2P4HX 3FFBA 4H0FA 3DF7A 4KREA 3SQXA 2FU5C 1ZSYA 2OXCA 2WJAA 3B52X 1I3NA 4JLUA 4PIPA 3Q3EA 3GGOA 4KQFA 1CDDA 1GEEA 4NYJQ 4F5ZA 5A9RA 2QY9A 1IHXA 4EJSA 1GADO 1YHNA 1NQXA 4UEJA 5FQNA 3SBXA 2RHJA 3ZI0A 1KO8A 3BORA 2CHVA 2FPXA 3I9JA 4UHKA 3AVYA 1KJQA 1N2JA 1W2GA 3R3VA 2FF5A 3PC7A 4DMGA 2BFPA 4A8PA 1T6XA 3EG5A 2VJYA 1YRHA 3WLRA 3MQ4A 2W11A 3A58B 5F7XA 5JDIA 4QODA 4D92A 5EJIA 1FVHA 4BQOA 1GKLA 3CBGA 4G67A 3TG8A 1QB7A 1XXHA 2X9QA 3D3WB 2YJGA 3JW8A 1FA9A 3E4DA 2FP4A 2PZ8A 4JT9A 4W9NA 4ENUA 1TZJA 5IT5A 3ZJTA 2KE5A 1IAQA 3JZIA 1JHPA 1IN5A 3JQ6A 4IG4A 3LQFA 4FYJA 2MWMA 4Q4LA 4I5DA 4B3FX 3PLAE 1YT5A 3QH4A 2M6RA 2XUOA 1B2RA 1Z2EA 4JQOA 1KY2A 2CL6X 2PRSA 3CW2A 4LJAA 4QGFA 1R1DA 1MZPA 5B58C 2DR2A 3C87A 5IC4A 3EVDA 5SY6A 1I3OA 3FLBA 4BE4A 2OQVA 1WP9A 3EJ6A 4YCJA 4X20B 2AOTA 2Q3CA 3SKYA 3UXYA 1KZ1A 3KFLA 4E4YA 3GBPA 3WBFA 2BPOA 3SN6A 4D1YA 1THTA 3I6BA 4QXPA 3SSOA 5LB4A 4YMVA 2RK3A 3M1XA 1NX9A 2BN4A 2PGJA 2ZRHA 3KALA 4WN9B 4EA8A 2GCOB 2AD1A 2D5LA 1W30A 1RHJA 2QLBA 2F1OA 1Y80A 2RJNA 3TSYA 4ID3A 1AU9A 2DG2A 4X71A 5ALWA 1IWOA 3W79A 3L1KA 2QTZA 2A5GA 4J0HA 1F3OA 2BMJA 3HJAA 1DTSA 2CUZA 3A1WA 4KDRA 3TOCA 2GTPA 3TNFA 1ZLXA 2NAPA 3BB4A 4QU5A 1N6PA 3QFHA 3N6VA 4LMAA 3NTQA 4MEBA 1I3LA 2VJMB 4QDZA 5F4BA 1IZYA 3AVWA 3UY4A 1GZ6A 2ZJFA 3C6QA 3DNMA 4GU5A 3GLVA 1A88A 4W1RA 4R1NA 2CW5A 2WWTA 4CV1A 4WJKB 2AJLI 5F1OA 3ZV6A 1XZKA 5AVTA 3LXXA 1PK9A 4HFMA 2AI1A 2NUTA 3FYHA 4OJNA 3EN0A 5A3RA 3IHTA 4R31A 3ND8A 1OFUA 1XLWA 2OR3A 3TPFA 3UT5B 4ZT4A 3PXEA 4MYCA 3BILA 4KXQA 4R8SA 3ZEAA 1KZHA 4ZCIA 5DTQA 2YFYA 1SEPA 4Q47A 3ZY4A 1H93A 2OXRA 4PTZA 3TL3A 4FE3A 4RANA 3X1KA 4K6CA 4JR0A 1T0UA 1ACLA 3ZI7A 1M1UA 1FNSA 1GA6A 1YA8A 4B82A 1Z37A 3GLIA 4JP1A 4ZD6A 1TDJA 4OH1A 4A73A 3PITA 1V0JA 3ABOB 2KM1A 4OHVA 4PO3X 1XEXB 3BIJA 3H87A 1YS2X 2TYSB 2IGTA 4BWGA 1KC3A 2Y1CA 4B47A 4UTRA 2CVZA 1QG2A 2IK8A 2IXTA 2ZB7A 3N2IA 1K8QA 3OAAA 2PXHA 3M3PA 1CK4A 3VOTA 1AHHA 4TWIA 3CB2A 1FCJA 4NCIA 3Q98A 2JHFA 4WBSA 1VE7A 1LLQA 2F9MA 2PX8A 2F43B 4KWEA 4GM1A 5FJJA 5FV4A 2QW1A 4IIEA 3OE4A 3TL2A 2C57A 2VDWA 4UBMA 3TCNA 5BSEA 3JAMA 3HKCA 2WFLA 4FHDA 2LCQA 2BMEA 4HNSA 5AVWA 1GLNA 1W2WB 3IXMA 4EKYA 4QNRA 2ZQZA 1IBRA 5FLYA 3CB4A 1OCEA 4RFSB 2XQGA 4GPTA 1GQYA 5C1BA 5J4HA 2XHZA 2IXEA 1ZMOA 4P98A 3AFHA 1QHEA 3RU2A 3FOCA 1WHSA 2IZZA 2WP0A 5AVQA 3I32A 1Z4MA 1XTVA 5LLSA 3OZSA 1L5ZA 1QTRA 2G8NA 3VRHA 3GAAA 4B4OA 1T9CA 1BGWA 3QU7A 4CTMA 5CXQA 4F3NA 3GLFB 3GRZA 5LYJA 1IMOA 1OXVA 1Q2XA 3W8RA 3NYRA 4CKZA 5AVRA 1ZM7A 1JZTA 1XQVA 2XNKA 3IKMB 4NEHB 3TQOA 1J9GA 2WVGA 3S0HA 1MV8A 1LX7A 2QTNA 3OIDA 5KOYA 4JI5B 1VPWA 1VPEA 1TZ2A 1W6RA 3G2IA 1XNGA 3OFKA 1HNZB 2R5WA 3RRFA 4ID9A 3DB1A 4YJHB 4P7FA 1I8TA 2WIFA 2ETXA 5C32A 1NN0A 2VHCA 3AF4A 1ZNQO 1MMFB 3I55F 3OZEA 1GZHB 2A5LA 3IAM6 1QHFA 1PG0A 2IUFA 4Y1GA 3WGIA 2GKSA 3VHXB 4JN6B 3EVBA 3RABA 5HSGA 1UBUS 4C81A 1P1RA 1BVYF 3P8ZA 3TTUA 4XYLA 4ALNA 2CWWA 3D54D 4REMA 4BX0A 4CT4B 5I48A 1DGQA 1BWRA 1JE0A 3PDJA 4M9SA 5HIMA 3T9BA 5LQRA 4R8KA 2C98A 4R2XA 2YDYA 3MS4A 4S2EA 5LP6F 3E20B 2HWKA 4JLOA 4O33A 1NVWQ 1RWKA 4KEAA 4YUAA 1Q0UA 4CKEB 3T7CA 4CL0A 1K5PA 1RM4A 2CB9A 4BO5A 3HEMA 1USIA 2GB4A 4FNAA 4AJOA 4TV9F 3G6KA 4F9TA 4MWZA 2QP4A 3E03A 3HRHA 1EVZA 4O4JA 1PKXA 1TCCA 1MAHA 4M54A 4UNQA 4XH9B 5TEVA 1RWNA 1PNVA 4L15A 1YU6A 2KWIA 4CG0A 1IG3A 1N75A 2KSQA 2QTVA 2QTAA 3O1HB 4QU9A 3K7EA 5CP8A 4ENVA 1NRWA 1IOLA 4YT2A 4YMTA 1QAOA 1YR2A 4IQ4A 3O84A 1X70A 5K8UA 1ZKMA 1CPYA 1SEVA 2YJ6A 3R2JA 4KE6A 4UBNA 4D97A 5JEEA 1Z3CA 3QYJA 2Q5FA 5BW8A 3K70C 2VBCA 2J4CA 4JZYA 4KW7A 3HNPA 5HKKA 2IS2A 3K2XA 5K0EA 2NWQA 5AT1A 1FJGB 5F12A 1OWPA 2VH2A 1EINA 2W6PA 3VTFA 3Q0TA 2II6A 3SHTA 4DXDA 3E1YA 1ISRA 1EFDN 1FUKA 2ZYRA 3DKRA 4YAOA 4RHEA 1PRYA 2IHJA 3DFUA 1HK7A 1WDTA 2Y1EA 6ABPA 2C20A 1U2TA 4H1HA 1E6EA 2FX3A 3BERA 3DCIA 1XQXA 3VFDA 3WVNA 3K0AA 3B7PA 2GBGA 5KTMA 1USVA 1WE2A 2MIIA 2ZT7A 3PWTA 4L7QA 2B6NA 2ZJ7A 4FGJA 2A1TS 4O4LA 4WADA 4AQYB 3RU7A 1IBLB 4EA6A 2P8SA 4B35A 3GHZA 1E9FA 4TMXA 1IV1A 1H5QA 2I6QA 2RGYA 4RJKA 4XGQA 4F9GA 2BGNA 1WS6A 3KKOA 3PFFA 4UXHA 2ZRIA 4FOPA 4BN0A 2VOEA 3ZZ0A 1AKQA 2GZMA 2J9ZB 3KEOA 1ABFA 4JK3A 2FGYA 5B3JA 4H1UA 3NXKA 2A86A 3NGXA 5CFQA 5JVDB 1UFVA 1P75A 4OYYA 3AQIA 3IKEA 4JYBA 1KNXA 3O74A 4MGKR 2HHJA 5FWDA 3VTKA 4MVJG 2TMGA 2VLBA 4KO1S 3E7PA 4UHDA 4BFTA 4BZWA 2GRAA 3JD0A 3CZPA 3KE9A 3QBEA 4OD0A 5HY2A 4ZZ1A 1FP4B 1K3UB 2R8PA 3QWIA 1RXCA 1L4FA 5IDVA 4NCBA 4CL3A 1Y6FA 2I3GA 5IT9M 5F9MA 1EXWA 2VPWA 3LDGA 3IYLW 3K92A 2NO7A 2NTVA 3F47A 4IS3A 1E2IA 1ADGA 1LH0A 4R81A 5DBIA 1YRWA 3CCEF 4HAXA 2V59A 1YMVA 4JFRA 3EEIA 3RHZA 1AKYA 5KC8A 1GCUA 4Q9KA 1P73A 3DAPA 1S8OA 4GI2A 1XZJA 3M0EA 4HZUA 3I9FA 3CUYA 5AI8A 4ARCA 4EKNB 2CHFA 2PWYA 1NWHA 3HCDA 4Z9FA 1E3DA 1G17A 1MHTA 4LJRA 2C58A 4R5HA 3WRWA 3FD8A 4L9RA 3Q7PA 4K1LA 3V80A 4Y2TA 4D4IA 1BDIA 3GFFA 3BZUA 1AQYA 3KYDB 5AFSA 2D1TA 2OTCA 2PX6A 4Y0NA 4QFMA 3HH8A 3BE5A 1Z7YA 3FDZA 3KOOA 4P4NA 5HIAA 2VK2A 4OMDA 1EUQA 2AFVA 4YJ3A 1C1HA 2P9CA 2VHQA 2D8AA 3ASUA 4JB2A 4TSRA 1BS1A 3F6MA 1QO0D 5IT9A 1SZQA 3TNLA 1Q2UA 1XN4A 3HCNA 4W9MC 4B81A 8MHTA 3IDAA 3R1IA 4XEHA 4P5PA 3U56A 4MMYB 4OQXA 4BP9A 3K6SA 2Q1UA 1GZDA 2ZYIA 3A28A 2Y1OA 1T5HX 3P2YA 4H7FA 1I4WA 2NTJA 4ISCA 4YO7A 4I3GA 1SQSA 3C6KA 3AUJB 4DQKA 4NFHA 1GCOA 2JAOA 1JDZA 2EG9A 3I6ZA 2P79A 4A0RA 1G5RA 2XGMA 2JFWA 4QVIA 2A88A 3E3MA 2FPGB 3F5QA 3HCRA 4TRMA 1JBQA 4YMSA 2HHCA 4GX2A 5E9JA 3UV7A 5KVVA 3BWYA 4ZC1A 1RXEA 5GINC 1Z6GA 3NIDB 3WKAA 1RPNA 1YCGA 2JCXA 4NJOA 3LQ2A 4CKYA 4JVLA 2NSHA 1OWNA 3IQIX 2JBHA 1I0IA 4AJEA 3W8NA 2HO5A 2BFEA 4PCAA 2GN2A 4BO9A 1IQUA 1WABA 2HCJB 1U6JA 3D2BA 4PIMA 1T5LA 1TQ2A 5JISA 1KEEA 3KKPA 3OIYA 1KMMA 1PI3A 3LFTA 4PGHA 4LECA 5HY0A 1SWVA 4D02A 3OE5A 4QEKA 4MROA 4DV3B 3IOEA 4XGRA 4E5NA 3D8BA 2JIRA 4LZLA 1JJ7A 2OK8A 3IH5A 4EB0A 3DEFA 3EA5A 1K66A 4UPVA 4MYUA 3GDFA 5FF9A 3F3KA 3MELA 3SY8A 5K01A 1ULHA 4UZEA 2WABA 5A2GA 4QBKA 5JAIA 1XKTA 3GB9A 1DHTA 2FW6A 3W5HA 1WM1A 2IUTA 4G23A 1ZUHA 4PNEA 3AGPA 2WU8A 3BB1A 1T91A 5M04A 3L6BA 2O23A 4LDPA 5BVHA 1UKYA 2F1HA 3MMNA 5KVAA 4D9JA 3A2KA 3ZCPA 3B1VA 2IYRA 3ZDYB 2WV9A 2IHYA 1P60A 2H4JA 3NTRA 4IUCS 1WUKS 4LI0A 2ZBRA 1RCUA 1KC8H 4D9CA 2BTEA 4GOXA 3BPSA 3SZLA 3VV2A 1WAMA 2Q8PA 3NAMA 1JLMA 3CWCA 4KLRA 4CTOA 5E9QA 3DAGA 4ARZA 4QJBA 2JB9A 2H8CA 2FZEA 3A7EA 5GVSA 5YASA 3I58A 2VYVD 3LYAA 1P2UA 1UC5B 1MP0A 2Z08A 1D6MA 4L57A 1E4OA 4IKPA 1KOLA 3KR9A 1BDJA 4DKJA 5JI3E 5DXJA 2WSSD 2G1KA 1CZNA 3MWGA 1G64A 5EJMA 4DYHA 5F1YA 1IZ0A 3CX7A 2BGRA 2BOVA 2DHRA 2YBDA 1CB7A 3ADPA 1C3OA 3KBOA 3PXUA 3LYHA 1A8HA 2BKEA 4HWKA 4L5IA 4BX9A 3WMFA 2DZDA 1E79D 1VKRA 2HSGA 1GPBA 4JD5A 5HFNA 2GJ4A 3T38A 5JANA 1QFZA 1NRIA 4BFYA 5HA5A 2DE0X 3N0VA 5FWAA 3V7YA 3ZV7A 4FR2A 2IPAB 3VOBA 1QX3A 3KAQA 4I9NA 1ZN9A 4IMIB 3WKCA 4Q15A 2W42A 2W6OA 5CNJA 1YL5A 3WKBA 2WOJA 3KUKA 5AHRA 4EELA 3A37A 2HV9A 2IYWA 1W73A 2NPIA 4PC1A 3R76A 4C3OB 2PZJA 2Z1FA 3E8XA 4YR7A 1PFGA 4HYTA 2OUIA 4GI5A 3E3LA 2IHBA 2ZRKA 3G0DA 5AK3A 3N2EA 1NMEA 3VR1A 1FMJA 2R8BA 2J85A 3S7TA 1XD2A 1HYBA 1KY5A 3CUUA 1XCOA 3G9XA 3H6HA 3HZZA 2XD9A 3SS9X 4D45A 5DJ5A 2Q3JA 4PO8A 5FULA 4U9UA 1I1HA 3IJEB 2O2GA 3O3CA 3SLGA 4F8EA 4BLRA 2LP4Y 1FMLA 3AJAA 3N0XA 4GDMA 4K6FA 2XAAA 4HNRA 4GZ3A 4W99A 4Q05A 2DM6A 3SS8A 1NXWA 4J1NA 1G2QA 1V26A 2N42A 3OFSA 1UCFA 4O3FA 1B73A 4PO1A 2IHKA 3BF8A 4BJ5A 5A1JA 5AM2A 3VYSC 3DE3X 1QIJA 1IXSB 4QO8A 5DNVA 3LUJA 4L0DA 1KYTA 4Z2YA 1Z28A 1D6NA 2N75A 3QNUA 3OSUA 4EHLA 2VPQA 3AF5A 4FHZA 6GPBA 1WZIA 4DSAA 3HCWA 1SG0A 3P0RA 3F6RA 4JXKA 3P19A 4TKUA 2E55A 3WNQA 5LYJF 2PLNA 1H69A 2W5UA 3F7TA 4OFBA 3TX6A 4BVHA 5F23A 4RZSA 3MW8A 3RQIA 4EATA 3OQMA 2V96A 2CXHA 3MZ0A 5F64A 4QOIA 2EXXA 1JY8A 2I6TA 2VRBA 3OPYB 3NV9A 5FR1A 2AXPA 4ZDJA 3EA0A 2XVXA 1JH8A 4RPJA 3EGXB 4AWAA 1KDPA 3FLEA 4FMCF 4F4DA 3ID6C 3Q3IA 1GDTA 5JAMA 1VMKA 1M7BA 2HL6A 1X80A 5H3LA 1HG1A 1XE3A 1M2HA 3D6MA 1L7QA 3MBIA 3K16A 4MAMA 4ME6A 4BNYA 1L0BA 1L3IA 1IPHA 4UD2A 4ZHVA 2YMPA 2OFPA 2IP4A 4LY3A 1NDHA 3D4PA 4BVBA 5KREA 4C0XA 1B1AA 1S9DA 3Q6IA 4GW3A 1RIIA 1JT2A 3RQSA 3NBKA 1E32A 3MM4A 3Q4GA 3QVTA 4OQPA 1P5JA 4PPQA 2FSSA 4C8IA 1M0WA 2P65A 4Q9LA 3ZLUA 3UXMA 3G3EA 4E2WA 4BJ3A 1NQTA 2VP5A 4H3KB 3RSQA 4IUBS 4K9OA 4NECA 1T6NA 4JITA 3YASA 1T36A 4OQMA 5GONA 3I72A 1N2XA 1O9BA 1HG0A 5IZ4A 1H9CA 4K3VA 3W2GA 2Q29A 3EOZA 4KACA 5K8LA 2XMSA 1CYEA 4DNQA 4RD3A 1U63A 4XCVA 4X91A 1OGYA 4O4JF 2F3SA 1SCUB 2PWAA 1E9RA 1E0JA 2VDKB 4GUDA 5CR9A 1VLZA 3R74A 2N3ZA 3CLTD 5FXMA 2WD8A 4KRGA 1F6WA 2PZEA 3ZWNA 4CQMB 2H4HA 3G0OA 2OV4A 3PQ2A 4QQFA 2VRCA 1B6RA 3MTBA 3HJFA 1P6UA 2CLHB 3RPEA 3OMWA 3KXLA 3RSHA 2HRDA 1W4CA 3GP3A 1U9IA 2XB8A 4U9IS 4C0AC 2DQ4A 3SIWA 3JVUA 3IEUA 1JHRA 3PJFA 1OI3A 2LW7A 3NHAA 5KYXA 1A2QA 3K53A 3ND9A 3SP1A 1EM8A 4D8WA 1JHOA 1A5SB 3I34X 1TKBA 1LDBA 4EHDA 3G79A 4ZEWA 3O9VA 4C03A 4X64B 3TQQA 1N2IA 2UZ4A 3ERNA 1CHDA 2IP1A 2JJ2A 2NZVG 3FROA 4OXKA 2IBMA 3AYXB 4ZYLA 1Y6RA 2IXAA 1GPWB 2FW7A 1RBMA 2Q27A 2CLKB 2B35A 2EDAA 4AN1A 3OJCA 1I7SB 2GZHA 4XWYA 4MRMB 2A3RA 1JAIA 2QTRA 3ZZNA 2Q6OA 2G07A 2ZOVA 1QVGF 4O4LF 3K9LA 1A9SA 4JU9A 2PE5A 3AVVA 1SXJA 5IYZB 3E9YA 3C41J 1E2UA 2HREA 5DM60 2OUKA 4EF6A 4KIGA 4UHHA 1GTG1 4M49A 4U39A 3TAUA 3UT6A 5JYBA 1CR6A 1ZNZA 3EBLA 1CX9B 2VJBA 2BD0A 3DUWA 3PKIA 4S05A 2ZIEA 4X97A 1JEOA 3IP1A 1C3JA 2WSIA 2AA3A 4DS3A 3OEWA 2QN7A 4H31A 3EXAA 4HUQB 2YXNA 4RHYA 5K5EA 1QIHA 2X8AA 5FUXA 2Q5OA 1ILEA 1LDGA 3KNZA 4YAFA 5IX8A 2VSNA 5KQGA 1N2CA 5AI4A 2QPAA 2WBLC 5EIHA 3QVKA 3AFMA 1DS6A 1NUPA 3EPLA 4B4WA 4CMEA 3PYLA 2D2IA 2Q9UA 4OHUA 1P44A 1JAYA 2GAFA 4OK3A 4HMOA 2PMDA 1R8SA 2WG2A 1K6MA 3U6KA 2WZDA 2G9IA 4JC5A 4NX2A 2ZSBA 3N7UA 5AXAA 1DBFA 3AIIA 4HJRA 2VHEA 3TLKA 4DC0A 1XNRB 4IOMA 3WGYA 1OBOA 2ATIA 2B4KA 4OU5A 1RWXA 3HDGA 4KR6A 1Q20A 3KQHA 3IDSA 1C4WA 2BEJA 4MUNA 1GEGA 2DQKA 2YWCA 2IYYA 1C9YA 1JI0A 2CL0X 4FOLA 5FYDA 3K1ZA 2D7CA 1FFYA 1O58A 2AYZA 4YI3A 5FT9A 1XD9A 3GZTB 1XR3A 1Z0AA 4G63A 4ZIRB 2JCGA 3DAYA 3C5EA 4IXTA 1B8UA 1HDXA 5FTNA 3K9NA 1JU4A 5T4HA 3IVMA 3Q6MA 4Z54A 8GPBA 3ZWOA 4TT8A 3M6FA 4OYLA 1G4AE 3BA1A 3MB5A 1U7UA 1ORHA 1X7ZA 4MQ4A 4XASA 3VXKA 1DCMA 3P2KA 4EIWA 3U4QB 4MULA 1XDBA 2WD9A 4YJ3F 5L40A 4CNQA 3WE7A 1E3WB 2J6HA 3H75A 4UVGA 1LI5A 1K9VF 1JJIA 1PL8A 1PZNA 1TCBA 3FFXA 4M0DA 1V3UA 4QECA 4C6SA 4DC9A 5CCEA 2Y8EA 5ARCA 1PGJA 1JSLA 1WIWA 1Z4QA 3D2CA 3ZQJA 1U3TA 1EP9A 3U1BA 2V7TA 4N3CA 4TS1A 1T1SA 3PC8A 1WCWA 2DFVA 3AIMA 1DIOB 3Q9SA 1AT1A 2E4WA 4HQNA 3PPXA 4K03A 5DI3B 5DLEA 1XEWX 4XJXA 5KQPA 1NE7A 1Q74A 4FT4A 4X41A 3EVAA 5LVAA 3DE5X 1B3RA 2C7PA 1OXUA 2PKWA 3P2IA 1O1YA 2QENA 1ZMXA 2JGEA 4UCFA 3R9KA 1RI1A 5KBYA 1T34A 4XB1A 2ZJ2A 5DISB 3GNQA 4WH0A 3UH0A 5G2OA 5ADVA 1XI2A 4OEHA 3IOBA 1P7PA 2Y9PB 2CJFA 5DYTA 2G4LA 5TPWA 5EJ6A 1RP1A 4DA7A 5FOWA 1L8QA 1NMZA 1YMUA 1D6SA 2MQEA 1LZKA 3MD0A 3HJCA 1XRJA 5H8WA 1U8ZA 1D1TA 5JO0A 2EW2A 1NF3A 3BMOB 3DGFC 3OU2A 1UQRA 4TMFA 5KINB 4JQYA 4FUQA 4F04A 4HP8A 3I01M 3AVOA 4JT8A 3T7KA 2OZPA 4GE3A 4LNUA 2HT6A 4NAUA 2I4NA 2VP2A 3C3YA 2BFNA 1UC9A 3F49S 4BFUA 1SVSA 4GAEA 3TE7A 1WUHS 4LXIA 5EIEA 3VR6D 3MT7A 4AKIA 4I08A 3QMVA 4WKBA 2G71A 1XHLA 2QQEA 4NBWA 3EE6A 3TZEA 4BO7A 4PCLA 3X2FA 3F0TA 1PS9A 3T1QA 2VHVA 3NTLA 2FFBA 4WEQA 2FR1A 3IMCA 4MPPA 1W46A 2PFKA 1ZOIA 3VI3B 4R71A 4E1VA 3D5QA 1Z18A 2BM9A 4M83A 4EECA 3EIOA 3SE7A 4MR7A 5IXSA 3R7LA 2FDXA 3E2PA 3H3JA 3VBEA 4LAFA 1N9GB 1TU0A 1Y82A 2DQZA 2Z0MA 3DSRA 4BGUA 4CU2A 4D6XA 2C2ZA 1MAVA 3PYMA 2JF0A 3ZHXA 4NZZA 4ZC8A 2ZWIA 3CTMA 5KYYB 4X8OA 1LS1A 2HY7A 2X5OA 2PQ0A 3WLFA 1LSUA 4N7RA 3WLJA 2X3UA 4DJ5X 4IKOA 4DR7B 3OD5A 4CIVA 2Z4RA 4KDFA 1SIWA 1ZK0A 2NQ2C 5DYNA 1Z4NA 5JBQA 1YITF 3I01A 4X65B 4COKA 4HN9A 2OTJF 4QG7A 8LDHA 4XM2A 2VEDA 1RM3A 1SD5A 1UH5A 1YZLA 3MK31 3TUIC 1GTL1 4GRDA 2WMDA 5DV9A 4C6HA 2QUKA 4YGXB 4F2HA 1Z0FA 4EI9A 2YCLA 3EZNA 1YI1A 4BDTA 3H9CA 3U9SA 1ZHOA 3RGWS 4JL6A 3RANA 3EHEA 4FILA 2R85A 2IEAA 3BTSA 3RYIA 3BRQA 3R3UA 2C5HA 4DYDA 3DHEA 2H8KA 2G4VA 2F48A 5DMXA 2JCSA 1ECPA 3WC4A 5KYKA 4L2IB 1ADFA 5G0VA 2D7DA 3OEHA 2QM8A 2OORC 4ETNA 1J1UA 1M6NA 3ELBA 4LHXA 4FB4A 1J39A 1U3WA 2UYOA 1TAUA 4IQ8A 3EVCA 3O4FA 1RKUA 2OBBA 1JMKC 2GFIA 2VNJA 1VIMA 3BHJA 3KPJA 5H81A 2B8NA 3T61A 1GGNA 1VQVA 1SVKA 2Q21A 4HPJB 5E6SB 3TOVA 5BMOA 4TM8A 5H70A 4I5GA 7REQA 1PLKA 3A0UA 2NXEA 1YK1A 2Q3FA 3IP8A 4KNVA 1TVCA 4MQBA 1WD7A 2VK4A 5CA0B 4YQYA 1P4HA 2J31A 4RXTA 3VX4A 1PYOA 4LF6B 3V42A 3W6PA 4RK5A 3S2IA 2HNKA 3WQRA 4I4IA 1RYDA 5EJ9A 1JKMA 3MJCA 1VJRA 3U0OA 1Z0UA 9LDTA 3BYZA 2J8ZA 3K5WA 1JS1X 2PZKA 4IRMA 3O8DA 4M8LA 1J0XO 1E2LA 1PJ3A 1SG9A 2QWXA 2V5AA 4WY2A 3AOEC 3SYRA 2OM6A 2QL5A 3EDCA 3Q40A 4RVCA 4EHNA 5LD2B 1RJ9A 1VHJA 1B8NA 1ZEJA 3ZW7A 8ABPA 3FZNA 3WGTA 5CW2A 1EJ0A 3E7FA 1VXRA 3OFNA 4DV6B 2QBYA 1POWA 2VUHB 2WFMA 1L7MA 2C9YA 2JJQA 2QQFA 4EFNA 5JJKA 2CHSA 3PDHA 4N82A 4UUQA 5M3BA 1OFIA 4QYIB 3VV3A 4BMSA 2REXB 2CVPA 4KXYA 3KKKA 4P7GA 4RJIA 5AKGA 3GJ7A 3IVGA 4UM8B 2W22A 5FFFA 5FIUA 3SYNA 4CTJA 3PICA 4HV4A 5EJEA 4G1EB 2E7ZA 3SBEA 4NBNA 5JMWA 1JR4A 4I4TA 3BFPA 2KGWA 3EXHB 4ZA2A 1M34E 4RESA 3ROQA 2GCNA 2OP0A 2I66A 4TSFA 2ZKIA 3IS3A 2R86A 4UARA 3LECA 5C31A 4E51A 1QH1B 1X7XB 4J4BA 4P3XA 3IMFA 3NX4A 4LEIA 3HYRA 2GYUA 1T0AA 3H4MA 2VZ8A 4M53A 3ROTA 5K7SA 5IVHA 3B82A 3CC8A 4F5WA 1LV8A 2EJTA 3LQQA 4UE2A 5BP7A 3V1KA 1Z7WA 3W3AD 1A7KA 1SKBA 3NVKE 3HSSA 1JV2B 3P45A 2K2QB 2V6GA 3N0TA 1N5RA 1A82A 3PHCA 1CVLA 4A3SA 1F6BA 3U1TA 1QVZA 4RADA 1EWVA 3WQQA 5CYGA 3TSAA 1IIBA 5F5NA 2BKAA 1DT9A 3BTUA 1UEXC 1MIOB 3F71A 1EGHA 1VMAA 2BKVA 3DR5A 4Q9NA 2AJDA 5JS8A 5L3SB 2AZMA 2VIIA 2ZIXA 4BLSA 5KPDA 5G02A 2GZLA 1SY7A 3DUFA 3HB1A 4X60A 1QPGA 2OESA 4B7CA 2R6ZA 2I7VA 3GEGA 5CVJA 3P9KA 4J7AA 2DBQA 3FMIA 3W6ZA 3VPDA 1LWOA 5CT5A 4CKCA 1ZFNA 4CEJB 2H00A 2NNWB 2FJ0A 2JIBA 3WWEA 4HI0E 4YMIA 4ZOCA 3D43A 4AG5A 4CMAA 1HTTA 3OP4A 5COAA 3E22B 2ZWPA 3ONWA 5BSGA 1AGRA 1HEIA 4L4SA 5LOVF 1M76A 2Q6LA 4NOKA 4QM7A 1VIVA 2OCIA 1CY4A 2O6HA 2OHHA 2NX2A 3CYPB 1ZIXA 2XMRA 1NBMA 1XELA 3GGSA 2GEKA 4MH0R 4UVIA 2JGMA 1H1TA 2QT1A 1F0NA 1PF7E 4IBOA 1R12A 4CHTA 4J75A 1KFEB 2UZIR 3TINA 2P30A 4ZI3A 5J1SB 4KKXB 4NHOA 2XMDA 5TGTA 2Z1UA 4KC0A 1LS6A 2JFGA 3HVKA 4EY5A 3MGAA 4LSMA 3PGLA 1FUIA 1MO6A 1LLUA 2VF2A 5BSMA 3R5SA 1XOIA 1PJ4A 5FD8A 4AX8A 4P08A 1NUUA 2VZLA 4H27A 1N6NA 2HI0A 5A3SA 3P2MA 4LSWA 1JR3E 2C0PA 1V4NA 4MWEA 1V8BA 3UJ3X 2C97A 1JHDA 1J2EA 1MOSA 5AR1A 1ZEMA 1JUDA 2YL2A 1XPRA 1HXHA 3B5IA 3KKQA 5GZ1A 4DLSA 3G2LA 4BVFA 3QQ5A 5FL7A 3TLEA 2UXDB 4EY8A 3DLCA 4ZAZA 2RGWA 1NLMA 3O95A 1GLVA 4QWMA 2PMKA 4V03A 1OLXB 1JL3A 3EQ2A 5TQ0A 2A4KA 2BHSA 1SIUA 3DBIA 4X3MA 4ND8A 2HGSA 2V8OA 5EIBD 3GPBA 3K5IA 3GXOA 3U4MA 4BGEA 1UT5A 1RNLA 2QY6A 2C5EA 3KXPA 1XA0A 4QPPA 1GKYA 3TE6A 3ZDBA 4KQMA 1W42A 4JP2A 1PD0A 1IRIA 1DELA 3HCPA 3RC7A 3TRDA 4EOGA 5LD2C 3EHDA 4KQXA 5CBPA 1G20E 4FCWA 5LC1A 3W8EA 1T5BA 3V4LA 2H3EA 3WK9A 3L7MA 3RIYA 4JFAA 4CF7A 5JWOA 1II0A 3EDYA 2FFAA 2HHLA 2J87A 4IX9A 3WKDA 1ZAKA 3I73A 4NOLA 1PZHA 2JLUA 3VJMA 2ZDGA 3E5MA 3M70A 5E2IA 4PLTA 1EMDA 3PA8A 5KWIA 3AI3A 5K4HA 2M1XA 4K9KA 5KHOC 1UDBA 2HUNA 1YB6A 2W90A 2H85A 2ZTMA 1SURA 1PJLA 2AOUA 4MW7A 1H2ZA 1WCIB 4A2PA 4EY3A 1E5QA 5J2TA 2O48X 3GJ8A 3LF1A 4FOOA 2MMGA 3RAPR 1Q8RA 4F3CA 2HF2A 1VK3A 3KJEA 4NU5A 4R1PA 5IBPA 3TBFA 3NH6A 1ECFA 4NCXA 3COYA 2F55A 5JALA 2E82A 4GSLA 3HJGA 4X1KA 3ED5A 1T6BY 4MUKA 4RC9A 2GTIA 5LQMA 3Q8KA 3SC2A 2Z43A 2WVHA 2BC9A 3CJTA 3QWFA 3FY4A 3HDTA 4KWCA 4V02A 3WB9A 4GM0A 5EVCA 4GL2A 1K08A 1G2OA 1A2KC 1W96A 3FKSD 2NU8A 1JYEA 1Z47A 4P84A 1KH2A 3LKBA 4H77A 3DAHA 4KXUA 5FOXA 3SOPA 2O8FB 3R8XA 2FLVA 5FNVA 4DLWA 2PSDA 2QN2A 3OPNA 1UMBB 2VQFB 1YRBA 3LPCA 1HZZA 1O54A 1QGUB 3GFOA 3DM9B 3ANTA 3P27A 3QF4B 3RTAA 2GVNA 5E4YA 3K9BA 4P4TA 2XKAA 3E1GA 3HY3A 3MINB 4MVJP 4NXMB 1JHZA 4RVSA 3JQDA 1SKQA 3KTOA 1IHOA 3RAJA 5ECWA 1I4DD 4ENSA 2V54A 4QBTA 3UJNA 2PKQO 3I8XA 3KQSA 1MC4A 3RRXA 2OFWA 1OPRA 2FSPA 4TKLA 1IZZA 1FFDA 2HIGA 4DMCA 2GEUA 2HCBA 2MSNA 5JWHA 1SO8A 3IUQA 5IJXA 2V7VA 4XQ9A 5AW5A 3UUWA 1YFJA 3JSXA 4ZRNA 4YRPA 5ALUA 4O4IB 5JD5A 1VI2A 4L7VA 2OD9A 1DBWA 3BIOA 3PWZA 3V48A 4DQXA 4RGBA 5IM4A 1CRWG 3P2JA 3OZ7A 3D8RA 3VSBA 5EMMA 3TJRA 5BPHA 2BBSA 4AKTA 4JY7A 4DJAA 2EFJA 1V43A 2VHJA 4QPJC 2PX2A 2XYQA 2YFHA 2NO6A 4QHSA 3TIVA 2ZGVA 4LXYA 3VMFA 3OJ0A 4IUYA 5ADUS 4TVSA 3IA2A 2V1UA 1MQAA 3ZD6A 1CW2B 1KFJB 1K1EA 4OAPA 5KS2A 2CUTA 1TPYA 1I1OA 3TOXA 3WI7A 4XM1A 1P19A 4A5SA 2ZRAA 4EDHA 5AUOB 2DQSA 3ILXA 4TWBA 3CGWA 4DPLA 1CZLA 2I55A 1D2EA 2H08A 4R1UA 4B34A 4DSOA 1DEOA 3E9RA 2CV2A 3H4TA 3GRYA 2VTEA 3LS2A 3AL2A 1QKIA 3FR7A 3PPYA 5AOCA 4X1OA 4RMIA 3SE0A 4CGYA 2F8TA 2PSFA 4C78A 4YCBA 3EGDB 1ZUIA 4DRXA 4WPGA 2C29D 2WFLB 5CXXA 2GBLA 3KOZA 4M8IA 4KI7A 1PL6A 1O0CA 3EXIB 2IP2A 1XF9A 1S4QA 3C7TA 3NEPX 1CLUA 4YLEA 4EYGA 5MFPA 3KQLA 5CG1A 3ZWMA 1JDVA 1O6FA 4U6QA 5GVRA 3ZXUB 1P77A 3JASB 1TEHA 3QKRB 1T9KA 3THWA 4D26A 3IUMA 1TUBB 4TTTS 4F6LA 2B21A 2ZCUA 1C5KA 2BCGY 4YJKA 4ZYYA 4BFLA 3I0NA 5JE8A 4D8TA 1AA6A 2A8YA 3AP2A 5BOSA 5HZGA 1KFKB 3ZXXA 1JZSA 1LCIA 4KSYA 4HDMA 1I2AA 5GOZA 5CFOA 1LY1A 2QPOA 3S55A 3PT9A 4IZIA 3SFVA 4NV1A 3DTTA 3K5HA 5A9SA 3FCEA 5JASA 1BE1A 2LD4A 2GM5A 1EFKA 4F56A 4EW6A 1V8OA 5AVOA 2AN1A 5LJIA 4N8DA 4KQJA 2D5IA 3E4CA 2OXFA 1EXNA 1CY6A 3I6IA 3PYXA 4G0PA 2I8CA 3K6JA 4IDFA 5CJPA 5GAJA 3TPZA 2FW8A 3HY6A 3UC9A 3GG9A 4HYQA 4D4GA 5MDHA 1VJ5A 3C8DA 2PJUA 1NBOA 4U2BA 2IFTA 3G2QA 4IDAA 5EYPB 1NNUA 4ETMA 2QRLA 1WDLA 1G8HA 4BNTA 2AK2A 3AHDA 1DZIA 1W85A 1U7HA 5ENDA 4GX1A 5BSHA 4HDNB 1H48A 2K87A 2YVLA 4UE6A 4EG5A 1RXVA 4QRHA 4QBGB 2JVIA 3N75A 3ZWYA 3VM6A 3W6OA 2IEGA 4EB3A 4MJ7A 2WKSA 3E82A 4HDKB 3VU8A 3ILHA 4HEQA 1P2TA 1YBVA 4M9QA 1G0OA 3L6UA 4FWIB 1NM5A 2ZVDA 4G56A 2P9YA 3MT8A 3FNEA 4BNIA 4EI7A 3JQFA 3UPTA 4U2DA 3UG6A 3PNVA 4RTSA 4QPNA 3DMPA 1A8SA 1H2YA 5DKFA 3VVCA 1PZMA 3ES9A 2CC2A 1T5TA 2Y27A 3M4YA 3N5CA 4GGOA 2GLUA 1LBIA 1ODEA 3GROA 4PAMA 2JGDA 1N5JA 5HF5A 5E8RA 3FVVA 2VQ3A 5KQMA 1E2DA 5HCUA 5IN5A 5A5DA 4AZTA 3LBNA 4X90A 3UCXA 5HXAA 1VE1A 1ZXLA 4FE4A 2PRYA 5AD1A 4I4TF 3D8SA 2JH9A 1H3EA 4DZTA 1D2MA 4F4UA 3USES 5MN4A 4GOJA 3FF4A 2H1OA 2AD5A 1DHRA 1MABA 2NT4A 2R2GA 1YB2A 4PCUA 3E1KA 3BXFA 4JLVA 4MS3B 5AHKA 5A06A 1T2DA 5AM4A 5AK5A 4AJ2A 1EFCA 3ILSA 4DJTA 4M88A 3HWWA 4JX8A 3CV3A 1QKKA 4DZRA 4G07A 4Z4HA 2O54A 1K5HA 4N8EA 4LVNA 2XKKA 1OH7A 4EB6A 2I2DA 3DZGA 1MB2A 2R11A 2J5QA 2DFLA 4AM8A 1CERA 1V1RB 2YRFA 1GU7A 4EY4A 1F8FA 1NFFA 2AXNA 2BAGA 3IEXA 1H6DA 1FNCA 1RFGE 2QUJA 5T4BA 1FEZA 1IPEA 3JQ9C 3SHOA 1X7WB 2G0TA 3VVBA 3FCCA 5BN1A 4D9FA 4Y1FA 2RHMA 1EBBA 1N5MA 3GZNA 3ET4A 1I1NA 3B38A 1JU3A 2DLCX 2C3YA 4MRRA 2DKNA 4QOGA 2FFRA 1XMJA 1KI6A 1ZRNA 2ONKA 4YROA 2ZAMA 3OZDA 1M74A 3R9XB 5JQGB 1H3FA 1HO3A 1MH9A 1PFUA 3DOHA 1Y3IA 4P3KA 3ZX5A 5KKAA 4FT2A 2FPLA 2OZKA 4N4AA 3MLBA 3ORRA 1TTPB 1DG9A 4EPRA 2WTAA 3NQ41 3PXDA 3VH3A 1SUFA 5A04A 4RU1A 4CF6A 2LBTA 3J80M 4WSOA 4DNPA 3LVFO 4ZEMA 3QPWA 3AVXA 4ZO4A 3RARA 3PUXA 4CEHB 2XZDA 1G8GA 5FI3A 2HGZA 4MUGA 5BXYA 1P2GA 4TN1A 1T0KB 1ZWZA 1E20A 1OU0A 3P32A 4D9NA 4TUYB 3NHYA 4KODA 1RS0A 3KM0A 1EWKA 4FN5A 1FJ2A 5AOVA 1PJAA 3HK2A 3F6YA 4ZAWA 3RUEA 5G3ZA 4BKRA 2VYFA 1P2FA 3RYHB 3VTAA 1WV1A 1OT5A 1ZESA 3DFZA 3L84A 3PHGA 4IICA 4RBNA 3EIWA 4UNNA 4FGZA 4KDEA 4KPGA 5K6TA 1FMCA 4RO0A 4C21A 4C4OA 1DLIA 1SCNE 4D0SA 4UDNA 4IV5A 3MQ2A 2GOYA 2O06A 4OXNA 1UBOS 2LKDA 3ZXIA 1M8GA 2XBUA 3AUAA 1OLUB 3E9DA 2IPOA 4X95A 2JFPA 1UC4B 1QU9A 4C3ZA 1B16A 5TR9A 4WXHA 2V6JA 3P94A 4HTFA 4GMDA 1X9IA 4IDOA 5NLLA 1V9CA 2ZPAA 1Z08A 1TU3A 3DTNA 4BX2A 2ZTVA 1YRQA 1H2AS 2JGNA 3LBAA 4J9UE 4PLVA 3LGSA 4XEUA 1P9WA 3TFQA 1HR0B 4BO0A 1BH2A 1PR5A 1US8B 1IY8A 1CZOA 1PJRA 2YIVX 3A9RA 2OCPA 3U3KA 1A5AB 4AMUA 3P9YA 5K6AC 4CEIB 5LQKA 1XJ5A 1IOWA 2C2HA 2Z9BA 3NWBA 4ZEXA 2WFZA 1DKOA 1DZ3A 1JG4A 5DZSA 3VPGA 4MQEB 4N3NA 4HS9A 4JBLA 3FUVA 4RIFA 4B71A 1SOWA 2UUOA 3P0EA 3DEZA 4FIDA 4YRLA 1PN3A 2P6RA 4G1BA 1ZGCA 4RM2A 4IIHA 3F3SA 5JECA 3NM4A 2IYAA 4MLZA 5EERA 5EINA 3EFOA 3HO1A 3JU3A 3PL1A 1M2OA 1P4AA 1ZVVA 1K68A 2QIPA 3UICA 1II8A 1ORIA 3FB1A 2ATCA 4ZJYA 3BFVA 3T3GA 1YDGA 3QEOA 2LNDA 3LI2A 3NBYC 5FPYA 4HNHA 2OLKA 3JQ8B 3K0KA 3ND5A 2DGDA 1MEOA 2QJFA 4XIIA 3GT0A 3QTTA 3N4YA 4R40B 2XYVA 1YV9A 2HSZA 1B14A 3LD9A 5C5IA 3IEPA 2OLEA 2C5BA 3HACA 5J2TF 2AR7A 3HM9A 2PIAA 2XUZA 5LLTA 4OU4A 3GT7A 4M9XA 3SS7X 4LCBA 2GDJA 1C8KA 1TUEA 2OILA 2BGTA 1QH0A 2VTBA 5MF6A 1OH6A 4J1SA 721PA 1LPSA 3HYTA 3CLHA 3MWLA 5MGBA 1NA5A 2C5FA 1OA0A 3AKEA 5JCOC 4M1OA 1ZM3A 2XUGA 1GPUA 2EP5A 1ZW1A 1BD3A 3ESBA 3AERA 3PR3A 4R1SA 2Q9BA 1QR6A 3E6AA 1ESCA 2CE2X 4P34A 3S0WA 3D54A 2OBLA 5FNVF 5I7UA 3IBGA 4B46A 3IMGA 2XH8A 2W2XA 3L18A 4JOQA 3WLPA 1ZU5A 4IDPA 1UXJA 3N2GA 2X2PA 2JBAA 2Z8ZA 1ZIPA 4ZYUA 3B1FA 4XJTA 3NFRA 4IH9A 5I51A 4RORA 1YE8A 3EQZA 5IT4A 1X19A 5TMPA 3ZCTA 2HSJA 1L6IA 4G1FA 4ZVLA 3TOZA 1Z17A 2GPYA 2C7OA 3GGGA 4DA9A 1IVNA 2H1LA 1RADA 4IO0A 4RK7A 1Z2CA 1CUWA 4OKSA 2E4AA 1AS3A 1P2BA 2WM9B 1TO2E 1NVVR 4GE0A 2BFFB 2OCDA 3U7FB 4KHPB 2D5BA 2Z8YA 4WIAA 1L7OA 1TOAA 1CUAA 1OROA 4N18A 1QBKC 4MYDA 3DJFA 3C4VA 5IM4F 2VHTA 2E4ZA 2V45A 2PRJA 1RR6A 3HCEA 4UTOA 2A14A 1AIPA 3OKFA 5KTNA 3AFGA 3ZCUA 1AUVA 5TGZA 4JI4B 1IIRA 1I3KA 1V9SA 3NPMA 2X0FA 1YI2F 1GUFA 2ZANA 4WACA 3VPCA 5JSZA 5KKCA 4I3HA 2FK8A 3KVVA 1R6UA 3P97A 1CWUA 1Z36A 3DL0A 3FAKA 4LJ7A 3W05A 1SC4A 4I9GA 5F5LA 5KMGB 1KIFA 2ZJOA 3G8AA 3BCRA 3NHMA 3P0FA 3REOA 4EPXA 1AQIA 2YNMD 3OJWA 3RJ5A 4HD8A 3OCUA 4JBIA 4B40A 3GFQA 2ZUBA 3IDZA 4HRXA 4OSPA 2OPHA 3U26A 4BQPA 4G0UA 3HI4A 2JK1A 3JQQA 4I66A 2XTZA 3BYQA 2H5LA 1P4GA 1XZGA 1COWD 1IE3A 2GDZA 2OSVA 2X8BA 2X40A 3GVCA 3U3MA 1TK9A 2ZE5A 1H0SA 4Q3DA 3H1AA 4W1PA 5IAJA 5KDDA 2A5JA 3U60B 5KX5B 4M9RA 4XIGS 5CK4A 3GLIE 4B3SB 4D8XA 4ZCTA 3ACDA 3PQ4A 2GXUA 1TLFA 2ZB8A 2BVNA 3NR2A 4O0MA 1NTRA 6Q21A 4O1MA 4UJ3A 1GIAA 1NT4A 2O2YA 1JIJA 4PTLA 1E1RD 4DRZA 1FTWA 4WQMA 2PMEA 5IS2A 4KCGA 4L4UA 3LPNA 3OU7A 4YP1A 1SPXA 5DBEX 2VCYA 3VPBA 3C8UA 3RT7A 1S3GA 4Z7QB 5E6UB 1SQ5A 2RB4A 2X4LA 2A0YA 4R3UC 2O8NA 1RP7A 3LL7A 4EG3A 1OB2A 4INPA 1KH3A 2DECA 2G5GX 3MD9A 3DFFA 2R2AA 3I1FA 4MVJD 4TQ9A 5JS7A 1RC8A 3M34A 1QIFA 4DXHA 1XMPA 2QSZA 4AX4A 2YOHA 3DD5A 3ZD8A 1IEXA 4G88A 1LW6E 4WGGA 5KVSA 1JR6A 4GXRA 4BPRA 2BR3A 3A3YA 5ALDA 1EA5A 5BN5B 2DPHA 3VC3A 1M6WA 1UKVY 4LA4A 5ESWA 4BWVA 3AEXA 1VJDA 3W04A 2K5UA 2YHBA 4R1MA 1AZTA 2Y2UA 3IAUA 4OXRA 3X1YA 2FSFA 2QSYA 1F5SA 2ZI6A 3QU2A 4GBJA 3EEFA 3G1WA 3PFNA 5DHRA 4HDQB 5JD6A 1I51A 1T4MA 2AI2A 3LW7A 4EJMA 5TXGA 4R2MA 5L3ZA 2Z58A 4PN3A 1L5MA 4A2QA 2JK0A 1RBZA 2XCQA 1G2PA 5C1IA 4YWJA 2Q8NA 1QO0A 4K0KB 1HKHA 1ZHFA 2HIAA 1W88A 3MTEA 3PJEA 4J3NA 3TLMA 5KYNA 1AE1A 2G1AA 2TMDA 1DAMA 3QFSA 2ZWVA 5HXUA 1U7TA 3RYFA 3A31A 1GNSA 2H5IA 1PT8A 4YFVA 5BQFA 4NLLA 1G3UA 1EZ4A 1E8MA 2HNAA 4QEDA 4DCVA 2I6SA 3A3NA 3MCVA 4GICA 1N3BA 5KSZA 2H4XA 5G4KB 2EEPA 4B62A 1EHYA 2AJCA 3QFTA 4YFYA 4JUFA 4ROSA 5BV2P 3TFWA 1QOPB 3ONVA 5JV5A 2OL4A 1YFLA 4MWCA 4Y6PA 3MWDB 3FNFA 4GF5A 4DC1A 1UF9A 2P1RA 5L45A 3A1FA 3DCNA 3GI1A 2RGBA 4HAZA 4LF7B 4QTTB 5LBUA 2RGCA 2QX4A 3OTWA 1CQJA 2VNHA 2NVUB 2J7PA 2HRBA 2O8EB 1O4VA 1Z15A 2BLNA 2VBFA 3CRNA 4IJ5A 1QHGA 2Z3ZA 4J07A 4OXQA 4BUJA 1JPUA 3H5AA 3BCSA 1WTAA 4G6ZA 1LBTA 2QLNA 4R6WA 2DUWA 2KLHA 4MITA 4NMHA 3MS7A 4TXHA 4XWAA 4RTLA 5K4GA 4DG9A 3UMCA 2ZUFA 5JAUA 3D5EA 3IX7A 1MO3A 1ZG3A 4TYQA 3JCZA 1KJ9A 2CMFA 3TQRA 1W36C 4DREA 3OPQA 4WLOA 3OBWA 1AS2A 2C7QA 1EP2B 3C0KA 1GUYA 2Y66A 3GLSA 4GLOA 3BZWA 5CDSA 5JCZA 5REQA 4CCWA 2ODQA 3KIZA 1XWFA 2AEFA 5ALEA 3KOXA 4NBKA 3L8EA 3WJ2A 3U44B 1PL7A 1PNQA 2OCKA 2JGAA 3B89A 1EHCA 1KWGA 2OGUA 1PK8A 1IRXA 1MQSA 3R7SA 5TSDA 4CV0A 1ZD2P 1SCDA 3HP7A 1C29B 2CYBA 4IHKA 1X9HA 3MDOA 4GR5A 4JEIA 2PHZA 1X8JA 3R3WA 4DFDA 1JSRA 4IFTA 4OX9Y 2VYVA 5CDTA 3CQ9A 4XE5A 5JS6A 2OCLA 4N6GA 2HMTA 4XWWA 3I3SR 4I0WB 4J0JA 3A4VA 1RC0A 1RJDA 1T3SA 3WYNA 5KWEA 2ZZMA 4D3XA 4BAGA 2WSSA 2GPJA 1JFTA 2NSDA 2RHTA 3UUGA 1VQOF 3OEED 5EWJA 4NULA 4LHSA 4MP3A 1FYEA 2MU1A 4A0GA 3MMXA 3GUYA 5U4QA 4DNOA 5LU8A 4B1FA 3F3YA 3O6VA 1Q50A 2Z9CA 3VYTC 1E79A 2W2PA 3AHGA 5ER6A 4EHHA 3HU3A 1BS2A 1AB6A 1Z63A 1VMDA 2FJPA 2QAGC 2C9CA 2ZU0C 4ZVOA 1Z68A 2Q9CA 4BFWA 4LYHA 1TO1E 2PA0A 2I6FA 4HJXA 1I24A 1NMQA 1Q91A 4HQLA 3ZHRA 4A27A 1V6CA 1EFRD 2Y92A 3KX2A 4LW8A 4OA8A 4WECA 2RHGB 2SHKA 4B76A 5E9AA 3KJJA 4KDCA 2WJZB 3HWSA 2EP7A 4V1CI 1GSHA 4II7A 4F1KA 3RV3A 4G25A 3DOCA 4H4DA 1HNNA 1IV4A 2IEBA 2M98A 4BYMA 1MX3A 4RQAA 1QDLB 1NRXA 1T9GS 3HDJA 4P4GA 4RKEA 4BQNA 3IQFA 5TRTA 3F2IA 1XCLA 3KPUA 3R0IA 4XOIA 2GLZA 3WYEA 1OXMA 1QHSA 4NZNA 1I9CA 4HHEA 5AJXA 3RV4A 3V33A 2X2OA 3OO1A 1TM3E 4K1XA 4PSAA 3ZDEA 5KVCA 3CUSA 4KTTE 4P4SB 1Z7BA 1NXTA 3NUZA 3FSRA 1R7RA 3FX2A 4JUDX 1KYYA 4DJFC 4HF7A 4HVCA 2VVTA 3ETNA 1NXXA 1PR3A 5DYGA 4PZYA 1EE2A 1QGZA 5LQUA 4CZ2A 1SZDA 1P33A 3H2ZA 3B9BA 3W2HA 1G21B 3OM0A 1RQRA 4JJ7A 1VA5A 3KK0A 4F6RA 3OW2F 4JJ4A 5DCVA 3DBRA 1WQ4A 4IIJF 3F6BX 3LVBA 5ERYA 5EMHA 3FTEA 4H3HB 4PG6A 5HUJA 3FSEA 1R27A 1G6HA 5HY1A 2C61A 2PIDA 3DLIA 2IE0A 4MVJI 1TKRA 1QNFA 2YTZA 4RW0A 1BX0A 3QJGA 4OL0A 4QELA 5KYVA 4G0WA 2MJLA 3IEWA 3B6IA 1KPIA 1ZK3A 3G8CA 2IY9A 5GJBA 4XA8A 1DVRA 1GWNA 3ESXA 5KSOA 4CUZA 3ETDA 1W75A 4W82A 3I2IA 4CKWB 4EPTA 1H4TA 1HDCA 2YY5A 4A1FA 3B6NA 4AYWA 3GR6A 2WJPA 2GHIA 2E18A 2GWHA 5TVGA 1VXOA 1L5VA 3H97A 4IIBA 1KEPA 5CLHA 2VPXA 2ZG6A 3C43A 3QEMA 2CFRA 1FX1A 2WD7B 4M0EA 3T3MB 2D5CA 3UBTA 3ROMA 2HQBA 2PX3A 1KF0A 5A0FA 1JDJA 5BR4A 4KLAA 5CLJA 3ZWXA 1Q0LA 4D74A 4BMZA 2X0KA 4IS2A 3W4KA 4E5MA 3SMQA 3UZUA 2Q9AA 3GUZA 3R7FA 5JJ5A 3PGMA 4UBOA 1NU6A 4I50A 1CNMA 1U7DA 1IY2A 1QYDA 1YONA 3ADOA 3CRZA 3LSTA 2VATA 2EW1A 1ONSA 2Z5GA 3PRKE 2Q2QA 1JLLA 1S89A 2DUJA 5T57A 2H29A 4TWAA 1FVOA 1YBFA 5HQ3B 2AWNA 4TLCA 4FYPA 3EGEA 3ANLA 5L4LA 2W0MA 5DEIA 1JT9A 3EBPA 3A7DA 5C52B 4LOJA 1N6LA 4JGGA 1NVTA 4N5DA 3ZGOA 3RAEC 4R1TA 3EZ2A 4GH5A 1CQIB 1XZEA 3UK6A 4IHQA 4WXPA 1KDTA 5CAEA 2R79A 2HIMA 3PE6A 3KZKA 4S12A 4RTQA 4C1BA 4LNAA 1SUEA 4NE7A 1SKYE 1JTFA 3GT3A 4S2UA 4BNKA 2XE7A 5IBCA 2HTFA 5K0JA 1RI2A 1RVV1 3F46A 2IZ1A 3WLEA 3JZMA 1GNQA 1YK0A 2WNIA 3F3MA 3RJMA 5E4TA 4IXDA 3EMVA 1WBBA 1K8AH 4BQFA 3EVFA 4PANA 4ZI7A 5DBOA 1FU8A 4V0KA 3QUQA 5JC1A 1XLVA 5JFOA 4OMFG 5THQA 4R1QA 4N9QA 4Z4QA 2W98A 4ZTBA 2FZCA 3NEJA 4O2AB 4JMPA 4UE3S 2ZYWX 4RLHA 3WWZA 4RTOA 1H6AA 3GLTA 1RAIA 2J4DA 1H6CA 3SZRA 2ZYTX 3CX3A 4FBMA 1XO1A 2IH4A 1YS9A 3EEQA 3SKVA 1JSCA 1WV0A 2D5AA 9MHTA 1L7AA 4HO1X 1E4EB 3DV0A 2YICA 3KYIB 3MJSA 2A0UA 1Q0TA 2PXCA 4FE7A 3D8TA 3CT4A 1F14A 1MG0A 1S6YA 5T41A 4LS3A 4B0OA 2W70A 4LYGA 5EKDA 4CF5A 2HU5A 3L06A 4W7IA 1QK4A 5BWMA 2OHIA 3F8TA 5FI0B 3FDJA 1WKVA 5BV7A 1I7LA 2PUDA 4LOAA 4L5CA 4MX8A 4J4HA 2NP6A 4HSGA 3OZXA 2J1LA 1O9HA 2W8BB 4LPSA 3UBMA 4ALJA 2C04A 3K1AB 1IUKA 5DULA 1BX1A 4P93A 4FWBA 5D6NA 3A6FA 3T3IA 2PD3A 1E6KA 4FK8A 4NENA 2VR1A 2BGUA 3HDQA 5SY4A 2DKOA 2V4ZA 3KSDO 3LCVB 3TM4A 5FJ4C 2XDQA 1CRLA 3TW8B 1Y9JA 2C8LA 2Z98A 1P9LA 1GD1O 2HXSA 3DAOA 3PDIB 1RXWA 4UXJA 1IHYA 3VH1A 4YRIA 1KRHA 3FTNA 4QTZA 1PWXA 1GITA 2G9UA 1SVMA 2IA5A 4F12A 3ZI4A 3QIAA 3AGKA 1A3CA 3P0IA 2I4RA 4M7RA 2XYRA 1QPZA 2RKWA 5EJFA 4A9AA 2V4MA 1BDHA 2HLNA 3BXHA 4PO9A 5HUQA 2O14A 2VHYA 1O0BA 5B30A 2Z5FA 3W8FA 5LR6A 3HLKA 3STXA 2FTKE 3T9AA 3U49A 1QVFF 1L7VC 2HPVA 1IVSA 4QJ5A 2UV8A 3THOA 2WIGA 1Y3HA 1YL7A 2IX9A 2R60A 3PC6A 2I4MA 2G09A 4JJFA 3I4LA 1F1BA 2BRUA 2GERA 2IXFA 2R1ZA 4HGOA 2GBIA 3DZKA 4GYYA 4F9FA 4WY8A 4XRGA 3Q8MA 1OJLA 4ZEOA 1DC3A 1J2UA 1DO8A 1Z6AA 3W78A 1R5OA 3I9V1 4IW3B 4X7BA 4EYQA 5FWYA 1Z6YA 1ZGZA 4DQ0A 3DZHA 5ITZB 5E1BA 2OGWA 3O1JC 1GFIA 1MB0A 4EZBA 2XRZA 3PLAC 1KP2A 3WNBA 1QGYA 2B33A 1QWOA 2WF7A 4BC1A 4D98A 4F4FA 1IXYA 1G5FA 2QJOA 4CM8A 4DOMA 4FX2A 4EQZA 2A92A 2A9RA 3INRA 1XDSA 3AESB 4WZAB 1XZIA 2O59A 2QRGA 2HOQA 1AH2A 3OMXA 2EHJA 1KARA 1AHIA 5F76A 4KPFC 1SU7A 3V9PA 5B8FA 3KLPX 3A6ZA 3PRHA 4P5EA 2QVCA 3HZHA 4REOA 1M2EA 5D01A 4C4TA 1GO2A 1GG9A 5EB0A 3PEEA 5FP0A 1Z9BA 5JCPA 5CDFA 3CNLA 2HJRA 3M2TA 1RJEA 1LJLA 1L4LA 2HUPA 3MWEB 3OJFA 4A91A 2OHFA 2RBKA 4S1WA 4BVEA 3H05A 2A30A 3LFHA 5CGZA 5C35A 1PE0A 2XBMA 4C04A 4O4HB 5FOTA 3FUTA 1JLSA 3C1TA 3T12A 4EEZA 2P9EA 5F7ZA 4TL9A 1XQWA 2YYZA 2IYPA 3QPBA 2HQSC 2GX6A 2M6LA 3X2SA 5FDFA 2WWVD 1ORRA 2BMVA 2YS7A 2O05A 3T9EA 5BWLA 2GCIA 3HQ4O 3AKYA 2K7FA 2PUAA 1X7YB 3E3OA 4J1TA 1S01A 1NI4B 2E0IA 5H4HA 1FBTA 4AJKA 4YRBA 2Q5QA 1L5LA 4DNXA 2V0CA 2VNSA 1OX4A 4LBVA 1KMNA 4TV8F 1TXGA 5AUPB 2I2CA 5JHGB 4D6YA 1JDUA 1X7DA 4EG8A 3VKVA 4ND5A 3SFZA 3FD6A 1KNQA 5AKLA 3Q2OA 3ZXSA 1DAIA 3V2IA 3GP8A 1VQ6F 3H84A 2BGIA 3UMRA 5EMJA 1T2VA 3R41A 2HB6A 4W5OA 1KR2A 4R9VA 1D1PA 3QU5A 5IDYA 2W8BC 1GAJA 1ACMA 1DTEA 2ZR0A 3ZQ6A 4B2IA 4IZHA 5BNIA 4A2CA 4G4GA 2JJ1D 5IVIA 4NATA 1BD4A 1VDZA 3O3NB 2WWGA 4FFBB 3KEGA 3RIGA 2PVSA 4YT5A 3TUJC 2H65A 4MVXA 1P1BA 4LOLA 1C7JA 5DHAA 1PTJA 3SWWA 5EHNA 2FW0A 2WAAA 3LG2A 3QBDA 1KAMA 1XCMA 3T7DA 4EW2A 1LPAB 4KQWA 4UVDA 5TEWA 4E5KA 1QO9A 4N76A 1JIIA 4AY2A 4OKIA 1XQ6A 1R0XA 3AWIA 4YAWA 2ZWOA 1IUOA 2G67A 4OQNA 1N7JA 1DRJA 1JH9A 3FTFA 4FEAA 1EWQA 3ZYCA 3JRNA 1DCKA 5FAXA 3LW8A 1N57A 1YRYE 2I54A 2QM7A 3D3WA 3OA2A 5EMNA 4EKIA 2I4TA 3SR3A 1SKAA 2VXOA 5K0CA 5IT0A 4LE2A 2VZEA 3VI4B 1OASA 3IEQA 5IJ0A 3C6YA 5FBVB 1HFEL 1T13A 3VNAA 3ZTWA 4MV8A 3SBOA 1VRWA 2DU8A 2XA9A 1I4EB 1ICEA 2I1VB 2J09A 1XK6A 2OHJA 3DA8A 1VL8A 5ICFA 3HL4A 3AVUA 2NZYA 5U4XA 2X0RA 3IOMA 2PL5A 3MUEA 1EUDB 1CYDA 4PLFA 3QZUA 3V1NA 1HL7A 1U2DA 4O0LA 5DM70 2JAUA 2ZUEA 1ZC3A 2ZSJA 4DLTA 1BCSB 1Z35A 3QYPA 3P26A 4G2NA 1ISIA 3GRUA 1TPZA 4MLCA 5F3DA 1DBSA 1OWLA 2G8LA 4BCBA 1Z4PX 2E5FA 1USGA 3PGKA 2XZLA 3N6RA 1Z74A 2ZROA 3MAGA 4M0FA 3WADA 4CWAA 3HDHA 2N0SA 1X9GA 3L0SA 4H0NA 1FFBA 1H1LA 3O83A 4IYRA 4WN9A 3L0ZA 3PB3A 4PS1A 5EE3A 1B0UA 2GCOA 5PNTA 1XZCA 1BYIA 5JRDS 2CDAA 3ZU5A 1OH8A 1TZKA 2PH5A 1AMUA 5K0SA 4OI0A 1SBYA 1VM6A 4UHBA 1KAGA 2HCRA 3BMNB 4U5XA 1PHRA 2P75A 3AW9A 1PLJA 1TT5B 2EZ9A 2PPLA 3AXTA 3IPLA 1RRFA 4QJIA 2JFQA 1NPDA 3I1IA 3CINA 4KE9A 3PUYA 4PSKA 2DWUA 5FOSA 4WOBA 2YASA 1HYGA 4HQOA 4HB2A 4WK0B 1D1QA 1PF5A 2C84A 1GGVA 2VJMA 1TT7A 3M33A 3ZBUA 1NMYA 3D4IA 2X41A 3GEPA 3SCZA 1UJCA 4H7JA 3AI7A 4MR9B 3PP8A 4KFRA 2BKUA 2LDBA 1VQ5F 1E8DA 1KGSA 4FCCA 3WBKA 3ROXA 5B1SA 4F1JA 1BSVA 3QPCA 4DIKA 1U5BB 3TSWA 2ZS8A 3EJWA 5A0TA 1E2QA 5AI9A 1EAYA 3L7JA 3DMYA 1N2BA 4HOYA 2I4LA 2ZSFA 3RTBA 3UT5A 3V4FA 1GN9A 1EK0A 1NSYA 4MW4A 1WSAA 2IPNA 2MSKA 3IGFA 5SYAA 2D06A 1VB5A 4Q9AA 1RJWA 1HDGO 5HE9A 3NPAA 2AQ8A 4K9RA 3W3AA 1XDZA 1JHYA 1JYSA 2G5PA 1RQ2A 1OSNA 1U28C 3ECCA 4QDXA 4WKCA 3O38A 5E7QA 3WV5A 3QLVC 5CFMA 4LX8A 3RVQA 1LVHA 2LXNA 2EU8A 2JGRA 3FIJA 1X1RA 1XEXA 2YMLA 3LOPA 1PT6A 2E85A 4HN4B 2P91A 5EJ2A 2Y1LA 4H0CA 1E7KA 3X44A 1JDSA 1L5OA 4XKJA 1BVUA 1GFWA 5IRCD 3K3PA 4I50F 1Y6ZA 1D7OA 3QIVA 3DE1X 4TOIA 2P3QA 5AHWA 4NQ3A 3GRVA 3VPHA 4PRLA 5J23A 1IOZA 3BD7A 1A9ZA 4F60A 5A71A 1DXHA 4UBLA 3VYRB 4LOKA 3OHMA 4TWRA 1QC5B 4Z7NB 4QL3A 3LU1A 3AZPA 1LPOA 3QA9A 3PHIA 1M5TA 3ND7A 1XHFA 3FH0A 2F43A 2G7MC 3HZOA 4AG6A 3D0QA 5EP2A 3VO9A 4E4TA 2ASVA 1RM5A 2H18A 1NC1A 2AVDA 2IVZA 3DHYA 1X3SA 4P35A 1SQGA 1AVTA 2BEVB 3WRYC 3UCEA 2CJWB 3AXSA 4RTNA 3LT1A 3SXUB 2DAPA 3FXAA 2HWUA 4GSKA 4J0CA 3V9AA 1EWYA 1OAPA 3QVXA 3H6GA 4GHWA 2X4DA 3ZHOA 4CG3A 4RFSA 1IOVA 3LKVA 4Z1MD 2QZPA 1Z73A 3L02A 5L3VA 4RA9B 4YQFA 2EOAA 4ER7A 1G5HA 4KUGA 2X58A 3EIEA 2YJNA 3GLUA 1P8JA 3LDTA 5LIRA 1Y9AA 1WPRA 1OHHD 1XCPA 5HRCA 3GLFA 2A84A 1SVNA 2CE7A 3TOSA 1LU9A 3WBJA 3E3AA 2C59A 4ZI7F 1E1DA 4EG0A 3WK8A 4GRAA 1C9JA 3D8HA 1QIIA 4Q03A 2UXBB 2WTXA 1QFSA 1P9RA 4M1KA 1P4JA 4G36A 4C0BA 1GRNA 4CODB 1VL0A 4NYIQ 3OCCA 4AS2A 1I7DA 4RY0A 1IMJA 3GJRA 4G4SP 2G9ZA 5BN3B 3FRIA 2VDNB 3UB3A 4CCYB 3SQWA 1QF7A 2PFGA 2TMKA 1PW5A 2G04A 4YJHA 2W83A 2OV8A 2CFOA 1UDCA 4UOZA 1QCDA 4ZP1A 3GCZA 4ZOQI 2XMCA 3TW4A 1XTBA 2XX3A 4C2UA 4PHGA 4ESHA 1ZJZA 4WCVA 1KYIA 2HC9A 2QNBA 3VHXA 4G24A 1HH4A 3FGPA 3U9LA 5BYJA 5J4VA 2N48A 5IC5A 1C80A 5BSTA 1C81A 1TM7E 4IG9A 4US1R 4ENPA 1LBQA 4G5GA 1WO8A 1OZFA 2CNDA 2HA4A 4PW0A 2PZLA 3AR6A 3ENZA 4UZSA 4YIHA 1MX9A 3SNKA 3KWLA 3TLBA 2GXQA 3K2QA 1WB5A 3CEPB 2BBOA 4UU1A 4BZQA 3H16A 4I9FA 1KTIA 3BEDA 1BWPA 2YOGA 2JCYA 4CKEA 4EVQA 4YIKA 2BWJA 2GKGA 3ZH2A 1Q1GA 3PE4A 4C29A 1L5FA 1D2NA 3NBQA 4D82A 3RUIA 4EO4A 1QUFA 3OURA 1KXJA 3QVGB 3KSUA 2B2CA 2YWRA 1LSJA 3OM1A 3NHSA 4G9GA 1L1RA 3EC7A 1DMRA 4TZTA 3UWDA 4F3TA 4KV9A 4OGFA 5CT9A 3DWFA 4WVLA 3AH8A 4YDHB 5IAAA 5C7IO 4UU0A 5KKNB 1IBKB 1VG0B 3ZOZA 2PZMA 2ZATA 3G68A 3RBAA 3C5WP 4KWIA 4LNHA 2GO7A 1IN6A 1T15A 3OM9A 4L95C 1SA0B 2H7XA 1I14A 2XWQA 1RQNA 2IWHA 4EHBA 1DX6A 1UADA 2O9JA 4U0KA 5T7BA 3GA5A 3SOZA 4EGQA 2DVMA 4DCSA 4RD2A 2QI9C 3FIUA 4BIIA 2WSMA 3UOAB 3FKSA 3PR1A 2QPLA 1V11B 2AX3A 3OZCA 4NU6A 3WHIA 2JZCA 4NR0A 5BT9A 5KJCA 3FJ1A 4QYTA 4NG4A 3A4YA 3B36A 2J5BA 4EVIA 4FZVA 1U6IA 3EODA 3NP9A 1QU2A 4ZMBA 4P7KA 1LTQA 1VFPA 1DO0A 3HJUA 4M1YA 4OB6A 3A2NA 1CP3A 2Z01A 2GO1A 4I46A 4PZDA 4YRSA 5IJWA 3DPUA 4LY0A 4ZXPA 4B6GA 2AH5A 3UJBA 2X3FA 4GKJB 4UCQA 1F4PA 1QH8B 4LHVA 4I99A 4DUGD 2DT8A 2JIPA 1G66A 1YQXA 2GZDA 3HFSA 3QE2A 4URHA 4FKMA 2R3SA 2AQKA 5EXPA 3R0ZA 1U80A 3L49A 3UK2A 1NNLA 1IN8A 4AJJA 3WX0A 5JVDA 1XUOA 1OFUX 1R4AA 1T6YA 3VAZA 2B37A 2ODWA 5GIOE 4Z4FA 5A6SB 3IBTA 3T94A 2IEIA 2VI5A 3K8OE 4LKOA 5EEGA 3RUPA 2X1MA 3CF4G 4ILEA 4H1VA 4E21A 1IVYA 1FP4A 1J56A 4ZCPA 1GTRA 1IFXA 2QMOA 3M3DA 4CDGA 4F5DA 1L6RA 4UMEA 3IP5A 4U3JB 3SBDA 3C9RA 1DO2A 1N2HA 4QDTA 1YR7A 3ND6A 3DVQX 3TD6A 4QDJA 4MXDA 4L4XA 1ZX1A 4C4SA 4DHEA 4BV3A 4ZVKA 3B3GA 3H1PA 1YUMA 4GXNA 3EH2A 5ALQA 3CF0A 3SC4A 3VDXA 3A2LA 4DIFA 5A4JA 3BRCA 3TSCA 4ZYXA 2L2QA 3X0DA 1T1GA 4DIEA 1EXMA 3C14C 3UOWA 5DM4A 1EPUA 2XLBA 1H9BA 2BW0A 1VG9B 3R7BA 4MR8B 4DDMA 1D3AA 1NBME 2VNAA 2Z56A 4LZJA 2X7XA 3DOEA 5TVKA 1TQ6A 5L3QB 1FFXB 4L8FA 1TVMA 3LT2A 4GD3Q 4R7ZA 3W7AA 4CFZA 1ECCA 4XVRA 5IG2A 2B0JA 3KYDA 3OLVA 3QOFA 4PBTA 4D96A 3M2PA 3M89A 3F90A 2RE8A 1CE8B 1EK5A 4P83A 4NDZA 1XNJA 2ES4A 2YV4A 2QRVB 3ANMA 4TLMB 1LUAA 2P41A 5I6DA 2CLLB 1QG6A 2ZDHA 2G40A 5C8YA 3KOUA 4UDXX 3T9FA 3WIEA 1KD1H 1Y8RA 1QE0A 3P9QA 5EEHA 3V1UA 1TF7A 2GBPA 3C7AA 3DZ8A 1RI3A 5KNCD 3BQNB 3MCQA 1RCFA 3OCXA 2QV0A 3B3AA 3TVDA 2DR3A 2A94A 1EX1A 3G2KA 3SYTA 3K1TA 4LJLA 2HIHA 4H17A 1D9XA 4B85A 4US0R 2HZBA 1MFPA 2FOXA 2GA9A 3SSMA 1XNHA 5HJE