3VOCA

Crystal structure of the catalytic domain of beta-amylase from paenibacillus polymyxa
Total Genus 163
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
163
sequence length
416
structure length
416
Chain Sequence
AVADDFQASVMGPLAKINDWGSFKKQLQTLKNNGVYAITTDVWWGYVESAGDNQFDWSYYKTYANAVKEAGLKWVPIISTHKCGGNVGDDCNIPLPSWLSSKGSADEMQFKDESGYANSEALSPLWSGTGKQYDELYASFAENFAGYKSIIPKIYLSGGPSGELRYPSYYPAAGWSYPGRGKFQAYTETAKNAFRTAMNDKYGSLDKINAAWGTKLTSLSQINPPTDGDGFYTNGGYNSAYGKDFLSWYQSVLEKHLGVIGAAAHKNFDSVFGVRIGAKISGLHWQMNNPAMPHGTEQAGGYYDYNRLIQKFKDADLDLTFTCLEMSDSGTAPNYSLPSTLVDTVSSIANAKGVRLNGENALPTGGSGFQKIEEKITKFGYHGFTLLRINNLVNNDGSPTGELSGFKQYIISKAKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis by X-ray crystallography and small-angle scattering of the multi-domain beta-amylase from Paenibacillus polymyxa
rcsb
source organism Paenibacillus polymyxa
molecule tags Hydrolase
molecule keywords Beta/alpha-amylase
total genus 163
structure length 416
sequence length 416
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2012-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01373 Glyco_hydro_14 Glycosyl hydrolase family 14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3vocA00
3AIQA 4BQ2A 1TE1A 2VX4A 3NSNA 3GNRA 3SUWA 2BHZA 1JXKA 4D6HA 4M8UA 1C7SA 4S3KA 1GQKA 1CTNA 1JYVA 4HZ7A 3IAQA 3ZR6A 2XGIA 3B8SA 1U30A 2G4FA 1L0PA 3KE0A 1JZ5A 3GH4A 1EGZA 4MNMA 3AZSA 5DO8A 1UR4A 3N17A 3TTSA 3W38A 2BY2A 3NYDA 2J7BA 1J11A 3B9AA 1OT2A 4U31A 1QI4A 4WJXA 3LMYA 3ZT5A 2J78A 1JI2A 2BVYA 4H7VA 2X05A 4HPGA 3SCVA 1IT0A 1AQ0A 3KL3A 3SEPA 5DT7A 3QHOA 1LWJA 4LYPA 1JYWA 3TOPA 3WD4A 4PUEA 2ZX5A 3UETA 1LL6A 1HF6A 2D2OA 3CZGA 4FLOA 4UCFA 1KQYA 3WQVA 5JUVA 4RE4A 2XG9A 1UYQA 2XFYA 5E6ZA 3GTNA 1FHDA 1H49A 4JFVA 2WB5A 2VO5A 4JCMA 2WKGA 2J7CA 2W5FA 4U2ZA 3AZTA 3ZJ6A 1BHGA 1XD1A 2DDXA 1VJZA 2J4GA 5C71A 4WKAA 4MB5A 2ZX7A 1HKJA 3M6DA 3AXHA 4IUGA 4AZGA 4Z2LA 3CO4A 3F5LA 4TX8A 3ZJKA 2YL9A 2XJ7A 5A1AA 2OWXA 1XCWA 3WF2A 3B9DA 3AS3A 1KXVA 2D22A 1E4IA 3RM9A 2DEPA 1HNYA 2GK1B 2J62A 5A8QA 4WKFA 5FCZA 2J77A 2FGZA 4UQAA 4D6JA 3W53A 5E09A 3UR8A 1GQIA 2IXVA 1QNOA 2CBJA 1HP5A 3GNOA 2YBUA 1UR8A 2JIWA 4HOZA 4CU6A 3AHTA 4H8HA 4GZIA 4L4PA 2X0HA 2WLYA 3M46A 2J25A 4L4OA 1UHVA 1M01A 4ZE5A 1QNRA 5AYBA 1NOFA 1NARA 5AYIA 1XH0A 5I3DA 1H2JA 4XZWA 1DWIM 2XYLA 3WH7A 2XVNA 3AHXA 4JKKA 1HKKA 1LG1A 2J8FA 3BMVA 2D0GA 2TAAA 2X2YA 1EA9C 1CDGA 4PCTA 3CUGA 3WNMA 5CZKA 4J3VA 3K8LA 2NW0A 2WK2A 4NI3A 1JZ2A 1E40A 1NH6A 5IHSA 3CIVA 3VIIA 5A8OA 4CN4A 4ATDA 3WH9A 4BZYA 3AI0A 1GZJA 1D2KA 1Q6EA 2WPGA 1JFHA 3AIEA 1OD0A 2WMGA 5CXPA 2DPEA 2VQUA 1B9ZA 3APGA 5BWFA 5A8MA 2WHJA 3SCUA 3RIKA 4AISA 1ZBWA 3VD7A 1JGIA 5ABFA 4GXPA 2ZXAA 2WKLA 5A3HA 5FD0A 3AOFA 2EXOA 3SIMA 1M03A 4HZ8A 2E8YA 4H2CA 2PWGA 2W63A 5GQBA 3HN3A 3SCTA 2ZUSA 4K68A 5D9NA 1LL4A 2G3JA 3NCOA 3SCNA 4X0VA 5I78A 2YLAA 1FH7A 4AZCB 3VINA 3QHNA 3T0AA 1TCMA 3CGTA 1UR2A 3BCFA 4C7DA 2EPLX 1C8QA 3WFZA 1V6UA 1TA3B 2G41A 3F4VA 1J0HA 3AICA 1VFMA 4F79A 4HA3A 5CPQA 2CNCA 3SUUA 1EQCA 2CYGA 2NT0A 1OIMA 2Y4SA 4P8XA 2Y8KA 2D23A 1LLOA 4AIEA 3WF3A 3VOCA 4U3CA 1XV8A 1JZ6A 4Z2HA 3ALGA 1JF5A 3UG3A 2FGLA 2E9LA 1BGAA 3BAXA 3PZQA 1MYRA 4UFIA 2WXDM 1BTCA 2FH8A 4H04A 4DUVA 2CHNA 2G8ZA 3AHYA 1L8NA 1E6PA 5CLWA 1KR1A 3ARYA 1B3XA 1D3CA 1U33A 3SUSA 9CGTA 1R87A 3GXDA 1GOQA 1B90A 3AHVA 1E70M 3VX0A 1B3VA 3WNKA 3L4ZA 4EK7A 4JZ5A 2ZUMA 1J0IA 1QI3A 5DEZA 5EFDA 4B9ZA 3G6MA 3ZSTA 3CLWA 2OWCA 1UOKA 4W89A 1H0IA 2E9BA 3AYRA 3GH7A 3FAWA 1JZ3A 5BXSA 1PIFA 1E6XM 3AIVA 2V3GA 4CN6A 4CCDA 4JFUA 4BQ4A 4PYSA 3WL0A 2WLZA 4GQQA 1BGGA 4IM4A 4F9JA 1K6AA 3CZJA 1E6RA 4M82A 2WZEA 3QHMA 3EDJA 1MWOA 1V3IA 2VR5A 1HT6A 1FFRA 3EMQA 1RPKA 2ZWZA 4W86A 1V03A 4QFUA 3ZT6A 2QMKA 3DHPA 4BQ5A 3PZ9A 3RCNA 3VTRA 1BAGA 5IHRA 2VI0A 4QCFA 3WNPA 4DWSA 5BROA 3N9KA 5AC5A 1UH3A 4HTYA 1W3JA 3ZJ7A 4KWUA 3RO8A 5BCAA 1EDGA 2RGLA 1E72M 2JFEX 2BY0A 2W4XA 4P8VA 2E8ZA 1CLVA 3J7HA 4OUEA 3OLEA 1OBAA 3EMZA 4DUXA 1H3GA 2Q8XA 1C8YA 3OG2A 1GONA 4QLLA 1TFVA 1BYDA 4PMOA 3OLDA 4AD3A 2UY5A 1UQZA 1ZBKA 1J0ZA 2J74A 3GNPA 1PJ9A 4E4PA 1GOKA 1CGWA 3IJ7A 5A2CA 2ZX9A 1Q6CA 2V38A 5E0FA 1C90A 3FY1A 4QLKA 4OJYA 2VZTA 1CWYA 3DECA 1PBGA 2A3EA 5A94A 3DYPA 2W62A 1V0NA 4AIUA 3W6LA 4C7FA 4TTUA 5IFPA 4GZEA 1W91A 2O9TA 1E73M 3U7BA 3UCQA 4KH2A 5DT5A 2W92A 1IZKA 2QMJA 3T09A 5A6SA 5JBDA 4X9YA 3QR3A 4ZXOA 2GVYA 4PMZA 1NOUA 4D72A 1E5JA 3W26A 4IPLA 1V3HA 3W81A 2Y5EA 1FA2A 1WDSA 2DSUA 4CCCA 4PCSA 2ZIDA 5I23A 5D4YA 2C8NA 4D1JA 1CGXA 1HN1A 3WMSA 1JAKA 3UR7A 4CVWA 2PWEA 3VIPA 1ODZA 2OSXA 3BAIA 3VGGA 1QHPA 2VNCA 4W8BA 3D5HA 2OLHA 3M7SA 2V3FA 4GI8A 1J18A 2J7FA 2WMJA 5D9PA 1V0MA 3OLIA 2WCSA 4E8CA 5ABFB 5ABGA 5A6JA 3WMBA 1UKTA 1V6WA 2WMKA 3NDZA 5FL0A 4ZFMA 4V28A 1UA3A 3CZEA 2ZX6A 3WQ4A 3DHUA 1Q6FA 2VVNA 3WF4A 1QI5A 5E9AA 3SCPA 1K9EA 3MUY1 3N13A 5GNYA 5FKYA 3MSDA 3MU7A 2CBVA 2WVVB 2A3BA 4F66A 1V6XA 3W27A 2J7EA 1S46A 4AC1X 1WDQA 3I3BA 2VRKA 4MJ2A 4CD4A 1J01A 3MMUA 1TA3A 4IISA 5D9MA 4UNIA 2Y8VA 1MFVA 1H4PA 1GPFA 4JAWA 3ARRA 1E1FA 3AHZA 3SCWA 1KWKA 2QF8A 4PTMA 1JYXA 4OZOA 1QHOA 1TR1A 2Y2WA 1MW2A 1OWQA 4D6IA 1FFQA 6TAAA 3DYOA 2E3ZA 4PTXA 1XSKA 6A3HA 1ISWA 1ZB5A 2JE8A 4JHOA 5I0DA 4HP5A 2XHYA 4HMEA 1OSEA 2V5DA 4EE9A 2G3NA 2PWDA 3NDYA 3POHA 2YL5A 1LQ0A 1UR1A 4ML4A 4NRSA 2DQXA 1E0VA 4W7WA 4Y7EA 4A4AA 5HBFA 3ARWA 3A3HA 1CXHA 3AMLA 3PBGA 4J3TA 4WIWA 1KXTA 5C8BB 1D7FA 1BVZA 3VO0A 4MB1A 1WPCA 3CUJA 4PBGA 1ISYA 5HPCA 3AZRA 4JFWA 1WB0A 3GXMA 5I5RA 2Z1KA 1NWUA 1YHTA 4UOQA 2XTKA 3W0KA 1WCGA 4TX6A 5AC4A 4OOUA 4NRRA 4X0NA 1V3MA 1DHKA 3GBDA 3EDFA 3I3EA 4E8DA 2PI6A 4W93A 1EIBA 1EO7A 3ZSSA 3VMOA 1GJUA 1ZL1A 2DGAA 1A47A 3K4AA 1JZ4A 3T0BA 5CSYA 1XYFA 2WWCA 4TVUA 3AQUA 1BVNP 4ZENA 3WY1A 1NP2A 2QPSA 1OB0A 2WZIA 1DTUA 2XM1A 4BQ3A 3AJ7A 1E0XA 4JFSA 2YA2A 2QV4A 5CPTA 2WMHA 3T0DA 3WIJA 2HISA 1A3HA 3MMWA 1GQLA 4HA4A 5LA0A 3VVGA 3U5UA 3TTQA 2HVMA 4F9DA 3F5KA 1GQJA 5I79A 4AEFA 3BSHA 3POCA 3PTQA 3WNNA 3WMCA 2GSJA 3LPFA 1UZ1A 1V3LA 3UERA 2GDUA 4AZHA 1VEOA 1DWJM 2FH6A 1GCYA 2XGBA 5D9OA 2E0PA 4OBRA 2ZUUA 4C7GA 2G3IA 5LYRA 1CXKA 2DSVA 3VNZA 8CGTA 1AVAA 2UWFA 7CGTA 1OD8A 3PTKA 2Y24A 3A4XA 2ZUNA 4U5KA 4CU7A 3MS8A 3VIGA 1CXIA 1QI2A 2CETA 3BAYA 2BXZA 2PC8A 2DIJA 4UOJA 1HP4A 4ZEPA 1KXHA 3WEZA 4AW7A 5A69A 2WYSA 3AFBA 5HPOA 3EMCA 2XFFA 3WD3A 1LG2A 3TA9A 1Q4NX 2YKKA 3VGDA 1SMAA 3BCDA 1C91A 3EDDA 3WDPP 4AZIA 3II1A 2UY2A 3SUVA 4QP0A 4AD4A 4YN5A 1ZU8A 1MQRA 1HXJA 4W7VA 2WCGA 1UWTA 1XD0A 1ZJBA 1E55A 1CBGA 1UD4A 2X8RA 2IXUA 1WZAA 4QAWA 2VCAA 2OYKA 1J12A 2CHOA 1GOIA 2FHBA 2A3HA 2WANA 1QNQA 1VBRA 1V02E 3L4YA 4ZE4A 1I1XA 1HL8A 2GJXB 3ZQ9A 4AYSA 5C70A 3CZLA 4UR9A 3VILA 1TVNA 4JL1A 1NWTA 4LQ1A 1B31A 1W9XA 1R7AA 4GQRA 4N0RA 3MUZ1 1GORA 4UZSA 4CU8A 1W3LA 3N1AA 4P7LA 2G3MA 7A3HA 2W66A 2C7FA 1PIGA 3WUBA 1HIZA 1E6QM 3SCOA 1M04A 5DMYA 1CPUA 4OBSA 1UWIA 1IV8A 4Q22A 2ZOXA 4PMQA 1W2PA 5A6MA 1OINA 3QGVA 4W5ZA 3UESA 3WDJA 4AD2A 1MFUA 1QW9A 1NP0A 1DWHM 1UD3A 1JNEA 3W37A 3ZR5A 5CLTA 1PX4A 1PX8A 2EBNA 5FIPA 3M07A 3CZKA 3BGAA 4UOZA 3U57A 4EANA 3GDBA 1DWAM 1H11A 4TVDA 4FMVA 4QDMA 4HU8A 1W9VA 1KB3A 4M24A 3WH8A 4GO8A 2EO7A 1G1YA 4N42A 3BC9A 3BXWA 1KGWA 1KCLA 2ZXDA 1WKYA 1BPLB 1X6NA 4FF5A 3LPPA 2F2HA 2IUZA 4XUYA 1EOKA 5A2AA 4IPNB 5JIPA 1E3XA 1W2VA 4DM2A 3PZGA 4DWSD 1V3KA 3CHCA 3UEQA 2DT2A 4TXEA 1E56A 2XVLA 4TOQA 1WZMA 2O9OA 4P8UA 2J7GA 5E6YA 4RL3A 3AMCA 3WH6A 3NJ3A 4MPKA 3I3DA 1DEDA 1R85A 3RJYA 3BMWA 3AIUA 3VU2A 5I77A 1ZBCA 4TTGA 3AIRA 2E40A 2GFTA 3WEMA 1VRXA 3U7VA 4D6CA 1NOWA 3FW6A 3ARPA 4UFLA 3BAWA 3GYCA 2OSYA 4M80A 3RILA 1QOXA 5GNXA 4OKDA 3KL5A 3WF1A 1CIUA 1F4HA 2CEQA 2ZXBA 4AY1A 1BFNA 3VDBA 1KFWA 1MQPA 2OYMA 1VEPA 1ISXA 4ATLA 2VZOA 2J47A 1WP6A 4OOZA 1QNPA 1EXPA 4BCEA 1OT1A 4AZ6A 5A6LA 3OGRA 1TZ7A 4PTVA 5I24A 2VOTA 3RPMA 4J3SA 1V0LA 3EYPA 1UWQA 1W3HA 4H8UA 3AMDA 4D1IA 2D0FA 4WSJA 1X1NA 1HJUA 3SUTA 4WF7A 2V5CA 4EKJA 4J3XA 1CXLA 4MJ4A 1MXDA 1C3FA 1W9PA 1V02A 2UY3A 4AZBA 4PMXA 2VX5A 4DWSC 3OGSA 1EDQA 1XGZA 2D3NA 2WMFA 2XPKA 5EMYA 4F8XA 1UUQA 2GK1A 3VD9A 1US2A 3RDKA 2UY4A 4JKLA 3ZM8A 2JF7A 1UD6A 2VZSA 4AWEA 1CGUA 3HU7A 2BFGA 1OM0A 3VIJA 1CYGA 1GUVA 3D3AA 3EBVA 1VB9A 3JUGA 1SFSA 3A4WA 3UG4A 4J28A 3OGVA 3VGEA 2EPOA 2VUYA 3L4TA 2W91A 1E0WA 2WC3A 3A6OA 6CGTA 3TONA 5FL1A 5BXPA 1K9TA 4W7UA 4EAMA 2CKRA 4RE2A 3VUPA 1FHLA 2WVSA 4PTWA 2XIIA 1GHSA 3THDA 3VD4A 1FP8A 3WL1A 2OSWA 4CD8A 2EPNA 3ARUA 2YA0A 1BYCA 4UQ9A 3K1DA 3AMKA 5E0CA 4JCLA 3PZMA 1VFOA 4D6EA 2YBTA 1CXFA 4S3JA 1MW1A 4MTVA 1XYZA 1EDTA 3W29A 2WHKA 1BQCA 2YIHA 5LA2A 2F8QA 3OZOA 3N12A 2WCAA 1B30A 3VIOA 1HVXA 1KWGA 4PEEA 1CGTA 3T08A 4CKQA 5CSUA 4PMRA 1WE5A 1OCQA 1WO2A 1AQMA 2VL4A 3ARSA 3VX1A 2WVTA 2ZWYA 5HXMA 3SURA 1V6VA 4YPJA 1C93A 3EDKA 2FHCA 2GJPA 2WNWA 3DC0A 3W25A 4J3UA 3S6TA 3W6MA 2OWWA 1MW0A 1EHAA 1QBAA 3L4VA 4PMVA 1CLXA 3VDCA 4KMQA 2PWHA 3PZTA 4JHZA 4WKHA 4LYRA 1UA7A 4UQDA 3A47A 3CMGA 3TP4A 3MO4A 3WKZA 3RJXA 3EDEA 2DSWA 3PZUA 5CGMA 2O9RA 4CD5A 2VZUA 1HL9A 3KL0A 5DF0A 1ESWA 2BY3A 4UQEA 4U2YA 3N04A 1JIBA 1E4NA 2CIPA 1ECEA 4AZCA 4B3LA 3L2LA 4WK9A 4LXFA 1PPIA 3E1F1 2WSPA 3IAPA 4DWSB 3TTOA 4AMCA 3N18A 1B3WA 2EPKX 3OA5A 3BLKA 4U5IA 1JDAA 2DT0A 1CZ1A 3GM8A 3U5YA 3NIYA 2JF6A 1GOWA 3IK2A 2EEXA 3CH9A 1R7OA 3VDHA 1NWSA 1ITCA 1GJWA 1Q6GA 2ZXQA 3CZ8A 1CEOA 4GPNA 1SR0A 4P7OA 1J9YA 1QI0A 2YL8A 1UKSA 3W28A 2XSBA 3CHDA 1WZKA 1EO5A 2BNJA 1LL7A 4AEEA 3RMEA 1HJQA 1H41A 1HJXA 3PN8A 4LPCA 1GNXA 4CN1A 3BAJA 2EQDA 1E9LA 1QPKA 5JBEA 4JKMA 1CNVA 3PHAA 4KRTA 4Z2KA 1KGXA 3PZVA 5F7UA 3VIKA 2VT0A 4AZ5A 1CECA 1BLIA 3IJ9A 2CBUA 4W84A 1E4LA 1M7XA 3TTYA 2WWDA 2VR4A 1G0CA 1HKMA 2WC7A 4JFTA 2WMIA 4MB3A 1JZ8A 3VIHA 3FNDA 3AMGA 3VM5A 2PB1A 1E15A 3CHEA 4NSBA 4OIFA 2WHLA 1FP9A 1NWRA 1W32A 4B16A 3BLPX 1XC6A 2WMIB 2DSZA 4NZCA 3AIWA 4BF7A 4MNKA 5M17A 2VQTA 2OYLA 3W24A 4NF7A 2C0HA 5GNZA 1XCXA 3S2CA 5CPSA 1IZJA 2VZVA 3WBAA 1EHNA 1UZ4A 3WUGA 3KEHA 3HJEA 4MAVA 1EOMA 4ZXLA 1VFFA 1BG9A 3THCA 3WN6A 3VDAA 1YQ2A 3LPOA 3AS0A 2J7DA 4U3AA 1QVBA 1UWSA 1UKOA 3W82A 1HJVA 3HMCA 3WUEA 1JL8A 1TMQA 4UFHA 1J0KA 1GW1A 1PEZA 1QHZA 1K9DA 4HA1A 5AY7A 2X09A 1UH2A 3GBEA 1XRVA 1J10A 1W1VA 4U33A 8A3HA 2CKSA 4AZ7A 3WD2A 3ZO9A 1US3A 1I1WA 2J75A 2WVUA 4MNJA 2VCBA 3MV11 3OB8A 1BSIA 2XSAA 2FDMA 2W67A 4AD5A 3WF0A 1XHGA 3T2OA 2W61A 5CJ5A 3L4XA 1H0GA 3AROA 2WM0A 4GIAA 1V0KA 4A3YA 4TUFA 3B9EA 1GVYA 3K8MA 1ZBVA 1JAEA 1E3ZA 5IDIA 3VM7A 2VVSA 3AS2A 3WUFA 5A95A 2XUCA 4CCEA 3RM4A 1SMDA 1JD9A 1FOBA 4GI9A 1JG9A 1JNDA 4YHEA 1XSJA 4AIOA 1H5VA 3VGHA 1FH8A 4URIA 1VJSA 4B15A 3VIFA 2YA1A 3BH4A 4MNLA 3AIBA 4V2XA 2NT1A 1HX0A 3AYSA 5HDRA 2EPMX 2PWFA 1XH1A 1JYNA 1NM9A 2CITA 3CBWA 4UZUA 3VGBA 4Z2GA 1CENA 4PRWA 2D1ZA 2DT1A 4MB4A 4CVUA 2D24A 5CGTA 2YJQA 4GZJA 3PZIA 5I2UA 1P6WA 3O9NA 3AS1A 2DIEA 2WBGA 5LA1A 5HOSA 2WSKA 4PSRA 1QBBA 1E5NA 4PUDA 1W1TA 2YDSA 2BHYA 2VRQA 2VURA 1JF6A 3L4UA 1OGBA 4XB3A 2PBOA 3GXIA 5JIWA 5DFAA 2XVGA 3VMPA 3VD5A 1QNSA 1JDDA 4P8WA 4V27A 3MMDA 2V3DA 1RP9A 2XWEA 4D6FA 1TVPA 1BG4A 4MDPA 4LYQA 2DH3A 1BYBA 1E43A 4DM1A 3WFLA 5A6KA 3MKKA 4KGJA 1EH9A 1MQQA 2JEQA 2MANA 5EBAA 4D6DA 1JXJA 3MV01 2ZUWA 1C8XA 1PZ3A 3ZT7A 3NSXA 4AD1A 2ZUTA 1KCKA 4Z2IA 1UKQA 2QPUA 2AMGA 2Z1SA 3BAKA 1JI1A 3W4RA 1DP0A 3FHQA 3N15A 3ARZA 3FAXA 3MUIA 1Q6DA 1RH9A 1XH2A 2WVVA 4P7NA 4CGTA 1Z32X 1GOOA 2BXYA 2B31A 1CGVA 2D0HA 2J7HA 1V08A 2XIBA 1AMYA 4BA0A 4XX6A 2WBKA 4KGLA 1UR0A 5ABHA 3VD3A 5JBFA 1XSIA 4E2OA 1W9DM 2YLLA 1N82A 1HKIA 1C92A 4DUWA 1UH4A 2VCCA 3AXIA 1DWGM 4CD7A 1VF8A 3SCQA 3WQ8A 3ZJ8A 5A8NA 4P7RA 2JALA 2YL6A 3O6AA 3CPUA 3WQ5A 1LWHA 4M29A 4MADA 4UQCA 1E4MM 3WQWA 3WENA 5IXEA 1R86A 4M56A 2YDRA 3VKKA 1LF1A 4R5EA 3QOMA 1UWRA 3VMNA 3MSGA 1DWFM 1OGSA 1UKPA 4LX4A 4KRUA 1H09A 4PN2A 1KBKA 3OLGA 4ATWA 2XVPA 3K46A 4WSKA 5CQ1A 3ARVA 1WNOA 1B0IA 1W1YA 3T2PA 1ISZA 1ZS2A 3MANA 4H41A 1E6ZA 4QCEA 1KXQA 2D20A 3BSGA 3A4AA 4GI6A 5ECUA 5M03A 3ARTA 4LGXA 1NQ6A 5FOOA 1C7TA 1J0JA 3WSUA 5ABEA 2BS9A 4JIEA 4AD0A 2WC4A 1UWUA 4M81A 4HPHA 1UR9A 2BVDA 3FN9A 2ZICA 4W5UA 5D8WA 2GDVA 4W85A 2VTFA 5D8ZA 2WW5A 2CPUA 5GPRA 3CHFA 1KGUA 2FHFA 4H8VA 4ACYA 2DH2A 2E9MA 1HVQA 5M3WA 4UFJA 1ITXA 1VIWA 2O92A 3CMJA 4PMDA 1V3JA 5EB8A 4CUCA 1K9FA 1KR0A 1RP8A 5A6BA 1G9HA 4JL2A 1CXEA 4FLSA 1B3ZA 3PTMA 1WDRA 3UG5A 4R27A 3T2QA 2VJXA 3OBAA 1MXGA 2J79A 4ACZB 2XWDA 4J3WA 3CUHA 3WDRA 3AXXA 2A3AA 4HOXA 4HOWA 1M53A 4GO9A 3L4WA 2JEPA 2CERA 1O6IA 2DT3A 5CG0A 1AQHA 1WAWA 3WNOA 1H1NA 1E1EA 1Y7VA 2CESA 3IJ8A 4ACZA 2ZX8A 3WD1A 2D3LA 2WAGA 2AOSA 3WDIA 1HJWA 1UG6A 3AISA 3GXFA 5TD4A 4TVCA 4CD6A 3FXYA 4UFKA 3N11A 3VGFA 1I75A 1B1YA 5A8PA 2PF0A 2CCRA 4XZBA 4UFMA 5IFTA 3O2LA 4GINA 4XV0A 4HMDA 3ZMRA 4HU0A 3ECQA 1G01A 4FK9A 2V3EA 3CUIA 3OZPA 2BV9A 4Z2JA 2AAAA 1E71M 3ZOAA 1F4AA 3SCRA 1G94A 3RM8A 5BYWA 4J7RA 5EFFA 3GH5A 3ZIZA 1W9BM 1KBBA 2VRJA 4W8LA 4P7QA 5BRPA 3K8KA 1GHRA 4YHGA 2X1IA 5BRQA 3WD0A 2RGMA 3WELA 3VIMA 1MVYA 1PAMA 2XM2A 1J0YA 2JIEA 1VENA 3G6LA 1W3KA 3WDHA 4UQBA 2VC9A 1BYAA 3IANA 5BXTA 4J27A 1JDCA 3WEOA 1FH9A 1B3YA 3PZOA 1R8LA 3L2MA 4RE3A 5KZ6A 5I6SA 1ISVA 1PX3A 2A3CA 1JFXA 4D6GA 1VBUA 3K4DA 4HMCA 3ARQA 4MAZA 1X6LA 3LPGA 2XVKA 2WHMA 3QOKA 4B9YA 2ZUVA 2GUYA 1SYTA 2J8GA 3NSMA 4PMUA 3WNLA 4PSPA 2GJXA 2ZE0A 3VNYA 2VX7A 1E6SM 4FLRA 2VX6A 4GKLA 5M5DA 1ZJAA 1JD7A 3WH5A 1JZ7A 3WBEA 3ARXA 2PBGA 2BY1A 1U2YA 5A6AA 1VEMA 1KQZA 1VAHA 2QHAA 3OIHA 2XFRA 1WDPA 3PZNA 4MDOA 4HZ6A 4BS0A 2YOCA 1LJYA 1OGGA 1TUXA 2GJRA 3KZSA 4UTFA 1W9UA 1VFUA 1G5AA 4M1RA 5KEZA 3ALFA 1E6NA 1B2YA 2NSXA 1V6YA 1RD6A 1UQYA 2E4TA 1GVIA 1QW8A 3VPLA 1PZ2A 4WLCA 2ESCA 3WDQA 3KWXA 4FLQA 4PMYA 2VMFA 1MW3A 5E70A 4D71A 1TG7A 3NUKA 1ODUA 4W8AA 3SCSA 4W88A 3MUAA 3FHAA 3F5JA 4Q7NA 2BVTA 4W87A 3CTTA 1O7AA 1WZLA 3WQ6A 3GZAA 5BXRA 1EQPA 4QLJA 1UD2A 2WZHA 1UD5A 1UD8A 2BHUA 2YDQA 2O9PA 4PMNA 5A6BD 2EJ1A 4AXNA 2DSKA 4B3KA 2QLYA 5HNNA 5A2BA 1W1PA 1CGYA 2CXGA 4A3HA 1BF2A 2X0YA 3CUFA 2CBIA 1OIFA 3DYMA 1HJSA 7TAAA 1GOMA 2F61A
chains in the Genus database with same CATH superfamily
3R79A 4F48A 1LBFA 3DKLA 1A50A 1OX4A 1KBIA 1JXKA 4D6HA 4M8UA 4S3KA 5CBIA 3VNKA 4EAYA 4HZ7A 1M7PA 4FOKA 4HK5A 3BV4A 4Y6GA 3BV7A 2YSWA 2O7SA 5H8UA 3TW9A 3SDOA 1X39A 3TTEA 1EGZA 4MKNA 5DO8A 1OCBA 3N17A 4KEUA 3VFLA 3KHJA 3NYDA 4U31A 3B9AA 3LMYA 3DN5A 3ZT5A 2J78A 4NHVA 4NY2A 2BVYA 3QGAC 4H7VA 5DT7A 3QHOA 2ZA2A 3S8HA 3VI2A 5C55A 1LWJA 4LYPA 4Q8QA 3CB8A 4JN6A 2J13A 3FJ6A 1HF6A 1KQYA 3CUZA 4RE4A 2HVNA 1XLJA 1UYQA 1FHDA 2QJJA 4KEZA 1R3WA 3SO7A 1F7BA 2WB5A 4ONVA 2W5FA 1ZALA 4U2ZA 1TJPA 2I9UA 3BQ5A 2DDXA 1VJZA 5C71A 3LUTA 4HBKA 4MB5A 4LS0A 1DL3A 4XAGA 1CI1A 3AXHA 3GK0A 3P2VA 4IUGA 4JX5A 3ITLA 2ONEA 1VCFA 7REQA 3N9RA 1S2AA 1OFDA 2YL9A 2XJ7A 3VZYA 1S39A 3A24A 3WF2A 3SGUA 4G7FA 3B9DA 5EMUA 3RM9A 5T91A 4XZ9A 3EOEA 2GK1B 1HNYA 1HO1A 1QPOA 4LAKA 4HN4A 1J93A 4UQAA 3W53A 3MSYA 4WZHA 1QNOA 2EGZA 4O16A 1IR1A 2CBJA 1HP5A 5L9FA 1UR8A 2JIWA 4GZIA 4L4PA 3RYSA 4MHBA 3M46A 3TQKA 1UHVA 1UJPA 3TR2A 4X3ZA 2HRWA 4ZE5A 2OPJA 1NOFA 4XAYA 1W3TA 2XYLA 1HKKA 1RZMA 5JMUA 4XAFA 1OG0A 4IFOA 3BMVA 5F1UA 2X2YA 1TJ2A 5HMEA 1ALDA 4PCTA 3CAQA 4JTRA 3IUDA 2VEGA 4J3VA 2NW0A 4NI3A 1E40A 1NH6A 3CPGA 2QCNA 2ZZ5A 4ROPA 3WH9A 1O5XA 1TO3A 3AI0A 1D2KA 4IQJA 1OD0A 1M7OA 3KTSA 5CXPA 2DW7A 1QOPA 1PHQA 3RXZA 1B9ZA 5HR7A 4AQLA 1KBJA 3EPOA 4QM1A 1ZAJA 2QGHA 4I8YA 1WKEA 3LI1A 3TE9A 3RLHA 3SCUA 3IWPA 1BKSA 3UXDA 5HULA 1M41A 2EG8A 3MKVA 3UJFA 4IQLA 4TU1A 3VD7A 5AKQA 2RDTA 4NXKA 1FWBC 3QV6A 1T8QA 1M03A 2DJLA 4HZ8A 2C14A 1LROA 4KT2A 3L0KA 3QSTA 1MMFA 2W63A 3HN3A 1XLFA 3SCTA 3L65A 3NCOA 3SCNA 1TMLA 5I78A 2YLAA 4MUPA 3FOKA 3T0AA 2YXOA 1TCMA 1RJPA 1YPFA 4C7DA 1C8QA 3WFZA 1V6UA 3F2BA 1TA3B 3TN4A 3W1XA 3PR2A 4ZOCA 3GSMA 3DGBA 4GGBA 6TIMA 4IIDA 2CNCA 3INPA 4JXCA 3PK7A 4CNNA 2NT0A 4HYWA 1OIMA 2R1MA 3DOPA 1XS2A 3MI6A 5D2WA 3PJXA 1MXSA 2Y1HA 3N6HA 4K1GA 3VOCA 2ZE3A 4S23A 4YLWA 2VD9A 4KESA 4A35A 2XZ7A 1K4GA 4HKPA 3CL6A 1J6PA 2D2JA 3MDUA 1KKOA 5AB3A 5LKYA 3S2NA 2NSOA 1BTCA 5G1TA 4DUVA 2G8ZA 2C13A 4AX7A 3GIYA 4XKYB 3RCYA 4HJWA 5CLWA 1D3CA 1U33A 1T96A 3W86A 3TH6A 3GXDA 1UUOA 4GXMA 3G18A 4OT7A 1J8VA 4TV6A 3WNKA 3L4ZA 3N3MA 4KBXA 2ZUMA 3E0WA 1QI3A 5DEZA 2QYGA 3ZSTA 3CLWA 3MQTA 2OWCA 1TWZA 4DBDA 2E9BA 3GH7A 1JZ3A 5CC6A 3UCCA 3NWRA 1E6XM 1Z41A 1X38A 1H1YA 4CN6A 4JQ1A 4NAEA 4CCDA 1ME8A 3CYVA 4BQ4A 1WBJA 4JTGA 3WL0A 4IM4A 2ZYFA 1FWWA 4Y9AA 2J66A 3CZJA 4QJ3B 4XZMX 2PS2A 5K9XA 2VR5A 1NELA 3CM4A 3BVJA 3A5FA 1BRLA 3EMQA 1KC7A 1HFBA 4QFUA 5GJMA 3QMTA 3VNJA 4J5NA 3DHPA 3PZ9A 4FP1A 1BAGA 2FFCA 4EX4A 3NAVA 2BGSA 4JQAA 3N9KA 5AC5A 1UH3A 1K8CA 5BCAA 1EDGA 4XAPA 3NO1A 2YZ5A 4R88A 3TNBA 3ZFHA 3T0CA 1SZGA 2BY0A 4P8VA 3S0CA 2VDGA 2ZFAA 3S5YA 3OVRA 4O4VA 2JBMA 1EYWA 3QFEA 2Q8XA 3GFZA 4R53A 3E5PA 4JIHA 1R3QA 5BRBA 4QJ1A 2PDFA 1XL9A 4JTQA 3GNPA 1IWAA 4L1GA 3M0KA 3VC6A 3XISA 4EACA 3EOSA 5E0FA 4PUNA 3FY1A 1JULA 1CWYA 5D33A 1P0DA 3UXKA 4C6PA 3NA8A 2ZZ4A 3U48A 3DYPA 1V0NA 4AIUA 1L8PA 3W6LA 4C7FA 4TTUA 5IFPA 5BWAA 1W91A 2PDUA 3UG8A 1MRQA 1XLMA 4RK8A 3W2LA 2W92A 5A6SA 5KZMA 1GYLA 4PMZA 4WCJA 3CB3A 2NXHA 4LNCA 3N14A 3DENA 3R43A 4IPLA 1PZ1A 2PE4A 3LTPA 3P14A 2YCJA 3W81A 4RW5A 3OA3A 1OY0A 3FIGA 4CCCA 4PCSA 1EKOA 1OF8A 1CGXA 3QR1A 4ADSA 1RSCA 1H7XA 1JAKA 4CVWA 4LANA 2PWEA 3VIPA 3MVTA 3UFYA 2VNCA 4PB4A 2OLHA 3NVDA 4HNLA 2EKGA 5JH2A 2V3FA 1IYXA 2J7FA 1MUCA 2Y85A 4PTNA 2BXVA 1V0MA 4GC3A 3OLIA 5D9PA 4E8CA 1V6WA 5TQLA 3BE7A 3WQ4A 1Q6FA 2DZWA 1QI5A 3SCPA 2VDIA 3A3WA 3KAOA 3M5YA 2OR2A 4F66A 3CWNA 3FSTA 2J7EA 1S46A 3N29A 2VKZG 3SECA 4Y8EA 3MMUA 4DBEA 3W9ZA 4NX0A 4NX5A 5D9MA 3QZEA 4UNIA 2Y8VA 4ZQCA 2PTYA 3NM3A 1S2WA 3QZ6A 4BR1A 1GPFA 4ZB2A 4JAWA 3ARRA 5DX7A 5EYWA 1K7FA 2QUVA 4PCPA 4PR4A 2FZ9A 4PFMA 4V33A 2PPGA 4OZOA 5AYYA 4ZOBA 2Y2WA 4RPPA 2E3ZA 4IX0A 4LBUA 1XSKA 3QN3A 1ZB5A 2JE8A 3O0KA 5ABTA 4JHOA 3M0JA 1UP2A 4A22A 4HP5A 1VFTA 4QE4A 4EWND 4H6RA 2G3NA 3HG2A 4TX9A 2PWDA 3NDYA 3MTWA 1K70A 2DQXA 3H23A 4Y7EA 4A4AA 1TTQA 5HBFA 3QY6A 3R89A 2QJHA 4J3TA 4KPLA 2INEA 2IPJA 4WIWA 4S3CA 5C8BB 1BVZA 4WY0F 3AZRA 1WB0A 4LY4A 1U1HA 4REQB 3GXMA 2FTPA 3M5XA 1EFZA 1NDYA 3P6LA 1R5YA 3EDFA 3I3EA 3A9BA 4S38A 1LT7A 4W93A 3CAVA 4S1FA 1H61A 1EIBA 1WQ5A 3N6JA 4XBSA 3ZSSA 1LTDA 1KNWA 3JZUA 5CSYA 2CU0A 3CPRA 2WWCA 3OW1A 3L21A 3FJLA 5EMMA 3H2NA 4ZENA 2DZAA 1NP2A 2QPSA 3IVSA 1OB0A 5JVLA 3TK7A 1J5SA 1P0KA 4BQ3A 2B81A 3AJ7A 4JFSA 4GZ7A 5CPTA 1I0BA 2WMHA 2E7FA 1J2BA 1A3HA 2NX9A 4H6EA 1QU4A 3CWOX 4HA4A 4RW3A 4F9DA 4N4QA 4AEFA 1ZAHA 4QDPA 5KTLA 3WMCA 1QPRA 2Q8ZA 1TIWA 4AZHA 1DIOA 1KLYA 4N7QA 3N2MA 2FH6A 1M6JA 2XGBA 1IEXA 2YR1A 2GUUA 1I4NA 8CGTA 1JUKA 1AVAA 1PTDA 4PUMA 3M0LA 1OD8A 3TYUA 1JPDX 2NVCA 3VIGA 2BX7A 3P5ZA 3R1ZA 4KFPA 1UROA 1KXHA 4AW7A 4AXKA 1EYEA 2XFFA 3WD3A 1S2TA 3ITVA 1L6YA 4XIMA 1C91A 3MDWA 4FAMA 3WDPP 2C16A 4FNRA 5AC6A 3Q45A 4AD4A 2BLEA 1MQRA 1HXJA 3MYOA 1UWTA 4KF1A 1OCNA 2WNZA 3W2UA 2FB2A 4OFCA 1UD4A 1RVGA 4NYYA 4Q4SA 1U1UA 2VCAA 4GX9A 1J12A 2ACUA 3PAJA 1YYAA 3GVGA 3NL6A 1GOIA 4Q8VA 2FHBA 3C3NA 1E0TA 4S3BA 4PC8A 1UPMB 1MNZA 3EAUA 8RUCA 1TVLA 1I1XA 2GJXB 3ZQ9A 5F4WA 2OXNA 4JL1A 3G8RA 2NUWA 4PTDA 1SVDA 3Q65A 3TLQA 4LAZA 1VQTA 4I8DA 4N0RA 4AWSA 3U2CA 4CU8A 6XIMA 3SGGA 2PGEA 4E3TA 1RVKA 4HNOA 1H5YA 4WVXA 2X42A 4NQ1A 4I6VA 3NQGA 4MLRA 5DMYA 1KFBA 3M0XA 1IV8A 2ZOXA 4PMQA 5TBOA 2QF7A 1LWIA 3UESA 1IWPA 3WDJA 3CNYA 4ZODA 4QJ4B 1UD3A 1JNEA 3ZR5A 3TFXA 1EJSC 1DWAM 1IEVA 1XPYA 2VDHA 3VCRA 4Q6XA 4K2SA 4KCUA 3DAQA 3NG3A 4FMVA 1DJIA 3DUGA 5AHLA 5HUOA 1K02A 1KB3A 1N55A 4E8GA 3WH8A 4ZSTA 1U5VA 1RQHA 3BC9A 1JQVA 1KCLA 1BPLB 2NUXA 5TF0A 1FKWA 5A8GA 1QMLA 2Q8LA 5JIPA 1Q8AA 2GLKA 3EKLA 3LSCA 5BMWA 4DWSD 1RA5A 3QR0A 3CHCA 3O7UA 2QIIA 4TR9A 2XVLA 4JGDA 1NFGA 4NJHA 4RL3A 3NJ3A 2ALRA 3FYPA 1N8FA 3TR9A 5K7JA 3W7RA 5KINA 3FW6A 3ARPA 4UFLA 1FY6A 3LXBA 3S1VA 3DKJA 4Q8NA 3KL5A 3WF1A 3KRBA 2Z0IA 2CEQA 5F2GA 3VDBA 3TYCA 1VEPA 1X8FA 3LG3A 3S5SA 1OFEA 1EXPA 1J79A 3VNIA 4AZ6A 1F6YA 2BSLA 2QGYA 3OGRA 4DJEA 1TZ7A 4Q4QA 4AWUA 4PTVA 1ZNNA 3SFWA 1V0LA 1W3HA 1I2NA 2D0FA 3BJTA 1L6GA 2V5CA 1O68A 4EKJA 2KZHA 1CXLA 2PDCA 1MXDA 4DB7A 4Y8FA 1V02A 2OELA 4R33A 3O6YX 1P6BA 2VX5A 1EDQA 4ZZ9A 4E4FA 2OEKA 1H7OA 4OTKA 1UUQA 5PTDA 4ADUA 2XIOA 2GK1A 3PNUA 3VD9A 2V81A 3ZM8A 3HU7A 3E0VA 3TJ4A 1CYGA 1GUVA 3EBVA 3IIPA 3W7CA 3O0FA 3A4WA 7REQB 2VUYA 2W91A 2HWGA 3ZWSA 5T9CE 3TONA 2W0UA 3NPUA 2CKRA 4EAMA 1FHLA 2WVSA 4PTWA 2BOGX 1C9DA 4C6EA 3VD4A 4S3DA 3WL1A 3L5MA 2OSWA 2EPNA 3PS7A 2NV9A 1U5HA 3AU2A 3ARUA 4MGGA 2QCMA 3ITOA 3MI3A 2ISWA 3BL3A 4L5ZA 3EB2A 2L5HA 3ELFA 1JQXA 4D6EA 2YBTA 4J3ZA 3S1UA 3A3XA 3G8EA 4MTVA 5F4XA 1TPDA 1PKNA 2CW6A 2ATMA 5LA2A 4REQA 3IJLA 4JYDA 2F8QA 3B0XA 3KOZA 4YTSA 5AYZA 2WCAA 1R3TA 3S83A 2DY3A 4K8HA 3VNDA 4JTTA 2R94A 2QUNA 4IFKB 4CKQA 1WE5A 1AQMA 1QTWA 1W8GA 3H2FA 4PODA 4QDWA 1C93A 4GJIA 3RU8X 4K1WA 2INFA 2OOFA 3S6TA 3QKZA 2HQAA 2VGFA 3L4VA 1CLXA 3M0IA 2Y5SA 3PZTA 3WBWA 1AK5A 4JHZA 4ERIA 5KMYA 3GAYA 4UQDA 4ZSUA 3CMGA 4WY0A 2R6OA 2DSWA 3EEGA 4M6UA 2BY3A 3B9NA 4U2YA 3U4FA 1Q63A 1L6SA 2Y8UA 4GYKA 3L9CA 3QF0A 3EWWA 3E1F1 3PPCA 3MSRA 1B3WA 1YTDA 1K8ZA 1YXYA 1KTCA 5I3GA 1JDAA 4AX6A 2PD9A 3IGHX 1DIDA 1CZ1A 2IKJA 4I7WA 3U5YA 4DF1A 3B9OA 1EUNA 1XXXA 4RCXA 1GOWA 1R7OA 1NWSA 1GJWA 1B57A 2NX3A 1RK6A 1CLKA 1K77A 3CZ8A 3M9YA 1SR0A 2WJDA 3LLDA 2W9MA 2YL8A 3C61A 4IL2A 3F4DA 5FJOA 2NWRA 4X2PA 1OC6A 2BNJA 1HGYA 3XIMA 4IT1A 1H41A 2HDJA 4LFYA 4N2YA 4BI7A 3D0CA 1E9LA 5BU6A 5JBEA 3U0HA 3GIPA 4Z2KA 5F7UA 1RR2A 1CECA 1VH7A 1E4LA 1M7XA 2YZRA 4XZNX 2WWDA 4PBEA 1WDWA 4GIEA 3C2EA 2QCDB 3AMGA 2X30A 1W5NA 2PLJA 4UR8A 1VP5A 1NF0A 4OIFA 2BMBA 5DRIA 2H8XA 4GKTA 3HIJA 3LGGA 4Q4KA 5C9XA 4B16A 2HS6A 3BLPX 4H6KA 2WMIB 1EJWC 2OMAA 5FJIA 2PD5A 4C1NB 1QAPA 4O53A 1FDZA 4MNKA 5M17A 2VQTA 1UIOA 2OYLA 4AAJA 2VZVA 4HSHA 3HJEA 3ANUA 4LEFA 2FVLA 2GOKA 3NFUA 4BK9A 1XQKA 1AJZA 3CAWA 4AU0A 3WN6A 4HNUA 3P7YA 3DU0A 3H24A 4KKXA 1W17A 4H9XA 5F2IA 4KFOA 1XQLA 1G67A 1J0KA 1QHZA 1YDOA 4AIBA 2X09A 1UH2A 4I9AA 8A3HA 2VC6A 5I02A 3ZO9A 2XSXA 1SO3A 1I1WA 1R46A 1H1ZA 4MNJA 3MV11 3OODA 1BSIA 1XLBA 5D37A 1M3UA 2FDMA 4XSMA 3WF0A 2W61A 1O5QA 3TQVA 1EPXA 2QXWA 4Q7BA 3BUVA 3VCNA 3A23A 1HTIA 3JW7A 4GIAA 2VWTA 1V0KA 3B8VA 3VOJA 3K8MA 2ZTKA 4JD4A 3VM7A 1XUUA 2VVSA 1PCKA 3APTA 2X7WA 5A95A 1R2TA 4GI9A 4JQ2A 1T7LA 1Y8BA 4AYGA 1VJSA 2P88A 4B15A 2CFFA 2FYMA 1TWSA 3VIFA 4HQVA 4YWSA 1JR1A 2RJHA 4IH3A 3V0SA 2NT1A 3AYTA 3RX2A 2ZRVA 3AYSA 2HK0A 1XH1A 3CBWA 4UZUA 3VGBA 4Z2GA 2NXGA 1N2VA 4PRWA 3LRLA 4IIEA 4MB4A 4CVUA 1YADA 4GZJA 3PZIA 5BOEA 3C0JA 3O9NA 1GYNA 3AS1A 4NAFA 3OEXA 4DBSA 2QCDA 1OF6A 3MCMA 1PTGA 3GR8A 5I3KA 2DZTA 3WQEA 2WSKA 4XVDA 4PSRA 2RDUA 4PUDA 4LNYA 3VOFA 1MEHA 1TWDA 3L4UA 5CSSA 4QBXA 3GXIA 1KM4A 3VD5A 1JDDA 5C6MA 2V3DA 3C4UA 4LYQA 3JS3A 1BYBA 2IKHA 3MKCA 3HG5A 4K3ZA 4MWAD 5A6KA 3MKKA 4KGJA 1OG6A 2JEQA 4QE1A 3KRUA 1V7YA 2MANA 1W1B1 3E0FA 1W5QA 4MYXA 3DHDA 2ZUWA 1C8XA 4AD1A 1KCKA 3PWAA 1ENUA 1UKQA 3L0GA 2OFJA 3HPXA 1IT7A 1JI1A 5DCDA 3PBYA 4LY8A 1XYBA 1YRRA 2BB0A 3LCIA 2WVVA 5FJPA 2B31A 2J7HA 4KWOA 1V08A 4Y9MA 2GGHA 2WBKA 2EKCA 1THFD 1W54A 1T40A 1FVPA 1UR0A 3G1SA 3O63A 3VD3A 1HKVA 1XSIA 1W9DM 4LV4A 1YIXA 3M0ZA 2E6FA 1HKIA 3F2CA 5HK4A 4DUWA 2VCCA 4DJDC 4ROQA 4Z08A 2PDKA 1PE1A 3NXFA 3TC7A 1PSCA 4LAOA 4FF7A 2GSHA 1YNYA 3G3DA 4P7RA 3TN5A 4EPBC 2YL6A 3O6AA 3WQ5A 3CT2A 4HU3A 3C52A 3VKKA 2CXEA 4R5EA 3VMNA 4LX4A 1AG1O 4PN2A 3OLGA 4ATWA 4DNMA 1YNPA 3LI0A 3B3DA 3KOWA 1KV8A 4XSLA 4O11A 1ZS2A 3FA4A 3N34A 4H41A 5LSMA 1KXQA 2D20A 1EF3A 1OCJA 3HM7A 1C7TA 4J2PA 4IZGA 1UZDA 1F3TA 2YB4A 5ABEA 4AD0A 4XG1A 3EKZA 1GTEA 1UR3M 1YEYA 4MYAA 1J4EA 4W85A 5ENLA 2GDQA 5GPRA 3CHFA 2FHFA 2AGTA 1XRSA 4CNUA 4OHQA 4XD6A 2E9MA 4H7CA 4AF0B 3P3BA 3QPEA 2O92A 4PMDA 1V3JA 3W71A 1K9FA 3IVTA 5A6BA 3TC3A 2NUYA 1A5CA 2YCEA 4L56A 4GCXA 4JL2A 1W1IE 1KRMA 4GY7A 2Y7DA 1ZZMA 3A13A 1WDRA 2W27A 1VPXA 2J79A 2DUZA 1C9WA 4J3WA 1O1HA 1W31A 3WDRA 4HOXA 1VRDA 3GTIA 4ZOAA 5CG0A 3BLEA 1AQHA 1WAWA 1OADA 3IJQA 2ZX8A 4LB4A 4N6EA 1HJWA 1UG6A 5FF3A 5HMDA 4KCTA 2Z1VA 2CCRA 4XZBA 3MO7A 4UFMA 3NL5A 2FVKA 1D9EA 4XV0A 2J9YA 3CQHA 4ADTA 5HJLA 2V3EA 2Y7FA 2VGBA 3OZPA 2BV9A 2AAAA 4O0ZA 1REQA 3SCRA 3T9PA 1PXGA 1KM3A 1WA3A 2E67A 7ODCA 5KITA 1NDVA 2HS8A 2B7PA 5JQ9A 4R7OA 5BRPA 4WXZA 4CQDA 1DJGA 4AB4A 3VIMA 3F2DA 3V5CA 2XM2A 4ML9A 2JIEA 1VENA 3G6LA 2V9DA 3KXQA 2VC9A 3W7KA 2ALDA 3IANA 4WSHA 1AMKA 1DOSA 4P5UA 5DRCA 1KCXA 1OX6A 1R8LA 1TB3A 4RE3A 5KZ6A 1EA0A 3SB0A 4F2BA 2A3CA 4M6QA 1ONEA 1AH4A 3ARQA 4ZQPA 2XVKA 1Y65A 1DVJA 3IV3A 2GUYA 1SYTA 3PC0A 2BDQA 2VX7A 1E6SM 3NVTA 5E1QA 4FLRA 5M5DA 4I6KA 1DJWA 1S2CA 1JZ7A 1XGDA 2Z6IA 2BY1A 1U2YA 4DYKA 4JTEA 5A6AA 3LYEA 3OIHA 3EX6A 2XFRA 4DELA 3OIXA 2V30A 3KS6A 4BS0A 2YOCA 2Z1BA 2H9AA 2CLPA 5D09A 3V5FA 1W9UA 1G5AA 4M1RA 5KEZA 5CPLA 3ZVHB 3U2EA 4ZMGA 5MHBA 4MSSA 1UQYA 1PB0A 3S5ZA 4WRHA 3DC8A 3DX5A 1GVIA 3VPLA 3LRKA 3KWXA 3L7RA 1MW3A 3W70A 4D71A 3IGXA 4HHMA 1FWRA 2R1NA 4YCOA 3FHAA 1A5OC 3CTTA 2GWGA 3WQ6A 3SW6A 1A53A 4I5RA 1XGEA 1UD2A 4DRSA 5LGZA 4IFRA 3WO8A 1H60A 2P8BA 4H01A 4PMNA 3LTSA 1TPWA 3TX9A 4DZAA 4AXNA 2QLYA 4B2DD 5HNNA 3OZYA 3H8AA 1UP3A 4HYRA 4A2RA 2PZNA 2CBIA 3TW7A 2F61A 1B4EA 1ZJIA 5DBUA 1PZ0A 1TE1A 3NSNA 1AA1B 2BHZA 2YDAA 1V7AA 1JYVA 3IAQA 1Q45A 2XGIA 1SQ7A 2WJEA 5HATA 3ZWTA 3OBKA 1P43A 4MNMA 1UR4A 3TTSA 1I45A 2VOMA 2PODA 3R12A 4FXJA 4WJXA 1QI4A 1JI2A 3BW4A 2CHRA 3SCVA 1IT0A 1JGMA 5CC7A 3KL3A 3EGJA 1OFRA 1YPIA 1LL6A 2R1KA 5FESA 5J5DA 1IEIA 3CASA 1AD1A 2E5BA 5CPMA 1N8IA 4C91A 4JFVA 3VFCA 4MUZA 5IBXA 2V5LA 1BHGA 4OBTA 1XD1A 4IWWA 4H9YA 4L4MA 4WKAA 2I57A 3BTNA 2E28A 1EJXC 3B0YA 3E02A 3UCDA 3QFWA 3PSWA 3NQEA 2VGGA 4XVEA 4IPPA 2OWXA 2DZSA 5C5YA 1P1MA 1XIEA 1KXVA 2D22A 3W3OA 2PUZA 3GZ3A 5A8QA 4LRSA 5FCZA 3HBLA 4D6JA 2ACQA 5E09A 4DLFA 3QC3A 4RE0A 3W22A 4BY3A 1U22A 4J4KA 1A3WA 4DO6A 3GNOA 5HJYA 2X40A 4CU6A 1L6WA 1LDCA 4H8HA 2X0HA 3UWQA 3QXBA 3QMSA 1OEPA 4DBUA 1B54A 3PY2A 1XH0A 1VBJA 5I3DA 1DWIM 1W1A1 1LG1A 1O4UA 2J8FA 5EKYA 2XN1A 5CZJA 2TAAA 2X0SA 1LT8A 2IPFA 5FAJA 3ORWA 3K8LA 1TZ9A 1RUSA 5AHFA 4ZTYA 3CIVA 2C91A 4L6DA 2C79A 2XIJA 4CN4A 4MOZA 4TMCA 4QISA 1KTNA 4BZYA 1GZJA 3LHWA 1Q6EA 2WPGA 3V36A 4WY0B 3THQA 5HNUA 4BHYA 1QCWA 1UP0A 3ENLA 3MYPA 2PGFA 4IIGA 5BWFA 3O3RA 3OVPA 1AW5A 2WHJA 3KW3A 1Z69A 3RIKA 1Q66A 3AC0A 1RY8A 2WKLA 2X2GA 4QEHA 5FD0A 4Z1YA 3BK0A 3ID7A 2PC4A 2NLIA 4QTGA 4NZ3A 3NQ8A 5GQBA 3PUOA 3N4FA 1VFHA 1E9IA 2G3JA 3T05A 4OVXA 4EPKA 1TYGA 1FH7A 1RQEA 3QHNA 2V82A 1GZ1A 2OGJA 3O6DA 4LBRA 2YYUA 4DI9A 1AZ1A 3F4VA 3OQEA 4BF5A 4N9EA 3MPGA 3QQWA 2HE8A 3AICA 1BEUA 1W6TA 1IT8A 1S5NA 1EQCA 3VKCA 4L9XA 4F3HA 2CYGA 4YIWA 4I9JA 1W0MA 3N73A 4NG3A 5EA9A 4FNSA 5I09A 1SW3A 4IG2A 1K03A 1GVSA 4LJ3A 2ICSA 3N2BA 5HQEA 4AIEA 3GUWA 1XV8A 4HSNA 1JZ6A 4QIUA 4LRTA 2FGLA 3NQAA 1TV8A 2E9LA 3BAXA 4UFIA 2WXDM 4JY9A 4C5ZA 1E6PA 3ARYA 5CPNA 4PUKA 1B3XA 9CGTA 1ZP4A 4LC8A 1GOQA 1IE7C 3AHVA 3IIXA 3VX0A 1B3VA 1ML1A 1JCTA 5EFDA 8XIMA 3P5YA 3C2RA 4W89A 1H0IA 2WNQA 3FAWA 4L1XA 3TJIA 1JCXA 3HFTA 2XGZA 1RPXA 1A80A 4GLEA 3F4NA 1XLIA 1VGAA 2HXTA 1R0MA 1BGGA 4O1CA 1K6AA 3S5NA 2OX4A 1E6RA 4PRRA 4M82A 5MKGB 4NAEB 4US5A 5F2LA 1HT6A 4L4LA 1XG3A 2JKEA 3VKJA 3ME3A 3R4IA 4DJDA 4BQ5A 3UPBA 3RCNA 3BQ6A 5IHRA 4QCFA 3WQPA 4CQAA 1X6UA 4GVHA 1W3JA 3G3MA 3G1VA 2PEVA 4KWUA 4RR4A 3ZJ7A 3GHRA 1B4KA 1TELA 1Y5VA 2JFEX 2I17A 3L68A 2CLEA 2X1RA 1S1PA 1CLVA 3J7HA 4OUEA 2WZMA 4M6VA 1LOLA 3OLEA 3M5ZA 1H3GA 3DFQA 3C2FA 3O07A 2C1GA 4PMOA 3G77A 4AD3A 3EWBX 4TMBA 1ZBKA 3AUJA 1Y5XA 1TJ1A 2J74A 2R1LA 1GOKA 1CGWA 2PURA 2ZX9A 1Q6CA 3P60A 1EC7A 4IX2A 4QLKA 2VZTA 1OFPA 3DECA 4PL1A 2A3EA 3EA1A 1PHWA 3QQ1A 4GZEA 1X96A 1AQFA 3R5EA 3UCQA 2F6XA 4Q32A 5DT5A 4KETA 3A12A 5JBDA 2EG7A 4X9YA 4WDWA 3QR3A 4ZXOA 2GVYA 4IPJA 3OTRA 1UOZA 1S3HA 4HT3A 4UTKA 3LBOA 3FVMA 1WDSA 2ZIDA 1TPH1 5D4YA 2A4AA 2VEIA 1ODZA 3VGGA 4K8EA 3WK3A 1V51A 3LZ5A 4W8BA 4FA3A 1J18A 3T78A 2WMJA 3SR7A 3GX9A 4RLIA 3CWHA 2WCSA 1I8JA 3BG3A 5ABGA 1UKTA 3ISIX 2Y7EA 5A6TC 1Q4WA 4JNMA 4QITA 3W7OA 2ZX6A 3IK4A 1BD0A 2VVNA 5E9AA 1K9EA 4Z0JA 3V5OA 5GNYA 5FKYA 1EJVC 4IQDA 3FJ4A 3MSDA 3QW4B 5FEZA 2A3BA 4GBUA 1ADSA 4ERAA 1TV4A 1WDQA 1XRTA 2VRKA 2GQAA 4CD4A 4W9TA 1JPMA 3UZXA 4IISA 1MFVA 4Q8MA 1AL8A 4NKCA 1E1FA 1GT8A 3AHZA 2FJUB 3SCWA 1KWKA 2C3ZA 1S5WA 2QF8A 4US6A 3QW3A 3O8AA 3FDKA 3LHYA 4D6IA 2V67A 1EWDA 4PTXA 3EXRA 3HPSA 4WJ8A 4BWLA 2O4MA 3I7RA 1A4MA 1REQB 2Z27A 2QV5A 4EE9A 2YL5A 1LQ0A 1UR1A 2NQ5A 1E0VA 4W7WA 1EP1A 1SZRA 1DXFA 3ARWA 4A29A 3AMLA 1TRIA 3B8UA 1KXTA 3BLFA 3Q4DA 3H55A 4MB1A 3VO0A 1WPCA 3CUJA 4J9JA 2GJLA 4JFWA 2WSYA 1IXOA 3WLSA 1JEZA 2Z1KA 1VPQA 2FZNA 2XTKA 2E1DA 5AC4A 4OOUA 3TQPA 4X0NA 2XIQA 3WK2A 4ENLA 4FB7A 2ZDSA 2PI6A 4RKAA 3DFHA 8XIAA 3S46A 3TJLA 3VMOA 4PCFA 1A47A 1H7PA 3T0BA 5C9UA 5FJRA 1XYFA 4MWAE 3CS2A 3U2ZA 3KBSA 1DTUA 3QSRA 3VNMA 3R2GA 2ZRUA 3MBDA 3G24A 2YA2A 4UC5A 1LCOA 5KZDA 4E2DA 3WIJA 3MMWA 4ZB5A 1GQLA 1FUYA 2XINA 3TTQA 1GQJA 3XINA 5AYXA 1Z8AA 3POCA 4AVNA 1SO4A 4ICMA 2GSJA 3LPFA 1UZ1A 1V3LA 3UERA 1FWCC 2DP3A 4GI4A 3S5OA 5CJMA 4DJED 1GCYA 2QT3A 2ZUUA 4C7GA 2G3IA 4QG6A 3HGOA 5LYRA 3VNZA 4IMEA 2UWFA 3UXAA 7CGTA 3PTKA 3REQA 3IJ6A 2NX1A 3MC5A 1EGMA 1PO9A 3MS8A 3N19B 3OJGA 1QI2A 2CETA 3MA8A 3BAYA 2BXZA 4UOJA 1HP4A 3V4BA 5A69A 3TIMA 3EMCA 1VLWA 3STGA 2FPVA 3BCDA 1AD4A 3UWWA 3WLJA 1Z44A 2ZADA 2R14A 2UY2A 3SUVA 4QP0A 4IMFA 4YN5A 1ZU8A 3GS6A 4F4RA 4UUIA 4XZHA 1ZJBA 1E55A 4QAWA 2HVOA 1XBYA 2OYKA 2CHOA 1OYBA 3L5AA 5BMXA 5GJPA 4GGHA 2WANA 1QNQA 1V02E 4JX6A 4ZE4A 5C70A 3OG3A 1K8YA 3IACA 1TVNA 5XINA 4LQ1A 1B31A 1X98A 4XTIA 1XIIA 2HNEA 2J6XA 3TW6A 1GORA 1WYIA 3LN3A 3V3WA 2PU1A 4P7LA 1RJQA 1M9HA 3KBWA 2W66A 2C7FA 5LIUX 3NYZA 1TR9A 5U7SA 1E6QM 4MJMA 4GUGA 4JTHA 2W79A 2DJXA 4Q22A 1Z3NA 5C2GA 4O19A 5A6MA 1MFUA 1QW9A 4I7VA 1NP0A 4GFSA 3I7QA 4IXHA 1PX4A 1PX8A 3ABQA 1QPNA 4PCNA 4U4MA 3M07A 1JRCA 3B06A 3U57A 4EWJA 4EANA 3CYJA 4QS6A 1DBTA 4TVDA 4PE8A 1UZHA 4GNKB 4S3EA 2NLYA 1KA9F 1SJCA 2ZBTA 4ZVJA 5C2CA 4A6GA 4POCA 3BXWA 2OLSA 1WKYA 1A0EA 4NT0A 2F2HA 1EC8A 4JR5A 4K7VA 2J24A 4EXBA 5A2AA 4IPNB 1E3XA 5EU9A 1QW7A 3NPVA 4LSBA 2DZVA 4TXEA 2AL2B 3CH0A 3T55A 2O9OA 4P8UA 3WH6A 3I3DA 1DEDA 2OZ0A 2E5DA 3FGCA 3BMWA 1RCXB 5LHFA 5I77A 2HMCA 2GFTA 1S2VA 1E9ZB 3CAKA 2G3FA 5JXQA 1V77A 2GUBA 3C2YA 2PDYA 4FIQA 3BAWA 3UY7A 1BXBA 1F4HA 2B0MA 2ZXBA 1SZNA 1VCGA 3CQ0A 4XO6A 1XYCA 1KFWA 3USBA 1MQPA 4MM1A 1EJRC 3GHSA 3KWSA 2J47A 3GKFA 1WP6A 5LNSA 3YPIA 3LRMA 2XU2A 1IEQA 2ZC1A 5HMFA 3DHFA 4XISA 5A6LA 3KZPA 4OU1A 2VOTA 1TQXA 1XDLA 3RPMA 1TKKA 1UWQA 1OFQA 1UBSA 3UJSA 2PMQA 2NQZA 3QYSA 5CC5A 4CNPA 1FWJC 1ZUAX 2PP3A 1C3FA 1YW1A 3W1MA 1NFBA 1W9PA 3NQ7A 4AZBA 1XBVA 4DWSC 2QJNA 4C6IA 2QCFA 4X2RA 2C1HA 2PRMA 1US2A 3RDKA 3VOGA 1SU5A 9XIMA 4LF2A 1CGUA 4LOCA 2Z7GA 3D3AA 1HZYA 2BG5A 4HZMA 3JUGA 3DBPA 3EWYA 3OGVA 2HXUA 3L4TA 1FWFC 1E0WA 3SBFA 3A6OA 3QPYA 6CGTA 3UZJA 5FL1A 1YBQB 1K9TA 5T9BG 3T0TA 3GXTA 1SJDA 2F9RA 4A8NA 2YPIA 3QLDA 4CD8A 6ENLA 2QDEA 1BYCA 1UIPA 3GW0A 1M68A 1SZFA 1O94A 4A3RA 1SSDA 5E0CA 4LALA 4GQGA 3STPA 2YW3A 4O1FA 4D8ZA 2GVGA 2YIHA 2Z29A 2FKPA 3N12A 3BJSA 3B0UX 1XWYA 3VIOA 3WLIA 2ON3A 3PG8A 1VCVA 3DFSA 3W88A 1POJA 4GBDA 2B7OA 4C1KA 2ZZ7A 3IUIA 1CGTA 3T08A 1WO2A 3NPXA 3ARSA 3VX1A 4ZTXA 2WVTA 2ZWYA 4N6FA 3SADA 3EDKA 1QNVA 1AJ0A 2GJPA 2WNWA 4NJGA 4O50A 5AFDA 5CZTA 1MW0A 3HQPA 1QBAA 4PMVA 3H2AA 2POZA 3W73A 1FQ0A 4LYRA 3A47A 4LUJA 3MO4A 2NQJA 4CCZA 3RJXA 3EDEA 4BEQA 5FJJA 2H3DA 1MDRA 3OPSA 1WKDA 3N04A 3EWUA 4EF9A 5H91A 1E4NA 2CIPA 4KFNA 2G37A 3BURA 1ECEA 3TMQA 4AZCA 3QLLA 2F2KA 3AWNA 4BFAA 2VM8A 2WSPA 3HG3A 5AZ1A 3W2JA 3D3FA 4C6DA 3APYA 1AH0A 1PYFA 4DWSB 3N18A 3S4TA 4GH1A 2DT0A 2CLLA 4EPDC 1WKFA 4YNGA 3GTXA 3CK5A 3GM8A 1YDYA 4ZO9A 2JF6A 3IK2A 1FXPA 5FF0A 2NV2A 1Q6GA 2FZ8A 4JTIA 4XAZA 4S3AA 2ZXQA 4P7OA 4DO5A 3H4WA 4IGSA 4G5DA 3H7RA 1WZKA 2PGRA 1LL7A 3N3TA 1F05A 5I3JA 1HJQA 3PN8A 3ZR4A 3AU6A 4CN1A 4L61A 3BAJA 1NSJA 3GC2A 2WJFA 3TZNA 1ONRA 4JKMA 1OVDA 1T8XA 5LIXX 2D69A 2VT0A 5D30A 4AZ5A 4DUOA 1GQNA 3IJ9A 2CBUA 3DBNA 4GISA 1IWBA 4JFTA 1A0DA 1MSSA 3VIHA 4UTUA 3VM5A 4YTUA 3AJXA 3CHEA 3JVAA 2WHLA 4IMDA 2QVNA 3TYBA 2BODX 1XC6A 4NZCA 1Z48A 2DSZA 3G2GA 3N9SA 4HSOA 4EOUA 1FBAA 3HTWA 1VC4A 4NF7A 1DJYA 1ZAIA 2TRSA 4UWMA 1EHNA 1UZ4A 1QATA 1VKFA 4MAVA 1EOMA 3KRSA 4N9CA 3UWUA 4PRTA 2A7RA 4HNTA 3FVDA 3N4EA 3AS0A 4JEJA 4U3AA 1RLCL 1UWSA 1NEYA 1HJVA 2GVEA 3RK8A 4HK7A 4ZQMA 4XK2A 2O56A 5AY7A 5LZLA 1U5JA 1XRVA 1J10A 4AZ7A 2Z25A 3GU2A 2OEMA 2A6NA 2XSAA 3SAZA 1MZRA 3L0NA 2PDIA 2OEJA 1AH3A 1HGWA 3HZ3A 1J5TA 3LXCA 4ZL1A 3KLLA 3GWQA 2WJZA 1YBQA 2IW0A 3P80A 3RF9A 3VCCA 3N2XA 5IDIA 1CW2A 2E6AA 1F6KA 3QY8A 3AS2A 2B7NA 4CCEA 2PZ0A 1I60A 1JD9A 1FOBA 1PKYA 1SMDA 4AIOA 5FSDC 2YGYA 1H5VA 3KOYA 1EB3A 2A3LA 1WXZA 4YVXA 4GD0A 3TAOA 3KHDA 3E0LA 2YA1A 1R47A 1W8SA 1F3EA 4JS3A 5AOUA 4M1BA 4O10A 1GEQA 1NM9A 3TUUA 2ZRXA 2D1ZA 2ZA3A 2D24A 1KFCA 2YJQA 3FXGA 4N4PA 4J35A 2ZCGA 1GG1A 5D2YA 4A8RA 1NF7A 5IOBA 1E5NA 4UMAA 3GR7A 1W1TA 3LZ3A 2QS8A 1DJXA 3ZLFA 4FALA 3TZFA 1TPB1 1FDYA 2C0AA 1OGBA 1Q13A 4FOUA 4CEXC 1XLEA 5XIAA 4R85A 1TVPA 3R8GA 4A05A 4MDPA 4FS9A 2JK2A 1RQBA 1E43A 4DM1A 2V5BA 1MQQA 3TYAA 3GG7A 4B5TA 3TOYA 1JXJA 5HR6A 3MV01 3G1XA 4B5SA 2NQHA 2I56A 2ZUTA 3MUXA 3GC5A 1FCUA 4XBJA 1MO0A 2TODA 3DGRA 3H2CA 2OQLA 2OQHA 1DP0A 4C5YA 3RR4A 1FWTA 3FAXA 2KX9A 2VEMA 3WX7A 1SO6A 3D47A 4P7NA 5B7YA 4CGTA 2BP1A 1Z32X 3FYOA 5G4EA 1GOOA 2BXYA 4HGXA 1R3VA 4XX6A 3R8HA 3KDNA 1EX5A 4IIBA 1O1ZA 5ABHA 3UJ2A 2OJPA 1KRAC 4E2OA 2YBVA 3EXTA 3RUBL 2FDSA 4HCDA 2PWUA 3PJUA 4H3DA 1DWGM 4K36A 4CD7A 3AWOA 3RRXA 2PLMA 5A8NA 2JALA 3CPUA 1LWHA 4E4UA 3GO2A 4UQCA 3W7QA 4XD3A 3WENA 1R86A 4M56A 2YDRA 2HJPA 2QZRA 1LF1A 3QOMA 3SSZA 1DIKA 3MSGA 1DWFM 1UKPA 5HWJA 3KVJA 4HMNA 3FA5A 3RLGA 3LMZA 3NQCA 3H2EA 3KBMA 1W1YA 1P48A 3MANA 1F8IA 2Q09A 5AC7A 3CL8A 3R10A 5FOOA 3OVGA 4F2UA 1J0JA 2BS9A 4JIEA 2WC4A 2OLAA 4B91A 3RAOA 2ZICA 3OOQA 4DYEA 1D8CA 4FO4A 1YTKA 5D8WA 1V79A 2GDVA 2ISVA 2VTFA 5D8ZA 3Q37A 3M0MA 4QJ5B 4RZBA 2R8WA 4H8VA 4ACYA 2DH2A 4WDUA 3RR1A 4UFJA 1ITXA 3QQ0A 4CQ8A 4DXKA 4GQBA 5EB8A 3EX2A 1RP8A 4AY8A 4JYFA 1GKRA 1G9HA 3I7SA 1XKJA 2Z6JA 1CXEA 4FLSA 3BICA 3DFYA 3IRSA 3UF9A 5DLCA 4XIAA 4R27A 5D2VA 5EGRA 3OBAA 5LNUA 2WZTA 3KTXA 2FZMA 4GJ1A 4ACZB 1GOXA 4HNVA 2XWDA 2QDHA 1TMHA 3KTCA 3AXXA 2P5NA 3L4WA 3NZPA 2D73A 5CKSA 1OYAA 1H1NA 2YX0A 3TWAA 3NTYA 3GXFA 4TVCA 3NL3A 5DMLA 1B1YA 5A8PA 4D9PA 2ZVIA 3F4WA 3LTYA 5IFTA 2XH4A 4E2VA 2ISDA 4HMDA 4G1KA 4HU0A 3ECQA 3E0IA 2WKJA 1Z89A 3UP8A 5I03A 3IGUA 3W1RA 1KCZA 1E71M 2YW4A 4Q7IA 5HUPA 1G94A 2HV5A 4U28A 1BVWA 1TCDA 2QJIA 2GGIA 4L7ZA 4MPQA 2YCLB 1KBBA 2NXIA 3UY8A 4P7QA 1W5MA 3WD0A 2PDHA 3LY0A 3EZ4A 3PBMA 2RGMA 4JIQA 3V35A 1PAMA 4IUOA 1AJ2A 4GOAA 4M51A 4AVFA 2CZ5A 1XCFA 4UQBA 3E9AA 1OK6A 4J40A 1BYAA 2PP1A 1JDCA 2TSYA 3M64A 5FJUA 3L2MA 1CX9A 5ECVA 3Q58A 3TXZA 4D6GA 1MI3A 3KOFA 3CV6A 1TV5A 1FWAC 3LPGA 5BOOA 3N2CA 2R24A 3E6EA 4MJZA 3S1GA 3WNLA 4PMUA 2GJXA 2ZE0A 4FZIA 4DXXA 1EC9A 3S9ZA 1F74A 3ARXA 3Q2DA 4MDOA 2CZVA 2Y62A 1K8XA 3I4EA 1OGGA 3VE7A 4OWGA 1G4EA 2GJRA 3KZSA 4UTFA 4GMEA 4IGNA 1VFUA 3W00A 2Q71A 1K6WA 3ALFA 1E6NA 2EAWA 2I9EA 5EL1A 2NSXA 1V6YA 1RD6A 2YCIX 4WDXA 1MEIA 1XG4A 1PZ2A 4WLCA 2VEKA 3LGEA 3LK6A 4F0SA 1E1CB 3EWZA 2A79A 2HEJA 1W3NA 2J88A 4C1LA 1TIMA 3PPGA 4W8AA 3MUAA 3WLRA 2BVTA 1O7AA 1S2UA 1FTXA 4MY9A 1P0NA 3MZ2A 3GZAA 3BOFA 5BXRA 1EQPA 3SQLA 3UZ5A 2WZHA 3E12A 2BHUA 5CAKA 4FX8A 4RX0A 2QULA 4V1XA 2P1FA 5G1MA 3RNDA 2FMNA 4S3FA 1SSGA 2X0YA 1Q2RA 3H4GA 7TAAA 1T99A 3C0SA 4BQ2A 3GNRA 3T8QA 1LBLA 1CTNA 1SUXA 2ATSA 4WX2A 3W7JA 2R1PA 1PCWA 1QK0A 1AFSA 4QGCA 4NZ4A 4IP4A 3DEQA 1VJIA 1JZ5A 3MWCA 3W1AA 1SO5A 1S5MA 2BY2A 3EB3A 4C6MA 1J11A 2VC7A 3GFXA 4LS1A 3W72A 2X05A 1FWIC 1Q5MA 9XIAA 1YDVA 3A64A 4HU4A 3G5EA 3THUA 1HL2A 2PLKA 1FHUA 4L9ZA 1LBMA 4LAUA 1JYWA 4UMCA 1KM5A 3TOPA 4GH3A 3WD4A 4PUEA 1T41A 1WAUA 3ICJA 4UCFA 3WQVA 3QTGA 1JDEA 2X7VA 2G96A 4UR7A 2XG9A 4R7WA 1NFPA 3GTNA 2I5QA 1H49A 1ITUA 4O4WA 2AMXA 5C0QA 3TWBA 1V5XA 2VO5A 3T1GA 4JCMA 2WKGA 3H4XA 3P84A 3ZJ6A 3AZTA 4I3GA 5MKGA 4GVFA 3EB4A 1XIHA 5HNTA 5CPOA 1OC5A 2GZXA 6REQB 3KBNA 4EP8C 1B3OA 3N4AA 1HKJA 3M6DA 1OFAA 2DFAA 4LVFA 5FI8A 2FZDA 4AZGA 4Z2LA 3WCZA 4NJIA 4Q4OA 1WV2A 3ZYZA 4XBKA 2DU2A 1XYMA 3BGJA 3A9IA 3E96A 1XIDA 3FSUA 4HJFA 3G22A 1LQAA 5JU6A 1E4IA 2PRLA 1HW6A 1TTPA 2DEPA 4WKFA 2J77A 2QCEA 2FGZA 2KAUC 2LLEA 1GQIA 2GGGA 3BOLA 2OODA 3CXOA 2E6DA 3G1AA 2OZ3A 2YBUA 4HOZA 1GVEA 3WJZA 2ABAA 3AHTA 3W7IA 4E0CA 2QAPA 3I6EA 3IJDA 2WSRA 3W02A 1GZGA 1F2JA 3C8NA 4LVAA 3WLNA 4F0KA 1G69A 2VFHA 1QNRA 4RDWA 5AYBA 1NARA 5AYIA 2YCKX 3WLQA 2QR6A 3WH7A 4XZWA 4LUYA 2XVNA 1F73A 1F07A 3MHGA 1P0BA 3ATYA 2NZLA 5CBJA 3FGCB 4QNEA 1XFBA 1AUSL 3STEA 3CIXA 1EA9C 1CDGA 3CUGA 4NVTA 3WNMA 3W1UA 5DELA 5CZKA 1Y0EA 5LHEA 2WK2A 1IXNA 3ZXWA 5IHSA 3S2LA 1VPYA 5C9WA 1K7XA 5A8OA 4ATDA 1VFSA 1YLVA 1JFHA 3AIEA 3WLLA 4NZFA 4BI6A 4AF0A 2Q6ZA 4B4FA 1FHVA 1MRAA 1VLIA 1BXNA 4PUUA 1OABA 2YB1A 1JPHA 3R0KA 4YYFA 4M7TA 5A8MA 3UWEA 3VKDA 1X8CA 3RLVA 3VA8A 5E0KA 3SRFA 1ZBWA 3RFAA 5ABFA 4GXPA 1MUMA 2GQ8A 2ZXAA 4GWEA 4DLMA 5A3HA 2PGWA 3NQVA 3AOFA 3Q94A 2R91A 4MG4A 2EXOA 3SIMA 3P62A 2E8YA 4H2CA 2PWGA 1NY1A 4H6QA 2PDMA 1DYSA 1MDLA 3W7GA 1JCLA 4O15A 1RBAA 2ZUSA 4K68A 2P10A 4X0VA 3TVAA 3GLCA 4UTMA 4AZCB 3VINA 5EBUA 5G4HC 2Y63A 4U10A 1UR2A 4JTAA 3CV2A 3H21A 2EPLX 1FCVA 2G41A 1XR2A 4KWVA 1G4PA 3U3HA 1VFMA 4HA3A 4YMZA 3SUUA 2CZFA 1V6TA 2J27A 1EF2A 2Y4SA 4IJCA 4P8XA 4IJRA 1HKWA 4KWSA 2GL5A 4CQBA 4OUIA 4U3CA 4Z0SA 4JTSA 4Z2HA 3WQGA 5CZSA 2V63A 1XLHA 3VDGA 1BGAA 3PZQA 2ZZ2A 1MYRA 3I68A 2FMOA 4H04A 1TUFA 3AHYA 1L8NA 1VIZA 3UWVA 3NZQA 1R87A 2ZRWA 5DXXA 1B90A 3NQ2A 1E70M 5DQPA 2GGEA 4JZ5A 1J0IA 4B9ZA 3C3UA 1MZHA 1UOKA 3O1NA 3AYRA 3WBYA 5LIYX 4JTUA 4NJKA 3GG0A 4A3UA 4IQEA 4JFUA 2WLZA 1PIIA 3S47A 3K30A 5CH9A 2I16A 2ZRYA 3F03K 3QBUA 2WZEA 3LOTA 3EDJA 1V3IA 4H83A 4KERA 2OG9A 3FK4A 1PYMA 4ZFCA 3GB6A 4AG0A 4W86A 1V03A 4Q8WA 4CEUC 3ZT6A 3BPWA 2QMKA 1IIGA 3VTRA 5BROA 5TNVA 4HTYA 4ALDA 4YTRA 1H51A 2NVDA 3WJYA 1G7UA 2RGLA 1EP2A 1E72M 2W4XA 2E8ZA 3QV7A 3CQIA 1OBAA 2CLHA 3EMZA 3FS2A 3OG2A 2OZ8A 1GONA 4QLLA 1EJ7L 3EPMA 1TFVA 3EOLA 3W84A 2IPGA 2GSEA 4HPNA 2UY5A 1UQZA 1YE6A 2V68A 1R6WA 4KW2A 5A2CA 2YXGA 3I6TA 1C90A 4QNWA 3C8FA 4ICCX 4OJYA 5T8GA 4LVGA 1PBGA 2W62A 3DG7A 4IL0A 2V69A 2O9TA 1P5BA 4HD5A 3U7BA 2GOUA 3T09A 4NZ5A 3HGJA 3TEVA 2C71A 1E5JA 3GNNA 3W26A 3COTA 2DZPA 5AZ0A 1V3HA 2R82A 3PBVA 3MWAA 3NQBA 4CNTA 2A0NA 3NZRA 3G0UA 3UU0A 1S5VA 1T0OA 3PBWA 1MNSA 4NU7A 3WLMA 4D1JA 4ZQOA 3RU6A 1EJUC 3WMSA 3UR7A 3OQ8A 3PUDA 1QWGA 2OKTA 2R9RA 3D5HA 4DEFA 1TV2A 4RXFA 1ADOA 1QXLA 1I2RA 2ZA1A 5ABFB 3WMBA 3FKRA 3MVIA 4S39A 4ZFMA 4V28A 4YCPA 3ANYA 1V4YA 3CZEA 3DHUA 2VELA 4JYEA 2HZGA 5D03A 2VFDA 3LD5A 3MU7A 2CBVA 2WVVB 3WQOA 5EY5A 2CC0A 2C15A 1V6XA 4YVPA 3LBCA 1LP6A 3M0HA 3OHIA 3I3BA 4MJ2A 3MP5A 4GK8A 2DIKA 2Q01A 1DJQA 1OJXA 3NR0A 3FLUA 2PU0A 3H2OA 3AXKA 3NQFA 4GA8A 1NJJA 1XISA 3DIPA 2IPWA 1LORA 1P7TA 2ACRA 4NASA 5AHEA 4ZO6A 4NZJA 1OWQA 6TAAA 4EIVA 4Q8UA 3IS4A 6A3HA 4GCAA 5I0DA 4C60A 2XHYA 3KLKA 4HMEA 3LXAA 1OSEA 4UXDA 2V5DA 3POHA 3W1LA 1W56A 4G56A 2NQ9A 2QDDA 2PF8A 3CV1A 3M5VA 1QFEA 4WEVX 1TPFA 4CQ9A 5FJTA 5AHNA 2GQ9A 4DHGA 1Q65A 1XW8A 3A3HA 1CXHA 1KRCC 1OZMA 3W85A 3NOEA 1D7FA 4FPSA 4Y9NA 3K13A 3VC5A 4DXVA 1H7NA 5HPCA 4XZIA 3TSDA 2BWGA 5I5RA 1DORA 3O05A 4UTWA 3LHZA 4UOQA 4TX6A 4BF9A 1KKRA 3GBDA 3DERA 4LF1A 4Q33A 1TPVA 4E8DA 4LUTA 4PULA 1TQJA 4AEOA 3MHFA 1EO7A 5K3VA 1ZL1A 2DGAA 4I9MA 2I5GA 5B80A 3DG6A 1IF2A 5EMJA 4TVUA 1NTHA 1QDSA 4O0QA 1PWLA 4G8TA 4H9UA 2WZIA 1S38A 2XM1A 4IXXA 2RAGA 2HPMA 4WDTA 2QV4A 2IKIA 2HISA 4TV5A 1SGJA 4LUIA 1FWEC 4R9OA 1Z7AA 3ES8A 3WQFA 3BSHA 4GC4A 3DI1A 4AHOA 3O16A 3PTQA 5G4WA 2FGBA 1XFCA 3MJMA 2JGYA 4H9ZA 4M7SA 7PTDA 3MT1A 3BANA 3ONBA 4F2TA 3TYDA 3GRIA 1RHCA 1DWJM 4Y96A 2FFIA 5D9OA 3WQDA 2E0PA 4OBRA 1HUVA 1CXKA 1O66A 3WZ0E 1SZEA 3NQDA 2Q02A 1OX5A 2ZUNA 4CU7A 4HA0A 3QGKC 1EIXA 4DJEC 3UA3A 1CXIA 1PL9A 2IQDA 3UXIA 4ZO7A 3TV8A 2VENA 3H54A 2PC8A 4QQ3A 1XIMA 2DIJA 4ZEPA 4BI5A 3P93A 2WYSA 5T26A 4D2JA 1K1DA 3IARA 1KM1A 1JPKA 1LG2A 1Q4NX 3PB0A 2YKKA 3VGDA 3STCA 2QJGA 1H50A 3EDDA 4AZIA 4HK6A 3V75A 1LUCA 3O15A 2ZQ0A 3LNPA 2DZXA 3UYCA 4W7VA 2WCGA 3V0UA 3EPNA 2IXUA 1RY0A 1BWVA 5D05A 2W3ZA 1X1OA 2A3HA 3GG8A 3UGVA 3L4YA 4GYPA 9RUBA 5FSEC 1HL8A 4AYSA 3QJAA 4C1NA 3CZLA 2C6QA 2Y5JA 3VILA 3H6OA 1CB2A 1W9XA 3NM1A 1I2PA 3R25A 3GY1A 5G2HA 5DY3A 3MUZ1 4BWLC 5I3FA 3OYXA 5C7VA 1W3LA 3T07A 3N1AA 2WQPA 2G3MA 7A3HA 1Q2SA 3NGFA 1ICSA 3NEVA 3K2GA 1CPUA 5LNWA 4AWTA 4OBSA 1UWIA 3TQ0A 3MJYA 1W5OA 1UB3A 3UZWA 3E2QA 4X61A 3M0VA 4RNJA 4AD2A 3W37A 2EBNA 4GY1A 2UV8G 1CCWB 3LENA 2QKFA 2DVTA 1QRQA 1FWNA 1H11A 2OTDA 3W01A 4PBFA 4WD0A 4HU8A 3RPTA 3B8IA 2P3EA 4I9TA 2DV0A 1G1YA 4UNKA 1F8MA 1KGWA 4IGHA 4GQ0A 2XH2A 1WOBA 1X6NA 4FF5A 4HHPA 3LPPA 2IUZA 3I10A 4IMGA 4K37A 5DANA 2NWSA 4XTDA 3FA3A 3UJEA 1W2VA 1O95A 2PDQA 1YTEA 1FRBA 1ZCCA 2DT2A 4PL2A 4TOQA 1WZMA 3UNTA 2V2HA 4GVGA 5CC3A 3W83A 5FF2A 4MPKA 1UWAA 3AIUA 4NJJA 1ZBCA 3AIRA 3CJPA 1VRXA 3ITYA 4ZBCA 4IIHA 4D6CA 4AVOA 2V5JA 1OX4B 3GYCA 2OSYA 4C6KA 3SY8A 1TWWA 3E2SA 2DUAA 1O12A 1CIUA 1BFNA 2AGKA 2OYMA 3HA1A 4ATLA 1EP3A 4PUWA 5BOFA 1Q8JA 1XX1A 1POKA 1QNPA 3UYIA 2EF9A 4C65A 1OT1A 5FACA 5I24A 4OV9A 3SRHA 4LVDA 2VD8A 3TDFA 1LOQA 3B0PA 4H8UA 4O1AA 4D1IA 3IGSA 4WSJA 1HJUA 4WF7A 1US0A 2FPTA 4MJ4A 2QCGA 4DJFD 2PFHA 2OOGA 3V7PA 3VOHA 2NV1A 2Z1WA 4PMXA 3DFPA 3OGSA 1XGZA 3P81A 4KIRA 3RMJA 4EVZA 1R3RA 4RXGA 3GXPA 2XPKA 4JY8A 5EMYA 4F8XA 3E2VA 4M6PA 3NZGA 2UY4A 4JKLA 1UD6A 2VZSA 4WJEA 2BFGA 1OM0A 2PDNA 3VIJA 1SFTA 1VYSX 1VB9A 2CLMA 1ZY9A 2PWVA 1SFSA 4LS2A 3HMJG 3VGEA 2EPOA 1EZWA 4NIRA 5BW6A 4FIRA 4W7UA 3SN0A 3VUPA 3REQB 1NAL1 1GHSA 1FP8A 4KEMA 1ZFJA 2YA0A 4UQ9A 3UVAA 3A5VA 4L80A 3K1DA 3AMKA 3URNA 3KBJA 2OCZA 3QY7A 5D2XA 3G1FA 4GYFA 3GHTA 5KSWA 5GVJA 1ZPTA 4BKNA 3DXIA 4PB5A 1XYZA 1G7VA 1EDTA 4UTTA