3VOKA

X-ray crystal structure of wild type hrtr in the apo form with the target dna.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
188
structure length
176
Chain Sequence
b'PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transcription/dna
total genus 70
structure length 176
sequence length 188
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vokA00
3QPLA 3QQAA 4JKZA 4NN1A 3S5RA 2GENA 4V2GA 3KKDA 5K7FA 4I76A 2IBDA 5J1RA 3NI7A 2WGBA 2GBYA 4GFLA 4W1UA 5CW8A 4XK4A 4D7MA 3KNWA 2DTZA 5F0CA 4M3GA 4GCKA 5D19A 2VPRA 3CWRA 3RH2A 5K58A 2G0EA 3CDLA 5EFYA 3BTIA 5AQCA 3WHCA 1Z77A 2HXOA 3Q0VA 5J1UA 3CCYA 3B81A 2XB5A 5CXGA 3PM1A 2XGDA 4M3DA 4AC0A 3ZQIA 3BR3A 2DG7A 3SDGA 2Y2ZA 2QOPA 3ANGA 5F08A 5FHPA 3VP5A 4UDSA 3LSPA 5F0HA 2Y30A 3VW2A 3Q0WA 5C4YA 3B6CA 2ZCNA 3ZQHA 5IPAA 5GP9A 2IAIA 4M3EA 3VVZA 2JJ7A 3KZ9A 1T33A 2ZCMA 3LHQA 4I6ZA 3DCFA 1UI6A 4D7NA 3HGGA 2PZ9A 1JUPA 4M3BA 3BRUA 1JTYA 5F0FA 3C2BA 2XPUA 3BR5A 3BTCA 3QBMA 3VVYA 4MXMA 3VW1A 1U9NA 2OERA 3T6NA 4G12A 2XGEA 2PBXA 2DG8A 3HTHA 3VVXA 3VOKA 2HYJA 1VI0A 2XRLA 4D5CA 2XDNA 1RPWA 3EUPA 5F1JA 1Z0XA 2G7LA 4JL3A 1JTXA 2FBQA 3NRGA 2ZOYA 3B6AA 5EZGA 5GPCA 2YVEA 4GCTA 3O8HA 2HYTA 4ICHA 5IOYA 2UXOA 3CRJA 3ZQFA 3Q0UA 3VUQA 3QPSA 2RHAA 4ACIA 3ON4A 3NNRA 3MNLA 3G1LA 5FKLA 1UI5A 3TP0A 3HTIA 3HTAA 3BR0A 2HQ5A 3G1MA 3ZQLA 3RD3A 2X9DA 2O7TA 3G7RA 5K7ZA 3HIMA 3KKCA 3BQZA 4DW6A 4X1EA 3NPIA 2QKOA 2OF7A 4W97A 3ANPA 3BT9A 5FKMA 5J1YA 5DAJA 1JT0A 3BTJA 3BHQA 1ORKA 3BNIA 5HBUA 4D5FA 3O60A 4YZEA 2Q24A 3GEUA 3BCGA 3ZQGA 2HXIA 2FJ1A 2G7SA 3BJBA 1RKTA 3BR6A 5FKOA 3BTLA 4M3FA 2W53A 2NP3A 4B3AA 3O8GA 2QCOA 2WUIA 2FX0A 3DEWA 2NS8A 3GZIA 3EGQA 5IP6A 3COLA 4PXIA 2HKUA 4GCLA 2EH3A 3QKXA 3PASA 1JUSA 3VIBA 2G7GA 4ME9A 1JT6A 2JK3A 3BR1A 4JYKA 5D1RA 2D6YA 4AC6A 3CJDA 1T56A 2RAEA 3IH4A 1ZK8A 5F04A 4AF5A 2GFNA 2QWTA 2FD5A 2O7OA 2GUHA 2V57A 2RASA 3LWJA 3F0CA 4V2FA 2NX4A 3BQYA 4KWAA 3HTJA 2X6OA 3HE0A 3F1BA 1QVUA 3LJLA 5H9TA 1A6IA 4NELA 1QPIA 4AUXA 3V78A 2WV1A 5FKNA 3LOCA 3VPRA 3FRQA 5EYRA 2ZB9A 2OI8A 2REKA 3G1OA 3SFIA 1BJZA 3JSJA 1RKWA 4ABZA 3VW0A 2UXPA 3HGYA 2NP5A 3E7QA 2IEKA 4B1RA 2UXIA 1U9OA 2UXUA 2F07A 4HKUA 5K7HA 2ZCXA 3AQTA 3FK7A 5D18A 3NXCA 2FQ4A 2ID6A 3LSJA 2OPTA 2YVHA 2VKVA 2XPVA 3Q3SA 3LSRA 4L62A 2NS7A 2UXHA 2Y31A 3G56A 2I10A 3ON2A 3FIWA 2XPWA 3C07A 4MK6A 3VOXA 3BR2A 5FKKA 1QVTA 5GPAA 2IU5A 1ZKGA 4CGRA 3IH2A 3PPBA 1JUMA 2XGCA 5FGLA 5FMPA 3P9TA 5HSZA 2VKEA 4GFKA 5CXIA 2QTQA 5IOZA 5EZHA 2ID3A 3MVPA 3AQSA 2TRTA 5HAWA 2G3BA 3DPJA 1SGMA 2TCTA 3IUVA 2QIBA 3V6GA 2ZOZA 3FK6A 3WHBA 4JNNA 5F27A 3IH3A 3TP3A 4MO7A 5J3LA
chains in the Genus database with same CATH superfamily
3QPLA 3QQAA 4JKZA 4NN1A 3S5RA 2GENA 4V2GA 3KKDA 2ZY9A 2R7XA 5K7FA 4I76A 2IBDA 5J1RA 3NI7A 2WGBA 2GBYA 4GFLA 4W1UA 5CW8A 4XK4A 4D7MA 3KNWA 2DTZA 5F0CA 4M3GA 4GCKA 5D19A 2VPRA 3CWRA 3RH2A 5K58A 2G0EA 3CDLA 5EFYA 3BTIA 2R7QA 5AQCA 3WHCA 1Z77A 2HXOA 3Q0VA 5J1UA 3VTIA 3CCYA 3B81A 2XB5A 5CXGA 3PM1A 2XGDA 4M3DA 4AC0A 3ZQIA 3BR3A 2DG7A 3SDGA 5CQGA 2Y2ZA 2QOPA 3ANGA 2FJI1 5F08A 5FHPA 3VP5A 4UDSA 3LSPA 5F0HA 2Y30A 5C4YA 3Q0WA 3VW2A 3B6CA 2ZCNA 3ZQHA 5IPAA 5GP9A 2IAIA 4M3EA 3VVZA 2JJ7A 3KZ9A 3KYLA 2YVXA 1T33A 2ZCMA 3LHQA 4I6ZA 3DCFA 1UI6A 4D7NA 3HGGA 2PZ9A 1JUPA 4M3BA 3BRUA 1JTYA 5F0FA 3C2BA 2XPUA 3BR5A 3BTCA 3QBMA 4WIBA 3VVYA 4MXMA 3VW1A 1U9NA 2OERA 3T6NA 3DU5A 4G12A 2XGEA 2PBXA 2DG8A 3HTHA 3VVXA 3VOKA 2HYJA 1VI0A 2XRLA 4D5CA 2XDNA 1RPWA 3EUPA 5F1JA 1Z0XA 2G7LA 4JL3A 1JTXA 2FBQA 3NRGA 2ZOYA 3B6AA 5EZGA 5GPCA 2YVEA 4GCTA 3O8HA 2HYTA 4ICHA 5IOYA 2UXOA 3CRJA 3NS4A 3ZQFA 3Q0UA 3VUQA 3QPSA 4IRVA 2RHAA 4ACIA 3ON4A 3NNRA 3MNLA 3G1LA 5FKLA 1UI5A 3TP0A 3HTIA 3HTAA 3BR0A 2HQ5A 3G1MA 3ZQLA 3RD3A 4U9LA 2X9DA 2O7TA 3G7RA 5K7ZA 2R7TA 3HIMA 3KKCA 3BQZA 4DW6A 4X1EA 3FHNA 2R7OA 3NPIA 2QKOA 2OF7A 4W97A 3ANPA 3BT9A 5FKMA 5J1YA 5DAJA 1JT0A 3BTJA 3BHQA 1ORKA 3BNIA 5HBUA 4D5FA 3O60A 4YZEA 2Q24A 3GEUA 3BCGA 3ZQGA 2HXIA 2FJ1A 2G7SA 3BJBA 1RKTA 3BR6A 5FKOA 3BTLA 4M3FA 2W53A 2NP3A 4B3AA 3O8GA 4U9NA 2QCOA 2WUIA 4DVYP 2FX0A 3DU6A 3DEWA 2NS8A 3GZIA 3EGQA 5IP6A 3COLA 4PXIA 2HKUA 4GCLA 2EH3A 2R7RA 3QKXA 3PASA 1JUSA 3VIBA 2G7GA 4ME9A 1JT6A 2JK3A 3BR1A 4JYKA 5D1RA 2D6YA 4AC6A 3CJDA 1T56A 2RAEA 3IH4A 1ZK8A 5F04A 4AF5A 2GFNA 2QWTA 2FD5A 2O7OA 2GUHA 2V57A 2RASA 3LWJA 3F0CA 4V2FA 2NX4A 3BQYA 4KWAA 3HTJA 2X6OA 3HE0A 3F1BA 1QVUA 3LJLA 5H9TA 1A6IA 4NELA 1QPIA 4AUXA 3V78A 2WV1A 5FKNA 3LOCA 3VPRA 3SWHA 3FRQA 5EYRA 2ZB9A 2OI8A 2REKA 3G1OA 3SFIA 1BJZA 4OD4A 3JSJA 1RKWA 4ABZA 3VW0A 2UXPA 3HGYA 2NP5A 3E7QA 2IEKA 4B1RA 2UXIA 1U9OA 2UXUA 2F07A 4HKUA 5K7HA 2ZCXA 3AQTA 3FK7A 5D18A 3NXCA 2FQ4A 2ID6A 3LSJA 2OPTA 2YVHA 2VKVA 2XPVA 3Q3SA 3LSRA 4L62A 2NS7A 2UXHA 2Y31A 4C2MA 3G56A 2R7UA 2I10A 3ON2A 3FIWA 2XPWA 3C07A 4MK6A 3VOXA 3BR2A 5FKKA 1QVTA 5GPAA 2IU5A 1ZKGA 2B3WA 4CGRA 3IH2A 3PPBA 1JUMA 2XGCA 5FGLA 5FMPA 3P9TA 2B1EA 5HSZA 2VKEA 4GFKA 5CXIA 2R7VA 2QTQA 5IOZA 5EZHA 2ID3A 3MVPA 3AQSA 2TRTA 5HAWA 2G3BA 3DPJA 1SGMA 2TCTA 3IUVA 2QIBA 2PFVA 3V6GA 2ZOZA 3FK6A 3WHBA 4OD5A 2R7SA 4JNNA 2R7WA 5F27A 2A2FX 3IH3A 3TP3A 3K8PC 4MO7A 5J3LA
chains in the Genus database with same CATH topology
3QPLA 3QQAA 4JKZA 4NN1A 3S5RA 2GENA 4V2GA 3KKDA 5K7FA 4I76A 2IBDA 5J1RA 3NI7A 2WGBA 2GBYA 4GFLA 4W1UA 5CW8A 4XK4A 4D7MA 3KNWA 2DTZA 5F0CA 4M3GA 4GCKA 5D19A 2VPRA 3CWRA 3RH2A 5K58A 2G0EA 3CDLA 5EFYA 3BTIA 5AQCA 3WHCA 1Z77A 2HXOA 3Q0VA 5J1UA 3CCYA 3B81A 2XB5A 5CXGA 3PM1A 2XGDA 4M3DA 4AC0A 3ZQIA 3BR3A 2DG7A 3SDGA 2Y2ZA 2QOPA 3ANGA 5F08A 5FHPA 3VP5A 4UDSA 3LSPA 5F0HA 2Y30A 3VW2A 3Q0WA 5C4YA 3B6CA 2ZCNA 3ZQHA 5IPAA 5GP9A 2IAIA 4M3EA 3VVZA 2JJ7A 3KZ9A 1T33A 2ZCMA 3LHQA 4I6ZA 3DCFA 1UI6A 4D7NA 3HGGA 2PZ9A 1JUPA 4M3BA 3BRUA 1JTYA 5F0FA 3C2BA 2XPUA 3BR5A 3BTCA 3QBMA 3VVYA 4MXMA 3VW1A 1U9NA 2OERA 3T6NA 4G12A 2XGEA 2PBXA 2DG8A 3HTHA 3VVXA 3VOKA 2HYJA 1VI0A 2XRLA 4D5CA 2XDNA 1RPWA 3EUPA 5F1JA 1Z0XA 2G7LA 4JL3A 1JTXA 2FBQA 3NRGA 2ZOYA 3B6AA 5EZGA 5GPCA 2YVEA 4GCTA 3O8HA 2HYTA 4ICHA 5IOYA 2UXOA 3CRJA 3ZQFA 3Q0UA 3VUQA 3QPSA 2RHAA 4ACIA 3ON4A 3NNRA 3MNLA 3G1LA 5FKLA 1UI5A 3TP0A 3HTIA 3HTAA 3BR0A 2HQ5A 3G1MA 3ZQLA 3RD3A 2X9DA 2O7TA 3G7RA 5K7ZA 3HIMA 3KKCA 3BQZA 4DW6A 4X1EA 3NPIA 2QKOA 2OF7A 4W97A 3ANPA 3BT9A 5FKMA 5J1YA 5DAJA 1JT0A 3BTJA 3BHQA 1ORKA 3BNIA 5HBUA 4D5FA 3O60A 4YZEA 2Q24A 3GEUA 3BCGA 3ZQGA 2HXIA 2FJ1A 2G7SA 3BJBA 1RKTA 3BR6A 5FKOA 3BTLA 4M3FA 2W53A 2NP3A 4B3AA 3O8GA 2QCOA 2WUIA 2FX0A 3DEWA 2NS8A 3GZIA 3EGQA 5IP6A 3COLA 4PXIA 2HKUA 4GCLA 2EH3A 3QKXA 3PASA 1JUSA 3VIBA 2G7GA 4ME9A 1JT6A 2JK3A 3BR1A 4JYKA 5D1RA 2D6YA 4AC6A 3CJDA 1T56A 2RAEA 3IH4A 1ZK8A 5F04A 4AF5A 2GFNA 2QWTA 2FD5A 2O7OA 2GUHA 2V57A 2RASA 3LWJA 3F0CA 4V2FA 2NX4A 3BQYA 4KWAA 3HTJA 2X6OA 3HE0A 3F1BA 1QVUA 3LJLA 5H9TA 1A6IA 4NELA 1QPIA 4AUXA 3V78A 2WV1A 5FKNA 3LOCA 3VPRA 3FRQA 5EYRA 2ZB9A 2OI8A 2REKA 3G1OA 3SFIA 1BJZA 3JSJA 1RKWA 4ABZA 3VW0A 2UXPA 3HGYA 2NP5A 3E7QA 2IEKA 4B1RA 2UXIA 1U9OA 2UXUA 2F07A 4HKUA 5K7HA 2ZCXA 3AQTA 3FK7A 5D18A 3NXCA 2FQ4A 2ID6A 3LSJA 2OPTA 2YVHA 2VKVA 2XPVA 3Q3SA 3LSRA 4L62A 2NS7A 2UXHA 2Y31A 3G56A 2I10A 3ON2A 3FIWA 2XPWA 3C07A 4MK6A 3VOXA 3BR2A 5FKKA 1QVTA 5GPAA 2IU5A 1ZKGA 4CGRA 3IH2A 3PPBA 1JUMA 2XGCA 5FGLA 5FMPA 3P9TA 5HSZA 2VKEA 4GFKA 5CXIA 2QTQA 5IOZA 5EZHA 2ID3A 3MVPA 3AQSA 2TRTA 5HAWA 2G3BA 3DPJA 1SGMA 2TCTA 3IUVA 2QIBA 3V6GA 2ZOZA 3FK6A 3WHBA 4JNNA 5F27A 3IH3A 3TP3A 4MO7A 5J3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPL A;  3QQA A;  4JKZ A;  4NN1 A;  3S5R A;  2GEN A;  4V2G A;  3KKD A;  5K7F A;  4I76 A;  2IBD A;  5J1R A;  3NI7 A;  2WGB A;  2GBY A;  4GFL A;  4W1U A;  5CW8 A;  4XK4 A;  4D7M A;  3KNW A;  2DTZ A;  5F0C A;  4M3G A;  4GCK A;  5D19 A;  2VPR A;  3CWR A;  3RH2 A;  5K58 A;  2G0E A;  3CDL A;  5EFY A;  3BTI A;  5AQC A;  3WHC A;  1Z77 A;  2HXO A;  3Q0V A;  5J1U A;  3CCY A;  3B81 A;  2XB5 A;  5CXG A;  3PM1 A;  2XGD A;  4M3D A;  4AC0 A;  3ZQI A;  3BR3 A;  2DG7 A;  3SDG A;  2Y2Z A;  2QOP A;  3ANG A;  5F08 A;  5FHP A;  3VP5 A;  4UDS A;  3LSP A;  5F0H A;  2Y30 A;  3VW2 A;  3Q0W A;  5C4Y A;  3B6C A;  2ZCN A;  3ZQH A;  5IPA A;  5GP9 A;  2IAI A;  4M3E A;  3VVZ A;  2JJ7 A;  3KZ9 A;  1T33 A;  2ZCM A;  3LHQ A;  4I6Z A;  3DCF A;  1UI6 A;  4D7N A;  3HGG A;  2PZ9 A;  1JUP A;  4M3B A;  3BRU A;  1JTY A;  5F0F A;  3C2B A;  2XPU A;  3BR5 A;  3BTC A;  3QBM A;  3VVY A;  4MXM A;  3VW1 A;  1U9N A;  2OER A;  3T6N A;  4G12 A;  2XGE A;  2PBX A;  2DG8 A;  3HTH A;  3VVX A;  3VOK A;  2HYJ A;  1VI0 A;  2XRL A;  4D5C A;  2XDN A;  1RPW A;  3EUP A;  5F1J A;  1Z0X A;  2G7L A;  4JL3 A;  1JTX A;  2FBQ A;  3NRG A;  2ZOY A;  3B6A A;  5EZG A;  5GPC A;  2YVE A;  4GCT A;  3O8H A;  2HYT A;  4ICH A;  5IOY A;  2UXO A;  3CRJ A;  3ZQF A;  3Q0U A;  3VUQ A;  3QPS A;  2RHA A;  4ACI A;  3ON4 A;  3NNR A;  3MNL A;  3G1L A;  5FKL A;  1UI5 A;  3TP0 A;  3HTI A;  3HTA A;  3BR0 A;  2HQ5 A;  3G1M A;  3ZQL A;  3RD3 A;  2X9D A;  2O7T A;  3G7R A;  5K7Z A;  3HIM A;  3KKC A;  3BQZ A;  4DW6 A;  4X1E A;  3NPI A;  2QKO A;  2OF7 A;  4W97 A;  3ANP A;  3BT9 A;  5FKM A;  5J1Y A;  5DAJ A;  1JT0 A;  3BTJ A;  3BHQ A;  1ORK A;  3BNI A;  5HBU A;  4D5F A;  3O60 A;  4YZE A;  2Q24 A;  3GEU A;  3BCG A;  3ZQG A;  2HXI A;  2FJ1 A;  2G7S A;  3BJB A;  1RKT A;  3BR6 A;  5FKO A;  3BTL A;  4M3F A;  2W53 A;  2NP3 A;  4B3A A;  3O8G A;  2QCO A;  2WUI A;  2FX0 A;  3DEW A;  2NS8 A;  3GZI A;  3EGQ A;  5IP6 A;  3COL A;  4PXI A;  2HKU A;  4GCL A;  2EH3 A;  3QKX A;  3PAS A;  1JUS A;  3VIB A;  2G7G A;  4ME9 A;  1JT6 A;  2JK3 A;  3BR1 A;  4JYK A;  5D1R A;  2D6Y A;  4AC6 A;  3CJD A;  1T56 A;  2RAE A;  3IH4 A;  1ZK8 A;  5F04 A;  4AF5 A;  2GFN A;  2QWT A;  2FD5 A;  2O7O A;  2GUH A;  2V57 A;  2RAS A;  3LWJ A;  3F0C A;  4V2F A;  2NX4 A;  3BQY A;  4KWA A;  3HTJ A;  2X6O A;  3HE0 A;  3F1B A;  1QVU A;  3LJL A;  5H9T A;  1A6I A;  4NEL A;  1QPI A;  4AUX A;  3V78 A;  2WV1 A;  5FKN A;  3LOC A;  3VPR A;  3FRQ A;  5EYR A;  2ZB9 A;  2OI8 A;  2REK A;  3G1O A;  3SFI A;  1BJZ A;  3JSJ A;  1RKW A;  4ABZ A;  3VW0 A;  2UXP A;  3HGY A;  2NP5 A;  3E7Q A;  2IEK A;  4B1R A;  2UXI A;  1U9O A;  2UXU A;  2F07 A;  4HKU A;  5K7H A;  2ZCX A;  3AQT A;  3FK7 A;  5D18 A;  3NXC A;  2FQ4 A;  2ID6 A;  3LSJ A;  2OPT A;  2YVH A;  2VKV A;  2XPV A;  3Q3S A;  3LSR A;  4L62 A;  2NS7 A;  2UXH A;  2Y31 A;  3G56 A;  2I10 A;  3ON2 A;  3FIW A;  2XPW A;  3C07 A;  4MK6 A;  3VOX A;  3BR2 A;  5FKK A;  1QVT A;  5GPA A;  2IU5 A;  1ZKG A;  4CGR A;  3IH2 A;  3PPB A;  1JUM A;  2XGC A;  5FGL A;  5FMP A;  3P9T A;  5HSZ A;  2VKE A;  4GFK A;  5CXI A;  2QTQ A;  5IOZ A;  5EZH A;  2ID3 A;  3MVP A;  3AQS A;  2TRT A;  5HAW A;  2G3B A;  3DPJ A;  1SGM A;  2TCT A;  3IUV A;  2QIB A;  3V6G A;  2ZOZ A;  3FK6 A;  3WHB A;  4JNN A;  5F27 A;  3IH3 A;  3TP3 A;  4MO7 A;  5J3L A; 
#chains in the Genus database with same CATH topology
 3QPL A;  3QQA A;  4JKZ A;  4NN1 A;  3S5R A;  2GEN A;  4V2G A;  3KKD A;  2ZY9 A;  2R7X A;  5K7F A;  4I76 A;  2IBD A;  5J1R A;  3NI7 A;  2WGB A;  2GBY A;  4GFL A;  4W1U A;  5CW8 A;  4XK4 A;  4D7M A;  3KNW A;  2DTZ A;  5F0C A;  4M3G A;  4GCK A;  5D19 A;  2VPR A;  3CWR A;  3RH2 A;  5K58 A;  2G0E A;  3CDL A;  5EFY A;  3BTI A;  2R7Q A;  5AQC A;  3WHC A;  1Z77 A;  2HXO A;  3Q0V A;  5J1U A;  3VTI A;  3CCY A;  3B81 A;  2XB5 A;  5CXG A;  3PM1 A;  2XGD A;  4M3D A;  4AC0 A;  3ZQI A;  3BR3 A;  2DG7 A;  3SDG A;  5CQG A;  2Y2Z A;  2QOP A;  3ANG A;  2FJI 1;  5F08 A;  5FHP A;  3VP5 A;  4UDS A;  3LSP A;  5F0H A;  2Y30 A;  5C4Y A;  3Q0W A;  3VW2 A;  3B6C A;  2ZCN A;  3ZQH A;  5IPA A;  5GP9 A;  2IAI A;  4M3E A;  3VVZ A;  2JJ7 A;  3KZ9 A;  3KYL A;  2YVX A;  1T33 A;  2ZCM A;  3LHQ A;  4I6Z A;  3DCF A;  1UI6 A;  4D7N A;  3HGG A;  2PZ9 A;  1JUP A;  4M3B A;  3BRU A;  1JTY A;  5F0F A;  3C2B A;  2XPU A;  3BR5 A;  3BTC A;  3QBM A;  4WIB A;  3VVY A;  4MXM A;  3VW1 A;  1U9N A;  2OER A;  3T6N A;  3DU5 A;  4G12 A;  2XGE A;  2PBX A;  2DG8 A;  3HTH A;  3VVX A;  3VOK A;  2HYJ A;  1VI0 A;  2XRL A;  4D5C A;  2XDN A;  1RPW A;  3EUP A;  5F1J A;  1Z0X A;  2G7L A;  4JL3 A;  1JTX A;  2FBQ A;  3NRG A;  2ZOY A;  3B6A A;  5EZG A;  5GPC A;  2YVE A;  4GCT A;  3O8H A;  2HYT A;  4ICH A;  5IOY A;  2UXO A;  3CRJ A;  3NS4 A;  3ZQF A;  3Q0U A;  3VUQ A;  3QPS A;  4IRV A;  2RHA A;  4ACI A;  3ON4 A;  3NNR A;  3MNL A;  3G1L A;  5FKL A;  1UI5 A;  3TP0 A;  3HTI A;  3HTA A;  3BR0 A;  2HQ5 A;  3G1M A;  3ZQL A;  3RD3 A;  4U9L A;  2X9D A;  2O7T A;  3G7R A;  5K7Z A;  2R7T A;  3HIM A;  3KKC A;  3BQZ A;  4DW6 A;  4X1E A;  3FHN A;  2R7O A;  3NPI A;  2QKO A;  2OF7 A;  4W97 A;  3ANP A;  3BT9 A;  5FKM A;  5J1Y A;  5DAJ A;  1JT0 A;  3BTJ A;  3BHQ A;  1ORK A;  3BNI A;  5HBU A;  4D5F A;  3O60 A;  4YZE A;  2Q24 A;  3GEU A;  3BCG A;  3ZQG A;  2HXI A;  2FJ1 A;  2G7S A;  3BJB A;  1RKT A;  3BR6 A;  5FKO A;  3BTL A;  4M3F A;  2W53 A;  2NP3 A;  4B3A A;  3O8G A;  4U9N A;  2QCO A;  2WUI A;  4DVY P;  2FX0 A;  3DU6 A;  3DEW A;  2NS8 A;  3GZI A;  3EGQ A;  5IP6 A;  3COL A;  4PXI A;  2HKU A;  4GCL A;  2EH3 A;  2R7R A;  3QKX A;  3PAS A;  1JUS A;  3VIB A;  2G7G A;  4ME9 A;  1JT6 A;  2JK3 A;  3BR1 A;  4JYK A;  5D1R A;  2D6Y A;  4AC6 A;  3CJD A;  1T56 A;  2RAE A;  3IH4 A;  1ZK8 A;  5F04 A;  4AF5 A;  2GFN A;  2QWT A;  2FD5 A;  2O7O A;  2GUH A;  2V57 A;  2RAS A;  3LWJ A;  3F0C A;  4V2F A;  2NX4 A;  3BQY A;  4KWA A;  3HTJ A;  2X6O A;  3HE0 A;  3F1B A;  1QVU A;  3LJL A;  5H9T A;  1A6I A;  4NEL A;  1QPI A;  4AUX A;  3V78 A;  2WV1 A;  5FKN A;  3LOC A;  3VPR A;  3SWH A;  3FRQ A;  5EYR A;  2ZB9 A;  2OI8 A;  2REK A;  3G1O A;  3SFI A;  1BJZ A;  4OD4 A;  3JSJ A;  1RKW A;  4ABZ A;  3VW0 A;  2UXP A;  3HGY A;  2NP5 A;  3E7Q A;  2IEK A;  4B1R A;  2UXI A;  1U9O A;  2UXU A;  2F07 A;  4HKU A;  5K7H A;  2ZCX A;  3AQT A;  3FK7 A;  5D18 A;  3NXC A;  2FQ4 A;  2ID6 A;  3LSJ A;  2OPT A;  2YVH A;  2VKV A;  2XPV A;  3Q3S A;  3LSR A;  4L62 A;  2NS7 A;  2UXH A;  2Y31 A;  4C2M A;  3G56 A;  2R7U A;  2I10 A;  3ON2 A;  3FIW A;  2XPW A;  3C07 A;  4MK6 A;  3VOX A;  3BR2 A;  5FKK A;  1QVT A;  5GPA A;  2IU5 A;  1ZKG A;  2B3W A;  4CGR A;  3IH2 A;  3PPB A;  1JUM A;  2XGC A;  5FGL A;  5FMP A;  3P9T A;  2B1E A;  5HSZ A;  2VKE A;  4GFK A;  5CXI A;  2R7V A;  2QTQ A;  5IOZ A;  5EZH A;  2ID3 A;  3MVP A;  3AQS A;  2TRT A;  5HAW A;  2G3B A;  3DPJ A;  1SGM A;  2TCT A;  3IUV A;  2QIB A;  2PFV A;  3V6G A;  2ZOZ A;  3FK6 A;  3WHB A;  4OD5 A;  2R7S A;  4JNN A;  2R7W A;  5F27 A;  2A2F X;  3IH3 A;  3TP3 A;  3K8P C;  4MO7 A;  5J3L A; 
#chains in the Genus database with same CATH homology
 3QPL A;  3QQA A;  4JKZ A;  4NN1 A;  3S5R A;  2GEN A;  4V2G A;  3KKD A;  5K7F A;  4I76 A;  2IBD A;  5J1R A;  3NI7 A;  2WGB A;  2GBY A;  4GFL A;  4W1U A;  5CW8 A;  4XK4 A;  4D7M A;  3KNW A;  2DTZ A;  5F0C A;  4M3G A;  4GCK A;  5D19 A;  2VPR A;  3CWR A;  3RH2 A;  5K58 A;  2G0E A;  3CDL A;  5EFY A;  3BTI A;  5AQC A;  3WHC A;  1Z77 A;  2HXO A;  3Q0V A;  5J1U A;  3CCY A;  3B81 A;  2XB5 A;  5CXG A;  3PM1 A;  2XGD A;  4M3D A;  4AC0 A;  3ZQI A;  3BR3 A;  2DG7 A;  3SDG A;  2Y2Z A;  2QOP A;  3ANG A;  5F08 A;  5FHP A;  3VP5 A;  4UDS A;  3LSP A;  5F0H A;  2Y30 A;  3VW2 A;  3Q0W A;  5C4Y A;  3B6C A;  2ZCN A;  3ZQH A;  5IPA A;  5GP9 A;  2IAI A;  4M3E A;  3VVZ A;  2JJ7 A;  3KZ9 A;  1T33 A;  2ZCM A;  3LHQ A;  4I6Z A;  3DCF A;  1UI6 A;  4D7N A;  3HGG A;  2PZ9 A;  1JUP A;  4M3B A;  3BRU A;  1JTY A;  5F0F A;  3C2B A;  2XPU A;  3BR5 A;  3BTC A;  3QBM A;  3VVY A;  4MXM A;  3VW1 A;  1U9N A;  2OER A;  3T6N A;  4G12 A;  2XGE A;  2PBX A;  2DG8 A;  3HTH A;  3VVX A;  3VOK A;  2HYJ A;  1VI0 A;  2XRL A;  4D5C A;  2XDN A;  1RPW A;  3EUP A;  5F1J A;  1Z0X A;  2G7L A;  4JL3 A;  1JTX A;  2FBQ A;  3NRG A;  2ZOY A;  3B6A A;  5EZG A;  5GPC A;  2YVE A;  4GCT A;  3O8H A;  2HYT A;  4ICH A;  5IOY A;  2UXO A;  3CRJ A;  3ZQF A;  3Q0U A;  3VUQ A;  3QPS A;  2RHA A;  4ACI A;  3ON4 A;  3NNR A;  3MNL A;  3G1L A;  5FKL A;  1UI5 A;  3TP0 A;  3HTI A;  3HTA A;  3BR0 A;  2HQ5 A;  3G1M A;  3ZQL A;  3RD3 A;  2X9D A;  2O7T A;  3G7R A;  5K7Z A;  3HIM A;  3KKC A;  3BQZ A;  4DW6 A;  4X1E A;  3NPI A;  2QKO A;  2OF7 A;  4W97 A;  3ANP A;  3BT9 A;  5FKM A;  5J1Y A;  5DAJ A;  1JT0 A;  3BTJ A;  3BHQ A;  1ORK A;  3BNI A;  5HBU A;  4D5F A;  3O60 A;  4YZE A;  2Q24 A;  3GEU A;  3BCG A;  3ZQG A;  2HXI A;  2FJ1 A;  2G7S A;  3BJB A;  1RKT A;  3BR6 A;  5FKO A;  3BTL A;  4M3F A;  2W53 A;  2NP3 A;  4B3A A;  3O8G A;  2QCO A;  2WUI A;  2FX0 A;  3DEW A;  2NS8 A;  3GZI A;  3EGQ A;  5IP6 A;  3COL A;  4PXI A;  2HKU A;  4GCL A;  2EH3 A;  3QKX A;  3PAS A;  1JUS A;  3VIB A;  2G7G A;  4ME9 A;  1JT6 A;  2JK3 A;  3BR1 A;  4JYK A;  5D1R A;  2D6Y A;  4AC6 A;  3CJD A;  1T56 A;  2RAE A;  3IH4 A;  1ZK8 A;  5F04 A;  4AF5 A;  2GFN A;  2QWT A;  2FD5 A;  2O7O A;  2GUH A;  2V57 A;  2RAS A;  3LWJ A;  3F0C A;  4V2F A;  2NX4 A;  3BQY A;  4KWA A;  3HTJ A;  2X6O A;  3HE0 A;  3F1B A;  1QVU A;  3LJL A;  5H9T A;  1A6I A;  4NEL A;  1QPI A;  4AUX A;  3V78 A;  2WV1 A;  5FKN A;  3LOC A;  3VPR A;  3FRQ A;  5EYR A;  2ZB9 A;  2OI8 A;  2REK A;  3G1O A;  3SFI A;  1BJZ A;  3JSJ A;  1RKW A;  4ABZ A;  3VW0 A;  2UXP A;  3HGY A;  2NP5 A;  3E7Q A;  2IEK A;  4B1R A;  2UXI A;  1U9O A;  2UXU A;  2F07 A;  4HKU A;  5K7H A;  2ZCX A;  3AQT A;  3FK7 A;  5D18 A;  3NXC A;  2FQ4 A;  2ID6 A;  3LSJ A;  2OPT A;  2YVH A;  2VKV A;  2XPV A;  3Q3S A;  3LSR A;  4L62 A;  2NS7 A;  2UXH A;  2Y31 A;  3G56 A;  2I10 A;  3ON2 A;  3FIW A;  2XPW A;  3C07 A;  4MK6 A;  3VOX A;  3BR2 A;  5FKK A;  1QVT A;  5GPA A;  2IU5 A;  1ZKG A;  4CGR A;  3IH2 A;  3PPB A;  1JUM A;  2XGC A;  5FGL A;  5FMP A;  3P9T A;  5HSZ A;  2VKE A;  4GFK A;  5CXI A;  2QTQ A;  5IOZ A;  5EZH A;  2ID3 A;  3MVP A;  3AQS A;  2TRT A;  5HAW A;  2G3B A;  3DPJ A;  1SGM A;  2TCT A;  3IUV A;  2QIB A;  3V6G A;  2ZOZ A;  3FK6 A;  3WHB A;  4JNN A;  5F27 A;  3IH3 A;  3TP3 A;  4MO7 A;  5J3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...