3VOKA

X-ray crystal structure of wild type hrtr in the apo form with the target dna.
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
188
structure length
176
Chain Sequence
PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITDRKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transcription/dna
molecule keywords Transcriptional regulator
total genus 70
structure length 176
sequence length 188
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vokA00
1UI6A 3CJDA 3O60A 2UXOA 3NRGA 4KWAA 3BTIA 2FBQA 3G7RA 3GZIA 3LSRA 3BR5A 2TRTA 2DG8A 3CRJA 3BR6A 2NP5A 2G7GA 2IEKA 5EFYA 3T6NA 3B6AA 3VIBA 4G12A 3BT9A 2OPTA 3VOXA 1RKWA 3RD3A 4HKUA 3G1OA 3HTIA 1Z77A 3GEUA 4ICHA 3BRUA 5FKMA 2DTZA 2G7LA 3RH2A 5FMPA 5HAWA 1JT0A 1RKTA 3QBMA 3ANGA 4I76A 3IH4A 2WGBA 2ZCMA 3Q0VA 4B3AA 4GCTA 2PBXA 3HE0A 3O8GA 4D5CA 1JTYA 3DPJA 2XB5A 5F1JA 2OI8A 1A6IA 2V57A 3BQZA 5F0FA 5FHPA 4GCKA 3C2BA 4GCLA 3LWJA 3G1LA 2EH3A 1ZK8A 3BR3A 2XRLA 3FIWA 3QPLA 1QPIA 5FGLA 5D1RA 3ANPA 3TP3A 3LSPA 2QWTA 2QKOA 2XPUA 2JJ7A 2ZOYA 2WUIA 3BCGA 2GENA 5J1RA 2UXPA 4M3DA 3VVXA 4M3BA 5GPCA 3DCFA 3WHBA 3BHQA 4MO7A 5IPAA 4I6ZA 5F08A 5K7ZA 4D5FA 1RPWA 2TCTA 3HTJA 2F07A 2NS7A 2FJ1A 1QVUA 4M3FA 3SDGA 3NPIA 3C07A 2HXOA 2UXIA 3S5RA 2XPVA 3FRQA 5J3LA 1QVTA 1ORKA 3EUPA 1JT6A 3KZ9A 5J1UA 3BNIA 2FQ4A 1T56A 4M3GA 4W97A 3VW2A 2IAIA 3B81A 3TP0A 3WHCA 2RAEA 3BQYA 4JNNA 2D6YA 4X1EA 2W53A 2QOPA 2GFNA 5DAJA 1JUPA 2XGCA 3ZQHA 3Q0WA 3JSJA 2G7SA 3VUQA 4NELA 4ACIA 3ZQIA 4GFKA 4AC6A 3FK7A 3CWRA 5HSZA 3BR2A 4ME9A 4D7NA 3ON4A 1VI0A 3VVYA 2HKUA 1JTXA 5FKLA 3V78A 3Q3SA 3PM1A 3NI7A 2QTQA 3HGYA 3B6CA 2G3BA 2UXHA 2GBYA 4M3EA 2OF7A 3HGGA 2RHAA 1SGMA 5C4YA 5HBUA 3COLA 5FKNA 3KKDA 2ZB9A 3ZQLA 3ZQFA 2ZOZA 3BR1A 5EZGA 3F0CA 3HTHA 2O7OA 5F0CA 2PZ9A 3VW0A 5CXIA 5CW8A 4NN1A 4JL3A 3O8HA 2HQ5A 3KKCA 1BJZA 3ZQGA 4XK4A 3ON2A 4GFLA 3V6GA 2IBDA 2Q24A 3PASA 4PXIA 2REKA 3QKXA 2G0EA 2I10A 5K58A 2ID3A 3VW1A 5FKKA 5F0HA 2VKEA 3EGQA 2HXIA 2Y31A 2JK3A 4V2GA 2NS8A 5IOZA 3VVZA 4ABZA 1JUMA 3F1BA 2UXUA 4V2FA 3CDLA 5GPAA 3FK6A 5FKOA 2XDNA 3MNLA 1JUSA 1ZKGA 2YVHA 1U9OA 2NX4A 3BTJA 2VPRA 2FX0A 4DW6A 3MVPA 2O7TA 3CCYA 2Y2ZA 1UI5A 2HYTA 3HIMA 4CGRA 5EYRA 5CXGA 3AQSA 5F04A 3IUVA 5EZHA 5D19A 4W1UA 2IU5A 2ID6A 4B1RA 3QPSA 5J1YA 3KNWA 4AUXA 3BR0A 4AF5A 4L62A 5AQCA 2VKVA 5IOYA 2DG7A 5H9TA 3E7QA 2OERA 3DEWA 4MXMA 3BJBA 5K7HA 4JYKA 2XGEA 3BTCA 2YVEA 5K7FA 3VOKA 4AC0A 1U9NA 2RASA 2ZCXA 3G1MA 4JKZA 2GUHA 3AQTA 3LJLA 3NNRA 2HYJA 2XGDA 4YZEA 1Z0XA 3VP5A 3LHQA 2WV1A 4UDSA 3LOCA 3Q0UA 2FD5A 2X6OA 3IH2A 1T33A 2QCOA 2X9DA 5IP6A 3SFIA 5F27A 3BTLA 4MK6A 2NP3A 3HTAA 3LSJA 3VPRA 2ZCNA 3NXCA 3PPBA 2XPWA 2Y30A 3G56A 5D18A 3IH3A 3QQAA 3P9TA 4D7MA 5GP9A 2QIBA
chains in the Genus database with same CATH superfamily
1UI6A 3CJDA 3O60A 2UXOA 3NRGA 4KWAA 3BTIA 2FBQA 4U9NA 3G7RA 3GZIA 3LSRA 3BR5A 2TRTA 2DG8A 3CRJA 3BR6A 2NP5A 2G7GA 2IEKA 5EFYA 3T6NA 3B6AA 3VIBA 4G12A 3BT9A 2OPTA 3VOXA 1RKWA 3RD3A 4HKUA 3G1OA 3HTIA 1Z77A 3GEUA 4ICHA 2PFVA 3BRUA 5FKMA 2DTZA 2G7LA 3RH2A 5FMPA 5HAWA 1JT0A 1RKTA 3QBMA 3ANGA 4I76A 3IH4A 2WGBA 2ZCMA 3Q0VA 4B3AA 4GCTA 2PBXA 3HE0A 3O8GA 4D5CA 1JTYA 3DPJA 2XB5A 5F1JA 2OI8A 1A6IA 2V57A 3BQZA 5F0FA 5FHPA 4GCKA 3C2BA 4GCLA 3LWJA 3G1LA 2EH3A 1ZK8A 3BR3A 2XRLA 3FIWA 3QPLA 1QPIA 5FGLA 5D1RA 3ANPA 3TP3A 3LSPA 2QWTA 2QKOA 2XPUA 2JJ7A 2ZOYA 2WUIA 3BCGA 2GENA 5J1RA 2UXPA 4M3DA 3VVXA 4M3BA 5GPCA 3DCFA 3WHBA 3BHQA 4MO7A 5IPAA 4I6ZA 4WIBA 5F08A 2R7RA 5K7ZA 4D5FA 1RPWA 2FJI1 2TCTA 2R7TA 3HTJA 2F07A 2NS7A 2FJ1A 1QVUA 4M3FA 3SDGA 3NPIA 3C07A 2HXOA 2UXIA 3S5RA 2XPVA 3FRQA 5J3LA 3K8PC 5CQGA 1QVTA 1ORKA 3EUPA 1JT6A 3KZ9A 5J1UA 3BNIA 3DU5A 2FQ4A 1T56A 4M3GA 4W97A 3VW2A 2IAIA 3B81A 3TP0A 3WHCA 2RAEA 3BQYA 4JNNA 2D6YA 4X1EA 4OD4A 2W53A 2QOPA 2GFNA 5DAJA 1JUPA 3SWHA 2XGCA 3ZQHA 3Q0WA 3JSJA 2G7SA 3VUQA 4NELA 4ACIA 3ZQIA 4GFKA 4AC6A 3FK7A 3CWRA 5HSZA 3BR2A 4ME9A 4D7NA 3ON4A 1VI0A 3VVYA 2HKUA 1JTXA 5FKLA 3V78A 3Q3SA 3PM1A 3NI7A 2QTQA 3HGYA 3B6CA 2G3BA 2UXHA 2GBYA 4M3EA 3FHNA 2OF7A 3HGGA 2RHAA 1SGMA 2YVXA 5C4YA 5HBUA 3COLA 5FKNA 3KKDA 2ZB9A 3ZQLA 3ZQFA 2ZOZA 3BR1A 5EZGA 3F0CA 3HTHA 2O7OA 5F0CA 2PZ9A 3VW0A 2A2FX 5CXIA 5CW8A 4NN1A 4JL3A 3O8HA 2HQ5A 3KKCA 1BJZA 3ZQGA 4XK4A 3ON2A 4GFLA 3V6GA 2IBDA 3VTIA 2Q24A 3PASA 4PXIA 2REKA 2B1EA 3QKXA 2G0EA 3KYLA 2I10A 5K58A 2ID3A 3VW1A 5FKKA 5F0HA 2VKEA 3EGQA 2HXIA 3NS4A 2Y31A 2JK3A 4V2GA 2B3WA 2NS8A 4OD5A 5IOZA 3VVZA 4ABZA 1JUMA 3F1BA 2UXUA 4V2FA 3CDLA 5GPAA 3FK6A 5FKOA 2XDNA 3MNLA 1JUSA 1ZKGA 2YVHA 1U9OA 2NX4A 3BTJA 2VPRA 2FX0A 4DW6A 3MVPA 2O7TA 3CCYA 2Y2ZA 1UI5A 2HYTA 2R7VA 3HIMA 3DU6A 4CGRA 5EYRA 5CXGA 3AQSA 5F04A 3IUVA 5EZHA 5D19A 4W1UA 2IU5A 2ID6A 4B1RA 4DVYP 3QPSA 5J1YA 3KNWA 4AUXA 3BR0A 4AF5A 4L62A 5AQCA 2VKVA 4IRVA 2ZY9A 5IOYA 2DG7A 5H9TA 3E7QA 2R7SA 2OERA 3DEWA 2R7UA 2R7QA 4MXMA 3BJBA 5K7HA 4JYKA 2XGEA 3BTCA 2YVEA 5K7FA 4U9LA 3VOKA 4AC0A 1U9NA 2RASA 2ZCXA 3G1MA 2R7WA 4JKZA 2GUHA 3AQTA 3LJLA 3NNRA 2HYJA 2XGDA 4YZEA 4C2MA 1Z0XA 3VP5A 3LHQA 2WV1A 4UDSA 3LOCA 3Q0UA 2FD5A 2X6OA 3IH2A 1T33A 2QCOA 2X9DA 5IP6A 3SFIA 5F27A 3BTLA 4MK6A 2NP3A 3HTAA 3LSJA 3VPRA 2ZCNA 3NXCA 3PPBA 2XPWA 2Y30A 3G56A 5D18A 3IH3A 3QQAA 3P9TA 4D7MA 2R7XA 5GP9A 2QIBA 2R7OA
chains in the Genus database with same CATH topology
1UI6A 3CJDA 3O60A 2UXOA 3NRGA 4KWAA 3BTIA 2FBQA 3G7RA 3GZIA 3LSRA 3BR5A 2TRTA 2DG8A 3CRJA 3BR6A 2NP5A 2G7GA 2IEKA 5EFYA 3T6NA 3B6AA 3VIBA 4G12A 3BT9A 2OPTA 3VOXA 1RKWA 3RD3A 4HKUA 3G1OA 3HTIA 1Z77A 3GEUA 4ICHA 3BRUA 5FKMA 2DTZA 2G7LA 3RH2A 5FMPA 5HAWA 1JT0A 1RKTA 3QBMA 3ANGA 4I76A 3IH4A 2WGBA 2ZCMA 3Q0VA 4B3AA 4GCTA 2PBXA 3HE0A 3O8GA 4D5CA 1JTYA 3DPJA 2XB5A 5F1JA 2OI8A 1A6IA 2V57A 3BQZA 5F0FA 5FHPA 4GCKA 3C2BA 4GCLA 3LWJA 3G1LA 2EH3A 1ZK8A 3BR3A 2XRLA 3FIWA 3QPLA 1QPIA 5FGLA 5D1RA 3ANPA 3TP3A 3LSPA 2QWTA 2QKOA 2XPUA 2JJ7A 2ZOYA 2WUIA 3BCGA 2GENA 5J1RA 2UXPA 4M3DA 3VVXA 4M3BA 5GPCA 3DCFA 3WHBA 3BHQA 4MO7A 5IPAA 4I6ZA 5F08A 5K7ZA 4D5FA 1RPWA 2TCTA 3HTJA 2F07A 2NS7A 2FJ1A 1QVUA 4M3FA 3SDGA 3NPIA 3C07A 2HXOA 2UXIA 3S5RA 2XPVA 3FRQA 5J3LA 1QVTA 1ORKA 3EUPA 1JT6A 3KZ9A 5J1UA 3BNIA 2FQ4A 1T56A 4M3GA 4W97A 3VW2A 2IAIA 3B81A 3TP0A 3WHCA 2RAEA 3BQYA 4JNNA 2D6YA 4X1EA 2W53A 2QOPA 2GFNA 5DAJA 1JUPA 2XGCA 3ZQHA 3Q0WA 3JSJA 2G7SA 3VUQA 4NELA 4ACIA 3ZQIA 4GFKA 4AC6A 3FK7A 3CWRA 5HSZA 3BR2A 4ME9A 4D7NA 3ON4A 1VI0A 3VVYA 2HKUA 1JTXA 5FKLA 3V78A 3Q3SA 3PM1A 3NI7A 2QTQA 3HGYA 3B6CA 2G3BA 2UXHA 2GBYA 4M3EA 2OF7A 3HGGA 2RHAA 1SGMA 5C4YA 5HBUA 3COLA 5FKNA 3KKDA 2ZB9A 3ZQLA 3ZQFA 2ZOZA 3BR1A 5EZGA 3F0CA 3HTHA 2O7OA 5F0CA 2PZ9A 3VW0A 5CXIA 5CW8A 4NN1A 4JL3A 3O8HA 2HQ5A 3KKCA 1BJZA 3ZQGA 4XK4A 3ON2A 4GFLA 3V6GA 2IBDA 2Q24A 3PASA 4PXIA 2REKA 3QKXA 2G0EA 2I10A 5K58A 2ID3A 3VW1A 5FKKA 5F0HA 2VKEA 3EGQA 2HXIA 2Y31A 2JK3A 4V2GA 2NS8A 5IOZA 3VVZA 4ABZA 1JUMA 3F1BA 2UXUA 4V2FA 3CDLA 5GPAA 3FK6A 5FKOA 2XDNA 3MNLA 1JUSA 1ZKGA 2YVHA 1U9OA 2NX4A 3BTJA 2VPRA 2FX0A 4DW6A 3MVPA 2O7TA 3CCYA 2Y2ZA 1UI5A 2HYTA 3HIMA 4CGRA 5EYRA 5CXGA 3AQSA 5F04A 3IUVA 5EZHA 5D19A 4W1UA 2IU5A 2ID6A 4B1RA 3QPSA 5J1YA 3KNWA 4AUXA 3BR0A 4AF5A 4L62A 5AQCA 2VKVA 5IOYA 2DG7A 5H9TA 3E7QA 2OERA 3DEWA 4MXMA 3BJBA 5K7HA 4JYKA 2XGEA 3BTCA 2YVEA 5K7FA 3VOKA 4AC0A 1U9NA 2RASA 2ZCXA 3G1MA 4JKZA 2GUHA 3AQTA 3LJLA 3NNRA 2HYJA 2XGDA 4YZEA 1Z0XA 3VP5A 3LHQA 2WV1A 4UDSA 3LOCA 3Q0UA 2FD5A 2X6OA 3IH2A 1T33A 2QCOA 2X9DA 5IP6A 3SFIA 5F27A 3BTLA 4MK6A 2NP3A 3HTAA 3LSJA 3VPRA 2ZCNA 3NXCA 3PPBA 2XPWA 2Y30A 3G56A 5D18A 3IH3A 3QQAA 3P9TA 4D7MA 5GP9A 2QIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UI6 A;  3CJD A;  3O60 A;  2UXO A;  3NRG A;  4KWA A;  3BTI A;  2FBQ A;  3G7R A;  3GZI A;  3LSR A;  3BR5 A;  2TRT A;  2DG8 A;  3CRJ A;  3BR6 A;  2NP5 A;  2G7G A;  2IEK A;  5EFY A;  3T6N A;  3B6A A;  3VIB A;  4G12 A;  3BT9 A;  2OPT A;  3VOX A;  1RKW A;  3RD3 A;  4HKU A;  3G1O A;  3HTI A;  1Z77 A;  3GEU A;  4ICH A;  3BRU A;  5FKM A;  2DTZ A;  2G7L A;  3RH2 A;  5FMP A;  5HAW A;  1JT0 A;  1RKT A;  3QBM A;  3ANG A;  4I76 A;  3IH4 A;  2WGB A;  2ZCM A;  3Q0V A;  4B3A A;  4GCT A;  2PBX A;  3HE0 A;  3O8G A;  4D5C A;  1JTY A;  3DPJ A;  2XB5 A;  5F1J A;  2OI8 A;  1A6I A;  2V57 A;  3BQZ A;  5F0F A;  5FHP A;  4GCK A;  3C2B A;  4GCL A;  3LWJ A;  3G1L A;  2EH3 A;  1ZK8 A;  3BR3 A;  2XRL A;  3FIW A;  3QPL A;  1QPI A;  5FGL A;  5D1R A;  3ANP A;  3TP3 A;  3LSP A;  2QWT A;  2QKO A;  2XPU A;  2JJ7 A;  2ZOY A;  2WUI A;  3BCG A;  2GEN A;  5J1R A;  2UXP A;  4M3D A;  3VVX A;  4M3B A;  5GPC A;  3DCF A;  3WHB A;  3BHQ A;  4MO7 A;  5IPA A;  4I6Z A;  5F08 A;  5K7Z A;  4D5F A;  1RPW A;  2TCT A;  3HTJ A;  2F07 A;  2NS7 A;  2FJ1 A;  1QVU A;  4M3F A;  3SDG A;  3NPI A;  3C07 A;  2HXO A;  2UXI A;  3S5R A;  2XPV A;  3FRQ A;  5J3L A;  1QVT A;  1ORK A;  3EUP A;  1JT6 A;  3KZ9 A;  5J1U A;  3BNI A;  2FQ4 A;  1T56 A;  4M3G A;  4W97 A;  3VW2 A;  2IAI A;  3B81 A;  3TP0 A;  3WHC A;  2RAE A;  3BQY A;  4JNN A;  2D6Y A;  4X1E A;  2W53 A;  2QOP A;  2GFN A;  5DAJ A;  1JUP A;  2XGC A;  3ZQH A;  3Q0W A;  3JSJ A;  2G7S A;  3VUQ A;  4NEL A;  4ACI A;  3ZQI A;  4GFK A;  4AC6 A;  3FK7 A;  3CWR A;  5HSZ A;  3BR2 A;  4ME9 A;  4D7N A;  3ON4 A;  1VI0 A;  3VVY A;  2HKU A;  1JTX A;  5FKL A;  3V78 A;  3Q3S A;  3PM1 A;  3NI7 A;  2QTQ A;  3HGY A;  3B6C A;  2G3B A;  2UXH A;  2GBY A;  4M3E A;  2OF7 A;  3HGG A;  2RHA A;  1SGM A;  5C4Y A;  5HBU A;  3COL A;  5FKN A;  3KKD A;  2ZB9 A;  3ZQL A;  3ZQF A;  2ZOZ A;  3BR1 A;  5EZG A;  3F0C A;  3HTH A;  2O7O A;  5F0C A;  2PZ9 A;  3VW0 A;  5CXI A;  5CW8 A;  4NN1 A;  4JL3 A;  3O8H A;  2HQ5 A;  3KKC A;  1BJZ A;  3ZQG A;  4XK4 A;  3ON2 A;  4GFL A;  3V6G A;  2IBD A;  2Q24 A;  3PAS A;  4PXI A;  2REK A;  3QKX A;  2G0E A;  2I10 A;  5K58 A;  2ID3 A;  3VW1 A;  5FKK A;  5F0H A;  2VKE A;  3EGQ A;  2HXI A;  2Y31 A;  2JK3 A;  4V2G A;  2NS8 A;  5IOZ A;  3VVZ A;  4ABZ A;  1JUM A;  3F1B A;  2UXU A;  4V2F A;  3CDL A;  5GPA A;  3FK6 A;  5FKO A;  2XDN A;  3MNL A;  1JUS A;  1ZKG A;  2YVH A;  1U9O A;  2NX4 A;  3BTJ A;  2VPR A;  2FX0 A;  4DW6 A;  3MVP A;  2O7T A;  3CCY A;  2Y2Z A;  1UI5 A;  2HYT A;  3HIM A;  4CGR A;  5EYR A;  5CXG A;  3AQS A;  5F04 A;  3IUV A;  5EZH A;  5D19 A;  4W1U A;  2IU5 A;  2ID6 A;  4B1R A;  3QPS A;  5J1Y A;  3KNW A;  4AUX A;  3BR0 A;  4AF5 A;  4L62 A;  5AQC A;  2VKV A;  5IOY A;  2DG7 A;  5H9T A;  3E7Q A;  2OER A;  3DEW A;  4MXM A;  3BJB A;  5K7H A;  4JYK A;  2XGE A;  3BTC A;  2YVE A;  5K7F A;  3VOK A;  4AC0 A;  1U9N A;  2RAS A;  2ZCX A;  3G1M A;  4JKZ A;  2GUH A;  3AQT A;  3LJL A;  3NNR A;  2HYJ A;  2XGD A;  4YZE A;  1Z0X A;  3VP5 A;  3LHQ A;  2WV1 A;  4UDS A;  3LOC A;  3Q0U A;  2FD5 A;  2X6O A;  3IH2 A;  1T33 A;  2QCO A;  2X9D A;  5IP6 A;  3SFI A;  5F27 A;  3BTL A;  4MK6 A;  2NP3 A;  3HTA A;  3LSJ A;  3VPR A;  2ZCN A;  3NXC A;  3PPB A;  2XPW A;  2Y30 A;  3G56 A;  5D18 A;  3IH3 A;  3QQA A;  3P9T A;  4D7M A;  5GP9 A;  2QIB A; 
#chains in the Genus database with same CATH topology
 1UI6 A;  3CJD A;  3O60 A;  2UXO A;  3NRG A;  4KWA A;  3BTI A;  2FBQ A;  4U9N A;  3G7R A;  3GZI A;  3LSR A;  3BR5 A;  2TRT A;  2DG8 A;  3CRJ A;  3BR6 A;  2NP5 A;  2G7G A;  2IEK A;  5EFY A;  3T6N A;  3B6A A;  3VIB A;  4G12 A;  3BT9 A;  2OPT A;  3VOX A;  1RKW A;  3RD3 A;  4HKU A;  3G1O A;  3HTI A;  1Z77 A;  3GEU A;  4ICH A;  2PFV A;  3BRU A;  5FKM A;  2DTZ A;  2G7L A;  3RH2 A;  5FMP A;  5HAW A;  1JT0 A;  1RKT A;  3QBM A;  3ANG A;  4I76 A;  3IH4 A;  2WGB A;  2ZCM A;  3Q0V A;  4B3A A;  4GCT A;  2PBX A;  3HE0 A;  3O8G A;  4D5C A;  1JTY A;  3DPJ A;  2XB5 A;  5F1J A;  2OI8 A;  1A6I A;  2V57 A;  3BQZ A;  5F0F A;  5FHP A;  4GCK A;  3C2B A;  4GCL A;  3LWJ A;  3G1L A;  2EH3 A;  1ZK8 A;  3BR3 A;  2XRL A;  3FIW A;  3QPL A;  1QPI A;  5FGL A;  5D1R A;  3ANP A;  3TP3 A;  3LSP A;  2QWT A;  2QKO A;  2XPU A;  2JJ7 A;  2ZOY A;  2WUI A;  3BCG A;  2GEN A;  5J1R A;  2UXP A;  4M3D A;  3VVX A;  4M3B A;  5GPC A;  3DCF A;  3WHB A;  3BHQ A;  4MO7 A;  5IPA A;  4I6Z A;  4WIB A;  5F08 A;  2R7R A;  5K7Z A;  4D5F A;  1RPW A;  2FJI 1;  2TCT A;  2R7T A;  3HTJ A;  2F07 A;  2NS7 A;  2FJ1 A;  1QVU A;  4M3F A;  3SDG A;  3NPI A;  3C07 A;  2HXO A;  2UXI A;  3S5R A;  2XPV A;  3FRQ A;  5J3L A;  3K8P C;  5CQG A;  1QVT A;  1ORK A;  3EUP A;  1JT6 A;  3KZ9 A;  5J1U A;  3BNI A;  3DU5 A;  2FQ4 A;  1T56 A;  4M3G A;  4W97 A;  3VW2 A;  2IAI A;  3B81 A;  3TP0 A;  3WHC A;  2RAE A;  3BQY A;  4JNN A;  2D6Y A;  4X1E A;  4OD4 A;  2W53 A;  2QOP A;  2GFN A;  5DAJ A;  1JUP A;  3SWH A;  2XGC A;  3ZQH A;  3Q0W A;  3JSJ A;  2G7S A;  3VUQ A;  4NEL A;  4ACI A;  3ZQI A;  4GFK A;  4AC6 A;  3FK7 A;  3CWR A;  5HSZ A;  3BR2 A;  4ME9 A;  4D7N A;  3ON4 A;  1VI0 A;  3VVY A;  2HKU A;  1JTX A;  5FKL A;  3V78 A;  3Q3S A;  3PM1 A;  3NI7 A;  2QTQ A;  3HGY A;  3B6C A;  2G3B A;  2UXH A;  2GBY A;  4M3E A;  3FHN A;  2OF7 A;  3HGG A;  2RHA A;  1SGM A;  2YVX A;  5C4Y A;  5HBU A;  3COL A;  5FKN A;  3KKD A;  2ZB9 A;  3ZQL A;  3ZQF A;  2ZOZ A;  3BR1 A;  5EZG A;  3F0C A;  3HTH A;  2O7O A;  5F0C A;  2PZ9 A;  3VW0 A;  2A2F X;  5CXI A;  5CW8 A;  4NN1 A;  4JL3 A;  3O8H A;  2HQ5 A;  3KKC A;  1BJZ A;  3ZQG A;  4XK4 A;  3ON2 A;  4GFL A;  3V6G A;  2IBD A;  3VTI A;  2Q24 A;  3PAS A;  4PXI A;  2REK A;  2B1E A;  3QKX A;  2G0E A;  3KYL A;  2I10 A;  5K58 A;  2ID3 A;  3VW1 A;  5FKK A;  5F0H A;  2VKE A;  3EGQ A;  2HXI A;  3NS4 A;  2Y31 A;  2JK3 A;  4V2G A;  2B3W A;  2NS8 A;  4OD5 A;  5IOZ A;  3VVZ A;  4ABZ A;  1JUM A;  3F1B A;  2UXU A;  4V2F A;  3CDL A;  5GPA A;  3FK6 A;  5FKO A;  2XDN A;  3MNL A;  1JUS A;  1ZKG A;  2YVH A;  1U9O A;  2NX4 A;  3BTJ A;  2VPR A;  2FX0 A;  4DW6 A;  3MVP A;  2O7T A;  3CCY A;  2Y2Z A;  1UI5 A;  2HYT A;  2R7V A;  3HIM A;  3DU6 A;  4CGR A;  5EYR A;  5CXG A;  3AQS A;  5F04 A;  3IUV A;  5EZH A;  5D19 A;  4W1U A;  2IU5 A;  2ID6 A;  4B1R A;  4DVY P;  3QPS A;  5J1Y A;  3KNW A;  4AUX A;  3BR0 A;  4AF5 A;  4L62 A;  5AQC A;  2VKV A;  4IRV A;  2ZY9 A;  5IOY A;  2DG7 A;  5H9T A;  3E7Q A;  2R7S A;  2OER A;  3DEW A;  2R7U A;  2R7Q A;  4MXM A;  3BJB A;  5K7H A;  4JYK A;  2XGE A;  3BTC A;  2YVE A;  5K7F A;  4U9L A;  3VOK A;  4AC0 A;  1U9N A;  2RAS A;  2ZCX A;  3G1M A;  2R7W A;  4JKZ A;  2GUH A;  3AQT A;  3LJL A;  3NNR A;  2HYJ A;  2XGD A;  4YZE A;  4C2M A;  1Z0X A;  3VP5 A;  3LHQ A;  2WV1 A;  4UDS A;  3LOC A;  3Q0U A;  2FD5 A;  2X6O A;  3IH2 A;  1T33 A;  2QCO A;  2X9D A;  5IP6 A;  3SFI A;  5F27 A;  3BTL A;  4MK6 A;  2NP3 A;  3HTA A;  3LSJ A;  3VPR A;  2ZCN A;  3NXC A;  3PPB A;  2XPW A;  2Y30 A;  3G56 A;  5D18 A;  3IH3 A;  3QQA A;  3P9T A;  4D7M A;  2R7X A;  5GP9 A;  2QIB A;  2R7O A; 
#chains in the Genus database with same CATH homology
 1UI6 A;  3CJD A;  3O60 A;  2UXO A;  3NRG A;  4KWA A;  3BTI A;  2FBQ A;  3G7R A;  3GZI A;  3LSR A;  3BR5 A;  2TRT A;  2DG8 A;  3CRJ A;  3BR6 A;  2NP5 A;  2G7G A;  2IEK A;  5EFY A;  3T6N A;  3B6A A;  3VIB A;  4G12 A;  3BT9 A;  2OPT A;  3VOX A;  1RKW A;  3RD3 A;  4HKU A;  3G1O A;  3HTI A;  1Z77 A;  3GEU A;  4ICH A;  3BRU A;  5FKM A;  2DTZ A;  2G7L A;  3RH2 A;  5FMP A;  5HAW A;  1JT0 A;  1RKT A;  3QBM A;  3ANG A;  4I76 A;  3IH4 A;  2WGB A;  2ZCM A;  3Q0V A;  4B3A A;  4GCT A;  2PBX A;  3HE0 A;  3O8G A;  4D5C A;  1JTY A;  3DPJ A;  2XB5 A;  5F1J A;  2OI8 A;  1A6I A;  2V57 A;  3BQZ A;  5F0F A;  5FHP A;  4GCK A;  3C2B A;  4GCL A;  3LWJ A;  3G1L A;  2EH3 A;  1ZK8 A;  3BR3 A;  2XRL A;  3FIW A;  3QPL A;  1QPI A;  5FGL A;  5D1R A;  3ANP A;  3TP3 A;  3LSP A;  2QWT A;  2QKO A;  2XPU A;  2JJ7 A;  2ZOY A;  2WUI A;  3BCG A;  2GEN A;  5J1R A;  2UXP A;  4M3D A;  3VVX A;  4M3B A;  5GPC A;  3DCF A;  3WHB A;  3BHQ A;  4MO7 A;  5IPA A;  4I6Z A;  5F08 A;  5K7Z A;  4D5F A;  1RPW A;  2TCT A;  3HTJ A;  2F07 A;  2NS7 A;  2FJ1 A;  1QVU A;  4M3F A;  3SDG A;  3NPI A;  3C07 A;  2HXO A;  2UXI A;  3S5R A;  2XPV A;  3FRQ A;  5J3L A;  1QVT A;  1ORK A;  3EUP A;  1JT6 A;  3KZ9 A;  5J1U A;  3BNI A;  2FQ4 A;  1T56 A;  4M3G A;  4W97 A;  3VW2 A;  2IAI A;  3B81 A;  3TP0 A;  3WHC A;  2RAE A;  3BQY A;  4JNN A;  2D6Y A;  4X1E A;  2W53 A;  2QOP A;  2GFN A;  5DAJ A;  1JUP A;  2XGC A;  3ZQH A;  3Q0W A;  3JSJ A;  2G7S A;  3VUQ A;  4NEL A;  4ACI A;  3ZQI A;  4GFK A;  4AC6 A;  3FK7 A;  3CWR A;  5HSZ A;  3BR2 A;  4ME9 A;  4D7N A;  3ON4 A;  1VI0 A;  3VVY A;  2HKU A;  1JTX A;  5FKL A;  3V78 A;  3Q3S A;  3PM1 A;  3NI7 A;  2QTQ A;  3HGY A;  3B6C A;  2G3B A;  2UXH A;  2GBY A;  4M3E A;  2OF7 A;  3HGG A;  2RHA A;  1SGM A;  5C4Y A;  5HBU A;  3COL A;  5FKN A;  3KKD A;  2ZB9 A;  3ZQL A;  3ZQF A;  2ZOZ A;  3BR1 A;  5EZG A;  3F0C A;  3HTH A;  2O7O A;  5F0C A;  2PZ9 A;  3VW0 A;  5CXI A;  5CW8 A;  4NN1 A;  4JL3 A;  3O8H A;  2HQ5 A;  3KKC A;  1BJZ A;  3ZQG A;  4XK4 A;  3ON2 A;  4GFL A;  3V6G A;  2IBD A;  2Q24 A;  3PAS A;  4PXI A;  2REK A;  3QKX A;  2G0E A;  2I10 A;  5K58 A;  2ID3 A;  3VW1 A;  5FKK A;  5F0H A;  2VKE A;  3EGQ A;  2HXI A;  2Y31 A;  2JK3 A;  4V2G A;  2NS8 A;  5IOZ A;  3VVZ A;  4ABZ A;  1JUM A;  3F1B A;  2UXU A;  4V2F A;  3CDL A;  5GPA A;  3FK6 A;  5FKO A;  2XDN A;  3MNL A;  1JUS A;  1ZKG A;  2YVH A;  1U9O A;  2NX4 A;  3BTJ A;  2VPR A;  2FX0 A;  4DW6 A;  3MVP A;  2O7T A;  3CCY A;  2Y2Z A;  1UI5 A;  2HYT A;  3HIM A;  4CGR A;  5EYR A;  5CXG A;  3AQS A;  5F04 A;  3IUV A;  5EZH A;  5D19 A;  4W1U A;  2IU5 A;  2ID6 A;  4B1R A;  3QPS A;  5J1Y A;  3KNW A;  4AUX A;  3BR0 A;  4AF5 A;  4L62 A;  5AQC A;  2VKV A;  5IOY A;  2DG7 A;  5H9T A;  3E7Q A;  2OER A;  3DEW A;  4MXM A;  3BJB A;  5K7H A;  4JYK A;  2XGE A;  3BTC A;  2YVE A;  5K7F A;  3VOK A;  4AC0 A;  1U9N A;  2RAS A;  2ZCX A;  3G1M A;  4JKZ A;  2GUH A;  3AQT A;  3LJL A;  3NNR A;  2HYJ A;  2XGD A;  4YZE A;  1Z0X A;  3VP5 A;  3LHQ A;  2WV1 A;  4UDS A;  3LOC A;  3Q0U A;  2FD5 A;  2X6O A;  3IH2 A;  1T33 A;  2QCO A;  2X9D A;  5IP6 A;  3SFI A;  5F27 A;  3BTL A;  4MK6 A;  2NP3 A;  3HTA A;  3LSJ A;  3VPR A;  2ZCN A;  3NXC A;  3PPB A;  2XPW A;  2Y30 A;  3G56 A;  5D18 A;  3IH3 A;  3QQA A;  3P9T A;  4D7M A;  5GP9 A;  2QIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...