3VOLA

X-ray crystal structure of pas-hamp aer2 in the cn-bound form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
GSHMARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANERLGSAVQWTDRTEEHRAEQEVSQLVQAAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aerotaxis transducer Aer2
publication title Structural basis for oxygen sensing and signal transduction of the heme-based sensor protein Aer2 from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3volA00
5HWWA 2ZBBA 2B02A 3ICYA 1TS0A 3UE6A 4PKYG 4KQDA 1S67L 2EA9A 3NOPC 3P7NA 1KOUA 2PR5A 1T1BA 1WA9A 3F1PB 3E4QA 5HD3A 5F5YA 2L0WA 5HDDA 1XFQA 3MXQA 3MR0A 3PYPA 1OJGA 3F1NA 3NOUC 4GW9A 4I39A 2WKPA 4H6JA 1TS6A 4XT2B 4HJ3A 4I5SA 1LSXA 1S1YA 4F3LB 1UWPX 1GSVA 4HIAA 2Z6CA 3LI9A 5F68A 4I3AA 4HH3A 2ZOHA 3GECA 1V9ZA 1OT6A 3KX0X 2W27A 4L9FA 3RH8B 5DKKA 4EQ1A 3BWLA 4EERA 5F6AA 4WL9A 2R78A 3SW1A 2A24A 3UB6A 2BASA 4LRYC 4MN6A 3BY9A 4DJ3A 1UWNX 5DJTA 2J80A 2KX6A 4NXEA 3H7WA 1XJ6A 4EXOA 2HV1A 4HOIA 5AVEA 5TBMA 4HJ4A 4DJ2A 2V1BA 2V0WA 2INWA 3LI8A 3LIEA 2QKPA 1S1ZA 1LL8A 4JGQA 4HJ6A 4GHIA 4M4XA 2OWHA 1XFNA 2YKFA 1GSWA 3K3DA 2M1CA 4HP9A 1OT9A 4JGPA 5HWTA 2PD7A 4BBTA 5DKLA 5HSQA 3T50A 3IS2B 1EW0A 1BYWA 3D72A 2JHEA 3B33A 3H82A 1DRMA 1T1AA 4H6JB 3GDIA 1DP8A 4PKYA 4HNBA 2VV6A 1ODVA 3A0VA 5J4EA 4GS9A 3VOLA 1OTEA 2VV7A 3LIFA 4LRZE 1LSWA 1P0ZA 1S4SA 2P7JA 5HDCA 1JNUA 5HDSA 5IS1A 3UMDA 3F1OA 3ULFA 1S4RA 4R38A 2OOLA 3BY8A 1T18A 3NOTC 2A24B 2VLGA 3VE3A 3EWKA 4EESA 5KIZA 3H7WB 3F1PA 2JN7A 3HJIA 4L9EA 1N9NA 4RQ9A 4K08A 3VE4A 3NHQA 4KUOA 3MQQA 1LT0A 1OJ5A 3PHYA 4XT2A 1MZUA 4F3LA 3UB7A 4YWZA 2GJ3A 4I3JA 2PHYA 2QHKA 5G4YA 1UGUA 3MQOA 3H9WA 3LICA 3OLOA 1V9YA 5HWVA 3RTYA 3C2WA 3CAXA 3C8CA 5HD5A 3LUQA 3FC7A 4EEUA 3NJAA 3MFXA 2PD8A 1TS8A 4EW7A 1N9OA 4MN5A 1D06A 2CMNA 4B9OA 3UB9A 1LSVA 3CLOA 4HI4A 1OTDA 4JGOA 2QJ7A 4HY8A 1D7EA 2PYPA 4KUKA 3F1NB 3UB8A 1GSXA 1NWZA 5EFWA 5J7EA 5F69A 1S66L 1P97A 2VV8A 3LIDA 3LIAA 1X0OA 1N9LA 3A0SA 2Z6DA 3MJQA 4R3AA 4E04A 2H28A 4LPZA 1XJ3A 5AVFA 3K3CA 1OTBA 5G4ZA 3HJKA 5J3WA 4WN5A 3IS2A 4JGRA 3E4OA 2L4RA 4NXGA 4HQAA 2PDRA 2QWSA 4NXBA 3CWFA 4WUJA 2K7SA 3UMEA 4WF0A 3IBRA 1DP6A 3FG8A 2V1AA 4I3IA 1Y28A 4I38A 5TBMB 4EEPA 4HH2A 1G28A 4WLAA 2V0UA 1T19A 4NXFA 2VEAA 3A0RA 1XJ2A 4GHIB 3ZQ5A 2PR6A 5HZHA 2YKHA 4GCZA 1VB6A 5I5LA 2D02A 2D01A 4HP4A 1OTAA 2WKQA 2V9AA 4BBVA 4HHDA 2ZOIA 3H82B 2OWJA 3LYXA 3LIBA 5A8BA 2WKRA 1OTIA 1TS7A 2KDKA 2PYRA 4R6LA 2QJ5A 4EETB 3EEHA 5DJUA 1DP9A 4R70A 1F98A 2W0NA 1XJ4A 5IU1A 4GS9B 2L1MA 4BBUA 4LRXC 4LLOB 1T1CA 1F9IA 4L9GA 3F1OB 3G6OA 2I9VA 3E4PA
chains in the Genus database with same CATH superfamily
2ZBBA 4OQHA 4X68A 4PKYG 2KOIA 3DBAA 3ZNYA 5F82A 3BECA 3NOPC 1KOUA 2PR5A 3NBLA 2JCHA 3E4QA 3FKVA 5F5YA 5HDDA 1XFQA 3MXQA 5HPFA 1KVMA 3P09A 2BG1A 5A92A 3G2YA 5GHYA 5IHVA 4Y7PA 1ZKJA 2P9VA 4PM5A 1SCWA 5HARA 3LR3A 4QY5A 3MZDA 1IYSA 5F68A 4X6TA 3M6BA 4HH3A 3W2ZA 3GECA 4S2KA 3KX0X 4L9FA 2QZ6A 3OPLA 1CEGA 4KZ9A 1J3WA 3BQ8A 4HBUA 5CHMA 2A24A 3UB6A 4O0PA 4ZAMA 4MN6A 5EVIB 3HL9A 1I5QA 2J80A 3LGOA 1KDSA 1TDLA 3T12B 1YQSA 5GLBA 3TJZC 4HJ4A 4NEED 3R7WA 4DJ2A 2V1BA 4DDYA 2Q9NA 4LGWA 3LI8A 3BJNA 5A90A 3LIEA 5HL6A 5HAQA 2Y2JA 1ZHHB 4ZBEA 3RFBA 1LL8A 4M4XA 1JTDA 1XFNA 1EROA 3WS0A 4F94A 1G6AA 2M1CA 3TOIA 4OVDA 2PD7A 4OLDA 2FFYA 4N1HA 1BYWA 4K0WA 2O9BA 3C7UA 5GHXA 1BULA 3B33A 4KZ5A 2ZL1B 4X56A 4WMCD 2WZZA 4Q0HA 4H6JB 1CI9A 3UB5P 4PKYA 2VV6A 4OP8A 4GKUA 4EQIA 4Q8IA 5CGXA 1OTEA 1JTGA 2VV7A 1DY6A 1IKGA 1YLWA 5FATA 5IT5A 2Y4AA 5FI7A 2UV0E 3CG5A 1LSWA 3QP1A 2P7JA 4LV1A 5HDCA 4MLLA 3ZG5A 3ZFZA 3T4QA 5EOOA 4LENA 2Y55A 3UPPA 1YLPA 1T18A 4ZJ3A 1Z6FA 1VEUB 4ID4A 3N4IA 5EUAA 3ZHHA 2ACGA 1BLPA 3F1PA 3VSLA 4R1GA 3RJUA 1IEMA 2HDQA 1L2SA 4EBLA 3HJIA 4L9EA 2HF6A 3ZG0A 4IBXA 1N9NA 4RQ9A 2W1TB 4E6XA 2WAFA 4K08A 3NHQA 4KZ6A 2ZQ8A 2JKGA 4QHCA 5DTKA 4DE2A 1MZUA 2KLIA 5KZHA 4MCWA 1O07A 4I3JA 3EQUA 3MKFA 5EVLA 4N1XA 3FPWA 2O0YA 3BFCA 4Y13A 2IWCA 4GOGA 2O99A 1YKDA 1FILA 4QB8A 5CTMA 4PPRA 3VSKA 3JVUA 1P9WA 3IXBA 1WYCA 3WWXA 3NI9A 5FQMA 4Y2FA 2BLSA 5GLAA 4OONA 1GHIA 3NJAA 1JWZA 4EW7A 1TS8A 5FAQA 3EGXC 3LY4A 3G35A 1N9OA 4MN5A 4BL3A 3BQAA 4S2NC 4K0XA 3Q82A 3PBNA 4S2MA 3UB9A 1K56D 3ZYTA 2XGNA 1MKMA 4P6ZS 1FR6A 1ES2A 4HY8A 5FDSA 1LLBA 3WRTA 2H5SA 3M2JA 5J7EA 2WGVA 3S7QA 1S66L 3W8KA 3HUMA 3HLWA 3UY6A 1XP4A 4FOFA 4Y17A 2QMIA 4D2OA 1PI5A 2ZC5B 1X0OA 2ZC7A 5DFXA 1ESUA 2Z6DA 4R3AA 3UE1A 2EX6A 3W4PA 4E04A 1VM1A 2JKTI 4HBTA 5AVFA 4EBNA 5EPHA 3T4LA 1OTBA 3UPOA 1C3BA 1M40A 5FEGA 2P08A 3O3VA 4S2NA 5J3WA 4FCFA 2Q9MA 1MWUA 4E3MA 5DVAA 2ZM8A 4NXGA 1FCMA 2Y2LA 1MC0A 3QNCA 4IBRA 5TR7A 4E6WA 4QWOA 2V20A 2OAP1 3LCEA 4R3JA 3CWFA 4KZ3A 2K7SA 1W8YA 1TF1A 3LEZA 4MMNA 1KGFA 4KZBA 2ZC4B 3N8LA 4UAAA 3HCYA 1E3UD 3IBJA 3PBQA 3VP2A 4X53A 5FQ9A 4I38A 2Y2OA 1K6RA 3BW6A 1KE4A 1YMXA 4IVKA 3UPNA 3S7OA 4PM9A 3VFHA 4K91A 5FEFA 4JXGA 4ARZA 3PAGA 3VFFA 4NXFA 1MWTA 5GLDA 4MDZA 4LV0A 3EEAA 4JXWA 4JXVA 3UDIA 2JBFA 2DMWA 1IYQA 4GNUA 3CZDA 3GRJA 3T1XA 2D01A 4JBFA 4ZJ1A 4DF6A 3M6HA 1JVJA 5FQQA 3LIBA 3LYXA 4WM9A 4R6LA 1VQQA 2QJ5A 3EEHA 2XF3A 5TGFA 1Q2QA 2Y2NA 2L1MA 4P6BA 4UA6A 4C6YA 3L9KA 3G31A 4Z1WA 4LLOB 2M7UA 3P01A 5CXWA 2W3GA 3SS5A 3KSHA 2J7VA 3F1OB 3IXHA 1K57C 4XXRA 3ICYA 2V2FF 3M2KA 4JLFA 5L07A 3UE6A 1AXBA 5E2HA 5FQIA 3IHAA 2WAEA 4HESA 1LL9A 3C4OA 4Y5FA 3K2NA 4XUZA 1SKFA 5HD3A 2VKSA 3HUNA 2HDUA 4KQOA 2L0WA 3IHBA 3T4TA 1PZOA 5FAOA 2IWBA 4Q0JA 2V1ZA 2IWDA 3TRCA 3WRZA 2P04A 3VMAA 3MR0A 3PYPA 1OJGA 3NOUC 2XEPA 4I39A 3E2KA 3OZHA 4HJ3A 3CJMA 1LSXA 3ZDJA 4ESPA 3Q7VA 4ETZA 1TD5A 1UWPX 1GSVA 1BUEA 1K57A 3UDFA 2WGIA 3LI9A 2EWWA 4CLCE 2XLNA 4I3AA 4CJNA 4YOFA 3OPPA 3IWIA 3BEBA 2DCFA 3QP5A 2XD1A 1GCEA 2JKRI 2HJEA 1A0KA 2OV5A 4AFIA 2PT7A 2G7UA 4U0TA 4Y15A 1P9RA 1STZA 4EQ1A 5M18A 4PHTA 3BWLA 3EQVA 4MEZA 5F6AA 4YNRA 2R78A 3SW1A 2Y2KA 3IX8A 5C5KA 2BASA 2A2LA 1S6RA 5JYPA 3SH9A 2EWVA 4OPRA 3O87A 4QY6A 3LFVA 2ZLYA 1YSQA 1VETB 2X71A 1BTLA 3C4PA 3T4KA 3O86A 2XFTA 1XJ6A 4JF5A 3KYQA 3NC8A 2HV1A 5CERA 4R3BA 4HOIA 4OQIA 5L09A 5AVEA 5TBMA 2V0WA 1KE0A 4PM7A 2CC1A 4MBFA 1S0WA 4S2IA 2QKPA 1K4FA 2WADA 2XA7M 4HJ6A 5MC7A 3PBRA 4FSFA 1XPBA 3IF6B 1GSWA 3BFGA 3K3DA 4EWFA 3MXSA 4HP9A 1OT9A 4ZJ2A 2WKHA 4DRTA 3KSIA 3G32A 5FQJA 1PWGA 4BBTA 2LB5A 3QP8A 3T50A 3IS2B 2BTFP 3TSGA 5HFOA 3T4SA 1ZC2A 4E3KA 4GN2A 4P6ZM 3MMHA 3D72A 3JPUA 2P9VB 1ONHA 3GDIA 4E3LA 2PRFA 2AVXA 1DJAA 5J4EA 4BENA 1G68A 2QYBA 1YT4A 5FA7A 1HLUP 4O8GA 1MXOA 2B5RA 5FASA 4R38A 1CI8A 4NK3A 3AGEA 4Y0TA 2A24B 3NDGA 4C75A 1HTZA 3HLCA 3S7PA 4E3OA 1NLZA 4WEJA 2XK1A 3GR2A 5EVIC 3R7WB 3BRMA 4KUOA 4DXCA 1K38A 3QP6A 4UEYA 2NUPC 4CLCD 3V39A 2Y2GA 1OJ5A 3G2ZA 3PHYA 2XQZA 3I7JA 3TE8A 3G4PA 2J9OA 2GJ3A 4B4XA 4BL2A 4WYYA 5G4YA 2B95A 3IXGA 3R4KA 5HWVA 1NJ4A 1NZUA 3OCLA 1MWRA 3C2WA 1SHVA 1QMEA 3T1QB 2XR0A 2PD8A 5K5BA 3A3JA 2V8CA 5EVIA 4KG6A 5E43A 1D06A 2CMNA 2OAQ1 2XDMA 2J3TD 4HI4A 1FQGA 4JGOA 1HD8A 3NY4A 1D7EA 4KUKA 1IYOA 3F1NB 3UB8A 1QMFA 1PIOA 5EFWA 1MY8A 3OPHA 1P97A 3VOZA 1SKOB 2W1RA 2XD5A 3FPVA 3O5YA 4GB7A 1N9LA 1PNEA 3A0SA 3WS1A 3MJQA 3HREA 3VP0A 1XJ3A 2HDRA 5E2EA 2E8IA 3ZVWA 2NUTC 1KGGA 3CPTB 4WN5A 2GDNA 2ZMVA 1FSWA 3IXDA 4D60A 3E4OA 2ZL1A 4A5RA 4KQRA 4BD0A 5CRFA 5I94A 5GHZA 3L7HA 3MZFA 5HPIA 3IBRA 3FG8A 3TG9A 1G5UA 4RX2A 4PAUA 2Y2PA 1G28A 4CQHA 4WLAA 2V0UA 4S2PA 4X1MA 1MPLA 3A0RA 2W3FA 1XJ2A 4GHIB 5D3OA 4Z9QA 3ZQ5A 1ES4A 3JYIA 2PR6A 5HZHA 1VEUA 3LY3A 1L3LA 5EM0A 4OQ0A 5CEBA 1W7FA 4E3NA 1TDGA 3IX3A 3HLEA 1SDNA 2ZC3B 4CLCB 4HP4A 2ZQAA 4BBVA 4Y0UA 3H82B 2OWJA 5A8BA 4JF4A 2WKRA 1OTIA 2PYRA 3SH8A 1GHPA 3UO9A 2W0NA 5IU1A 1KVLA 4GS9B 2EX2A 3BM6A 1NZOA 1CEFA 2WZXA 4NETA 2EX9A 1BZAA 2VGLS 2ZM2A 1GA9A 4DE1A 4L9GA 2OLUA 1NWZA 3E4PA 5E2FA 4DN0A 5HWWA 2X01A 1NLYA 2B02A 1GHMA 4U0XA 2GNXA 3UE0A 5HL1A 1YLZA 4GDNA 3DTIA 3DW0A 1XXMA 5TJJA 1S67L 2A49A 1I2WA 3P7NA 4HEFA 3KYEA 4R4SA 1WA9A 1MBLA 3MQ0A 5A93A 2X02A 2JKFA 4JF6A 2EX8A 2JKTM 1DJBA 4OQGA 2MJ6A 4GW9A 2W3DA 3CI6A 4EUZA 4XT2B 3OCNA 1Y4OA 4KQQA 1PYYA 4F3LB 3W4QA 4HIAA 2Z6CA 4GD6A 2ZC6B 1IELA 2RCXA 2ZOHA 4G3KA 3C38A 3LR5A 1V9ZA 2VJWA 2W27A 3MBZA 3RH8B 5DKKA 1D1JA 2DRWA 1BSGA 3B42A 4WL9A 4UQIS 3QP4A 4LRYC 3A3IA 3DWKA 1NRFA 5G18A 4DJ3A 1BLHA 4NXEA 4ZDXA 1YMSA 3H7WA 5CECA 4R0QA 5GL9A 4KZ8A 4LCMA 2VX8A 2WGWB 1N9BA 2PAVP 4Y0OA 3ZNTA 2JE5A 3T4JA 3CUEC 3BFEA 3VV4A 1LI0A 3QP2A 3UNWA 4G3WA 2INWA 1JWPA 1VHMA 1U60A 2Q0OA 2O9AA 2YKFA 1ZTUA 4Y3IA 1F5MA 1ZG4A 5AJGA 1H8ZA 1JWVA 2A3UA 4UA7A 3D9YA 3WS2A 4JGPA 4IVIA 2EXBA 2O9CA 4Q0IA 1L0FA 5HSQA 5DKLA 1ACFA 3EOIA 4OH0A 3B47A 1NRJA 3V5MA 1EWZA 4B93A 5AQ9A 1YLTA 4FUWA 2JHEA 3V3RA 1DRMA 2DNSA 1DP8A 1W63Q 4HNBA 3CUEA 3T4OA 1ODVA 3ITAA 2J8YA 5FQKA 3VOLA 1RGYA 2XROA 3LIFA 4LRZE 1RCJA 1P0ZA 1S4SA 1JNUA 3FV7A 2G2UA 1L0EA 3WS4A 3UMDA 1O7EA 3GV9A 3ZVTA 5U47A 3F1OA 1IYPA 3AGFA 1S4RA 3A3FA 2WKIA 1PZPA 4P87A 3VE3A 4C3QA 3EWKA 5CX7A 4EESA 4NKPA 4QJGA 2VZWA 1NYMA 3LEQA 4YINA 4B4ZA 4RX3A 4OOMA 5L2FA 3GQZA 5J8XA 2ZQ9A 1RGZA 3ZGAB 4JKTA 2JKRM 3OPRA 5EVID 4KG2A 5GLCA 3VE4A 1DJCA 1K54C 4ZTKA 3IT9A 4X55A 4MBKA 2R9WA 3MKEA 3UN7A 3MQQA 5EV0A 5DF8A 1CQAA 1CF0A 3FZCA 3WS5A 1LI9A 3PBOA 3OOVA 4FH4A 4DXBA 4N9KA 3C5AA 3U2AA 4LV3A 3H9WA 4S2JA 3OLOA 3UDXA 3RTYA 3T1SA 3IF6C 2H0TA 3IF5A 3CAXA 5FL3A 3C8CA 5HD5A 3LUQA 3FC7A 1OMEA 4FD8A 4RVAA 1XGJA 1L0DA 1E3UA 1K54A 2LB9A 2FH5A 5F1GA 3P98A 1BT5A 1OTDA 2Y91A 1FIKA 4MN7A 1VETA 2Y79A 1KE3A 2PYPA 3PAEA 4WBGA 2VGLM 4GZBA 3MF0A 3BFFA 3PBSA 3VP1A 3HVFA 4EUVA 4XUXA 2G2WA 3LIDA 3LIAA 1WE4A 3DTMA 1XA1A 3FYZA 4BD1A 3IF6A 2V8FA 4ME4A 4LPZA 4WEKA 2PBDP 1FCNA 4X25A 5AQ7A 1NY0A 2Y2IA 3N8SA 4X1LA 3HJKA 5DFYA 1KDWA 3IS2A 3IWQA 1PW8A 4JGRA 4JPMA 3B3XA 1M6KA 3V67A 2L4RA 2XH9A 3PBTA 2ZQDA 4KZ7A 3HLBA 3LO7A 1Z09A 1ZG6A 2PDRA 4NXBA 2W3EA 4WUJA 2EFUA 2EXAA 4O01A 2V1AA 3U4LP 4OPQA 4I3IA 5AQBA 1H5XA 3IWOA 3HBRA 1Y28A 4EEPA 3IX4A 3N7WA 3LR4A 3PTEA 5L10A 4IJGA 5CTNA 1ERMA 1IFQA 3BFDA 1T19A 1TEMA 1Q2PA 1IKIA 2HP6A 2Y2MA 2XRNA 2YKHA 4BMWA 4GCZA 4UQIM 1VB6A 3HUOA 2K31A 1W79A 3S1YA 5BOHA 4DKIA 5FI6A 4II7A 1YLYA 2WKQA 4OOYA 4U3TA 2ZOIA 4N92A 3S7NA 3PXPA 1TS7A 2KDKA 3D4FA 3DTKA 4R70A 3Q81A 4ZRRA 1PWCA 3E98A 5F1FA 4R23A 1AWIA 4LRXC 2K2NA 1PFLA 3G34A 5EECA 3C7VA 1H8YA 1F9IA 3NDEA 3ZG8B 3G6OA 4MBHA 5JYOA 2I9VA 1YSPA 3Q07A 5KSCA 3SH7A 1TS0A 3MZEA 4LV2A 4DE3A 4KQDA 4BLMA 3D3OA 5CGSA 3VP3A 4FTXA 2EA9A 3RXWA 4OKPA 4OP5A 1T1BA 1K55C 3F1PB 4KZAA 4GD8A 4PMAA 3GMWA 4N9LA 5CEDA 1FSYA 3G30A 3V50A 2ZJ9A 2ZQ7A 5LBRA 5CHJA 4E3IA 2H0YA 1CK3A 3A3EA 3F1NA 4IEDA 2WKPA 4QD4A 1NXYA 3O88A 4H6JA 1TS6A 1BLSA 4I5SA 1S1YA 2GZAA 1SKOA 2FFFB 2W3HA 2Y59A 3GTCA 5DF9A 3HLGA 4EV4A 2XFSA 5KSHA 3T1RA 5AQAA 1OT6A 3UE3A 4EU0A 1H8MA 4CPKA 3E2LA 1K55A 4KZ4A 3CPTA 3TW8A 4EERA 4DDSA 1MKIA 1RP5A 2WKEA 2FZ0A 3BY9A 3JVVA 4E3JA 1TVFA 4CLCC 1UWNX 5DJTA 2KX6A 4P85A 3ZCZA 5FAPA 1ES3A 2W1TA 4EXOA 3NULA 1K4EA 2J9PA 3DAVA 1EI5A 2PU2A 2I72A 1W63M 4FH2A 3SS3A 2XA7S 4LFUA 4G3VA 1E4DA 1S1ZA 4JGQA 4GHIA 2OWHA 3HLFA 2JC7A 1PW1A 3QNBA 2VA0A 2Z2MB 5HWTA 2IA2A 1SDEA 4CLCA 2J3TC 3SZTA 1EW0A 2OSUA 5EE8A 5HAPA 4WZ4A 5M19A 1E25A 2PBYA 3RXXA 2EFXA 1N4OA 3H82A 1W8QA 2WUQA 1PI4A 1T1AA 3VP4A 2HP5A 1HZOA 3A0VA 4GS9A 5A91A 1KGEA 3CMZA 1FCOA 1ALQA 2PU4A 3A3DA 3HLDA 3NCKA 2ZD8A 2P74A 3CHWP 2VGKA 5HDSA 2XSSA 5IS1A 4ARZB 3ULFA 2OOLA 3BY8A 1ONGA 1OPXA 3NOTC 1MWSA 2ZMFA 5M1AA 2VLGA 3Q1FA 4O7DA 3OC2A 1XA7A 4S2LA 3PR6A 4R4RA 5KIZA 3H7WB 2HGVA 4WMCA 2JN7A 4GLQA 4OLGA 1W5DA 2ZQCA 1HVBA 5F83A 2M7VA 3GSGA 3S4XA 4M3KA 4BQMA 5E2GA 1LT0A 4RA7A 2VK3A 3SOIA 4RYEA 2Z2LB 2Y8HA 1LL5A 4XT2A 3ISGA 4F3LA 3UB7A 4YFMA 2VGJA 4YWZA 4S2OA 2PHYA 4ETXA 2QPNA 1YLJA 4UA9A 1GA0A 1IOUA 3ZG9B 2UWXA 2HJ9C 2QHKA 1UGUA 3MQOA 3IQAA 3LICA 5FSRA 5EVEA 3VOYA 3BLSA 4NG2A 1V9YA 1F2KA 4L0LA 4JXSA 5HW3A 4UHUA 1I2SA 1J9MA 1L0GA 4EEUA 3MFXA 1K0KA 4OPZA 2ZM0A 3C30A 1BLCA 4B9OA 1Y54A 5CGWA 2GX5A 5EOEA 1LSVA 3CLOA 4BWIA 3ZG7B 3BLMA 3EGDC 2QJ7A 2WGWA 3DTEA 1ES5A 1GSXA 2WYXA 1XX2A 5F69A 3Q7VB 2VV8A 5CHUA 3KO6A 3LR0A 3GVBA 3V3SA 2OLVA 3CITA 1SZVA 4MNRA 5TFQA 4PM8A 2H28A 4WZ5C 3MSHA 2H10A 4B88A 2ZMAA 4KG5A 3K3CA 3ITBA 3E0YA 1CJFA 1PWDA 5G4ZA 4P0MA 4X69A 4BJPA 3MFDA 3AGDA 1K56A 2Y2HA 3Q7ZA 1XKZA 4QU3A 1LHYA 4HQAA 2QWSA 1K25A 3FKWA 3UMEA 1PRQA 4WF0A 3IH8A 2Y2QA 1DP6A 2E8JA 3NECA 4LCLA 3IH9A 5KMWA 5EM1A 5DTSA 5TBMB 4HH2A 2R9XA 2HDSA 4WELA 3BYDA 4IHQA 3KSFA 4WZ5A 3W4OA 1FR1A 4EBPA 1H0MA 2VEAA 4KENB 1XGIA 3FWLA 1YM1A 3KSGA 5I5LA 2D02A 5DTTA 3NIAA 1NYYA 5L8MA 5HX9A 2C6WB 1G6OA 3MXRA 2HZ5A 4QPRA 3DWZA 5DF7A 5FI2A 3N8RA 2J3WA 3N6IA 1ERQA 4PM6A 1OTAA 2V9AA 4OPYA 4HHDA 3KYZA 4DMZA 3MS6A 4IUKA 4EETB 4IUHA 2WK0A 1YAXA 2RL3A 5DJUA 1DP9A 4DE0A 1ESIA 4OOLA 1F98A 1XJ4A 1K6SA 5FDHA 2C5WB 1FOFA 1YPRA 3OBFA 4GJ4A 4BBUA 1WYBA 5HAIA 4H8RA 2B18A 3S22A 1H3QA 3SS4A 1T1CA 2HPBA 3QHYA 2HP9A 4GDBA
chains in the Genus database with same CATH topology
5HWWA 2ZBBA 1NLYA 2B02A 3ICYA 2GNXA 1TS0A 3UE6A 4PKYG 4KQDA 2KOIA 3DBAA 3D3OA 5TJJA 1S67L 2EA9A 3NOPC 3P7NA 4Y5FA 1KOUA 2PR5A 3K2NA 1T1BA 1WA9A 3MQ0A 3F1PB 3E4QA 5HD3A 5F5YA 2VKSA 4KQOA 2L0WA 5HDDA 1XFQA 3MXQA 3T4TA 5HPFA 2JKTM 4Q0JA 3TRCA 5LBRA 2P04A 3MR0A 2MJ6A 3PYPA 1OJGA 3F1NA 3NOUC 4GW9A 4I39A 2W3DA 2WKPA 3CI6A 4H6JA 1TS6A 4XT2B 4HJ3A 3OCNA 4I5SA 1LSXA 1S1YA 2GZAA 3LR3A 4F3LB 4ETZA 1UWPX 1TD5A 1GSVA 2W3HA 4HIAA 5DF9A 2Z6CA 3LI9A 5F68A 2EWWA 4CLCE 4I3AA 4HH3A 3W2ZA 4YOFA 5KSHA 2ZOHA 4G3KA 3GECA 3C38A 3LR5A 2JKRI 2HJEA 1V9ZA 2VJWA 4AFIA 1OT6A 3UE3A 3KX0X 4EU0A 1H8MA 2PT7A 2W27A 4L9FA 3RH8B 5DKKA 2G7UA 1P9RA 1STZA 4EQ1A 3TW8A 4PHTA 3BWLA 3EQVA 3BQ8A 4EERA 3B42A 4WL9A 4YNRA 2R78A 5F6AA 3SW1A 5C5KA 2A24A 4UQIS 3UB6A 4O0PA 2BASA 2A2LA 4LRYC 4MN6A 2FZ0A 3BY9A 3JVVA 4DJ3A 2EWVA 4CLCC 1UWNX 5DJTA 2J80A 2KX6A 3LFVA 4NXEA 3H7WA 1YSQA 2VX8A 3T4KA 1XJ6A 2W1TA 3KYQA 4EXOA 2HV1A 4HOIA 3T4JA 3TJZC 5AVEA 4HJ4A 4NEED 5TBMA 3R7WA 3CUEC 3VV4A 4DJ2A 2V1BA 2V0WA 4G3WA 2INWA 3LI8A 3BJNA 3LIEA 1W63M 5HL6A 1VHMA 1ZHHB 2XA7S 4G3VA 2QKPA 3RFBA 1S1ZA 1LL8A 2XA7M 4HJ6A 2O9AA 4GHIA 3PBRA 2OWHA 4JGQA 4M4XA 1XFNA 4FSFA 2YKFA 1ZTUA 4Y3IA 1F5MA 1GSWA 3K3DA 5AJGA 2M1CA 4HP9A 1OT9A 2VA0A 4JGPA 3KSIA 5HWTA 2O9CA 2PD7A 4Q0IA 2IA2A 5A8BA 4BBTA 2LB5A 5DKLA 5HSQA 3T50A 4CLCA 3EOIA 3IS2B 2J3TC 1EW0A 3B47A 1BYWA 3T4SA 1NRJA 4P6ZM 3MMHA 2O9BA 3D72A 4B93A 2JHEA 3B33A 3H82A 4Q0HA 1DRMA 1T1AA 4H6JB 3GDIA 1DP8A 1W63Q 4PKYA 4HNBA 3CUEA 2VV6A 3T4OA 1ODVA 3A0VA 5J4EA 4GS9A 3VOLA 2QYBA 1OTEA 2VV7A 2XROA 3LIFA 5IT5A 4LRZE 1LSWA 1P0ZA 1S4SA 2P7JA 4O8GA 5HDCA 1JNUA 5HDSA 2XSSA 3T4QA 5IS1A 3UMDA 4ARZB 3F1OA 3ULFA 1S4RA 4R38A 2OOLA 3BY8A 1T18A 1OPXA 3NOTC 2ZMFA 2A24B 2VLGA 3VE3A 3EWKA 5CX7A 3OC2A 4EESA 3PR6A 4NKPA 2VZWA 3S7PA 5KIZA 3H7WB 2HGVA 3F1PA 2JN7A 1NLZA 4GLQA 4WEJA 3HJIA 4L9EA 2HF6A 1N9NA 4OOMA 4RQ9A 2W1TB 2M7VA 2JKRM 4K08A 3VE4A 3R7WB 3NHQA 4KUOA 4UEYA 2NUPC 3MQQA 4CLCD 1LT0A 1OJ5A 2Y8HA 3PHYA 4XT2A 1MZUA 3TE8A 4F3LA 2KLIA 3UB7A 4MCWA 4YWZA 2GJ3A 3PBOA 3EQUA 2PHYA 3OOVA 4I3JA 4ETXA 3FPWA 2O0YA 1IOUA 2O99A 1YKDA 2HJ9C 2QHKA 5G4YA 1UGUA 3U2AA 3MQOA 5MC7A 3H9WA 1YSPA 3LICA 3OLOA 3R4KA 3JVUA 1P9WA 1V9YA 5HWVA 4L0LA 3RTYA 3OCLA 4Y2FA 3C2WA 3CAXA 5FL3A 3C8CA 5HD5A 3LUQA 3FC7A 4EEUA 3NJAA 3MFXA 2PD8A 1TS8A 4EW7A 5K5BA 3EGXC 1N9OA 4MN5A 3C30A 3BQAA 1D06A 2CMNA 4B9OA 2LB9A 2OAQ1 2GX5A 2FH5A 3PBNA 3UB9A 1LSVA 2J3TD 3CLOA 3ZYTA 4BWIA 4HI4A 1MKMA 1OTDA 4JGOA 3EGDC 4MN7A 4P6ZS 2QJ7A 2Y79A 4HY8A 1D7EA 2PYPA 4KUKA 3F1NB 3UB8A 1GSXA 1NWZA 5EFWA 5J7EA 2VGLM 5F69A 3S7QA 1S66L 3MF0A 1P97A 3PBSA 2W1RA 2VV8A 3FPVA 4FOFA 3O5YA 4EUVA 3KO6A 3LIDA 3LR0A 3LIAA 1X0OA 3CITA 1N9LA 5DFXA 3A0SA 2Z6DA 3MJQA 4R3AA 4E04A 4ME4A 2H28A 2JKTI 4LPZA 4WEKA 1XJ3A 5AVFA 3T4LA 2NUTC 3K3CA 1OTBA 3E0YA 2P08A 5G4ZA 5DFYA 3HJKA 5J3WA 4WN5A 4BJPA 2ZMVA 3IS2A 4JGRA 3E4OA 3V67A 2L4RA 4NXGA 1MC0A 3PBTA 2OAP1 4HQAA 2PDRA 2QWSA 4NXBA 3CWFA 2W3EA 4WUJA 2K7SA 1TF1A 3UMEA 4WF0A 4MMNA 4O01A 5HPIA 3IBRA 1DP6A 3FG8A 2V1AA 4I3IA 3HCYA 3IBJA 3PBQA 1Y28A 4I38A 5TBMB 4PAUA 4EEPA 3BW6A 4HH2A 4WELA 1G28A 3S7OA 3LR4A 4CQHA 4WLAA 2V0UA 4IHQA 3KSFA 4IJGA 4ARZA 1IFQA 1T19A 4NXFA 2VEAA 3A0RA 2W3FA 1XJ2A 4GHIB 4MDZA 3ZQ5A 3EEAA 2PR6A 5HZHA 2XRNA 2YKHA 4BMWA 4GCZA 2DMWA 4UQIM 1VB6A 3KSGA 5I5LA 2K31A 2D02A 5L8MA 1G6OA 4QPRA 4CLCB 4II7A 2D01A 4HP4A 2J3WA 1OTAA 2WKQA 2V9AA 4BBVA 4HHDA 2ZOIA 3H82B 2OWJA 3LIBA 3KYZA 3LYXA 3PXPA 3S7NA 4DMZA 2WKRA 1OTIA 1TS7A 2KDKA 2PYRA 4IUKA 4R6LA 2QJ5A 4EETB 3EEHA 4IUHA 1YAXA 5DJUA 1DP9A 4R70A 4OOLA 1F98A 2W0NA 1XJ4A 4ZRRA 5IU1A 3E98A 4GS9B 2L1MA 3OBFA 4GJ4A 4BBUA 4LRXC 2K2NA 4Z1WA 4LLOB 2M7UA 3P01A 2B18A 2W3GA 2VGLS 3KSHA 1H3QA 1T1CA 1F9IA 4L9GA 3F1OB 3G6OA 2I9VA 3E4PA 4DN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HWW A;  2ZBB A;  2B02 A;  3ICY A;  1TS0 A;  3UE6 A;  4PKY G;  4KQD A;  1S67 L;  2EA9 A;  3NOP C;  3P7N A;  1KOU A;  2PR5 A;  1T1B A;  1WA9 A;  3F1P B;  3E4Q A;  5HD3 A;  5F5Y A;  2L0W A;  5HDD A;  1XFQ A;  3MXQ A;  3MR0 A;  3PYP A;  1OJG A;  3F1N A;  3NOU C;  4GW9 A;  4I39 A;  2WKP A;  4H6J A;  1TS6 A;  4XT2 B;  4HJ3 A;  4I5S A;  1LSX A;  1S1Y A;  4F3L B;  1UWP X;  1GSV A;  4HIA A;  2Z6C A;  3LI9 A;  5F68 A;  4I3A A;  4HH3 A;  2ZOH A;  3GEC A;  1V9Z A;  1OT6 A;  3KX0 X;  2W27 A;  4L9F A;  3RH8 B;  5DKK A;  4EQ1 A;  3BWL A;  4EER A;  5F6A A;  4WL9 A;  2R78 A;  3SW1 A;  2A24 A;  3UB6 A;  2BAS A;  4LRY C;  4MN6 A;  3BY9 A;  4DJ3 A;  1UWN X;  5DJT A;  2J80 A;  2KX6 A;  4NXE A;  3H7W A;  1XJ6 A;  4EXO A;  2HV1 A;  4HOI A;  5AVE A;  5TBM A;  4HJ4 A;  4DJ2 A;  2V1B A;  2V0W A;  2INW A;  3LI8 A;  3LIE A;  2QKP A;  1S1Z A;  1LL8 A;  4JGQ A;  4HJ6 A;  4GHI A;  4M4X A;  2OWH A;  1XFN A;  2YKF A;  1GSW A;  3K3D A;  2M1C A;  4HP9 A;  1OT9 A;  4JGP A;  5HWT A;  2PD7 A;  4BBT A;  5DKL A;  5HSQ A;  3T50 A;  3IS2 B;  1EW0 A;  1BYW A;  3D72 A;  2JHE A;  3B33 A;  3H82 A;  1DRM A;  1T1A A;  4H6J B;  3GDI A;  1DP8 A;  4PKY A;  4HNB A;  2VV6 A;  1ODV A;  3A0V A;  5J4E A;  4GS9 A;  3VOL A;  1OTE A;  2VV7 A;  3LIF A;  4LRZ E;  1LSW A;  1P0Z A;  1S4S A;  2P7J A;  5HDC A;  1JNU A;  5HDS A;  5IS1 A;  3UMD A;  3F1O A;  3ULF A;  1S4R A;  4R38 A;  2OOL A;  3BY8 A;  1T18 A;  3NOT C;  2A24 B;  2VLG A;  3VE3 A;  3EWK A;  4EES A;  5KIZ A;  3H7W B;  3F1P A;  2JN7 A;  3HJI A;  4L9E A;  1N9N A;  4RQ9 A;  4K08 A;  3VE4 A;  3NHQ A;  4KUO A;  3MQQ A;  1LT0 A;  1OJ5 A;  3PHY A;  4XT2 A;  1MZU A;  4F3L A;  3UB7 A;  4YWZ A;  2GJ3 A;  4I3J A;  2PHY A;  2QHK A;  5G4Y A;  1UGU A;  3MQO A;  3H9W A;  3LIC A;  3OLO A;  1V9Y A;  5HWV A;  3RTY A;  3C2W A;  3CAX A;  3C8C A;  5HD5 A;  3LUQ A;  3FC7 A;  4EEU A;  3NJA A;  3MFX A;  2PD8 A;  1TS8 A;  4EW7 A;  1N9O A;  4MN5 A;  1D06 A;  2CMN A;  4B9O A;  3UB9 A;  1LSV A;  3CLO A;  4HI4 A;  1OTD A;  4JGO A;  2QJ7 A;  4HY8 A;  1D7E A;  2PYP A;  4KUK A;  3F1N B;  3UB8 A;  1GSX A;  1NWZ A;  5EFW A;  5J7E A;  5F69 A;  1S66 L;  1P97 A;  2VV8 A;  3LID A;  3LIA A;  1X0O A;  1N9L A;  3A0S A;  2Z6D A;  3MJQ A;  4R3A A;  4E04 A;  2H28 A;  4LPZ A;  1XJ3 A;  5AVF A;  3K3C A;  1OTB A;  5G4Z A;  3HJK A;  5J3W A;  4WN5 A;  3IS2 A;  4JGR A;  3E4O A;  2L4R A;  4NXG A;  4HQA A;  2PDR A;  2QWS A;  4NXB A;  3CWF A;  4WUJ A;  2K7S A;  3UME A;  4WF0 A;  3IBR A;  1DP6 A;  3FG8 A;  2V1A A;  4I3I A;  1Y28 A;  4I38 A;  5TBM B;  4EEP A;  4HH2 A;  1G28 A;  4WLA A;  2V0U A;  1T19 A;  4NXF A;  2VEA A;  3A0R A;  1XJ2 A;  4GHI B;  3ZQ5 A;  2PR6 A;  5HZH A;  2YKH A;  4GCZ A;  1VB6 A;  5I5L A;  2D02 A;  2D01 A;  4HP4 A;  1OTA A;  2WKQ A;  2V9A A;  4BBV A;  4HHD A;  2ZOI A;  3H82 B;  2OWJ A;  3LYX A;  3LIB A;  5A8B A;  2WKR A;  1OTI A;  1TS7 A;  2KDK A;  2PYR A;  4R6L A;  2QJ5 A;  4EET B;  3EEH A;  5DJU A;  1DP9 A;  4R70 A;  1F98 A;  2W0N A;  1XJ4 A;  5IU1 A;  4GS9 B;  2L1M A;  4BBU A;  4LRX C;  4LLO B;  1T1C A;  1F9I A;  4L9G A;  3F1O B;  3G6O A;  2I9V A;  3E4P A; 
#chains in the Genus database with same CATH topology
 2ZBB A;  4OQH A;  4X68 A;  4PKY G;  2KOI A;  3DBA A;  3ZNY A;  5F82 A;  3BEC A;  3NOP C;  1KOU A;  2PR5 A;  3NBL A;  2JCH A;  3E4Q A;  3FKV A;  5F5Y A;  5HDD A;  1XFQ A;  3MXQ A;  5HPF A;  1KVM A;  3P09 A;  2BG1 A;  5A92 A;  3G2Y A;  5GHY A;  5IHV A;  4Y7P A;  1ZKJ A;  2P9V A;  4PM5 A;  1SCW A;  5HAR A;  3LR3 A;  4QY5 A;  3MZD A;  1IYS A;  5F68 A;  4X6T A;  3M6B A;  4HH3 A;  3W2Z A;  3GEC A;  4S2K A;  3KX0 X;  4L9F A;  2QZ6 A;  3OPL A;  1CEG A;  4KZ9 A;  1J3W A;  3BQ8 A;  4HBU A;  5CHM A;  2A24 A;  3UB6 A;  4O0P A;  4ZAM A;  4MN6 A;  5EVI B;  3HL9 A;  1I5Q A;  2J80 A;  3LGO A;  1KDS A;  1TDL A;  3T12 B;  1YQS A;  5GLB A;  3TJZ C;  4HJ4 A;  4NEE D;  3R7W A;  4DJ2 A;  2V1B A;  4DDY A;  2Q9N A;  4LGW A;  3LI8 A;  3BJN A;  5A90 A;  3LIE A;  5HL6 A;  5HAQ A;  2Y2J A;  1ZHH B;  4ZBE A;  3RFB A;  1LL8 A;  4M4X A;  1JTD A;  1XFN A;  1ERO A;  3WS0 A;  4F94 A;  1G6A A;  2M1C A;  3TOI A;  4OVD A;  2PD7 A;  4OLD A;  2FFY A;  4N1H A;  1BYW A;  4K0W A;  2O9B A;  3C7U A;  5GHX A;  1BUL A;  3B33 A;  4KZ5 A;  2ZL1 B;  4X56 A;  4WMC D;  2WZZ A;  4Q0H A;  4H6J B;  1CI9 A;  3UB5 P;  4PKY A;  2VV6 A;  4OP8 A;  4GKU A;  4EQI A;  4Q8I A;  5CGX A;  1OTE A;  1JTG A;  2VV7 A;  1DY6 A;  1IKG A;  1YLW A;  5FAT A;  5IT5 A;  2Y4A A;  5FI7 A;  2UV0 E;  3CG5 A;  1LSW A;  3QP1 A;  2P7J A;  4LV1 A;  5HDC A;  4MLL A;  3ZG5 A;  3ZFZ A;  3T4Q A;  5EOO A;  4LEN A;  2Y55 A;  3UPP A;  1YLP A;  1T18 A;  4ZJ3 A;  1Z6F A;  1VEU B;  4ID4 A;  3N4I A;  5EUA A;  3ZHH A;  2ACG A;  1BLP A;  3F1P A;  3VSL A;  4R1G A;  3RJU A;  1IEM A;  2HDQ A;  1L2S A;  4EBL A;  3HJI A;  4L9E A;  2HF6 A;  3ZG0 A;  4IBX A;  1N9N A;  4RQ9 A;  2W1T B;  4E6X A;  2WAF A;  4K08 A;  3NHQ A;  4KZ6 A;  2ZQ8 A;  2JKG A;  4QHC A;  5DTK A;  4DE2 A;  1MZU A;  2KLI A;  5KZH A;  4MCW A;  1O07 A;  4I3J A;  3EQU A;  3MKF A;  5EVL A;  4N1X A;  3FPW A;  2O0Y A;  3BFC A;  4Y13 A;  2IWC A;  4GOG A;  2O99 A;  1YKD A;  1FIL A;  4QB8 A;  5CTM A;  4PPR A;  3VSK A;  3JVU A;  1P9W A;  3IXB A;  1WYC A;  3WWX A;  3NI9 A;  5FQM A;  4Y2F A;  2BLS A;  5GLA A;  4OON A;  1GHI A;  3NJA A;  1JWZ A;  4EW7 A;  1TS8 A;  5FAQ A;  3EGX C;  3LY4 A;  3G35 A;  1N9O A;  4MN5 A;  4BL3 A;  3BQA A;  4S2N C;  4K0X A;  3Q82 A;  3PBN A;  4S2M A;  3UB9 A;  1K56 D;  3ZYT A;  2XGN A;  1MKM A;  4P6Z S;  1FR6 A;  1ES2 A;  4HY8 A;  5FDS A;  1LLB A;  3WRT A;  2H5S A;  3M2J A;  5J7E A;  2WGV A;  3S7Q A;  1S66 L;  3W8K A;  3HUM A;  3HLW A;  3UY6 A;  1XP4 A;  4FOF A;  4Y17 A;  2QMI A;  4D2O A;  1PI5 A;  2ZC5 B;  1X0O A;  2ZC7 A;  5DFX A;  1ESU A;  2Z6D A;  4R3A A;  3UE1 A;  2EX6 A;  3W4P A;  4E04 A;  1VM1 A;  2JKT I;  4HBT A;  5AVF A;  4EBN A;  5EPH A;  3T4L A;  1OTB A;  3UPO A;  1C3B A;  1M40 A;  5FEG A;  2P08 A;  3O3V A;  4S2N A;  5J3W A;  4FCF A;  2Q9M A;  1MWU A;  4E3M A;  5DVA A;  2ZM8 A;  4NXG A;  1FCM A;  2Y2L A;  1MC0 A;  3QNC A;  4IBR A;  5TR7 A;  4E6W A;  4QWO A;  2V20 A;  2OAP 1;  3LCE A;  4R3J A;  3CWF A;  4KZ3 A;  2K7S A;  1W8Y A;  1TF1 A;  3LEZ A;  4MMN A;  1KGF A;  4KZB A;  2ZC4 B;  3N8L A;  4UAA A;  3HCY A;  1E3U D;  3IBJ A;  3PBQ A;  3VP2 A;  4X53 A;  5FQ9 A;  4I38 A;  2Y2O A;  1K6R A;  3BW6 A;  1KE4 A;  1YMX A;  4IVK A;  3UPN A;  3S7O A;  4PM9 A;  3VFH A;  4K91 A;  5FEF A;  4JXG A;  4ARZ A;  3PAG A;  3VFF A;  4NXF A;  1MWT A;  5GLD A;  4MDZ A;  4LV0 A;  3EEA A;  4JXW A;  4JXV A;  3UDI A;  2JBF A;  2DMW A;  1IYQ A;  4GNU A;  3CZD A;  3GRJ A;  3T1X A;  2D01 A;  4JBF A;  4ZJ1 A;  4DF6 A;  3M6H A;  1JVJ A;  5FQQ A;  3LIB A;  3LYX A;  4WM9 A;  4R6L A;  1VQQ A;  2QJ5 A;  3EEH A;  2XF3 A;  5TGF A;  1Q2Q A;  2Y2N A;  2L1M A;  4P6B A;  4UA6 A;  4C6Y A;  3L9K A;  3G31 A;  4Z1W A;  4LLO B;  2M7U A;  3P01 A;  5CXW A;  2W3G A;  3SS5 A;  3KSH A;  2J7V A;  3F1O B;  3IXH A;  1K57 C;  4XXR A;  3ICY A;  2V2F F;  3M2K A;  4JLF A;  5L07 A;  3UE6 A;  1AXB A;  5E2H A;  5FQI A;  3IHA A;  2WAE A;  4HES A;  1LL9 A;  3C4O A;  4Y5F A;  3K2N A;  4XUZ A;  1SKF A;  5HD3 A;  2VKS A;  3HUN A;  2HDU A;  4KQO A;  2L0W A;  3IHB A;  3T4T A;  1PZO A;  5FAO A;  2IWB A;  4Q0J A;  2V1Z A;  2IWD A;  3TRC A;  3WRZ A;  2P04 A;  3VMA A;  3MR0 A;  3PYP A;  1OJG A;  3NOU C;  2XEP A;  4I39 A;  3E2K A;  3OZH A;  4HJ3 A;  3CJM A;  1LSX A;  3ZDJ A;  4ESP A;  3Q7V A;  4ETZ A;  1TD5 A;  1UWP X;  1GSV A;  1BUE A;  1K57 A;  3UDF A;  2WGI A;  3LI9 A;  2EWW A;  4CLC E;  2XLN A;  4I3A A;  4CJN A;  4YOF A;  3OPP A;  3IWI A;  3BEB A;  2DCF A;  3QP5 A;  2XD1 A;  1GCE A;  2JKR I;  2HJE A;  1A0K A;  2OV5 A;  4AFI A;  2PT7 A;  2G7U A;  4U0T A;  4Y15 A;  1P9R A;  1STZ A;  4EQ1 A;  5M18 A;  4PHT A;  3BWL A;  3EQV A;  4MEZ A;  5F6A A;  4YNR A;  2R78 A;  3SW1 A;  2Y2K A;  3IX8 A;  5C5K A;  2BAS A;  2A2L A;  1S6R A;  5JYP A;  3SH9 A;  2EWV A;  4OPR A;  3O87 A;  4QY6 A;  3LFV A;  2ZLY A;  1YSQ A;  1VET B;  2X71 A;  1BTL A;  3C4P A;  3T4K A;  3O86 A;  2XFT A;  1XJ6 A;  4JF5 A;  3KYQ A;  3NC8 A;  2HV1 A;  5CER A;  4R3B A;  4HOI A;  4OQI A;  5L09 A;  5AVE A;  5TBM A;  2V0W A;  1KE0 A;  4PM7 A;  2CC1 A;  4MBF A;  1S0W A;  4S2I A;  2QKP A;  1K4F A;  2WAD A;  2XA7 M;  4HJ6 A;  5MC7 A;  3PBR A;  4FSF A;  1XPB A;  3IF6 B;  1GSW A;  3BFG A;  3K3D A;  4EWF A;  3MXS A;  4HP9 A;  1OT9 A;  4ZJ2 A;  2WKH A;  4DRT A;  3KSI A;  3G32 A;  5FQJ A;  1PWG A;  4BBT A;  2LB5 A;  3QP8 A;  3T50 A;  3IS2 B;  2BTF P;  3TSG A;  5HFO A;  3T4S A;  1ZC2 A;  4E3K A;  4GN2 A;  4P6Z M;  3MMH A;  3D72 A;  3JPU A;  2P9V B;  1ONH A;  3GDI A;  4E3L A;  2PRF A;  2AVX A;  1DJA A;  5J4E A;  4BEN A;  1G68 A;  2QYB A;  1YT4 A;  5FA7 A;  1HLU P;  4O8G A;  1MXO A;  2B5R A;  5FAS A;  4R38 A;  1CI8 A;  4NK3 A;  3AGE A;  4Y0T A;  2A24 B;  3NDG A;  4C75 A;  1HTZ A;  3HLC A;  3S7P A;  4E3O A;  1NLZ A;  4WEJ A;  2XK1 A;  3GR2 A;  5EVI C;  3R7W B;  3BRM A;  4KUO A;  4DXC A;  1K38 A;  3QP6 A;  4UEY A;  2NUP C;  4CLC D;  3V39 A;  2Y2G A;  1OJ5 A;  3G2Z A;  3PHY A;  2XQZ A;  3I7J A;  3TE8 A;  3G4P A;  2J9O A;  2GJ3 A;  4B4X A;  4BL2 A;  4WYY A;  5G4Y A;  2B95 A;  3IXG A;  3R4K A;  5HWV A;  1NJ4 A;  1NZU A;  3OCL A;  1MWR A;  3C2W A;  1SHV A;  1QME A;  3T1Q B;  2XR0 A;  2PD8 A;  5K5B A;  3A3J A;  2V8C A;  5EVI A;  4KG6 A;  5E43 A;  1D06 A;  2CMN A;  2OAQ 1;  2XDM A;  2J3T D;  4HI4 A;  1FQG A;  4JGO A;  1HD8 A;  3NY4 A;  1D7E A;  4KUK A;  1IYO A;  3F1N B;  3UB8 A;  1QMF A;  1PIO A;  5EFW A;  1MY8 A;  3OPH A;  1P97 A;  3VOZ A;  1SKO B;  2W1R A;  2XD5 A;  3FPV A;  3O5Y A;  4GB7 A;  1N9L A;  1PNE A;  3A0S A;  3WS1 A;  3MJQ A;  3HRE A;  3VP0 A;  1XJ3 A;  2HDR A;  5E2E A;  2E8I A;  3ZVW A;  2NUT C;  1KGG A;  3CPT B;  4WN5 A;  2GDN A;  2ZMV A;  1FSW A;  3IXD A;  4D60 A;  3E4O A;  2ZL1 A;  4A5R A;  4KQR A;  4BD0 A;  5CRF A;  5I94 A;  5GHZ A;  3L7H A;  3MZF A;  5HPI A;  3IBR A;  3FG8 A;  3TG9 A;  1G5U A;  4RX2 A;  4PAU A;  2Y2P A;  1G28 A;  4CQH A;  4WLA A;  2V0U A;  4S2P A;  4X1M A;  1MPL A;  3A0R A;  2W3F A;  1XJ2 A;  4GHI B;  5D3O A;  4Z9Q A;  3ZQ5 A;  1ES4 A;  3JYI A;  2PR6 A;  5HZH A;  1VEU A;  3LY3 A;  1L3L A;  5EM0 A;  4OQ0 A;  5CEB A;  1W7F A;  4E3N A;  1TDG A;  3IX3 A;  3HLE A;  1SDN A;  2ZC3 B;  4CLC B;  4HP4 A;  2ZQA A;  4BBV A;  4Y0U A;  3H82 B;  2OWJ A;  5A8B A;  4JF4 A;  2WKR A;  1OTI A;  2PYR A;  3SH8 A;  1GHP A;  3UO9 A;  2W0N A;  5IU1 A;  1KVL A;  4GS9 B;  2EX2 A;  3BM6 A;  1NZO A;  1CEF A;  2WZX A;  4NET A;  2EX9 A;  1BZA A;  2VGL S;  2ZM2 A;  1GA9 A;  4DE1 A;  4L9G A;  2OLU A;  1NWZ A;  3E4P A;  5E2F A;  4DN0 A;  5HWW A;  2X01 A;  1NLY A;  2B02 A;  1GHM A;  4U0X A;  2GNX A;  3UE0 A;  5HL1 A;  1YLZ A;  4GDN A;  3DTI A;  3DW0 A;  1XXM A;  5TJJ A;  1S67 L;  2A49 A;  1I2W A;  3P7N A;  4HEF A;  3KYE A;  4R4S A;  1WA9 A;  1MBL A;  3MQ0 A;  5A93 A;  2X02 A;  2JKF A;  4JF6 A;  2EX8 A;  2JKT M;  1DJB A;  4OQG A;  2MJ6 A;  4GW9 A;  2W3D A;  3CI6 A;  4EUZ A;  4XT2 B;  3OCN A;  1Y4O A;  4KQQ A;  1PYY A;  4F3L B;  3W4Q A;  4HIA A;  2Z6C A;  4GD6 A;  2ZC6 B;  1IEL A;  2RCX A;  2ZOH A;  4G3K A;  3C38 A;  3LR5 A;  1V9Z A;  2VJW A;  2W27 A;  3MBZ A;  3RH8 B;  5DKK A;  1D1J A;  2DRW A;  1BSG A;  3B42 A;  4WL9 A;  4UQI S;  3QP4 A;  4LRY C;  3A3I A;  3DWK A;  1NRF A;  5G18 A;  4DJ3 A;  1BLH A;  4NXE A;  4ZDX A;  1YMS A;  3H7W A;  5CEC A;  4R0Q A;  5GL9 A;  4KZ8 A;  4LCM A;  2VX8 A;  2WGW B;  1N9B A;  2PAV P;  4Y0O A;  3ZNT A;  2JE5 A;  3T4J A;  3CUE C;  3BFE A;  3VV4 A;  1LI0 A;  3QP2 A;  3UNW A;  4G3W A;  2INW A;  1JWP A;  1VHM A;  1U60 A;  2Q0O A;  2O9A A;  2YKF A;  1ZTU A;  4Y3I A;  1F5M A;  1ZG4 A;  5AJG A;  1H8Z A;  1JWV A;  2A3U A;  4UA7 A;  3D9Y A;  3WS2 A;  4JGP A;  4IVI A;  2EXB A;  2O9C A;  4Q0I A;  1L0F A;  5HSQ A;  5DKL A;  1ACF A;  3EOI A;  4OH0 A;  3B47 A;  1NRJ A;  3V5M A;  1EWZ A;  4B93 A;  5AQ9 A;  1YLT A;  4FUW A;  2JHE A;  3V3R A;  1DRM A;  2DNS A;  1DP8 A;  1W63 Q;  4HNB A;  3CUE A;  3T4O A;  1ODV A;  3ITA A;  2J8Y A;  5FQK A;  3VOL A;  1RGY A;  2XRO A;  3LIF A;  4LRZ E;  1RCJ A;  1P0Z A;  1S4S A;  1JNU A;  3FV7 A;  2G2U A;  1L0E A;  3WS4 A;  3UMD A;  1O7E A;  3GV9 A;  3ZVT A;  5U47 A;  3F1O A;  1IYP A;  3AGF A;  1S4R A;  3A3F A;  2WKI A;  1PZP A;  4P87 A;  3VE3 A;  4C3Q A;  3EWK A;  5CX7 A;  4EES A;  4NKP A;  4QJG A;  2VZW A;  1NYM A;  3LEQ A;  4YIN A;  4B4Z A;  4RX3 A;  4OOM A;  5L2F A;  3GQZ A;  5J8X A;  2ZQ9 A;  1RGZ A;  3ZGA B;  4JKT A;  2JKR M;  3OPR A;  5EVI D;  4KG2 A;  5GLC A;  3VE4 A;  1DJC A;  1K54 C;  4ZTK A;  3IT9 A;  4X55 A;  4MBK A;  2R9W A;  3MKE A;  3UN7 A;  3MQQ A;  5EV0 A;  5DF8 A;  1CQA A;  1CF0 A;  3FZC A;  3WS5 A;  1LI9 A;  3PBO A;  3OOV A;  4FH4 A;  4DXB A;  4N9K A;  3C5A A;  3U2A A;  4LV3 A;  3H9W A;  4S2J A;  3OLO A;  3UDX A;  3RTY A;  3T1S A;  3IF6 C;  2H0T A;  3IF5 A;  3CAX A;  5FL3 A;  3C8C A;  5HD5 A;  3LUQ A;  3FC7 A;  1OME A;  4FD8 A;  4RVA A;  1XGJ A;  1L0D A;  1E3U A;  1K54 A;  2LB9 A;  2FH5 A;  5F1G A;  3P98 A;  1BT5 A;  1OTD A;  2Y91 A;  1FIK A;  4MN7 A;  1VET A;  2Y79 A;  1KE3 A;  2PYP A;  3PAE A;  4WBG A;  2VGL M;  4GZB A;  3MF0 A;  3BFF A;  3PBS A;  3VP1 A;  3HVF A;  4EUV A;  4XUX A;  2G2W A;  3LID A;  3LIA A;  1WE4 A;  3DTM A;  1XA1 A;  3FYZ A;  4BD1 A;  3IF6 A;  2V8F A;  4ME4 A;  4LPZ A;  4WEK A;  2PBD P;  1FCN A;  4X25 A;  5AQ7 A;  1NY0 A;  2Y2I A;  3N8S A;  4X1L A;  3HJK A;  5DFY A;  1KDW A;  3IS2 A;  3IWQ A;  1PW8 A;  4JGR A;  4JPM A;  3B3X A;  1M6K A;  3V67 A;  2L4R A;  2XH9 A;  3PBT A;  2ZQD A;  4KZ7 A;  3HLB A;  3LO7 A;  1Z09 A;  1ZG6 A;  2PDR A;  4NXB A;  2W3E A;  4WUJ A;  2EFU A;  2EXA A;  4O01 A;  2V1A A;  3U4L P;  4OPQ A;  4I3I A;  5AQB A;  1H5X A;  3IWO A;  3HBR A;  1Y28 A;  4EEP A;  3IX4 A;  3N7W A;  3LR4 A;  3PTE A;  5L10 A;  4IJG A;  5CTN A;  1ERM A;  1IFQ A;  3BFD A;  1T19 A;  1TEM A;  1Q2P A;  1IKI A;  2HP6 A;  2Y2M A;  2XRN A;  2YKH A;  4BMW A;  4GCZ A;  4UQI M;  1VB6 A;  3HUO A;  2K31 A;  1W79 A;  3S1Y A;  5BOH A;  4DKI A;  5FI6 A;  4II7 A;  1YLY A;  2WKQ A;  4OOY A;  4U3T A;  2ZOI A;  4N92 A;  3S7N A;  3PXP A;  1TS7 A;  2KDK A;  3D4F A;  3DTK A;  4R70 A;  3Q81 A;  4ZRR A;  1PWC A;  3E98 A;  5F1F A;  4R23 A;  1AWI A;  4LRX C;  2K2N A;  1PFL A;  3G34 A;  5EEC A;  3C7V A;  1H8Y A;  1F9I A;  3NDE A;  3ZG8 B;  3G6O A;  4MBH A;  5JYO A;  2I9V A;  1YSP A;  3Q07 A;  5KSC A;  3SH7 A;  1TS0 A;  3MZE A;  4LV2 A;  4DE3 A;  4KQD A;  4BLM A;  3D3O A;  5CGS A;  3VP3 A;  4FTX A;  2EA9 A;  3RXW A;  4OKP A;  4OP5 A;  1T1B A;  1K55 C;  3F1P B;  4KZA A;  4GD8 A;  4PMA A;  3GMW A;  4N9L A;  5CED A;  1FSY A;  3G30 A;  3V50 A;  2ZJ9 A;  2ZQ7 A;  5LBR A;  5CHJ A;  4E3I A;  2H0Y A;  1CK3 A;  3A3E A;  3F1N A;  4IED A;  2WKP A;  4QD4 A;  1NXY A;  3O88 A;  4H6J A;  1TS6 A;  1BLS A;  4I5S A;  1S1Y A;  2GZA A;  1SKO A;  2FFF B;  2W3H A;  2Y59 A;  3GTC A;  5DF9 A;  3HLG A;  4EV4 A;  2XFS A;  5KSH A;  3T1R A;  5AQA A;  1OT6 A;  3UE3 A;  4EU0 A;  1H8M A;  4CPK A;  3E2L A;  1K55 A;  4KZ4 A;  3CPT A;  3TW8 A;  4EER A;  4DDS A;  1MKI A;  1RP5 A;  2WKE A;  2FZ0 A;  3BY9 A;  3JVV A;  4E3J A;  1TVF A;  4CLC C;  1UWN X;  5DJT A;  2KX6 A;  4P85 A;  3ZCZ A;  5FAP A;  1ES3 A;  2W1T A;  4EXO A;  3NUL A;  1K4E A;  2J9P A;  3DAV A;  1EI5 A;  2PU2 A;  2I72 A;  1W63 M;  4FH2 A;  3SS3 A;  2XA7 S;  4LFU A;  4G3V A;  1E4D A;  1S1Z A;  4JGQ A;  4GHI A;  2OWH A;  3HLF A;  2JC7 A;  1PW1 A;  3QNB A;  2VA0 A;  2Z2M B;  5HWT A;  2IA2 A;  1SDE A;  4CLC A;  2J3T C;  3SZT A;  1EW0 A;  2OSU A;  5EE8 A;  5HAP A;  4WZ4 A;  5M19 A;  1E25 A;  2PBY A;  3RXX A;  2EFX A;  1N4O A;  3H82 A;  1W8Q A;  2WUQ A;  1PI4 A;  1T1A A;  3VP4 A;  2HP5 A;  1HZO A;  3A0V A;  4GS9 A;  5A91 A;  1KGE A;  3CMZ A;  1FCO A;  1ALQ A;  2PU4 A;  3A3D A;  3HLD A;  3NCK A;  2ZD8 A;  2P74 A;  3CHW P;  2VGK A;  5HDS A;  2XSS A;  5IS1 A;  4ARZ B;  3ULF A;  2OOL A;  3BY8 A;  1ONG A;  1OPX A;  3NOT C;  1MWS A;  2ZMF A;  5M1A A;  2VLG A;  3Q1F A;  4O7D A;  3OC2 A;  1XA7 A;  4S2L A;  3PR6 A;  4R4R A;  5KIZ A;  3H7W B;  2HGV A;  4WMC A;  2JN7 A;  4GLQ A;  4OLG A;  1W5D A;  2ZQC A;  1HVB A;  5F83 A;  2M7V A;  3GSG A;  3S4X A;  4M3K A;  4BQM A;  5E2G A;  1LT0 A;  4RA7 A;  2VK3 A;  3SOI A;  4RYE A;  2Z2L B;  2Y8H A;  1LL5 A;  4XT2 A;  3ISG A;  4F3L A;  3UB7 A;  4YFM A;  2VGJ A;  4YWZ A;  4S2O A;  2PHY A;  4ETX A;  2QPN A;  1YLJ A;  4UA9 A;  1GA0 A;  1IOU A;  3ZG9 B;  2UWX A;  2HJ9 C;  2QHK A;  1UGU A;  3MQO A;  3IQA A;  3LIC A;  5FSR A;  5EVE A;  3VOY A;  3BLS A;  4NG2 A;  1V9Y A;  1F2K A;  4L0L A;  4JXS A;  5HW3 A;  4UHU A;  1I2S A;  1J9M A;  1L0G A;  4EEU A;  3MFX A;  1K0K A;  4OPZ A;  2ZM0 A;  3C30 A;  1BLC A;  4B9O A;  1Y54 A;  5CGW A;  2GX5 A;  5EOE A;  1LSV A;  3CLO A;  4BWI A;  3ZG7 B;  3BLM A;  3EGD C;  2QJ7 A;  2WGW A;  3DTE A;  1ES5 A;  1GSX A;  2WYX A;  1XX2 A;  5F69 A;  3Q7V B;  2VV8 A;  5CHU A;  3KO6 A;  3LR0 A;  3GVB A;  3V3S A;  2OLV A;  3CIT A;  1SZV A;  4MNR A;  5TFQ A;  4PM8 A;  2H28 A;  4WZ5 C;  3MSH A;  2H10 A;  4B88 A;  2ZMA A;  4KG5 A;  3K3C A;  3ITB A;  3E0Y A;  1CJF A;  1PWD A;  5G4Z A;  4P0M A;  4X69 A;  4BJP A;  3MFD A;  3AGD A;  1K56 A;  2Y2H A;  3Q7Z A;  1XKZ A;  4QU3 A;  1LHY A;  4HQA A;  2QWS A;  1K25 A;  3FKW A;  3UME A;  1PRQ A;  4WF0 A;  3IH8 A;  2Y2Q A;  1DP6 A;  2E8J A;  3NEC A;  4LCL A;  3IH9 A;  5KMW A;  5EM1 A;  5DTS A;  5TBM B;  4HH2 A;  2R9X A;  2HDS A;  4WEL A;  3BYD A;  4IHQ A;  3KSF A;  4WZ5 A;  3W4O A;  1FR1 A;  4EBP A;  1H0M A;  2VEA A;  4KEN B;  1XGI A;  3FWL A;  1YM1 A;  3KSG A;  5I5L A;  2D02 A;  5DTT A;  3NIA A;  1NYY A;  5L8M A;  5HX9 A;  2C6W B;  1G6O A;  3MXR A;  2HZ5 A;  4QPR A;  3DWZ A;  5DF7 A;  5FI2 A;  3N8R A;  2J3W A;  3N6I A;  1ERQ A;  4PM6 A;  1OTA A;  2V9A A;  4OPY A;  4HHD A;  3KYZ A;  4DMZ A;  3MS6 A;  4IUK A;  4EET B;  4IUH A;  2WK0 A;  1YAX A;  2RL3 A;  5DJU A;  1DP9 A;  4DE0 A;  1ESI A;  4OOL A;  1F98 A;  1XJ4 A;  1K6S A;  5FDH A;  2C5W B;  1FOF A;  1YPR A;  3OBF A;  4GJ4 A;  4BBU A;  1WYB A;  5HAI A;  4H8R A;  2B18 A;  3S22 A;  1H3Q A;  3SS4 A;  1T1C A;  2HPB A;  3QHY A;  2HP9 A;  4GDB A; 
#chains in the Genus database with same CATH homology
 5HWW A;  2ZBB A;  1NLY A;  2B02 A;  3ICY A;  2GNX A;  1TS0 A;  3UE6 A;  4PKY G;  4KQD A;  2KOI A;  3DBA A;  3D3O A;  5TJJ A;  1S67 L;  2EA9 A;  3NOP C;  3P7N A;  4Y5F A;  1KOU A;  2PR5 A;  3K2N A;  1T1B A;  1WA9 A;  3MQ0 A;  3F1P B;  3E4Q A;  5HD3 A;  5F5Y A;  2VKS A;  4KQO A;  2L0W A;  5HDD A;  1XFQ A;  3MXQ A;  3T4T A;  5HPF A;  2JKT M;  4Q0J A;  3TRC A;  5LBR A;  2P04 A;  3MR0 A;  2MJ6 A;  3PYP A;  1OJG A;  3F1N A;  3NOU C;  4GW9 A;  4I39 A;  2W3D A;  2WKP A;  3CI6 A;  4H6J A;  1TS6 A;  4XT2 B;  4HJ3 A;  3OCN A;  4I5S A;  1LSX A;  1S1Y A;  2GZA A;  3LR3 A;  4F3L B;  4ETZ A;  1UWP X;  1TD5 A;  1GSV A;  2W3H A;  4HIA A;  5DF9 A;  2Z6C A;  3LI9 A;  5F68 A;  2EWW A;  4CLC E;  4I3A A;  4HH3 A;  3W2Z A;  4YOF A;  5KSH A;  2ZOH A;  4G3K A;  3GEC A;  3C38 A;  3LR5 A;  2JKR I;  2HJE A;  1V9Z A;  2VJW A;  4AFI A;  1OT6 A;  3UE3 A;  3KX0 X;  4EU0 A;  1H8M A;  2PT7 A;  2W27 A;  4L9F A;  3RH8 B;  5DKK A;  2G7U A;  1P9R A;  1STZ A;  4EQ1 A;  3TW8 A;  4PHT A;  3BWL A;  3EQV A;  3BQ8 A;  4EER A;  3B42 A;  4WL9 A;  4YNR A;  2R78 A;  5F6A A;  3SW1 A;  5C5K A;  2A24 A;  4UQI S;  3UB6 A;  4O0P A;  2BAS A;  2A2L A;  4LRY C;  4MN6 A;  2FZ0 A;  3BY9 A;  3JVV A;  4DJ3 A;  2EWV A;  4CLC C;  1UWN X;  5DJT A;  2J80 A;  2KX6 A;  3LFV A;  4NXE A;  3H7W A;  1YSQ A;  2VX8 A;  3T4K A;  1XJ6 A;  2W1T A;  3KYQ A;  4EXO A;  2HV1 A;  4HOI A;  3T4J A;  3TJZ C;  5AVE A;  4HJ4 A;  4NEE D;  5TBM A;  3R7W A;  3CUE C;  3VV4 A;  4DJ2 A;  2V1B A;  2V0W A;  4G3W A;  2INW A;  3LI8 A;  3BJN A;  3LIE A;  1W63 M;  5HL6 A;  1VHM A;  1ZHH B;  2XA7 S;  4G3V A;  2QKP A;  3RFB A;  1S1Z A;  1LL8 A;  2XA7 M;  4HJ6 A;  2O9A A;  4GHI A;  3PBR A;  2OWH A;  4JGQ A;  4M4X A;  1XFN A;  4FSF A;  2YKF A;  1ZTU A;  4Y3I A;  1F5M A;  1GSW A;  3K3D A;  5AJG A;  2M1C A;  4HP9 A;  1OT9 A;  2VA0 A;  4JGP A;  3KSI A;  5HWT A;  2O9C A;  2PD7 A;  4Q0I A;  2IA2 A;  5A8B A;  4BBT A;  2LB5 A;  5DKL A;  5HSQ A;  3T50 A;  4CLC A;  3EOI A;  3IS2 B;  2J3T C;  1EW0 A;  3B47 A;  1BYW A;  3T4S A;  1NRJ A;  4P6Z M;  3MMH A;  2O9B A;  3D72 A;  4B93 A;  2JHE A;  3B33 A;  3H82 A;  4Q0H A;  1DRM A;  1T1A A;  4H6J B;  3GDI A;  1DP8 A;  1W63 Q;  4PKY A;  4HNB A;  3CUE A;  2VV6 A;  3T4O A;  1ODV A;  3A0V A;  5J4E A;  4GS9 A;  3VOL A;  2QYB A;  1OTE A;  2VV7 A;  2XRO A;  3LIF A;  5IT5 A;  4LRZ E;  1LSW A;  1P0Z A;  1S4S A;  2P7J A;  4O8G A;  5HDC A;  1JNU A;  5HDS A;  2XSS A;  3T4Q A;  5IS1 A;  3UMD A;  4ARZ B;  3F1O A;  3ULF A;  1S4R A;  4R38 A;  2OOL A;  3BY8 A;  1T18 A;  1OPX A;  3NOT C;  2ZMF A;  2A24 B;  2VLG A;  3VE3 A;  3EWK A;  5CX7 A;  3OC2 A;  4EES A;  3PR6 A;  4NKP A;  2VZW A;  3S7P A;  5KIZ A;  3H7W B;  2HGV A;  3F1P A;  2JN7 A;  1NLZ A;  4GLQ A;  4WEJ A;  3HJI A;  4L9E A;  2HF6 A;  1N9N A;  4OOM A;  4RQ9 A;  2W1T B;  2M7V A;  2JKR M;  4K08 A;  3VE4 A;  3R7W B;  3NHQ A;  4KUO A;  4UEY A;  2NUP C;  3MQQ A;  4CLC D;  1LT0 A;  1OJ5 A;  2Y8H A;  3PHY A;  4XT2 A;  1MZU A;  3TE8 A;  4F3L A;  2KLI A;  3UB7 A;  4MCW A;  4YWZ A;  2GJ3 A;  3PBO A;  3EQU A;  2PHY A;  3OOV A;  4I3J A;  4ETX A;  3FPW A;  2O0Y A;  1IOU A;  2O99 A;  1YKD A;  2HJ9 C;  2QHK A;  5G4Y A;  1UGU A;  3U2A A;  3MQO A;  5MC7 A;  3H9W A;  1YSP A;  3LIC A;  3OLO A;  3R4K A;  3JVU A;  1P9W A;  1V9Y A;  5HWV A;  4L0L A;  3RTY A;  3OCL A;  4Y2F A;  3C2W A;  3CAX A;  5FL3 A;  3C8C A;  5HD5 A;  3LUQ A;  3FC7 A;  4EEU A;  3NJA A;  3MFX A;  2PD8 A;  1TS8 A;  4EW7 A;  5K5B A;  3EGX C;  1N9O A;  4MN5 A;  3C30 A;  3BQA A;  1D06 A;  2CMN A;  4B9O A;  2LB9 A;  2OAQ 1;  2GX5 A;  2FH5 A;  3PBN A;  3UB9 A;  1LSV A;  2J3T D;  3CLO A;  3ZYT A;  4BWI A;  4HI4 A;  1MKM A;  1OTD A;  4JGO A;  3EGD C;  4MN7 A;  4P6Z S;  2QJ7 A;  2Y79 A;  4HY8 A;  1D7E A;  2PYP A;  4KUK A;  3F1N B;  3UB8 A;  1GSX A;  1NWZ A;  5EFW A;  5J7E A;  2VGL M;  5F69 A;  3S7Q A;  1S66 L;  3MF0 A;  1P97 A;  3PBS A;  2W1R A;  2VV8 A;  3FPV A;  4FOF A;  3O5Y A;  4EUV A;  3KO6 A;  3LID A;  3LR0 A;  3LIA A;  1X0O A;  3CIT A;  1N9L A;  5DFX A;  3A0S A;  2Z6D A;  3MJQ A;  4R3A A;  4E04 A;  4ME4 A;  2H28 A;  2JKT I;  4LPZ A;  4WEK A;  1XJ3 A;  5AVF A;  3T4L A;  2NUT C;  3K3C A;  1OTB A;  3E0Y A;  2P08 A;  5G4Z A;  5DFY A;  3HJK A;  5J3W A;  4WN5 A;  4BJP A;  2ZMV A;  3IS2 A;  4JGR A;  3E4O A;  3V67 A;  2L4R A;  4NXG A;  1MC0 A;  3PBT A;  2OAP 1;  4HQA A;  2PDR A;  2QWS A;  4NXB A;  3CWF A;  2W3E A;  4WUJ A;  2K7S A;  1TF1 A;  3UME A;  4WF0 A;  4MMN A;  4O01 A;  5HPI A;  3IBR A;  1DP6 A;  3FG8 A;  2V1A A;  4I3I A;  3HCY A;  3IBJ A;  3PBQ A;  1Y28 A;  4I38 A;  5TBM B;  4PAU A;  4EEP A;  3BW6 A;  4HH2 A;  4WEL A;  1G28 A;  3S7O A;  3LR4 A;  4CQH A;  4WLA A;  2V0U A;  4IHQ A;  3KSF A;  4IJG A;  4ARZ A;  1IFQ A;  1T19 A;  4NXF A;  2VEA A;  3A0R A;  2W3F A;  1XJ2 A;  4GHI B;  4MDZ A;  3ZQ5 A;  3EEA A;  2PR6 A;  5HZH A;  2XRN A;  2YKH A;  4BMW A;  4GCZ A;  2DMW A;  4UQI M;  1VB6 A;  3KSG A;  5I5L A;  2K31 A;  2D02 A;  5L8M A;  1G6O A;  4QPR A;  4CLC B;  4II7 A;  2D01 A;  4HP4 A;  2J3W A;  1OTA A;  2WKQ A;  2V9A A;  4BBV A;  4HHD A;  2ZOI A;  3H82 B;  2OWJ A;  3LIB A;  3KYZ A;  3LYX A;  3PXP A;  3S7N A;  4DMZ A;  2WKR A;  1OTI A;  1TS7 A;  2KDK A;  2PYR A;  4IUK A;  4R6L A;  2QJ5 A;  4EET B;  3EEH A;  4IUH A;  1YAX A;  5DJU A;  1DP9 A;  4R70 A;  4OOL A;  1F98 A;  2W0N A;  1XJ4 A;  4ZRR A;  5IU1 A;  3E98 A;  4GS9 B;  2L1M A;  3OBF A;  4GJ4 A;  4BBU A;  4LRX C;  2K2N A;  4Z1W A;  4LLO B;  2M7U A;  3P01 A;  2B18 A;  2W3G A;  2VGL S;  3KSH A;  1H3Q A;  1T1C A;  1F9I A;  4L9G A;  3F1O B;  3G6O A;  2I9V A;  3E4P A;  4DN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...