3VOLA

X-ray crystal structure of pas-hamp aer2 in the cn-bound form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
GSHMARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANERLGSAVQWTDRTEEHRAEQEVSQLVQAAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for oxygen sensing and signal transduction of the heme-based sensor protein Aer2 from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3volA00
5HDSA 2HV1A 3K3CA 4GS9A 4MN5A 3F1NB 4JGRA 1TS0A 5HWTA 1DP8A 2OWHA 4KUKA 2VV6A 2Z6CA 1EW0A 3GECA 1N9OA 5HD5A 3KX0X 1X0OA 1G28A 1TS6A 2A24B 2YKHA 3F1PB 1VB6A 2OOLA 3A0VA 3BY9A 4I5SA 2J80A 4WN5A 4R6LA 5TBMB 2ZBBA 2PR6A 2PYPA 2PDRA 1DRMA 3D72A 4NXGA 3A0SA 2ZOHA 5I5LA 3RH8B 2PR5A 1GSXA 3H82A 2L0WA 1N9LA 2QHKA 1OT9A 3G6OA 3NHQA 3BY8A 3HJIA 4L9EA 4LRXC 5G4YA 5KIZA 2OWJA 4L9FA 3VOLA 4F3LA 3ZQ5A 1D7EA 3LUQA 1XJ6A 3ICYA 5DJUA 2QWSA 2PD8A 1LT0A 3UMDA 4E04A 4EEUA 5J3WA 3LI8A 4EETB 5A8BA 4EERA 3MXQA 2VLGA 3MR0A 4HNBA 4HY8A 3LIBA 4B9OA 2YKFA 3VE4A 1UGUA 3F1OA 3UB6A 3UMEA 3CWFA 5EFWA 3H9WA 2L1MA 4HQAA 4I3IA 4KQDA 4MN6A 1S67L 2Z6DA 3LYXA 3NOUC 4HJ3A 5HWWA 4BBVA 4I3AA 2WKPA 3HJKA 3FG8A 4NXEA 4WLAA 1TS8A 3B33A 4GS9B 3UB9A 2JHEA 4R38A 4EEPA 1N9NA 5F69A 1KOUA 3F1OB 1LSVA 3IS2B 3MQQA 4GHIA 4HP9A 1OJGA 3IBRA 5DKKA 4DJ2A 4DJ3A 4GCZA 4NXBA 4R3AA 2KDKA 4PKYG 3MFXA 1T1CA 4RQ9A 1S4SA 2QJ7A 1T18A 3MJQA 1GSWA 1S1YA 1P0ZA 3H7WB 4XT2A 3UB7A 4F3LB 2W27A 4WUJA 5HZHA 4JGOA 1DP6A 2ZOIA 4HHDA 4WF0A 2P7JA 1V9ZA 3IS2A 4GHIB 1OJ5A 2W0NA 3H82B 5F68A 1WA9A 3NOTC 3E4QA 2V0WA 4I39A 2M1CA 4WL9A 1S4RA 5F5YA 1XJ2A 4JGQA 1BYWA 3P7NA 1GSVA 1T1AA 2INWA 4EQ1A 1P97A 1NWZA 5DJTA 3SW1A 1S66L 2V9AA 1DP9A 2WKRA 3LIEA 4HJ6A 4R70A 3MQOA 4HP4A 5HD3A 3RTYA 2BASA 3ULFA 2QKPA 3OLOA 3UB8A 4HJ4A 2CMNA 3PHYA 4EW7A 2B02A 3LIDA 3BWLA 5AVEA 3VE3A 4HH2A 5AVFA 3A0RA 4LRYC 1OT6A 3F1NA 5HDDA 3T50A 2JN7A 4HH3A 2R78A 4GW9A 4I3JA 4YWZA 1XJ3A 4H6JA 4KUOA 4BBTA 3EWKA 4I38A 3LICA 1D06A 1Y28A 1XJ4A 2A24A 4K08A 4H6JB 1T1BA 2V1AA 1MZUA 3E4OA 2VEAA 1LL8A 1V9YA 1OTEA 3CLOA 5DKLA 1XFNA 2PD7A 5HWVA 1ODVA 2GJ3A 1OTIA 2V1BA 3CAXA 4LRZE 4XT2B 4HI4A 2K7SA 1LSXA 2PYRA 3F1PA 3NOPC 1TS7A 3PYPA 4LLOB 4M4XA 5TBMA 2PHYA 2D01A 5G4ZA 5J7EA 1OTBA 2WKQA 4HIAA 2L4RA 3GDIA 4BBUA 5IS1A 3C2WA 1JNUA 2V0UA 3EEHA 2I9VA 3LIFA 2H28A 3FC7A 2VV7A 1F9IA 5F6AA 3K3DA 1OTDA 5IU1A 3E4PA 2D02A 1LSWA 3LIAA 4NXFA 1XFQA 4EESA 4EXOA 1UWPX 3C8CA 3NJAA 2QJ5A 5J4EA 1F98A 3LI9A 2KX6A 4PKYA 5HDCA 3UE6A 4LPZA 2VV8A 4JGPA 4HOIA 2EA9A 1S1ZA 3H7WA 1OTAA 5HSQA 4L9GA 1T19A 1UWNX
chains in the Genus database with same CATH superfamily
2HV1A 2WZZA 2Y8HA 3W2ZA 4UQIS 1YLTA 2OWHA 1FCMA 5HD5A 4M3KA 5L8MA 4QD4A 2Q9MA 4FOFA 5TBMB 4JBFA 4JF6A 3HLEA 2WGWA 3ZCZA 3W4QA 1N9LA 1OT9A 1Z6FA 4MLLA 4IBRA 3GMWA 3OPRA 2PD8A 1E3UD 3C4OA 4KZ8A 3ZFZA 4GDNA 2HP5A 1L0FA 3IF6C 1I2SA 4OLDA 3IF5A 3IHBA 4R23A 4FH2A 5HWWA 2XF3A 4NKPA 2QPNA 4ZTKA 2LB9A 3BECA 2H5SA 1LSVA 5GLBA 5A91A 4Y17A 4NXBA 2QMIA 5HPFA 1PI4A 2FFYA 3V39A 3IWQA 4S2PA 4IJGA 4WL9A 4P6BA 3S1YA 3NI9A 1RCJA 3LIEA 1GCEA 2ZC7A 3O5YA 3RTYA 2W3GA 4JKTA 3PHYA 1XGIA 3MKFA 3F1NA 4GW9A 5FQKA 3GQZA 1K54C 1PWGA 3N6IA 2ZQ9A 3P09A 3A3DA 1BULA 2V1BA 1MWSA 1FSWA 2G7UA 1E4DA 5TBMA 2HZ5A 3AGEA 5FA7A 5CXWA 1JNUA 4GN2A 4NXFA 5F1GA 2EX9A 3LI9A 3Q7VA 1KVLA 3UB5P 2J8YA 4GS9A 1ESUA 1DJAA 3T4SA 1DP8A 4C75A 3MQ0A 1BUEA 4BQMA 3P98A 1KGEA 5EVEA 1DRMA 1MKMA 2JKRM 4B4ZA 2J3TC 1XPBA 3QP4A 1ES4A 3ICYA 4EEUA 4Y13A 1FR1A 1VEUA 3E0YA 3MXQA 3MR0A 4IBXA 3FZCA 3LIBA 5EPHA 3SZTA 4KQDA 2Y4AA 3BRMA 1CI9A 1YPRA 3JYIA 2HPBA 1HLUP 3Q81A 4GCZA 4JXVA 2KDKA 3OZHA 2HP6A 4MCWA 3WS4A 1WYBA 4GHIB 1OJ5A 2PRFA 5F83A 2A2LA 2AVXA 3LFVA 4Q0HA 1GHPA 2ZD8A 1BZAA 4IHQA 1NRJA 1SDNA 4X1MA 2R9WA 2M7UA 3LICA 5GLAA 4ZDXA 1YLWA 4OP8A 4WZ5C 5J7EA 2FZ0A 2HDRA 3BQAA 3JPUA 1NYYA 1PNEA 4GB7A 2D02A 4OPRA 3IXBA 5J4EA 4Y5FA 3NULA 4WZ5A 1T19A 3EGDC 4S2LA 4JGRA 2XFTA 4IUHA 1VB6A 3C4PA 3MFDA 4QPRA 2FH5A 4N1XA 2PYPA 1L3LA 1MC0A 3T1XA 3SS5A 5L10A 2XK1A 3DW0A 4MBKA 2OWJA 1HD8A 5A8BA 1TDLA 5BOHA 2XA7M 3UMEA 4KZ3A 5FAOA 2EWVA 2Q9NA 5EOEA 1FCOA 1BLHA 4DMZA 5M19A 2DRWA 5DKKA 3AGFA 3DTKA 2Y79A 2ZMAA 3T4JA 2K2NA 4X6TA 5HL1A 5HZHA 2JKFA 3BQ8A 1V9ZA 1JWPA 2VX8A 1K6SA 2JE5A 2BG1A 3ZG8B 5HD3A 4MNRA 4S2IA 4GJ4A 4U0TA 1DJCA 1Y28A 2VGLM 1ZG6A 3UE1A 3UDIA 2PBYA 2K7SA 3NOPC 3P01A 2D01A 1MY8A 3ZNTA 5A93A 4ID4A 4DKIA 5KMWA 3FC7A 4U0XA 1H8ZA 4UHUA 5CTMA 4CPKA 3C8CA 1F98A 1QMEA 4LPZA 2W3EA 4HOIA 4ZJ1A 5L2FA 2C5WB 3BJNA 3G34A 3HLDA 4WN5A 3BEBA 3BM6A 3VOYA 5L07A 2Z6CA 3ZVWA 3BFDA 3HLGA 4I5SA 3SH9A 3Q07A 3T4OA 2ZL1A 2PT7A 1KDWA 1K0KA 2OV5A 1VEUB 1IEMA 3PBRA 4E3IA 4XUXA 1IYQA 3LUQA 4B93A 5TR7A 3VP0A 3T4KA 3MXRA 1E3UA 4P6ZS 4DDYA 2Y2QA 3G2YA 4BENA 3NOUC 2X01A 1STZA 4EEPA 3HUMA 3O3VA 2P9VA 1KOUA 5HPIA 2OSUA 4R3AA 1U60A 4ARZA 4OVDA 1BT5A 1NY0A 1O07A 2Y2GA 3EQUA 4UA6A 5GHXA 4F94A 3CMZA 4HBTA 2E8IA 2BLSA 2J9OA 3A3IA 2B18A 2HDSA 2XEPA 3NY4A 2CC1A 4OP5A 2Y59A 1PIOA 4KZAA 5M1AA 3LIDA 4X1LA 2V1ZA 2QYBA 4OQIA 3HCYA 3IH9A 1P9RA 5GL9A 2EFUA 2WYXA 1ODVA 4Z1WA 2PYRA 2XA7S 1TS7A 2VGJA 5FQQA 4ETXA 2X71A 1IELA 3L9KA 4YFMA 4OLGA 1F9IA 3MMHA 3ZNYA 5IT5A 2Y2KA 1EWZA 1CEGA 5CHUA 3N7WA 2HDQA 1YLPA 4L9GA 5HARA 3K3CA 2XD5A 3V67A 1XA7A 3GECA 4OOYA 1TEMA 2YKHA 4HBUA 5I5LA 4RX3A 5KIZA 2W3DA 3WWXA 3FKVA 2HJEA 5DJUA 3C7VA 3Q1FA 3SH8A 5DVAA 5AQBA 4JXWA 1ERQA 1K55C 2O9AA 3K2NA 4Z9QA 1E25A 3IF6B 4NXEA 3FG8A 2HGVA 4FH4A 2VZWA 3WS5A 3IXHA 3A3EA 1K55A 4GHIA 3R7WA 2VGKA 1KGFA 3V50A 3S22A 1F2KA 4JXSA 4XT2A 3QP1A 2W27A 3G2ZA 1VHMA 5DFYA 1OMEA 5HAQA 1P97A 2V9AA 1DP9A 3CHWP 1K38A 4IVIA 3VE3A 4HH2A 3A0RA 1LLBA 4FCFA 4BBTA 1HTZA 3S7QA 3VP1A 3CG5A 2V1AA 2DNSA 1PZPA 1YMXA 2Y2OA 4E6WA 3NDGA 2GJ3A 5FL3A 1LSXA 5FDHA 2WAEA 3SH7A 4QY5A 4PPRA 5JYOA 1HVBA 3LR5A 5HL6A 4HIAA 3LIFA 4WYYA 5CGWA 3K3DA 2KLIA 5CEBA 1ALQA 3NJAA 5M18A 3LY4A 3I7JA 3DAVA 1IFQA 5K5BA 4YOFA 4QU3A 2XLNA 3U2AA 3O87A 3IX3A 1L2SA 5HWTA 2VA0A 4KUKA 1CJFA 5EM1A 2A3UA 3M2JA 4Y2FA 3BFEA 3BY9A 5HX9A 4DE0A 4G3WA 2PR6A 3ISGA 3OC2A 2V20A 3PR6A 2GDNA 3SS3A 4ARZB 4H8RA 3T12B 2Y2IA 3SS4A 1JWVA 1YLJA 4B9OA 3O86A 2EX2A 2RL3A 3FPVA 4XUZA 2IWBA 2UV0E 3A3JA 3KSHA 4WLAA 1TS8A 3DWKA 3IQAA 4ZBEA 2P08A 4UA9A 3UN7A 3EOIA 5FEFA 1W79A 3H7WB 2NUPC 1PFLA 3UB7A 4AFIA 2V2FF 5DTTA 3T4LA 2V0WA 1S4RA 3N8RA 3P7NA 5F1FA 3SW1A 3E2LA 4R70A 2WKHA 4LV1A 4GD8A 2ZMVA 1J3WA 4JPMA 2XROA 5FQJA 1IYOA 3TSGA 5AQ7A 4X68A 4X69A 1V9YA 2J3TD 3HUNA 4NK3A 4Y0UA 2JKRI 3KSIA 1Y4OA 4DXCA 2ZQDA 3C5AA 1K54A 3RJUA 4BLMA 2MJ6A 1M40A 1RGYA 2ZJ9A 2VJWA 1OTBA 3NBLA 5F82A 1H0MA 2VKSA 3EGXC 1PWDA 2Y2MA 3ZG9B 1OTDA 3IX8A 4OPZA 3W8KA 3CPTA 1S1ZA 2ZLYA 2ZL1B 5CGXA 3F1NB 4WEJA 2GNXA 3TOIA 2OAQ1 4UQIM 3F1PB 2OOLA 4E6XA 4E3LA 1S6RA 4PM9A 3A0SA 2ZOHA 1VETA 5CRFA 4WMCA 4ETZA 2L0WA 4JLFA 1FR6A 2ZQCA 4JF5A 3TRCA 4EETB 4KQOA 3B47A 1WE4A 2P9VB 4MN6A 2JKTI 5I94A 2WKPA 1NJ4A 4GS9B 3VP2A 1NLZA 1JVJA 4EBPA 2ZC4B 1KE4A 5E2EA 1ZTUA 5F69A 1MWTA 3F1OB 2P04A 4DJ3A 3IHAA 4PKYG 5J8XA 4WUJA 3FV7A 3IS2A 1LI0A 4KZ4A 2M1CA 1EI5A 1RP5A 4EQ1A 3QP2A 3IWOA 5DJTA 1S66L 1XP4A 2JCHA 3MQOA 2CMNA 5U47A 3UPPA 1YM1A 4PHTA 1G5UA 4I38A 3IBJA 4H6JB 4R0QA 1BLSA 1MZUA 3D4FA 1LL8A 1OTEA 4OH0A 1XFNA 4LV2A 2ZM0A 3M6HA 3RXWA 5GHZA 3PAEA 3PTEA 2ZC3B 5CEDA 5KSCA 3A3FA 1KE0A 1ONGA 4PKYA 3EQVA 4LENA 4R3JA 5HDSA 5TGFA 4Q0JA 4BD1A 1N9OA 2XR0A 3U4LP 2PDRA 3IH8A 4IUKA 3GRJA 4RX2A 2WGWB 4N9LA 3HREA 3QP5A 3HJIA 1H5XA 2W3HA 1KGGA 3ZQ5A 1D7EA 2J9PA 5J3WA 3IXDA 4HNBA 1AXBA 2JKGA 1UGUA 3UB6A 3N8SA 3TG9A 1W63M 4S2NA 2W1TA 4P87A 3HVFA 2ZC6B 5EE8A 2XDMA 3CI6A 3NECA 4WM9A 1OJGA 5FQIA 5GHYA 1AWIA 2DCFA 1ZHHB 2PBDP 3OCNA 4OOLA 1H8MA 3S4XA 3HLWA 2WGIA 2UWXA 3N4IA 1LL5A 2M7VA 3ZG0A 4HP4A 4IVKA 4PM7A 3SOIA 3BWLA 5AVEA 4FSFA 4YWZA 5CGSA 1K56A 3MKEA 2A24A 3VSKA 1L0EA 4DE1A 3NCKA 2Y55A 5DKLA 4CLCB 1PWCA 1OTIA 3F1PA 4ME4A 1YQSA 4PM8A 3TW8A 2V0UA 4WELA 2H28A 4UA7A 4C3QA 2OLVA 3E4PA 5DF9A 3C38A 2WKEA 5FATA 3T4TA 4MN5A 1NZUA 4DXBA 2ZM2A 4GLQA 1G28A 1ESIA 1TS6A 5FEGA 4RVAA 2W1RA 3OPPA 4R6LA 5E2FA 2RCXA 4D2OA 1H3QA 1YKDA 4IEDA 2J7VA 2P74A 4G3VA 4EERA 4KZ9A 2GZAA 1YLZA 4LV0A 1PZOA 4HQAA 3RFBA 1S67L 4BBVA 5HFOA 1IKGA 4MDZA 4GKUA 3M2KA 3LGOA 3IBRA 1S4SA 2QJ7A 1GSWA 1NXYA 5HAIA 3V3RA 3OPHA 1XA1A 5F68A 1WA9A 1PW8A 3FYZA 3NIAA 3RXXA 2V8CA 4D60A 2JBFA 1MKIA 5EVLA 3KSFA 4LFUA 4GNUA 5KZHA 2QKPA 3GSGA 2IWDA 4QB8A 5DTKA 4KZ7A 2G2UA 1PW1A 3G31A 1MWUA 4E3NA 1NRFA 1SDEA 1YMSA 3ZG5A 3EEAA 3Q7ZA 5C5KA 3NC8A 2PHYA 5EVIA 1GHIA 4B88A 1G68A 4GZBA 3Q82A 2Q0OA 3B3XA 4OONA 2L4RA 1C3BA 1FCNA 4MBFA 2ZQAA 1F5MA 3LIAA 2VV8A 1XXMA 4JGPA 1K56D 3TJZC 2PU4A 2HF6A 4O0PA 4R3BA 2O9CA 2JC7A 4L0LA 2XD1A 4NEED 3CUEA 3PBSA 1QMFA 4O8GA 1TVFA 2G2WA 4LRXC 2EWWA 5FAPA 3LR0A 4Y0TA 1Y54A 3UMDA 4Y15A 4S2MA 2C6WB 3F1OA 3ZDJA 2L1MA 4KG5A 4EBNA 3QNBA 2DMWA 5IHVA 1BLCA 2LB5A 3HJKA 2B5RA 2XGNA 5FQMA 4HP9A 3IS2B 1O7EA 3ITAA 3G35A 3VFHA 5CECA 1Z09A 3C7UA 2B95A 1JTDA 4P0MA 4DDSA 3N8LA 4I39A 5LBRA 1J9MA 1L0DA 3T1SA 4PM6A 4Q8IA 5D3OA 2Y2PA 3HUOA 2B02A 5EVIC 5AVFA 5HDDA 3IF6A 2JN7A 3KO6A 1XJ3A 4FD8A 2VEAA 5L09A 2Y2JA 4WEKA 1K57A 4JXGA 3LO7A 2Z2MB 5GLCA 4HESA 2WKQA 3GDIA 3DBAA 3GVBA 1KDSA 2I9VA 1SCWA 3KYQA 5IU1A 1PI5A 2KX6A 4OQHA 3UDXA 1K57C 1P9WA 1CI8A 1OTAA 5FI6A 1TS0A 1Q2PA 2KOIA 2ZQ8A 1CF0A 3V3SA 5EOOA 3RH8B 3H82A 3S7NA 4BD0A 3UE0A 1YLYA 3LR4A 2Z2LB 1ES3A 4EV4A 3QP8A 4I3IA 4FTXA 1FQGA 4E3KA 5FQ9A 4CLCD 3G4PA 5CX7A 1G6OA 5FI7A 4P85A 4K0XA 1ZG4A 1FSYA 1S1YA 4ZJ3A 1XKZA 2HP9A 3R4KA 4NETA 3MZFA 1TF1A 3E4QA 3OOVA 1XJ2A 1LL9A 2WKRA 3ULFA 4B4XA 3LEQA 1GA9A 4WBGA 4EW7A 4CLCA 3IX4A 5DF8A 4KUOA 2OAP1 5E2HA 4K08A 4BWIA 3E2KA 2Y2HA 4KZ6A 1YT4A 3S7PA 3ZGAB 3GTCA 3MXSA 2WGVA 5CERA 1KVMA 3W4PA 2PU2A 4XT2B 4X56A 3OBFA 3KX0X 1FILA 1NZOA 2NUTC 2QHKA 2Y91A 1BLPA 5G4YA 3VOLA 5DF7A 4EU0A 1CQAA 1W63Q 1IYSA 4GOGA 4WZ4A 4BMWA 4EBLA 4PAUA 4E3OA 3CWFA 2HJ9C 5A90A 4NG2A 1W7FA 5FAQA 4HJ3A 4ESPA 5MC7A 4N92A 2H0YA 1T18A 2WUQA 3MJQA 5HW3A 1S0WA 3PBQA 2WKIA 3VMAA 3NOTC 2V8FA 2QZ6A 1GSVA 2INWA 1W5DA 3VFFA 4A5RA 2X02A 3WS1A 3DTIA 3MZEA 3T4QA 4X55A 2H0TA 1YSPA 2W1TB 2R78A 4I3JA 2I72A 1XJ4A 2O0YA 4KQRA 5TFQA 3GR2A 1GHMA 5GLDA 4DE2A 4HI4A 2XFSA 1SKOB 4LCMA 2ZQ7A 4LLOB 3MSHA 3C30A 4QHCA 1HZOA 3QNCA 1LSWA 1XFQA 4X53A 3UE6A 1LI9A 3PBNA 3WRTA 3H7WA 4R38A 5EM0A 2XSSA 2VV6A 4DE3A 2EX6A 3HLBA 1NLYA 3A0VA 4S2KA 4II7A 4K0WA 4KZ5A 1PRQA 4OQ0A 2BTFP 3VP3A 3G32A 2PR5A 1GSXA 3NHQA 3G6OA 3BY8A 1CEFA 2EXAA 1XJ6A 4E04A 2QWSA 1K6RA 5FASA 4BL3A 3KYEA 1FOFA 3FWLA 2XH9A 3H9WA 1OPXA 2Z6DA 3LYXA 4EUVA 4I3AA 5G18A 3ZHHA 2JHEA 2WK0A 3JVVA 2W3FA 2WZXA 5KSHA 2IA2A 4CLCE 4OPQA 3PBTA 4RQ9A 3BFFA 4LGWA 4O7DA 1BTLA 3CPTB 4WF0A 4JF4A 3ZG7B 4MN7A 3QP6A 5F5YA 4O01A 2EFXA 4OPYA 1TD5A 2E8JA 4KQQA 2BASA 2WADA 3VOZA 3OLOA 1A0KA 3LR3A 4LV3A 3IXGA 3DTEA 3CITA 4PMAA 3WS2A 2PD7A 1ZKJA 5CHMA 4BL2A 2O9BA 4XXRA 4KG6A 1DJBA 4YINA 3T1QB 3MZDA 3BLSA 4ZJ2A 2VV7A 4K91A 1UWPX 4Y0OA 3O88A 5HDCA 3PBOA 3VSLA 2EA9A 2Y2LA 3GV9A 1XGJA 4S2JA 4EQIA 1X0OA 2A24B 2IWCA 3HBRA 5AQAA 4FUWA 5DFXA 3HLFA 4EWFA 3WS0A 2WAFA 4R4RA 3KYZA 2HDUA 4L9FA 4Q0IA 1ACFA 5AQ9A 3LI8A 3JVUA 4MEZA 3VE4A 3G30A 5DTSA 5E2GA 4U3TA 4QWOA 2JKTM 1N9NA 3CJMA 4DJ2A 4E3JA 1IOUA 1BSGA 3DTMA 2XRNA 4F3LB 3M6BA 4HHDA 1IYPA 4E3MA 1H8YA 1JWZA 5HAPA 3BFCA 4G3KA 1T1AA 3ZYTA 1N4OA 4KZBA 1L0GA 3UB8A 5FSRA 4HJ4A 5FDSA 4LRYC 4ZAMA 1K4FA 2ZC5B 4MBHA 3E4OA 3CLOA 4UAAA 4N9KA 4LRZE 3LEZA 3BW6A 3PYPA 3VP4A 5EVID 1D1JA 2H10A 1VM1A 3C2WA 3DWZA 1I2WA 4S2NC 2QJ5A 3CZDA 4X25A 3E98A 5HSQA 5TJJA 2VK3A 2J3WA 1EW0A 3W4OA 4BJPA 4GDBA 1K4EA 2ZBBA 3UO9A 3ZVTA 3VV4A 4UEYA 1PYYA 2GX5A 4CLCC 2O99A 5E43A 3S7OA 3BFGA 3IWIA 2VLGA 4HY8A 2YKFA 1NYMA 5EFWA 1TDGA 3UB9A 4QJGA 1W8YA 1JTGA 4OQGA 3NDEA 4R4SA 4YNRA 1T1CA 1RGZA 4JGOA 2ZOIA 4R1GA 4RYEA 2P7JA 3H82B 1FIKA 1CK3A 3V5MA 3UPOA 1BYWA 1SHVA 3FPWA 1ZC2A 4HJ6A 3UDFA 4S2OA 3ITBA 3OCLA 1OT6A 3QHYA 4HH3A 4WMCD 1SKOA 1IKIA 3FKWA 3D3OA 1WYCA 3CUEC 4HEFA 5HWVA 4Y7PA 3CAXA 1MPLA 1DY6A 1ERMA 3KSGA 4P6ZM 2EXBA 4M4XA 3OPLA 5G4ZA 3PXPA 5IS1A 3HL9A 1MXOA 1K25A 5F6AA 3B42A 4EESA 4EXOA 3UPNA 5A92A 2OLUA 4ZRRA 4DN0A 3MQQA 3UY6A 1KE3A 4RA7A 4CJNA 2K31A 3Q7VB 2VGLS 2XQZA 1XX2A 1YSQA 3PAGA 3R7WB 2J80A 3HLCA 5JYPA 3MBZA 3WRZA 3D72A 4GD6A 4NXGA 4L9EA 5EECA 4F3LA 3IT9A 1LT0A 4OOMA 2ACGA 3D9YA 4DF6A 3BYDA 5EV0A 1MWRA 3LCEA 2ZM8A 5FI2A 4KG2A 3B33A 3MF0A 4N1HA 2A49A 3AGDA 1VQQA 3UE3A 3UNWA 3MFXA 3L7HA 1P0ZA 1LHYA 4C6YA 1ONHA 4LCLA 1DP6A 2ZMFA 1SKFA 5CTNA 2W0NA 5AJGA 4JGQA 1NWZA 2Y2NA 3BLMA 1N9BA 1VETB 4DRTA 1Q2QA 3MS6A 3T50A 1MBLA 1ES2A 2FFFB 4H6JA 1YAXA 4CQHA 3EWKA 2PAVP 1D06A 1T1BA 1I5QA 4MMNA 1ES5A 3T1RA 1SZVA 4KENB 3LY3A 5EUAA 1G6AA 5EVIB 4BBUA 3EEHA 4QY6A 2R9XA 2EX8A 4PM5A 5CHJA 4OKPA 4Y3IA 1GA0A 4EUZA 1EROA 1W8QA 3TE8A 1M6KA 1UWNX
chains in the Genus database with same CATH topology
3T4TA 2HV1A 2Y8HA 2XSSA 3K3CA 4MN5A 3W2ZA 4UQIS 3V67A 2OWHA 2VV6A 3GECA 5HD5A 4GLQA 1G28A 1TS6A 2YKHA 5L8MA 1NLYA 3A0VA 4FOFA 5TBMB 2W1RA 4R6LA 4II7A 5I5LA 2PR5A 1GSXA 3NHQA 1N9LA 1H3QA 1OT9A 3G6OA 5KIZA 3BY8A 2W3DA 1YKDA 2HJEA 1XJ6A 5DJUA 4E04A 2QWSA 2PD8A 4G3VA 4EERA 2GZAA 2O9AA 3H9WA 3K2NA 4HQAA 3RFBA 1OPXA 1S67L 2Z6DA 3LYXA 4EUVA 5HWWA 4BBVA 4I3AA 4NXEA 4NKPA 3FG8A 2HGVA 2VZWA 2JHEA 4MDZA 2LB9A 3JVVA 2W3FA 5KSHA 1LSVA 4GHIA 3IBRA 2IA2A 3R7WA 4NXBA 4CLCE 5HPFA 3PBTA 4RQ9A 1S4SA 2QJ7A 1GSWA 4XT2A 2W27A 4WF0A 5F68A 1WA9A 4IJGA 4MN7A 1VHMA 4WL9A 5DFYA 5F5YA 4O01A 1P97A 3KSFA 1TD5A 2V9AA 1DP9A 3LIEA 3O5YA 3RTYA 2W3GA 2BASA 2QKPA 3OLOA 3PHYA 3VE3A 4HH2A 3A0RA 3LR3A 3F1NA 4BBTA 4GW9A 3S7QA 3CITA 2V1AA 2PD7A 2GJ3A 2V1BA 2G7UA 3EEAA 5FL3A 1LSXA 5C5KA 2O9BA 5TBMA 2PHYA 3LR5A 5HL6A 4HIAA 2L4RA 1JNUA 3LIFA 2VV7A 1F5MA 3K3DA 2KLIA 4NXFA 3LIAA 1UWPX 3NJAA 5HDCA 3LI9A 3PBOA 2VV8A 1IFQA 5K5BA 4JGPA 4YOFA 2EA9A 3TJZC 3U2AA 4GS9A 2HF6A 4O0PA 3T4SA 2O9CA 1DP8A 2VA0A 3MQ0A 5HWTA 4KUKA 4NEED 4L0LA 1X0OA 2A24B 3CUEA 3PBSA 4Y2FA 3BY9A 4O8GA 4G3WA 2PR6A 1DRMA 5DFXA 1MKMA 3OC2A 3PR6A 2JKRM 4ARZB 4LRXC 2J3TC 2EWWA 3KYZA 3LR0A 4L9FA 3ICYA 4EEUA 3UMDA 4Q0IA 3LI8A 3E0YA 3JVUA 3MXQA 3MR0A 4B9OA 3LIBA 3VE4A 3F1OA 2L1MA 4KQDA 3FPVA 2DMWA 2LB5A 3HJKA 3KSHA 4WLAA 1TS8A 2JKTM 1N9NA 4HP9A 3IS2B 4DJ2A 1IOUA 2P08A 4GCZA 2KDKA 3EOIA 2XRNA 3H7WB 4MCWA 2NUPC 3UB7A 4F3LB 4HHDA 4AFIA 4GHIB 1OJ5A 3T4LA 4I39A 2A2LA 2V0WA 5LBRA 1S4RA 3LFVA 3P7NA 4Q0HA 4G3KA 1T1AA 3ZYTA 3SW1A 4R70A 4IHQA 1NRJA 3UB8A 4HJ4A 2ZMVA 2XROA 2B02A 5AVFA 5HDDA 4LRYC 2JN7A 3KO6A 1XJ3A 2M7UA 3LICA 3E4OA 2VEAA 1V9YA 2J3TD 3CLOA 2JKRI 3KSIA 4LRZE 4WEKA 3BW6A 3PYPA 2MJ6A 5J7EA 2VJWA 1OTBA 2FZ0A 2WKQA 3BQAA 3GDIA 3DBAA 2VKSA 3C2WA 3EGXC 2I9VA 3KYQA 1OTDA 5IU1A 2D02A 5J4EA 4Y5FA 2QJ5A 2KX6A 1P9WA 1S1ZA 1OTAA 3E98A 5HSQA 1T19A 3EGDC 5TJJA 3F1NB 4JGRA 1TS0A 4WEJA 2GNXA 2J3WA 1EW0A 2OAQ1 4BJPA 4IUHA 3F1PB 1VB6A 2OOLA 4UQIM 2KOIA 4QPRA 2FH5A 2ZBBA 2PYPA 3VV4A 1MC0A 3A0SA 2ZOHA 4UEYA 3RH8B 3H82A 4ETZA 2L0WA 3S7NA 2GX5A 2OWJA 4CLCC 3TRCA 4EETB 5A8BA 3LR4A 2O99A 3S7OA 4KQOA 2VLGA 3B47A 4HY8A 2YKFA 2XA7M 3UMEA 5EFWA 4I3IA 4MN6A 2EWVA 2JKTI 2WKPA 4GS9B 3UB9A 1NLZA 4R38A 4DMZA 4CLCD 1ZTUA 5F69A 3F1OB 5CX7A 5DKKA 1G6OA 2P04A 4DJ3A 2Y79A 4PKYG 3T4JA 4YNRA 1T1CA 2K2NA 1S1YA 5HZHA 4WUJA 4JGOA 3BQ8A 2ZOIA 2P7JA 1V9ZA 3IS2A 3R4KA 3H82B 1TF1A 3E4QA 2VX8A 2M1CA 3OOVA 1XJ2A 1BYWA 3FPWA 4EQ1A 5DJTA 1S66L 2WKRA 3ULFA 4HJ6A 3MQOA 5HD3A 2CMNA 4EW7A 4CLCA 3OCLA 1OT6A 4HH3A 4PHTA 4GJ4A 4KUOA 4I38A 2OAP1 3IBJA 3D3OA 1Y28A 4K08A 4H6JB 4BWIA 2VGLM 1MZUA 3CUEC 1LL8A 1OTEA 1XFNA 5HWVA 3CAXA 2K7SA 3KSGA 3NOPC 4P6ZM 3P01A 4M4XA 2D01A 3S7PA 5G4ZA 3PXPA 5IS1A 3FC7A 5F6AA 3B42A 4EESA 4EXOA 3C8CA 1F98A 4PKYA 3EQVA 4LPZA 2W3EA 4ZRRA 4DN0A 4HOIA 3BJNA 3MQQA 4XT2B 4WN5A 3OBFA 5HDSA 4Q0JA 2K31A 2Z6CA 2VGLS 1N9OA 3KX0X 1YSQA 3R7WB 4I5SA 2J80A 3T4OA 2PT7A 2PDRA 3D72A 4NXGA 4IUKA 2NUTC 2QHKA 5G4YA 3PBRA 3HJIA 4L9EA 3VOLA 2W3HA 4F3LA 3ZQ5A 1D7EA 3LUQA 4B93A 4EU0A 1LT0A 4OOMA 1W63Q 5J3WA 4HNBA 3T4KA 4BMWA 4PAUA 1UGUA 3UB6A 3CWFA 4P6ZS 2HJ9C 1W63M 2W1TA 3NOUC 4HJ3A 1STZA 3B33A 3MF0A 3CI6A 4EEPA 1KOUA 5HPIA 1OJGA 3UE3A 5MC7A 4R3AA 4ARZA 3MFXA 1ZHHB 1T18A 3MJQA 3EQUA 1P0ZA 3OCNA 1DP6A 3PBQA 2ZMFA 1H8MA 4OOLA 2W0NA 5AJGA 3NOTC 4JGQA 1GSVA 2INWA 2B18A 1NWZA 2M7VA 4HP4A 3T4QA 3LIDA 3BWLA 5AVEA 3T50A 4FSFA 1YSPA 2QYBA 2W1TB 2R78A 4I3JA 4YWZA 4H6JA 1YAXA 4CQHA 3EWKA 1D06A 3HCYA 1XJ4A 2A24A 2O0YA 1P9RA 1T1BA 4MMNA 5DKLA 4CLCB 1ODVA 1OTIA 4Z1WA 4HI4A 2PYRA 3F1PA 4ME4A 2XA7S 1TS7A 4LLOB 4ETXA 4BBUA 3C30A 3EEHA 2V0UA 3TW8A 4WELA 2H28A 1F9IA 3MMHA 3E4PA 1LSWA 1XFQA 5IT5A 5DF9A 3UE6A 4Y3IA 3PBNA 3C38A 3H7WA 3TE8A 4L9GA 1UWNX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HDS A;  2HV1 A;  3K3C A;  4GS9 A;  4MN5 A;  3F1N B;  4JGR A;  1TS0 A;  5HWT A;  1DP8 A;  2OWH A;  4KUK A;  2VV6 A;  2Z6C A;  1EW0 A;  3GEC A;  1N9O A;  5HD5 A;  3KX0 X;  1X0O A;  1G28 A;  1TS6 A;  2A24 B;  2YKH A;  3F1P B;  1VB6 A;  2OOL A;  3A0V A;  3BY9 A;  4I5S A;  2J80 A;  4WN5 A;  4R6L A;  5TBM B;  2ZBB A;  2PR6 A;  2PYP A;  2PDR A;  1DRM A;  3D72 A;  4NXG A;  3A0S A;  2ZOH A;  5I5L A;  3RH8 B;  2PR5 A;  1GSX A;  3H82 A;  2L0W A;  1N9L A;  2QHK A;  1OT9 A;  3G6O A;  3NHQ A;  3BY8 A;  3HJI A;  4L9E A;  4LRX C;  5G4Y A;  5KIZ A;  2OWJ A;  4L9F A;  3VOL A;  4F3L A;  3ZQ5 A;  1D7E A;  3LUQ A;  1XJ6 A;  3ICY A;  5DJU A;  2QWS A;  2PD8 A;  1LT0 A;  3UMD A;  4E04 A;  4EEU A;  5J3W A;  3LI8 A;  4EET B;  5A8B A;  4EER A;  3MXQ A;  2VLG A;  3MR0 A;  4HNB A;  4HY8 A;  3LIB A;  4B9O A;  2YKF A;  3VE4 A;  1UGU A;  3F1O A;  3UB6 A;  3UME A;  3CWF A;  5EFW A;  3H9W A;  2L1M A;  4HQA A;  4I3I A;  4KQD A;  4MN6 A;  1S67 L;  2Z6D A;  3LYX A;  3NOU C;  4HJ3 A;  5HWW A;  4BBV A;  4I3A A;  2WKP A;  3HJK A;  3FG8 A;  4NXE A;  4WLA A;  1TS8 A;  3B33 A;  4GS9 B;  3UB9 A;  2JHE A;  4R38 A;  4EEP A;  1N9N A;  5F69 A;  1KOU A;  3F1O B;  1LSV A;  3IS2 B;  3MQQ A;  4GHI A;  4HP9 A;  1OJG A;  3IBR A;  5DKK A;  4DJ2 A;  4DJ3 A;  4GCZ A;  4NXB A;  4R3A A;  2KDK A;  4PKY G;  3MFX A;  1T1C A;  4RQ9 A;  1S4S A;  2QJ7 A;  1T18 A;  3MJQ A;  1GSW A;  1S1Y A;  1P0Z A;  3H7W B;  4XT2 A;  3UB7 A;  4F3L B;  2W27 A;  4WUJ A;  5HZH A;  4JGO A;  1DP6 A;  2ZOI A;  4HHD A;  4WF0 A;  2P7J A;  1V9Z A;  3IS2 A;  4GHI B;  1OJ5 A;  2W0N A;  3H82 B;  5F68 A;  1WA9 A;  3NOT C;  3E4Q A;  2V0W A;  4I39 A;  2M1C A;  4WL9 A;  1S4R A;  5F5Y A;  1XJ2 A;  4JGQ A;  1BYW A;  3P7N A;  1GSV A;  1T1A A;  2INW A;  4EQ1 A;  1P97 A;  1NWZ A;  5DJT A;  3SW1 A;  1S66 L;  2V9A A;  1DP9 A;  2WKR A;  3LIE A;  4HJ6 A;  4R70 A;  3MQO A;  4HP4 A;  5HD3 A;  3RTY A;  2BAS A;  3ULF A;  2QKP A;  3OLO A;  3UB8 A;  4HJ4 A;  2CMN A;  3PHY A;  4EW7 A;  2B02 A;  3LID A;  3BWL A;  5AVE A;  3VE3 A;  4HH2 A;  5AVF A;  3A0R A;  4LRY C;  1OT6 A;  3F1N A;  5HDD A;  3T50 A;  2JN7 A;  4HH3 A;  2R78 A;  4GW9 A;  4I3J A;  4YWZ A;  1XJ3 A;  4H6J A;  4KUO A;  4BBT A;  3EWK A;  4I38 A;  3LIC A;  1D06 A;  1Y28 A;  1XJ4 A;  2A24 A;  4K08 A;  4H6J B;  1T1B A;  2V1A A;  1MZU A;  3E4O A;  2VEA A;  1LL8 A;  1V9Y A;  1OTE A;  3CLO A;  5DKL A;  1XFN A;  2PD7 A;  5HWV A;  1ODV A;  2GJ3 A;  1OTI A;  2V1B A;  3CAX A;  4LRZ E;  4XT2 B;  4HI4 A;  2K7S A;  1LSX A;  2PYR A;  3F1P A;  3NOP C;  1TS7 A;  3PYP A;  4LLO B;  4M4X A;  5TBM A;  2PHY A;  2D01 A;  5G4Z A;  5J7E A;  1OTB A;  2WKQ A;  4HIA A;  2L4R A;  3GDI A;  4BBU A;  5IS1 A;  3C2W A;  1JNU A;  2V0U A;  3EEH A;  2I9V A;  3LIF A;  2H28 A;  3FC7 A;  2VV7 A;  1F9I A;  5F6A A;  3K3D A;  1OTD A;  5IU1 A;  3E4P A;  2D02 A;  1LSW A;  3LIA A;  4NXF A;  1XFQ A;  4EES A;  4EXO A;  1UWP X;  3C8C A;  3NJA A;  2QJ5 A;  5J4E A;  1F98 A;  3LI9 A;  2KX6 A;  4PKY A;  5HDC A;  3UE6 A;  4LPZ A;  2VV8 A;  4JGP A;  4HOI A;  2EA9 A;  1S1Z A;  3H7W A;  1OTA A;  5HSQ A;  4L9G A;  1T19 A;  1UWN X; 
#chains in the Genus database with same CATH topology
 2HV1 A;  2WZZ A;  2Y8H A;  3W2Z A;  4UQI S;  1YLT A;  2OWH A;  1FCM A;  5HD5 A;  4M3K A;  5L8M A;  4QD4 A;  2Q9M A;  4FOF A;  5TBM B;  4JBF A;  4JF6 A;  3HLE A;  2WGW A;  3ZCZ A;  3W4Q A;  1N9L A;  1OT9 A;  1Z6F A;  4MLL A;  4IBR A;  3GMW A;  3OPR A;  2PD8 A;  1E3U D;  3C4O A;  4KZ8 A;  3ZFZ A;  4GDN A;  2HP5 A;  1L0F A;  3IF6 C;  1I2S A;  4OLD A;  3IF5 A;  3IHB A;  4R23 A;  4FH2 A;  5HWW A;  2XF3 A;  4NKP A;  2QPN A;  4ZTK A;  2LB9 A;  3BEC A;  2H5S A;  1LSV A;  5GLB A;  5A91 A;  4Y17 A;  4NXB A;  2QMI A;  5HPF A;  1PI4 A;  2FFY A;  3V39 A;  3IWQ A;  4S2P A;  4IJG A;  4WL9 A;  4P6B A;  3S1Y A;  3NI9 A;  1RCJ A;  3LIE A;  1GCE A;  2ZC7 A;  3O5Y A;  3RTY A;  2W3G A;  4JKT A;  3PHY A;  1XGI A;  3MKF A;  3F1N A;  4GW9 A;  5FQK A;  3GQZ A;  1K54 C;  1PWG A;  3N6I A;  2ZQ9 A;  3P09 A;  3A3D A;  1BUL A;  2V1B A;  1MWS A;  1FSW A;  2G7U A;  1E4D A;  5TBM A;  2HZ5 A;  3AGE A;  5FA7 A;  5CXW A;  1JNU A;  4GN2 A;  4NXF A;  5F1G A;  2EX9 A;  3LI9 A;  3Q7V A;  1KVL A;  3UB5 P;  2J8Y A;  4GS9 A;  1ESU A;  1DJA A;  3T4S A;  1DP8 A;  4C75 A;  3MQ0 A;  1BUE A;  4BQM A;  3P98 A;  1KGE A;  5EVE A;  1DRM A;  1MKM A;  2JKR M;  4B4Z A;  2J3T C;  1XPB A;  3QP4 A;  1ES4 A;  3ICY A;  4EEU A;  4Y13 A;  1FR1 A;  1VEU A;  3E0Y A;  3MXQ A;  3MR0 A;  4IBX A;  3FZC A;  3LIB A;  5EPH A;  3SZT A;  4KQD A;  2Y4A A;  3BRM A;  1CI9 A;  1YPR A;  3JYI A;  2HPB A;  1HLU P;  3Q81 A;  4GCZ A;  4JXV A;  2KDK A;  3OZH A;  2HP6 A;  4MCW A;  3WS4 A;  1WYB A;  4GHI B;  1OJ5 A;  2PRF A;  5F83 A;  2A2L A;  2AVX A;  3LFV A;  4Q0H A;  1GHP A;  2ZD8 A;  1BZA A;  4IHQ A;  1NRJ A;  1SDN A;  4X1M A;  2R9W A;  2M7U A;  3LIC A;  5GLA A;  4ZDX A;  1YLW A;  4OP8 A;  4WZ5 C;  5J7E A;  2FZ0 A;  2HDR A;  3BQA A;  3JPU A;  1NYY A;  1PNE A;  4GB7 A;  2D02 A;  4OPR A;  3IXB A;  5J4E A;  4Y5F A;  3NUL A;  4WZ5 A;  1T19 A;  3EGD C;  4S2L A;  4JGR A;  2XFT A;  4IUH A;  1VB6 A;  3C4P A;  3MFD A;  4QPR A;  2FH5 A;  4N1X A;  2PYP A;  1L3L A;  1MC0 A;  3T1X A;  3SS5 A;  5L10 A;  2XK1 A;  3DW0 A;  4MBK A;  2OWJ A;  1HD8 A;  5A8B A;  1TDL A;  5BOH A;  2XA7 M;  3UME A;  4KZ3 A;  5FAO A;  2EWV A;  2Q9N A;  5EOE A;  1FCO A;  1BLH A;  4DMZ A;  5M19 A;  2DRW A;  5DKK A;  3AGF A;  3DTK A;  2Y79 A;  2ZMA A;  3T4J A;  2K2N A;  4X6T A;  5HL1 A;  5HZH A;  2JKF A;  3BQ8 A;  1V9Z A;  1JWP A;  2VX8 A;  1K6S A;  2JE5 A;  2BG1 A;  3ZG8 B;  5HD3 A;  4MNR A;  4S2I A;  4GJ4 A;  4U0T A;  1DJC A;  1Y28 A;  2VGL M;  1ZG6 A;  3UE1 A;  3UDI A;  2PBY A;  2K7S A;  3NOP C;  3P01 A;  2D01 A;  1MY8 A;  3ZNT A;  5A93 A;  4ID4 A;  4DKI A;  5KMW A;  3FC7 A;  4U0X A;  1H8Z A;  4UHU A;  5CTM A;  4CPK A;  3C8C A;  1F98 A;  1QME A;  4LPZ A;  2W3E A;  4HOI A;  4ZJ1 A;  5L2F A;  2C5W B;  3BJN A;  3G34 A;  3HLD A;  4WN5 A;  3BEB A;  3BM6 A;  3VOY A;  5L07 A;  2Z6C A;  3ZVW A;  3BFD A;  3HLG A;  4I5S A;  3SH9 A;  3Q07 A;  3T4O A;  2ZL1 A;  2PT7 A;  1KDW A;  1K0K A;  2OV5 A;  1VEU B;  1IEM A;  3PBR A;  4E3I A;  4XUX A;  1IYQ A;  3LUQ A;  4B93 A;  5TR7 A;  3VP0 A;  3T4K A;  3MXR A;  1E3U A;  4P6Z S;  4DDY A;  2Y2Q A;  3G2Y A;  4BEN A;  3NOU C;  2X01 A;  1STZ A;  4EEP A;  3HUM A;  3O3V A;  2P9V A;  1KOU A;  5HPI A;  2OSU A;  4R3A A;  1U60 A;  4ARZ A;  4OVD A;  1BT5 A;  1NY0 A;  1O07 A;  2Y2G A;  3EQU A;  4UA6 A;  5GHX A;  4F94 A;  3CMZ A;  4HBT A;  2E8I A;  2BLS A;  2J9O A;  3A3I A;  2B18 A;  2HDS A;  2XEP A;  3NY4 A;  2CC1 A;  4OP5 A;  2Y59 A;  1PIO A;  4KZA A;  5M1A A;  3LID A;  4X1L A;  2V1Z A;  2QYB A;  4OQI A;  3HCY A;  3IH9 A;  1P9R A;  5GL9 A;  2EFU A;  2WYX A;  1ODV A;  4Z1W A;  2PYR A;  2XA7 S;  1TS7 A;  2VGJ A;  5FQQ A;  4ETX A;  2X71 A;  1IEL A;  3L9K A;  4YFM A;  4OLG A;  1F9I A;  3MMH A;  3ZNY A;  5IT5 A;  2Y2K A;  1EWZ A;  1CEG A;  5CHU A;  3N7W A;  2HDQ A;  1YLP A;  4L9G A;  5HAR A;  3K3C A;  2XD5 A;  3V67 A;  1XA7 A;  3GEC A;  4OOY A;  1TEM A;  2YKH A;  4HBU A;  5I5L A;  4RX3 A;  5KIZ A;  2W3D A;  3WWX A;  3FKV A;  2HJE A;  5DJU A;  3C7V A;  3Q1F A;  3SH8 A;  5DVA A;  5AQB A;  4JXW A;  1ERQ A;  1K55 C;  2O9A A;  3K2N A;  4Z9Q A;  1E25 A;  3IF6 B;  4NXE A;  3FG8 A;  2HGV A;  4FH4 A;  2VZW A;  3WS5 A;  3IXH A;  3A3E A;  1K55 A;  4GHI A;  3R7W A;  2VGK A;  1KGF A;  3V50 A;  3S22 A;  1F2K A;  4JXS A;  4XT2 A;  3QP1 A;  2W27 A;  3G2Z A;  1VHM A;  5DFY A;  1OME A;  5HAQ A;  1P97 A;  2V9A A;  1DP9 A;  3CHW P;  1K38 A;  4IVI A;  3VE3 A;  4HH2 A;  3A0R A;  1LLB A;  4FCF A;  4BBT A;  1HTZ A;  3S7Q A;  3VP1 A;  3CG5 A;  2V1A A;  2DNS A;  1PZP A;  1YMX A;  2Y2O A;  4E6W A;  3NDG A;  2GJ3 A;  5FL3 A;  1LSX A;  5FDH A;  2WAE A;  3SH7 A;  4QY5 A;  4PPR A;  5JYO A;  1HVB A;  3LR5 A;  5HL6 A;  4HIA A;  3LIF A;  4WYY A;  5CGW A;  3K3D A;  2KLI A;  5CEB A;  1ALQ A;  3NJA A;  5M18 A;  3LY4 A;  3I7J A;  3DAV A;  1IFQ A;  5K5B A;  4YOF A;  4QU3 A;  2XLN A;  3U2A A;  3O87 A;  3IX3 A;  1L2S A;  5HWT A;  2VA0 A;  4KUK A;  1CJF A;  5EM1 A;  2A3U A;  3M2J A;  4Y2F A;  3BFE A;  3BY9 A;  5HX9 A;  4DE0 A;  4G3W A;  2PR6 A;  3ISG A;  3OC2 A;  2V20 A;  3PR6 A;  2GDN A;  3SS3 A;  4ARZ B;  4H8R A;  3T12 B;  2Y2I A;  3SS4 A;  1JWV A;  1YLJ A;  4B9O A;  3O86 A;  2EX2 A;  2RL3 A;  3FPV A;  4XUZ A;  2IWB A;  2UV0 E;  3A3J A;  3KSH A;  4WLA A;  1TS8 A;  3DWK A;  3IQA A;  4ZBE A;  2P08 A;  4UA9 A;  3UN7 A;  3EOI A;  5FEF A;  1W79 A;  3H7W B;  2NUP C;  1PFL A;  3UB7 A;  4AFI A;  2V2F F;  5DTT A;  3T4L A;  2V0W A;  1S4R A;  3N8R A;  3P7N A;  5F1F A;  3SW1 A;  3E2L A;  4R70 A;  2WKH A;  4LV1 A;  4GD8 A;  2ZMV A;  1J3W A;  4JPM A;  2XRO A;  5FQJ A;  1IYO A;  3TSG A;  5AQ7 A;  4X68 A;  4X69 A;  1V9Y A;  2J3T D;  3HUN A;  4NK3 A;  4Y0U A;  2JKR I;  3KSI A;  1Y4O A;  4DXC A;  2ZQD A;  3C5A A;  1K54 A;  3RJU A;  4BLM A;  2MJ6 A;  1M40 A;  1RGY A;  2ZJ9 A;  2VJW A;  1OTB A;  3NBL A;  5F82 A;  1H0M A;  2VKS A;  3EGX C;  1PWD A;  2Y2M A;  3ZG9 B;  1OTD A;  3IX8 A;  4OPZ A;  3W8K A;  3CPT A;  1S1Z A;  2ZLY A;  2ZL1 B;  5CGX A;  3F1N B;  4WEJ A;  2GNX A;  3TOI A;  2OAQ 1;  4UQI M;  3F1P B;  2OOL A;  4E6X A;  4E3L A;  1S6R A;  4PM9 A;  3A0S A;  2ZOH A;  1VET A;  5CRF A;  4WMC A;  4ETZ A;  2L0W A;  4JLF A;  1FR6 A;  2ZQC A;  4JF5 A;  3TRC A;  4EET B;  4KQO A;  3B47 A;  1WE4 A;  2P9V B;  4MN6 A;  2JKT I;  5I94 A;  2WKP A;  1NJ4 A;  4GS9 B;  3VP2 A;  1NLZ A;  1JVJ A;  4EBP A;  2ZC4 B;  1KE4 A;  5E2E A;  1ZTU A;  5F69 A;  1MWT A;  3F1O B;  2P04 A;  4DJ3 A;  3IHA A;  4PKY G;  5J8X A;  4WUJ A;  3FV7 A;  3IS2 A;  1LI0 A;  4KZ4 A;  2M1C A;  1EI5 A;  1RP5 A;  4EQ1 A;  3QP2 A;  3IWO A;  5DJT A;  1S66 L;  1XP4 A;  2JCH A;  3MQO A;  2CMN A;  5U47 A;  3UPP A;  1YM1 A;  4PHT A;  1G5U A;  4I38 A;  3IBJ A;  4H6J B;  4R0Q A;  1BLS A;  1MZU A;  3D4F A;  1LL8 A;  1OTE A;  4OH0 A;  1XFN A;  4LV2 A;  2ZM0 A;  3M6H A;  3RXW A;  5GHZ A;  3PAE A;  3PTE A;  2ZC3 B;  5CED A;  5KSC A;  3A3F A;  1KE0 A;  1ONG A;  4PKY A;  3EQV A;  4LEN A;  4R3J A;  5HDS A;  5TGF A;  4Q0J A;  4BD1 A;  1N9O A;  2XR0 A;  3U4L P;  2PDR A;  3IH8 A;  4IUK A;  3GRJ A;  4RX2 A;  2WGW B;  4N9L A;  3HRE A;  3QP5 A;  3HJI A;  1H5X A;  2W3H A;  1KGG A;  3ZQ5 A;  1D7E A;  2J9P A;  5J3W A;  3IXD A;  4HNB A;  1AXB A;  2JKG A;  1UGU A;  3UB6 A;  3N8S A;  3TG9 A;  1W63 M;  4S2N A;  2W1T A;  4P87 A;  3HVF A;  2ZC6 B;  5EE8 A;  2XDM A;  3CI6 A;  3NEC A;  4WM9 A;  1OJG A;  5FQI A;  5GHY A;  1AWI A;  2DCF A;  1ZHH B;  2PBD P;  3OCN A;  4OOL A;  1H8M A;  3S4X A;  3HLW A;  2WGI A;  2UWX A;  3N4I A;  1LL5 A;  2M7V A;  3ZG0 A;  4HP4 A;  4IVK A;  4PM7 A;  3SOI A;  3BWL A;  5AVE A;  4FSF A;  4YWZ A;  5CGS A;  1K56 A;  3MKE A;  2A24 A;  3VSK A;  1L0E A;  4DE1 A;  3NCK A;  2Y55 A;  5DKL A;  4CLC B;  1PWC A;  1OTI A;  3F1P A;  4ME4 A;  1YQS A;  4PM8 A;  3TW8 A;  2V0U A;  4WEL A;  2H28 A;  4UA7 A;  4C3Q A;  2OLV A;  3E4P A;  5DF9 A;  3C38 A;  2WKE A;  5FAT A;  3T4T A;  4MN5 A;  1NZU A;  4DXB A;  2ZM2 A;  4GLQ A;  1G28 A;  1ESI A;  1TS6 A;  5FEG A;  4RVA A;  2W1R A;  3OPP A;  4R6L A;  5E2F A;  2RCX A;  4D2O A;  1H3Q A;  1YKD A;  4IED A;  2J7V A;  2P74 A;  4G3V A;  4EER A;  4KZ9 A;  2GZA A;  1YLZ A;  4LV0 A;  1PZO A;  4HQA A;  3RFB A;  1S67 L;  4BBV A;  5HFO A;  1IKG A;  4MDZ A;  4GKU A;  3M2K A;  3LGO A;  3IBR A;  1S4S A;  2QJ7 A;  1GSW A;  1NXY A;  5HAI A;  3V3R A;  3OPH A;  1XA1 A;  5F68 A;  1WA9 A;  1PW8 A;  3FYZ A;  3NIA A;  3RXX A;  2V8C A;  4D60 A;  2JBF A;  1MKI A;  5EVL A;  3KSF A;  4LFU A;  4GNU A;  5KZH A;  2QKP A;  3GSG A;  2IWD A;  4QB8 A;  5DTK A;  4KZ7 A;  2G2U A;  1PW1 A;  3G31 A;  1MWU A;  4E3N A;  1NRF A;  1SDE A;  1YMS A;  3ZG5 A;  3EEA A;  3Q7Z A;  5C5K A;  3NC8 A;  2PHY A;  5EVI A;  1GHI A;  4B88 A;  1G68 A;  4GZB A;  3Q82 A;  2Q0O A;  3B3X A;  4OON A;  2L4R A;  1C3B A;  1FCN A;  4MBF A;  2ZQA A;  1F5M A;  3LIA A;  2VV8 A;  1XXM A;  4JGP A;  1K56 D;  3TJZ C;  2PU4 A;  2HF6 A;  4O0P A;  4R3B A;  2O9C A;  2JC7 A;  4L0L A;  2XD1 A;  4NEE D;  3CUE A;  3PBS A;  1QMF A;  4O8G A;  1TVF A;  2G2W A;  4LRX C;  2EWW A;  5FAP A;  3LR0 A;  4Y0T A;  1Y54 A;  3UMD A;  4Y15 A;  4S2M A;  2C6W B;  3F1O A;  3ZDJ A;  2L1M A;  4KG5 A;  4EBN A;  3QNB A;  2DMW A;  5IHV A;  1BLC A;  2LB5 A;  3HJK A;  2B5R A;  2XGN A;  5FQM A;  4HP9 A;  3IS2 B;  1O7E A;  3ITA A;  3G35 A;  3VFH A;  5CEC A;  1Z09 A;  3C7U A;  2B95 A;  1JTD A;  4P0M A;  4DDS A;  3N8L A;  4I39 A;  5LBR A;  1J9M A;  1L0D A;  3T1S A;  4PM6 A;  4Q8I A;  5D3O A;  2Y2P A;  3HUO A;  2B02 A;  5EVI C;  5AVF A;  5HDD A;  3IF6 A;  2JN7 A;  3KO6 A;  1XJ3 A;  4FD8 A;  2VEA A;  5L09 A;  2Y2J A;  4WEK A;  1K57 A;  4JXG A;  3LO7 A;  2Z2M B;  5GLC A;  4HES A;  2WKQ A;  3GDI A;  3DBA A;  3GVB A;  1KDS A;  2I9V A;  1SCW A;  3KYQ A;  5IU1 A;  1PI5 A;  2KX6 A;  4OQH A;  3UDX A;  1K57 C;  1P9W A;  1CI8 A;  1OTA A;  5FI6 A;  1TS0 A;  1Q2P A;  2KOI A;  2ZQ8 A;  1CF0 A;  3V3S A;  5EOO A;  3RH8 B;  3H82 A;  3S7N A;  4BD0 A;  3UE0 A;  1YLY A;  3LR4 A;  2Z2L B;  1ES3 A;  4EV4 A;  3QP8 A;  4I3I A;  4FTX A;  1FQG A;  4E3K A;  5FQ9 A;  4CLC D;  3G4P A;  5CX7 A;  1G6O A;  5FI7 A;  4P85 A;  4K0X A;  1ZG4 A;  1FSY A;  1S1Y A;  4ZJ3 A;  1XKZ A;  2HP9 A;  3R4K A;  4NET A;  3MZF A;  1TF1 A;  3E4Q A;  3OOV A;  1XJ2 A;  1LL9 A;  2WKR A;  3ULF A;  4B4X A;  3LEQ A;  1GA9 A;  4WBG A;  4EW7 A;  4CLC A;  3IX4 A;  5DF8 A;  4KUO A;  2OAP 1;  5E2H A;  4K08 A;  4BWI A;  3E2K A;  2Y2H A;  4KZ6 A;  1YT4 A;  3S7P A;  3ZGA B;  3GTC A;  3MXS A;  2WGV A;  5CER A;  1KVM A;  3W4P A;  2PU2 A;  4XT2 B;  4X56 A;  3OBF A;  3KX0 X;  1FIL A;  1NZO A;  2NUT C;  2QHK A;  2Y91 A;  1BLP A;  5G4Y A;  3VOL A;  5DF7 A;  4EU0 A;  1CQA A;  1W63 Q;  1IYS A;  4GOG A;  4WZ4 A;  4BMW A;  4EBL A;  4PAU A;  4E3O A;  3CWF A;  2HJ9 C;  5A90 A;  4NG2 A;  1W7F A;  5FAQ A;  4HJ3 A;  4ESP A;  5MC7 A;  4N92 A;  2H0Y A;  1T18 A;  2WUQ A;  3MJQ A;  5HW3 A;  1S0W A;  3PBQ A;  2WKI A;  3VMA A;  3NOT C;  2V8F A;  2QZ6 A;  1GSV A;  2INW A;  1W5D A;  3VFF A;  4A5R A;  2X02 A;  3WS1 A;  3DTI A;  3MZE A;  3T4Q A;  4X55 A;  2H0T A;  1YSP A;  2W1T B;  2R78 A;  4I3J A;  2I72 A;  1XJ4 A;  2O0Y A;  4KQR A;  5TFQ A;  3GR2 A;  1GHM A;  5GLD A;  4DE2 A;  4HI4 A;  2XFS A;  1SKO B;  4LCM A;  2ZQ7 A;  4LLO B;  3MSH A;  3C30 A;  4QHC A;  1HZO A;  3QNC A;  1LSW A;  1XFQ A;  4X53 A;  3UE6 A;  1LI9 A;  3PBN A;  3WRT A;  3H7W A;  4R38 A;  5EM0 A;  2XSS A;  2VV6 A;  4DE3 A;  2EX6 A;  3HLB A;  1NLY A;  3A0V A;  4S2K A;  4II7 A;  4K0W A;  4KZ5 A;  1PRQ A;  4OQ0 A;  2BTF P;  3VP3 A;  3G32 A;  2PR5 A;  1GSX A;  3NHQ A;  3G6O A;  3BY8 A;  1CEF A;  2EXA A;  1XJ6 A;  4E04 A;  2QWS A;  1K6R A;  5FAS A;  4BL3 A;  3KYE A;  1FOF A;  3FWL A;  2XH9 A;  3H9W A;  1OPX A;  2Z6D A;  3LYX A;  4EUV A;  4I3A A;  5G18 A;  3ZHH A;  2JHE A;  2WK0 A;  3JVV A;  2W3F A;  2WZX A;  5KSH A;  2IA2 A;  4CLC E;  4OPQ A;  3PBT A;  4RQ9 A;  3BFF A;  4LGW A;  4O7D A;  1BTL A;  3CPT B;  4WF0 A;  4JF4 A;  3ZG7 B;  4MN7 A;  3QP6 A;  5F5Y A;  4O01 A;  2EFX A;  4OPY A;  1TD5 A;  2E8J A;  4KQQ A;  2BAS A;  2WAD A;  3VOZ A;  3OLO A;  1A0K A;  3LR3 A;  4LV3 A;  3IXG A;  3DTE A;  3CIT A;  4PMA A;  3WS2 A;  2PD7 A;  1ZKJ A;  5CHM A;  4BL2 A;  2O9B A;  4XXR A;  4KG6 A;  1DJB A;  4YIN A;  3T1Q B;  3MZD A;  3BLS A;  4ZJ2 A;  2VV7 A;  4K91 A;  1UWP X;  4Y0O A;  3O88 A;  5HDC A;  3PBO A;  3VSL A;  2EA9 A;  2Y2L A;  3GV9 A;  1XGJ A;  4S2J A;  4EQI A;  1X0O A;  2A24 B;  2IWC A;  3HBR A;  5AQA A;  4FUW A;  5DFX A;  3HLF A;  4EWF A;  3WS0 A;  2WAF A;  4R4R A;  3KYZ A;  2HDU A;  4L9F A;  4Q0I A;  1ACF A;  5AQ9 A;  3LI8 A;  3JVU A;  4MEZ A;  3VE4 A;  3G30 A;  5DTS A;  5E2G A;  4U3T A;  4QWO A;  2JKT M;  1N9N A;  3CJM A;  4DJ2 A;  4E3J A;  1IOU A;  1BSG A;  3DTM A;  2XRN A;  4F3L B;  3M6B A;  4HHD A;  1IYP A;  4E3M A;  1H8Y A;  1JWZ A;  5HAP A;  3BFC A;  4G3K A;  1T1A A;  3ZYT A;  1N4O A;  4KZB A;  1L0G A;  3UB8 A;  5FSR A;  4HJ4 A;  5FDS A;  4LRY C;  4ZAM A;  1K4F A;  2ZC5 B;  4MBH A;  3E4O A;  3CLO A;  4UAA A;  4N9K A;  4LRZ E;  3LEZ A;  3BW6 A;  3PYP A;  3VP4 A;  5EVI D;  1D1J A;  2H10 A;  1VM1 A;  3C2W A;  3DWZ A;  1I2W A;  4S2N C;  2QJ5 A;  3CZD A;  4X25 A;  3E98 A;  5HSQ A;  5TJJ A;  2VK3 A;  2J3W A;  1EW0 A;  3W4O A;  4BJP A;  4GDB A;  1K4E A;  2ZBB A;  3UO9 A;  3ZVT A;  3VV4 A;  4UEY A;  1PYY A;  2GX5 A;  4CLC C;  2O99 A;  5E43 A;  3S7O A;  3BFG A;  3IWI A;  2VLG A;  4HY8 A;  2YKF A;  1NYM A;  5EFW A;  1TDG A;  3UB9 A;  4QJG A;  1W8Y A;  1JTG A;  4OQG A;  3NDE A;  4R4S A;  4YNR A;  1T1C A;  1RGZ A;  4JGO A;  2ZOI A;  4R1G A;  4RYE A;  2P7J A;  3H82 B;  1FIK A;  1CK3 A;  3V5M A;  3UPO A;  1BYW A;  1SHV A;  3FPW A;  1ZC2 A;  4HJ6 A;  3UDF A;  4S2O A;  3ITB A;  3OCL A;  1OT6 A;  3QHY A;  4HH3 A;  4WMC D;  1SKO A;  1IKI A;  3FKW A;  3D3O A;  1WYC A;  3CUE C;  4HEF A;  5HWV A;  4Y7P A;  3CAX A;  1MPL A;  1DY6 A;  1ERM A;  3KSG A;  4P6Z M;  2EXB A;  4M4X A;  3OPL A;  5G4Z A;  3PXP A;  5IS1 A;  3HL9 A;  1MXO A;  1K25 A;  5F6A A;  3B42 A;  4EES A;  4EXO A;  3UPN A;  5A92 A;  2OLU A;  4ZRR A;  4DN0 A;  3MQQ A;  3UY6 A;  1KE3 A;  4RA7 A;  4CJN A;  2K31 A;  3Q7V B;  2VGL S;  2XQZ A;  1XX2 A;  1YSQ A;  3PAG A;  3R7W B;  2J80 A;  3HLC A;  5JYP A;  3MBZ A;  3WRZ A;  3D72 A;  4GD6 A;  4NXG A;  4L9E A;  5EEC A;  4F3L A;  3IT9 A;  1LT0 A;  4OOM A;  2ACG A;  3D9Y A;  4DF6 A;  3BYD A;  5EV0 A;  1MWR A;  3LCE A;  2ZM8 A;  5FI2 A;  4KG2 A;  3B33 A;  3MF0 A;  4N1H A;  2A49 A;  3AGD A;  1VQQ A;  3UE3 A;  3UNW A;  3MFX A;  3L7H A;  1P0Z A;  1LHY A;  4C6Y A;  1ONH A;  4LCL A;  1DP6 A;  2ZMF A;  1SKF A;  5CTN A;  2W0N A;  5AJG A;  4JGQ A;  1NWZ A;  2Y2N A;  3BLM A;  1N9B A;  1VET B;  4DRT A;  1Q2Q A;  3MS6 A;  3T50 A;  1MBL A;  1ES2 A;  2FFF B;  4H6J A;  1YAX A;  4CQH A;  3EWK A;  2PAV P;  1D06 A;  1T1B A;  1I5Q A;  4MMN A;  1ES5 A;  3T1R A;  1SZV A;  4KEN B;  3LY3 A;  5EUA A;  1G6A A;  5EVI B;  4BBU A;  3EEH A;  4QY6 A;  2R9X A;  2EX8 A;  4PM5 A;  5CHJ A;  4OKP A;  4Y3I A;  1GA0 A;  4EUZ A;  1ERO A;  1W8Q A;  3TE8 A;  1M6K A;  1UWN X; 
#chains in the Genus database with same CATH homology
 3T4T A;  2HV1 A;  2Y8H A;  2XSS A;  3K3C A;  4MN5 A;  3W2Z A;  4UQI S;  3V67 A;  2OWH A;  2VV6 A;  3GEC A;  5HD5 A;  4GLQ A;  1G28 A;  1TS6 A;  2YKH A;  5L8M A;  1NLY A;  3A0V A;  4FOF A;  5TBM B;  2W1R A;  4R6L A;  4II7 A;  5I5L A;  2PR5 A;  1GSX A;  3NHQ A;  1N9L A;  1H3Q A;  1OT9 A;  3G6O A;  5KIZ A;  3BY8 A;  2W3D A;  1YKD A;  2HJE A;  1XJ6 A;  5DJU A;  4E04 A;  2QWS A;  2PD8 A;  4G3V A;  4EER A;  2GZA A;  2O9A A;  3H9W A;  3K2N A;  4HQA A;  3RFB A;  1OPX A;  1S67 L;  2Z6D A;  3LYX A;  4EUV A;  5HWW A;  4BBV A;  4I3A A;  4NXE A;  4NKP A;  3FG8 A;  2HGV A;  2VZW A;  2JHE A;  4MDZ A;  2LB9 A;  3JVV A;  2W3F A;  5KSH A;  1LSV A;  4GHI A;  3IBR A;  2IA2 A;  3R7W A;  4NXB A;  4CLC E;  5HPF A;  3PBT A;  4RQ9 A;  1S4S A;  2QJ7 A;  1GSW A;  4XT2 A;  2W27 A;  4WF0 A;  5F68 A;  1WA9 A;  4IJG A;  4MN7 A;  1VHM A;  4WL9 A;  5DFY A;  5F5Y A;  4O01 A;  1P97 A;  3KSF A;  1TD5 A;  2V9A A;  1DP9 A;  3LIE A;  3O5Y A;  3RTY A;  2W3G A;  2BAS A;  2QKP A;  3OLO A;  3PHY A;  3VE3 A;  4HH2 A;  3A0R A;  3LR3 A;  3F1N A;  4BBT A;  4GW9 A;  3S7Q A;  3CIT A;  2V1A A;  2PD7 A;  2GJ3 A;  2V1B A;  2G7U A;  3EEA A;  5FL3 A;  1LSX A;  5C5K A;  2O9B A;  5TBM A;  2PHY A;  3LR5 A;  5HL6 A;  4HIA A;  2L4R A;  1JNU A;  3LIF A;  2VV7 A;  1F5M A;  3K3D A;  2KLI A;  4NXF A;  3LIA A;  1UWP X;  3NJA A;  5HDC A;  3LI9 A;  3PBO A;  2VV8 A;  1IFQ A;  5K5B A;  4JGP A;  4YOF A;  2EA9 A;  3TJZ C;  3U2A A;  4GS9 A;  2HF6 A;  4O0P A;  3T4S A;  2O9C A;  1DP8 A;  2VA0 A;  3MQ0 A;  5HWT A;  4KUK A;  4NEE D;  4L0L A;  1X0O A;  2A24 B;  3CUE A;  3PBS A;  4Y2F A;  3BY9 A;  4O8G A;  4G3W A;  2PR6 A;  1DRM A;  5DFX A;  1MKM A;  3OC2 A;  3PR6 A;  2JKR M;  4ARZ B;  4LRX C;  2J3T C;  2EWW A;  3KYZ A;  3LR0 A;  4L9F A;  3ICY A;  4EEU A;  3UMD A;  4Q0I A;  3LI8 A;  3E0Y A;  3JVU A;  3MXQ A;  3MR0 A;  4B9O A;  3LIB A;  3VE4 A;  3F1O A;  2L1M A;  4KQD A;  3FPV A;  2DMW A;  2LB5 A;  3HJK A;  3KSH A;  4WLA A;  1TS8 A;  2JKT M;  1N9N A;  4HP9 A;  3IS2 B;  4DJ2 A;  1IOU A;  2P08 A;  4GCZ A;  2KDK A;  3EOI A;  2XRN A;  3H7W B;  4MCW A;  2NUP C;  3UB7 A;  4F3L B;  4HHD A;  4AFI A;  4GHI B;  1OJ5 A;  3T4L A;  4I39 A;  2A2L A;  2V0W A;  5LBR A;  1S4R A;  3LFV A;  3P7N A;  4Q0H A;  4G3K A;  1T1A A;  3ZYT A;  3SW1 A;  4R70 A;  4IHQ A;  1NRJ A;  3UB8 A;  4HJ4 A;  2ZMV A;  2XRO A;  2B02 A;  5AVF A;  5HDD A;  4LRY C;  2JN7 A;  3KO6 A;  1XJ3 A;  2M7U A;  3LIC A;  3E4O A;  2VEA A;  1V9Y A;  2J3T D;  3CLO A;  2JKR I;  3KSI A;  4LRZ E;  4WEK A;  3BW6 A;  3PYP A;  2MJ6 A;  5J7E A;  2VJW A;  1OTB A;  2FZ0 A;  2WKQ A;  3BQA A;  3GDI A;  3DBA A;  2VKS A;  3C2W A;  3EGX C;  2I9V A;  3KYQ A;  1OTD A;  5IU1 A;  2D02 A;  5J4E A;  4Y5F A;  2QJ5 A;  2KX6 A;  1P9W A;  1S1Z A;  1OTA A;  3E98 A;  5HSQ A;  1T19 A;  3EGD C;  5TJJ A;  3F1N B;  4JGR A;  1TS0 A;  4WEJ A;  2GNX A;  2J3W A;  1EW0 A;  2OAQ 1;  4BJP A;  4IUH A;  3F1P B;  1VB6 A;  2OOL A;  4UQI M;  2KOI A;  4QPR A;  2FH5 A;  2ZBB A;  2PYP A;  3VV4 A;  1MC0 A;  3A0S A;  2ZOH A;  4UEY A;  3RH8 B;  3H82 A;  4ETZ A;  2L0W A;  3S7N A;  2GX5 A;  2OWJ A;  4CLC C;  3TRC A;  4EET B;  5A8B A;  3LR4 A;  2O99 A;  3S7O A;  4KQO A;  2VLG A;  3B47 A;  4HY8 A;  2YKF A;  2XA7 M;  3UME A;  5EFW A;  4I3I A;  4MN6 A;  2EWV A;  2JKT I;  2WKP A;  4GS9 B;  3UB9 A;  1NLZ A;  4R38 A;  4DMZ A;  4CLC D;  1ZTU A;  5F69 A;  3F1O B;  5CX7 A;  5DKK A;  1G6O A;  2P04 A;  4DJ3 A;  2Y79 A;  4PKY G;  3T4J A;  4YNR A;  1T1C A;  2K2N A;  1S1Y A;  5HZH A;  4WUJ A;  4JGO A;  3BQ8 A;  2ZOI A;  2P7J A;  1V9Z A;  3IS2 A;  3R4K A;  3H82 B;  1TF1 A;  3E4Q A;  2VX8 A;  2M1C A;  3OOV A;  1XJ2 A;  1BYW A;  3FPW A;  4EQ1 A;  5DJT A;  1S66 L;  2WKR A;  3ULF A;  4HJ6 A;  3MQO A;  5HD3 A;  2CMN A;  4EW7 A;  4CLC A;  3OCL A;  1OT6 A;  4HH3 A;  4PHT A;  4GJ4 A;  4KUO A;  4I38 A;  2OAP 1;  3IBJ A;  3D3O A;  1Y28 A;  4K08 A;  4H6J B;  4BWI A;  2VGL M;  1MZU A;  3CUE C;  1LL8 A;  1OTE A;  1XFN A;  5HWV A;  3CAX A;  2K7S A;  3KSG A;  3NOP C;  4P6Z M;  3P01 A;  4M4X A;  2D01 A;  3S7P A;  5G4Z A;  3PXP A;  5IS1 A;  3FC7 A;  5F6A A;  3B42 A;  4EES A;  4EXO A;  3C8C A;  1F98 A;  4PKY A;  3EQV A;  4LPZ A;  2W3E A;  4ZRR A;  4DN0 A;  4HOI A;  3BJN A;  3MQQ A;  4XT2 B;  4WN5 A;  3OBF A;  5HDS A;  4Q0J A;  2K31 A;  2Z6C A;  2VGL S;  1N9O A;  3KX0 X;  1YSQ A;  3R7W B;  4I5S A;  2J80 A;  3T4O A;  2PT7 A;  2PDR A;  3D72 A;  4NXG A;  4IUK A;  2NUT C;  2QHK A;  5G4Y A;  3PBR A;  3HJI A;  4L9E A;  3VOL A;  2W3H A;  4F3L A;  3ZQ5 A;  1D7E A;  3LUQ A;  4B93 A;  4EU0 A;  1LT0 A;  4OOM A;  1W63 Q;  5J3W A;  4HNB A;  3T4K A;  4BMW A;  4PAU A;  1UGU A;  3UB6 A;  3CWF A;  4P6Z S;  2HJ9 C;  1W63 M;  2W1T A;  3NOU C;  4HJ3 A;  1STZ A;  3B33 A;  3MF0 A;  3CI6 A;  4EEP A;  1KOU A;  5HPI A;  1OJG A;  3UE3 A;  5MC7 A;  4R3A A;  4ARZ A;  3MFX A;  1ZHH B;  1T18 A;  3MJQ A;  3EQU A;  1P0Z A;  3OCN A;  1DP6 A;  3PBQ A;  2ZMF A;  1H8M A;  4OOL A;  2W0N A;  5AJG A;  3NOT C;  4JGQ A;  1GSV A;  2INW A;  2B18 A;  1NWZ A;  2M7V A;  4HP4 A;  3T4Q A;  3LID A;  3BWL A;  5AVE A;  3T50 A;  4FSF A;  1YSP A;  2QYB A;  2W1T B;  2R78 A;  4I3J A;  4YWZ A;  4H6J A;  1YAX A;  4CQH A;  3EWK A;  1D06 A;  3HCY A;  1XJ4 A;  2A24 A;  2O0Y A;  1P9R A;  1T1B A;  4MMN A;  5DKL A;  4CLC B;  1ODV A;  1OTI A;  4Z1W A;  4HI4 A;  2PYR A;  3F1P A;  4ME4 A;  2XA7 S;  1TS7 A;  4LLO B;  4ETX A;  4BBU A;  3C30 A;  3EEH A;  2V0U A;  3TW8 A;  4WEL A;  2H28 A;  1F9I A;  3MMH A;  3E4P A;  1LSW A;  1XFQ A;  5IT5 A;  5DF9 A;  3UE6 A;  4Y3I A;  3PBN A;  3C38 A;  3H7W A;  3TE8 A;  4L9G A;  1UWN X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...