3VOLA

X-ray crystal structure of pas-hamp aer2 in the cn-bound form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
GSHMARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANERLGSAVQWTDRTEEHRAEQEVSQLVQAAAAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for oxygen sensing and signal transduction of the heme-based sensor protein Aer2 from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
molecule keywords Aerotaxis transducer Aer2
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3volA00
1S67L 4B9OA 2VV7A 3B33A 4H6JB 3VE3A 4RQ9A 1OTEA 1LSWA 4NXEA 1N9NA 2PD8A 4HQAA 3F1OA 1V9YA 4JGRA 5F68A 1GSVA 4HY8A 3FC7A 4HHDA 5F6AA 4HP4A 2W27A 2V1AA 4PKYA 2H28A 1Y28A 4GHIA 1XJ6A 4LPZA 4WN5A 3BY9A 3D72A 2WKPA 2VLGA 4EESA 5F5YA 5I5LA 2P7JA 4E04A 1DP8A 1XJ2A 2JHEA 2V9AA 4WLAA 1OTDA 2OOLA 1F9IA 1N9OA 5HWVA 1N9LA 1T19A 2A24A 2VEAA 5IS1A 3HJIA 1WA9A 2D02A 1OTIA 1XJ3A 3H82A 3HJKA 3NJAA 2L1MA 1JNUA 3PHYA 4HP9A 1S1YA 2INWA 2QJ5A 3MR0A 4R38A 3RH8B 3UMEA 4DJ2A 4HIAA 3A0SA 3VOLA 4H6JA 4BBUA 1UWPX 2PR5A 2YKFA 3NOPC 3E4PA 1T18A 3RTYA 3BY8A 3NOTC 2VV8A 4GS9B 4HJ6A 4MN5A 1S66L 4WF0A 5DKKA 2QHKA 4JGPA 1F98A 4HOIA 1OJ5A 5F69A 1TS0A 1S1ZA 4HJ3A 4XT2B 4F3LB 3CAXA 3LYXA 1D7EA 1LSVA 2I9VA 1P97A 1VB6A 4HNBA 1P0ZA 2Z6CA 2M1CA 3LIAA 2D01A 4KUOA 4EW7A 1ODVA 5J4EA 1KOUA 3P7NA 3T50A 4EQ1A 2V1BA 4EEUA 3CWFA 2PR6A 3IS2A 4L9FA 3ULFA 2L4RA 4GCZA 3UB7A 4PKYG 5AVFA 5A8BA 2QKPA 3E4OA 4LRXC 4R70A 1XFNA 4I3IA 2CMNA 3MQOA 3SW1A 1D06A 2PHYA 5DJTA 1G28A 2BASA 3IBRA 3K3CA 3LIDA 3UMDA 1LSXA 2WKQA 2PD7A 3KX0X 2GJ3A 2B02A 4GS9A 4HH3A 1NWZA 1OT9A 3G6OA 1BYWA 5HD3A 4M4XA 2EA9A 5HDDA 3EWKA 4NXFA 3GECA 4EXOA 2JN7A 3OLOA 4JGOA 3LICA 1X0OA 1TS6A 2ZOIA 3IS2B 3MQQA 4HJ4A 4I3AA 5EFWA 1OJGA 5HWTA 3H9WA 4HH2A 3UB6A 5HD5A 1T1AA 2PYRA 4I5SA 5HZHA 5DJUA 1OTBA 4EERA 3LIFA 4EEPA 1T1CA 3F1PB 1T1BA 3NHQA 2KDKA 1GSXA 4WL9A 5J7EA 3MJQA 1UWNX 5G4ZA 3C8CA 1GSWA 1XJ4A 4XT2A 5DKLA 3UB8A 4F3LA 5J3WA 5HWWA 2PYPA 2V0WA 2VV6A 4LRZE 4GW9A 3FG8A 4I39A 4NXBA 3LIBA 1LT0A 3ICYA 3PYPA 1OTAA 1UGUA 1DP9A 3LI9A 4K08A 4L9GA 5AVEA 3LIEA 3A0VA 1MZUA 4KUKA 2Z6DA 4MN6A 4WUJA 2L0WA 2W0NA 4LLOB 4JGQA 3F1OB 2K7SA 3C2WA 4L9EA 3VE4A 3H82B 3ZQ5A 4HI4A 3F1NA 3H7WA 5G4YA 3UB9A 2OWJA 4DJ3A 5KIZA 2YKHA 1OT6A 3A0RA 4I3JA 1EW0A 2ZOHA 2A24B 2PDRA 3EEHA 3GDIA 2OWHA 3F1PA 5TBMB 1DRMA 3MFXA 1S4SA 4KQDA 4BBVA 4BBTA 1XFQA 2KX6A 1TS8A 2ZBBA 3LI8A 4R6LA 1LL8A 5HDSA 3UE6A 5HSQA 4R3AA 3LUQA 2R78A 4GHIB 3K3DA 4YWZA 3E4QA 3CLOA 1V9ZA 4NXGA 5HDCA 5IU1A 2WKRA 4EETB 2J80A 3MXQA 5TBMA 3BWLA 4I38A 4LRYC 2HV1A 1TS7A 2QWSA 2V0UA 1S4RA 2QJ7A 3F1NB 3H7WB 3NOUC 1DP6A
chains in the Genus database with same CATH superfamily
3N8LA 2VGJA 4BMWA 2HF6A 1FR1A 1NYYA 5CXWA 1W8YA 3L9KA 1FILA 4WN5A 2J3TC 1MPLA 1OTDA 5FSRA 5E2HA 1AWIA 5FL3A 3G2YA 1EI5A 2YKFA 2Z2LB 2ZL1A 1T18A 2WGWA 3MZDA 4LENA 2VJWA 5GHYA 4G3WA 3PR6A 3G31A 2J8YA 1KGGA 5EM0A 1EWZA 1XX2A 4IHQA 3NULA 3OCLA 1LI0A 2ZL1B 4WEJA 3GMWA 1H3QA 2C6WB 2P9VA 2PD7A 2B02A 1ZC2A 4WZ5C 4P87A 2ZM0A 5FQIA 2XSSA 3I7JA 4KG5A 4HEFA 4G3VA 4N9KA 2O9AA 3BQAA 4OPRA 4QHCA 3VP2A 4X1MA 4N9LA 4D60A 1LT0A 1F5MA 3LIEA 5FQMA 1KGFA 3QP6A 4LLOB 1IKIA 4KQRA 3LR4A 5GLDA 2NUPC 2YKHA 3HVFA 1S4SA 1J3WA 2EFXA 2J7VA 3HCYA 5CECA 5FEGA 1K56A 2Y2GA 2J80A 5TBMA 4GDBA 1DP6A 3HL9A 3R4KA 5AQAA 4D2OA 4RA7A 2JE5A 4P6ZM 2V1AA 3NECA 1LHYA 1YMXA 2JHEA 4UHUA 4ETZA 2V1ZA 3HJIA 3KYQA 3OZHA 4R38A 1PFLA 2J3TD 1TF1A 1ERMA 4KZ7A 5KZHA 2P9VB 1F98A 1OJ5A 4LCMA 4F3LB 2ZQCA 1XA1A 4C3QA 1JTGA 1NY0A 1XGIA 4U3TA 2HP5A 3K3CA 2XA7S 3IBRA 2XR0A 3UMDA 1NWZA 3L7HA 2VGLS 3QNBA 4ARZB 5HL1A 5IHVA 5HDDA 2PBDP 2WAFA 4BD1A 3OBFA 3HLWA 3VP4A 4WEKA 3VP1A 5HAPA 2WUQA 2KDKA 4ZJ1A 5G4ZA 3GVBA 3VOZA 4WL9A 2HGVA 5F1GA 5FI6A 4M3KA 1DJAA 2Z6DA 1ESUA 3K2NA 3C2WA 4KZ8A 3RJUA 3MFDA 4DJ3A 1IOUA 3FZCA 4R3BA 4RVAA 3ZG8B 3HLFA 3BLMA 2JKTM 2ZBBA 4HESA 5L8MA 4L0LA 1LL9A 2EXBA 1PWDA 2JKTI 2AVXA 1YSQA 4PKYG 1KGEA 1TS7A 3O86A 2VV7A 1K54C 2ZM2A 4ZDXA 4BLMA 5FEFA 4O7DA 5FDHA 2O9CA 3D72A 2WKPA 4BL3A 1ZHHB 1MWUA 3VFHA 1JNUA 1S1YA 2XF3A 3LR3A 1O7EA 3NY4A 3IX3A 4O01A 3A3FA 2VV8A 3FPWA 3TJZC 2Y2KA 2P74A 2ZQ9A 1VETB 1W5DA 3AGFA 1VB6A 1P0ZA 1P9RA 4P0MA 5FI2A 1ES5A 4EQ1A 3ZGAB 1W63M 1I2WA 5EOOA 1H0MA 1ZKJA 1VQQA 3UDFA 3TG9A 1YKDA 2Q9MA 1YLJA 1NRFA 4OPQA 2B18A 4M4XA 1CQAA 5EUAA 1EROA 4JGOA 3O5YA 5EFWA 4JBFA 5DJUA 1T1CA 3GQZA 3UPOA 2ZC3B 5FA7A 2PYPA 1UGUA 2O99A 4OPYA 4YNRA 3W4QA 4KZ6A 2LB5A 2HDRA 3UY6A 3IWOA 1NRJA 3T1QB 4DDYA 3NI9A 4O0PA 5HL6A 2HJEA 3E98A 2Y2HA 1A0KA 1ONGA 2NUTC 3GTCA 4BD0A 2R9WA 4UAAA 1W63Q 4Y0UA 3UNWA 2VGLM 3SH9A 3N4IA 5GLBA 1HVBA 3HLGA 2VLGA 2B95A 2A3UA 3V67A 2VK3A 1FSWA 2X71A 1XJ3A 3M2KA 4UA7A 3BM6A 3UDIA 2QJ5A 4DJ2A 3VOLA 5CEDA 2PR5A 4X1LA 5D3OA 4HJ6A 3UN7A 3UDXA 5F69A 5DTTA 3UO9A 4E6XA 3LYXA 1P97A 2OAQ1 2V2FF 2Z6CA 1L0DA 3D9YA 3P7NA 1TVFA 4RX3A 4EEUA 3UB7A 4Z1WA 4R70A 3P98A 3SW1A 4OP5A 2WK0A 1ES2A 4S2IA 4B93A 4DXCA 4K91A 3C7UA 3Q07A 3EWKA 4EU0A 4U0XA 4HBTA 3IS2B 4EERA 4HH2A 2PYRA 1L3LA 2GZAA 1AXBA 4DE1A 4B4ZA 5EVID 1K25A 1DP9A 3C30A 4WUJA 2W0NA 3EGDC 3RXWA 5CHJA 1EW0A 2Y2LA 2ZOHA 5JYOA 2MJ6A 1FSYA 3F1PA 1YSPA 3ITAA 4WYYA 3GRJA 1W8QA 2J3WA 4R3AA 2DMWA 2R78A 4NEED 5FAOA 1NYMA 4JXVA 4E3KA 5EVEA 3DTEA 5KSCA 2W3FA 1N9NA 3F1OA 3B3XA 4HY8A 5F6AA 1E25A 1XXMA 2ZC4B 3BY9A 1XJ2A 1F9IA 1FOFA 1N9OA 5HWVA 2A24A 5IS1A 5HPFA 4GLQA 5HX9A 3GV9A 4HIAA 5FAQA 4Y13A 2P04A 1JWPA 4JGPA 2CC1A 4OP8A 1CK3A 1ODVA 1MKIA 1KOUA 3IS2A 1CEGA 4EWFA 2EWVA 1N9BA 4PM5A 1D06A 2WKQA 3CUEC 4S2MA 1SCWA 2XLNA 3EQVA 3GR2A 2QYBA 3QP1A 2K2NA 4EXOA 4R4SA 3DTMA 3H9WA 1T1AA 2W1TB 3W2ZA 1W7FA 3CMZA 4EEPA 1PZPA 4N1HA 1CI8A 4CJNA 2W1RA 1YLZA 3LIBA 1CEFA 4L9GA 2Y59A 3JVVA 1DY6A 2I72A 5FQJA 5GLAA 3ZG7B 3T4SA 4PM8A 4PM7A 3IBJA 1ZG6A 3Q81A 2OWJA 5M1AA 4IVIA 4IVKA 3BLSA 4YWZA 1N4OA 4EUZA 3BRMA 2XEPA 1ERQA 4MDZA 5FASA 4HBUA 4GZBA 3T4QA 1FCOA 1K38A 3OPLA 1JWVA 4HP4A 1YMSA 3N7WA 4QPRA 4GD6A 3BFDA 4YFMA 4Y5FA 4JXGA 2JCHA 3CPTA 1YLPA 2OV5A 2PU4A 4KZ5A 2JC7A 4H6JA 5EOEA 4S2NC 1UWPX 1RGYA 3QP2A 3BY8A 1S66L 2QHKA 4QWOA 3V39A 5CGXA 2VA0A 1S0WA 3IHAA 1L2SA 3IF5A 3FV7A 2PHYA 2WYXA 2G2UA 4EV4A 3WWXA 1E3UA 3VP3A 4QY6A 5CGWA 1FQGA 1MXOA 2ZOIA 3MQQA 1OJGA 3UB6A 3P01A 3BJNA 3HREA 3OC2A 2W3DA 4XT2A 2DNSA 2G7UA 2L0WA 4WZ5A 4KZ4A 1GA9A 2WKEA 3SOIA 5CERA 1OT6A 3C7VA 4X69A 2X02A 4GNUA 5CX7A 3DAVA 5CEBA 1Q2QA 1ACFA 3LUQA 2HP9A 4NXGA 5F83A 5HDCA 4S2NA 3MXQA 2HV1A 2QWSA 2QZ6A 3M2JA 3ZDJA 4DMZA 3CPTB 4JGRA 1PW8A 4EBLA 4PKYA 1YT4A 4EBPA 3DWKA 1MWTA 1YQSA 5EPHA 4FH2A 2EX6A 3MBZA 1FCMA 2QPNA 2ZJ9A 2A49A 2VEAA 2LB9A 2V20A 4IBXA 4ESPA 1WA9A 2D02A 2L1MA 3PHYA 4GD8A 3WS2A 1BTLA 1PYYA 2WKIA 2Y2IA 4MMNA 5DKKA 1VHMA 1HLUP 3IXGA 3HLDA 3Q7VA 2OAP1 3SS3A 2VKSA 3SS4A 4FOFA 4UA6A 2Q0OA 3HLCA 4KZ3A 4NG2A 1XFNA 4JXWA 3FKVA 3KX0X 2M7UA 2ZD8A 4Q0HA 1F2KA 2Q9NA 5HD3A 4PHTA 3OLOA 3LICA 4MCWA 5HZHA 4DRTA 5AQ7A 1T1BA 2VZWA 3MXRA 3UB8A 3MKFA 2H10A 1YLWA 5IT5A 1G5UA 3CUEA 3PBTA 1MZUA 4FUWA 4MN6A 3GSGA 5CRFA 4KENB 5DTSA 4CLCC 3UB9A 3F1NA 2PBYA 3ZFZA 4PPRA 5CHMA 2PDRA 3T12B 3EEHA 4C6YA 4BBVA 2GNXA 4LFUA 3OCNA 2RCXA 3CLOA 4DE3A 4CLCA 2GX5A 3F1NB 4B9OA 1Q2PA 3IXHA 1WYCA 3IHBA 3MXSA 1V9YA 2Z2MB 1DP8A 3MSHA 5L2FA 4OQ0A 2XFSA 4WM9A 1N9LA 5MC7A 4UA9A 1C3BA 5F82A 2IWCA 3S4XA 3MR0A 4AFIA 2XRNA 3A0SA 3TSGA 1FCNA 3MKEA 5E2FA 1NLYA 4HJ3A 3S22A 3M6HA 2D01A 1SKFA 2V1BA 1MKMA 1JWZA 3PBOA 3FPVA 1BLCA 1IEMA 2ZQ8A 3MQOA 3Q7VB 1SZVA 1DJBA 2Y2MA 3LIDA 2HDSA 2JKRI 3T4JA 2Y2JA 2BLSA 2XROA 3ZG9B 4DF6A 4U0TA 1OTBA 2PT7A 3LIFA 1ES3A 4NK3A 2K31A 4MNRA 1GSWA 2V0WA 1ZG4A 4LRZE 4MBKA 3QP5A 1OTAA 4OKPA 2VX8A 2OLUA 2FFFB 3G34A 3AGEA 4X56A 2XGNA 4BJPA 1L0FA 4WMCD 3PTEA 4I3JA 4WBGA 4KQDA 1DRMA 3MFXA 3IF6C 3RFBA 3LI8A 5DF7A 4KZBA 3OPPA 5HDSA 2E8JA 3K3DA 4KQOA 1WE4A 3EGXC 4EETB 4I38A 1H8YA 1OTEA 1XPBA 4ZBEA 4IBRA 3CZDA 3BEBA 3FC7A 3LEZA 3V3SA 1Y28A 5CTMA 1CJFA 3IWQA 1K4FA 2EX8A 3KSIA 5F5YA 3S7QA 3SH7A 4E04A 4WLAA 3C4OA 3DTKA 1MBLA 4G3KA 5EECA 4E3JA 5E2EA 4OLDA 1MWRA 4WELA 4YINA 4RX2A 3D3OA 4CLCB 4GS9B 3TOIA 3LO7A 1RGZA 4PM9A 4LV0A 3FWLA 4S2JA 4L9FA 3DWZA 3U4LP 3G30A 2EX2A 1I2SA 2KLIA 1BLPA 3R7WA 3MZEA 1YPRA 3U2AA 5GHXA 3T4TA 2Y8HA 3CITA 1LL5A 5A93A 3V5MA 3G35A 1X0OA 4GJ4A 5TFQA 3B42A 5DTKA 4X55A 4B4XA 4P6ZS 3EOIA 5J7EA 4MEZA 3C8CA 3ZVTA 4FSFA 3EQUA 3V3RA 2X01A 4UEYA 3IH9A 1TDGA 2Y55A 2Y91A 3FKWA 5HARA 3A3JA 4E6WA 3F1OB 2ZC6B 4L9EA 3H7WA 3PAGA 4KG2A 4KG6A 3M6BA 3UE0A 5EVIC 2H5SA 3E4QA 1LLBA 4FH4A 3H7WB 2VGKA 3ITBA 1S67L 4OPZA 3TRCA 4JLFA 2FH5A 2PU2A 4P6BA 4MLLA 3UPNA 1G6OA 2P7JA 2JKFA 2WGVA 3W4PA 4GOGA 3WRZA 4ID4A 1T19A 3QP8A 3P09A 4ME4A 3LEQA 2QMIA 3MQ0A 2GDNA 2INWA 4UQIS 1XKZA 3RTYA 5L10A 2DRWA 3NIAA 3PXPA 1CF0A 5A91A 3ZVWA 4HNBA 5FQ9A 2XD1A 1NZUA 2BTFP 2ZLYA 4IUKA 4N92A 1BULA 5JYPA 1KDSA 4HH3A 5TJJA 1QMEA 3G6OA 1P9WA 4GB7A 2EWWA 1K57C 1FIKA 3R7WB 4FCFA 2Y2NA 3MZFA 4DXBA 3QP4A 5M19A 3N6IA 4FTXA 1SHVA 4LGWA 5DKLA 4GN2A 3PYPA 4K08A 4R0QA 5AVEA 1YAXA 3W4OA 3WS1A 1KVMA 4LV3A 2Y4AA 4II7A 3A0RA 5F1FA 2ZQ7A 4JF6A 5GHZA 5M18A 4GHIB 1BLHA 2WKRA 2DCFA 3H82A 1NXYA 1BUEA 4QB8A 3CG5A 4H6JB 3A3IA 4GKUA 4HQAA 2HDUA 5F68A 3IF6A 3E2KA 1K55A 1PNEA 5HAIA 1GCEA 5I5LA 3HLBA 3IXBA 3D4FA 1D1JA 3S7NA 2IWDA 2ZMVA 5CHUA 1K6SA 3IF6B 3UMEA 4E3LA 1XP4A 4KZ9A 1NLZA 3E4PA 3IT9A 1PZOA 4BENA 2P08A 5EVIB 1BLSA 4KUOA 2HJ9C 3HLEA 4N1XA 2PR6A 2ZMAA 1PIOA 2BASA 5DFXA 3ISGA 1LSXA 3S7OA 5EE8A 4Y15A 1NZOA 5E2GA 3T4KA 4Y7PA 2W3GA 2ZQAA 3PBSA 2W3HA 3BFGA 2V8FA 2EFUA 2R9XA 2ZQDA 1UWNX 2WGIA 2O0YA 3G4PA 4F3LA 4DE2A 3JPUA 4GW9A 4I39A 1I5QA 4NXBA 1FR6A 1IYPA 5EVLA 4KUKA 3Q7ZA 4JGQA 5AJGA 2O9BA 3H82B 3ZQ5A 4O8GA 3O3VA 4ETXA 2A24B 3NCKA 3A3DA 4BBTA 4LCLA 2XQZA 3OPRA 5DF9A 4IEDA 4Y17A 1MC0A 1K0KA 4FD8A 5U47A 1SDEA 1W79A 1STZA 3KSGA 4JXSA 2V0UA 4WMCA 2PAVP 1OMEA 3JVUA 4NXEA 3VP0A 1G6AA 2PRFA 4QY5A 2H28A 1QMFA 4LPZA 1GHPA 3BFEA 5LBRA 3QHYA 3T4LA 2XK1A 4S2OA 2ACGA 3NDGA 3IH8A 1K6RA 3DBAA 3RH8B 5HAQA 3NOTC 4BWIA 1DJCA 1S1ZA 1H8ZA 3CAXA 1LSVA 4MN7A 1K56D 3LFVA 2IWBA 4Y3IA 1Z6FA 1ZTUA 5FATA 4OQHA 1VETA 5K5BA 2HZ5A 4PM6A 2GJ3A 1OT9A 3G32A 5TR7A 1ALQA 3C5AA 2EA9A 3WS5A 3OOVA 5E43A 1YLYA 3E0YA 1CI9A 2A2LA 2ZM8A 3BFFA 3NHQA 4K0XA 1MWSA 3MJQA 4JPMA 1KE0A 4JF5A 4X6TA 2B5RA 3VV4A 1E4DA 4DN0A 4OLGA 3VFFA 5KIZA 1Z09A 1OPXA 4WZ4A 2H0YA 1BT5A 2WZXA 4QU3A 3UE6A 4PMAA 3T1XA 4OOLA 4H8RA 5IU1A 3O87A 3WS0A 3HBRA 1IKGA 3C38A 2QJ7A 3B33A 3T1SA 1LSWA 3PBRA 1VEUB 3LGOA 1GSVA 1HD8A 1IFQA 5KMWA 2FFYA 4HHDA 3PBQA 1KDWA 1PI5A 4R23A 4R4RA 5FAPA 5HFOA 3ZNTA 1HZOA 4PAUA 3Q1FA 3S7PA 1L0EA 4MBFA 2J9OA 4Q8IA 4MN5A 4X53A 4HOIA 4A5RA 3IWIA 1XA7A 4XT2B 1SKOA 2Y2OA 2W3EA 1ONHA 1XGJA 5J4EA 3ULFA 2L4RA 4GCZA 5A8BA 4EBNA 3E4OA 2RL3A 2CMNA 2UV0E 1VM1A 1G28A 5EV0A 4EUVA 5L09A 4E3IA 2UWXA 1IYSA 4GS9A 2WGWB 5FDSA 3N8RA 3Q82A 1TS6A 3V50A 3BW6A 3KSFA 3N8SA 1PRQA 4DE0A 1K4EA 3ICYA 2IA2A 1Y54A 4XUZA 1K57A 1M6KA 5FQKA 3FYZA 3IX4A 2K7SA 3VE4A 2JKGA 4HI4A 1TEMA 2H0TA 3ZCZA 2E8IA 4R1GA 3GDIA 4ZJ2A 4B88A 3DTIA 1TS8A 4Y0OA 4R6LA 2WKHA 3VMAA 3NC8A 2Y2QA 1K55C 3BWLA 2OLVA 4QD4A 2XFTA 4X25A 3LY4A 3BECA 2W27A 4NETA 4OOYA 1XJ6A 1SDNA 1S6RA 1NJ4A 2V9AA 1SKOB 4DKIA 5A90A 3SS5A 1KE3A 1OTIA 3NJAA 4S2LA 3HJKA 3UPPA 3WS4A 4HP9A 4NKPA 5HPIA 3UB5P 3AGDA 4K0WA 1H5XA 3PAEA 1BZAA 1M40A 4WF0A 4P85A 1TS0A 4E3NA 4CLCE 1D7EA 2I9VA 4KZAA 3LIAA 4EW7A 4E3OA 4CPKA 4GDNA 2HP6A 4IUHA 4I3IA 4KQQA 4XUXA 5DJTA 1PI4A 4ZRRA 3A3EA 5BOHA 4ZTKA 1BYWA 3ZNYA 2KOIA 3CJMA 2JN7A 3IX8A 5HWTA 3IQAA 3KYEA 2ZC5B 5TGFA 1XJ4A 4S2KA 3FG8A 2JBFA 3SZTA 4ARZA 1BSGA 5G4YA 3T1RA 3T4OA 3TW8A 4DDSA 4BQMA 5CGSA 1H8MA 3B47A 5HSQA 3MF0A 2WAEA 3G2ZA 1V9ZA 5EM1A 2BG1A 4BL2A 5CTNA 3NOUC 4E3MA 3EEAA 4RQ9A 5J8XA 2PD8A 3HUMA 5GLCA 1KE4A 1JVJA 5G18A 4GHIA 4OONA 1KVLA 4EQIA 5EVIA 3HUNA 4JKTA 1J9MA 3UE3A 2ZMFA 2J9PA 1IYQA 5I94A 1PWCA 3TE8A 4ZJ3A 3NOPC 1K54A 4C75A 5AQBA 3VSLA 3NBLA 4MBHA 3LY3A 4OQIA 2Y2PA 4CLCD 3T50A 3CWFA 1ES4A 2WADA 5AQ9A 1LI9A 4Y0TA 1E3UD 1TDLA 5DF8A 3ZG5A 1YLTA 3KO6A 1GHIA 3GECA 5FI7A 2Y79A 1Y4OA 4I3AA 5C5KA 3LCEA 5HD5A 4I5SA 3DW0A 3UE1A 2C5WB 3ZHHA 4OQGA 1GSXA 3KYZA 4Y2FA 1GA0A 3WRTA 2EX9A 5A92A 3QNCA 3A0VA 4OOMA 1TD5A 1YM1A 3S1YA 1XFQA 2EXAA 2W1TA 5DFYA 2JKRM 1RP5A 4OVDA 4XXRA 4LRYC 3SH8A 3C4PA 3VE3A 4F94A 3IXDA 4X68A 1HTZA 1GHMA 4RYEA 5GL9A 4EESA 4S2PA 5HW3A 2XH9A 2XD5A 2OOLA 4OH0A 2M7VA 3MS6A 3ZG0A 4ZAMA 4Q0IA 4QJGA 3O88A 3OPHA 2XA7M 3E2LA 3BFCA 4Q0JA 1PWGA 3HUOA 4BBUA 2XDMA 4LV1A 1VEUA 2FZ0A 1JTDA 4Z9QA 1IELA 5HWWA 4LV2A 1L0GA 4JF4A 4UQIM 2M1CA 4IJGA 1G68A 1RCJA 5AVFA 2HDQA 2QKPA 2ZC7A 3BYDA 1WYBA 4LRXC 3MMHA 5DVAA 3VOYA 3NDEA 3CHWP 3LR5A 5L07A 4YOFA 4NXFA 1U60A 4HJ4A 3CI6A 3ZYTA 3JYIA 3PBNA 2V8CA 3F1PB 4CQHA 5J3WA 2VV6A 3W8KA 3KSHA 3LI9A 3RXXA 2G2WA 1ESIA 1O07A 1PW1A 5FQQA 3VSKA 3LR0A 4R3JA 2OWHA 5TBMB 2KX6A 2WZZA 1LL8A 1MY8A 3BQ8A 1IYOA 2HPBA 2OSUA 1S4RA 5KSHA
chains in the Genus database with same CATH topology
3B33A 1OTEA 2W3FA 1LSWA 3PBRA 4BMWA 2HF6A 1N9NA 3F1OA 1GSVA 4HY8A 1IFQA 3FC7A 4HHDA 5F6AA 3PBQA 1Y28A 4WN5A 2J3TC 3BY9A 3KSIA 5F5YA 3S7QA 4E04A 1XJ2A 4WLAA 1OTDA 1F9IA 1N9OA 4G3KA 5HWVA 2A24A 5IS1A 4PAUA 5HPFA 3S7PA 4GLQA 5FL3A 4WELA 4HIAA 2YKFA 3D3OA 2P04A 1T18A 4CLCB 4GS9B 4MN5A 4JGPA 4HOIA 4XT2B 2VJWA 2W3EA 5J4EA 1ODVA 4G3WA 1KOUA 3PR6A 3IS2A 4L9FA 3ULFA 2L4RA 4GCZA 4IHQA 5A8BA 2EWVA 3E4OA 3OCLA 2CMNA 4WEJA 2KLIA 1D06A 1H3QA 3R7WA 1G28A 4EUVA 2WKQA 2PD7A 3CUEC 4GS9A 2B02A 3U2AA 3EQVA 2QYBA 2K2NA 3T4TA 2Y8HA 3CITA 4EXOA 2XSSA 1X0OA 1TS6A 4GJ4A 3H9WA 1T1AA 3B42A 2W1TB 4G3VA 3W2ZA 2O9AA 4EEPA 3BW6A 3BQAA 4P6ZS 3EOIA 5J7EA 3C8CA 4FSFA 3EQUA 3KSFA 2W1RA 3LIBA 3ICYA 1LT0A 2IA2A 4L9GA 4UEYA 1F5MA 3JVVA 3LIEA 3T4SA 4LLOB 3F1OB 2K7SA 4L9EA 3VE4A 4HI4A 3H7WA 3LR4A 3IBJA 2OWJA 2NUPC 2YKHA 3GDIA 1S4SA 1TS8A 4R6LA 3HCYA 4YWZA 3E4QA 2J80A 5TBMA 3BWLA 4MDZA 3H7WB 1DP6A 1S67L 3TRCA 3T4QA 3R4KA 4P6ZM 2FH5A 4HP4A 2W27A 2V1AA 1XJ6A 4QPRA 1G6OA 2P7JA 2JHEA 2V9AA 4ETZA 1T19A 4Y5FA 4ME4A 3HJIA 3MQ0A 3KYQA 1OTIA 3NJAA 3HJKA 4HP9A 4NKPA 2INWA 4R38A 4UQIS 5HPIA 4H6JA 2J3TD 1TF1A 1UWPX 3RTYA 3BY8A 4WF0A 1S66L 3PXPA 2QHKA 1F98A 1OJ5A 1TS0A 4F3LB 4CLCE 1D7EA 2I9VA 4HNBA 3LIAA 4EW7A 2VA0A 4IUKA 4IUHA 4I3IA 2PHYA 5DJTA 3K3CA 2XA7S 3IBRA 3UMDA 4HH3A 4ZRRA 1NWZA 5TJJA 2VGLS 3G6OA 1BYWA 4ARZB 2KOIA 5HDDA 1P9WA 2EWWA 3OBFA 2JN7A 2ZOIA 3R7WB 3MQQA 5HWTA 1OJGA 3UB6A 3P01A 4WEKA 3BJNA 3OC2A 2KDKA 2W3DA 5G4ZA 1XJ4A 4XT2A 5DKLA 3FG8A 4WL9A 3PYPA 4K08A 2HGVA 5AVEA 1YAXA 4ARZA 2G7UA 2Z6DA 2L0WA 3K2NA 3C2WA 5G4YA 4DJ3A 1IOUA 4II7A 1OT6A 3T4OA 3A0RA 3TW8A 1H8MA 2JKTM 2ZBBA 3B47A 5CX7A 5L8MA 5HSQA 3LUQA 4L0LA 3MF0A 4GHIB 1V9ZA 4NXGA 5HDCA 2JKTI 2WKRA 3MXQA 1YSQA 4PKYG 2HV1A 1TS7A 2QWSA 3H82A 3NOUC 2VV7A 4H6JB 3EEAA 4RQ9A 4DMZA 2PD8A 4HQAA 4JGRA 5F68A 4PKYA 4GHIA 2O9CA 3D72A 2WKPA 5I5LA 3S7NA 2VEAA 1ZHHB 2LB9A 2ZMVA 1WA9A 2D02A 3UE3A 2ZMFA 2L1MA 1JNUA 3PHYA 1S1YA 3LR3A 3TE8A 3UMEA 4O01A 3NOPC 1NLZA 3E4PA 2VV8A 3FPWA 4MMNA 5DKKA 1VHMA 3TJZC 2P08A 1VB6A 2OAP1 1P0ZA 1P9RA 4KUOA 2HJ9C 4CLCD 2VKSA 3T50A 4EQ1A 3CWFA 2PR6A 4FOFA 1W63M 1XFNA 1YKDA 2BASA 5DFXA 1LSXA 3S7OA 3KX0X 2M7UA 4Q0HA 2B18A 3KO6A 5HD3A 4M4XA 3T4KA 2W3GA 4PHTA 3GECA 3OLOA 4JGOA 3LICA 3PBSA 2Y79A 3O5YA 5EFWA 4I3AA 5C5KA 5HD5A 4I5SA 4MCWA 2W3HA 5HZHA 5DJUA 1T1CA 1T1BA 1GSXA 2VZWA 1UWNX 2O0YA 4F3LA 3UB8A 3KYZA 4Y2FA 2PYPA 4GW9A 5IT5A 4I39A 4NXBA 3CUEA 1UGUA 3PBTA 2O99A 3A0VA 1MZUA 4KUKA 4OOMA 4MN6A 4JGQA 4YNRA 5AJGA 4CLCC 2O9BA 3H82B 3ZQ5A 3UB9A 3F1NA 4O8GA 4ETXA 1TD5A 2LB5A 2A24B 2PDRA 3EEHA 4BBVA 4BBTA 1XFQA 2GNXA 5DF9A 1MC0A 1NRJA 2W1TA 3OCNA 5DFYA 3CLOA 2JKRM 4CLCA 1STZA 3KSGA 2GX5A 4LRYC 4O0PA 3F1NB 5HL6A 2V0UA 2HJEA 3E98A 4B9OA 3VE3A 3JVUA 4NXEA 2NUTC 1V9YA 1W63Q 2VGLM 2H28A 4LPZA 4EESA 2VLGA 1DP8A 5LBRA 2OOLA 3T4LA 2M7VA 3V67A 1N9LA 5MC7A 4Q0IA 1XJ3A 2XA7M 3DBAA 4Q0JA 3RH8B 2QJ5A 3MR0A 4DJ2A 4AFIA 2XRNA 3VOLA 3A0SA 4BBUA 2PR5A 2FZ0A 3NOTC 4HJ6A 4BWIA 1NLYA 5F69A 4HJ3A 1S1ZA 5HWWA 3CAXA 3LYXA 1LSVA 1P97A 4MN7A 2OAQ1 2Z6CA 2M1CA 3LFVA 2D01A 4UQIM 4IJGA 3P7NA 2V1BA 4EEUA 1MKMA 3PBOA 3FPVA 4Y3IA 3UB7A 5AVFA 4Z1WA 2QKPA 4R70A 1ZTUA 4LRXC 3MMHA 3SW1A 3MQOA 5K5BA 3LR5A 3LIDA 2JKRI 2GJ3A 3T4JA 4B93A 1OT9A 2XROA 2EA9A 3EWKA 4YOFA 4EU0A 4NXFA 3OOVA 3IS2B 3E0YA 4HJ4A 4EERA 4HH2A 3CI6A 2PYRA 3ZYTA 2A2LA 1OTBA 2PT7A 3PBNA 3LIFA 3F1PB 3NHQA 2GZAA 2K31A 3MJQA 4CQHA 1GSWA 5J3WA 2V0WA 2VV6A 4LRZE 3KSHA 1OTAA 1DP9A 3LI9A 3VV4A 3C30A 2VX8A 4WUJA 2W0NA 4DN0A 3EGDC 4BJPA 5KIZA 1OPXA 3LR0A 4I3JA 1EW0A 2ZOHA 2MJ6A 2OWHA 3F1PA 1DRMA 3MFXA 4KQDA 5TBMB 2KX6A 1YSPA 3RFBA 3LI8A 1LL8A 5HDSA 2J3WA 3UE6A 4R3AA 2DMWA 2R78A 3K3DA 4KQOA 3BQ8A 4NEED 3EGXC 4OOLA 4EETB 5IU1A 4I38A 3C38A 1S4RA 2QJ7A 5KSHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S67 L;  4B9O A;  2VV7 A;  3B33 A;  4H6J B;  3VE3 A;  4RQ9 A;  1OTE A;  1LSW A;  4NXE A;  1N9N A;  2PD8 A;  4HQA A;  3F1O A;  1V9Y A;  4JGR A;  5F68 A;  1GSV A;  4HY8 A;  3FC7 A;  4HHD A;  5F6A A;  4HP4 A;  2W27 A;  2V1A A;  4PKY A;  2H28 A;  1Y28 A;  4GHI A;  1XJ6 A;  4LPZ A;  4WN5 A;  3BY9 A;  3D72 A;  2WKP A;  2VLG A;  4EES A;  5F5Y A;  5I5L A;  2P7J A;  4E04 A;  1DP8 A;  1XJ2 A;  2JHE A;  2V9A A;  4WLA A;  1OTD A;  2OOL A;  1F9I A;  1N9O A;  5HWV A;  1N9L A;  1T19 A;  2A24 A;  2VEA A;  5IS1 A;  3HJI A;  1WA9 A;  2D02 A;  1OTI A;  1XJ3 A;  3H82 A;  3HJK A;  3NJA A;  2L1M A;  1JNU A;  3PHY A;  4HP9 A;  1S1Y A;  2INW A;  2QJ5 A;  3MR0 A;  4R38 A;  3RH8 B;  3UME A;  4DJ2 A;  4HIA A;  3A0S A;  3VOL A;  4H6J A;  4BBU A;  1UWP X;  2PR5 A;  2YKF A;  3NOP C;  3E4P A;  1T18 A;  3RTY A;  3BY8 A;  3NOT C;  2VV8 A;  4GS9 B;  4HJ6 A;  4MN5 A;  1S66 L;  4WF0 A;  5DKK A;  2QHK A;  4JGP A;  1F98 A;  4HOI A;  1OJ5 A;  5F69 A;  1TS0 A;  1S1Z A;  4HJ3 A;  4XT2 B;  4F3L B;  3CAX A;  3LYX A;  1D7E A;  1LSV A;  2I9V A;  1P97 A;  1VB6 A;  4HNB A;  1P0Z A;  2Z6C A;  2M1C A;  3LIA A;  2D01 A;  4KUO A;  4EW7 A;  1ODV A;  5J4E A;  1KOU A;  3P7N A;  3T50 A;  4EQ1 A;  2V1B A;  4EEU A;  3CWF A;  2PR6 A;  3IS2 A;  4L9F A;  3ULF A;  2L4R A;  4GCZ A;  3UB7 A;  4PKY G;  5AVF A;  5A8B A;  2QKP A;  3E4O A;  4LRX C;  4R70 A;  1XFN A;  4I3I A;  2CMN A;  3MQO A;  3SW1 A;  1D06 A;  2PHY A;  5DJT A;  1G28 A;  2BAS A;  3IBR A;  3K3C A;  3LID A;  3UMD A;  1LSX A;  2WKQ A;  2PD7 A;  3KX0 X;  2GJ3 A;  2B02 A;  4GS9 A;  4HH3 A;  1NWZ A;  1OT9 A;  3G6O A;  1BYW A;  5HD3 A;  4M4X A;  2EA9 A;  5HDD A;  3EWK A;  4NXF A;  3GEC A;  4EXO A;  2JN7 A;  3OLO A;  4JGO A;  3LIC A;  1X0O A;  1TS6 A;  2ZOI A;  3IS2 B;  3MQQ A;  4HJ4 A;  4I3A A;  5EFW A;  1OJG A;  5HWT A;  3H9W A;  4HH2 A;  3UB6 A;  5HD5 A;  1T1A A;  2PYR A;  4I5S A;  5HZH A;  5DJU A;  1OTB A;  4EER A;  3LIF A;  4EEP A;  1T1C A;  3F1P B;  1T1B A;  3NHQ A;  2KDK A;  1GSX A;  4WL9 A;  5J7E A;  3MJQ A;  1UWN X;  5G4Z A;  3C8C A;  1GSW A;  1XJ4 A;  4XT2 A;  5DKL A;  3UB8 A;  4F3L A;  5J3W A;  5HWW A;  2PYP A;  2V0W A;  2VV6 A;  4LRZ E;  4GW9 A;  3FG8 A;  4I39 A;  4NXB A;  3LIB A;  1LT0 A;  3ICY A;  3PYP A;  1OTA A;  1UGU A;  1DP9 A;  3LI9 A;  4K08 A;  4L9G A;  5AVE A;  3LIE A;  3A0V A;  1MZU A;  4KUK A;  2Z6D A;  4MN6 A;  4WUJ A;  2L0W A;  2W0N A;  4LLO B;  4JGQ A;  3F1O B;  2K7S A;  3C2W A;  4L9E A;  3VE4 A;  3H82 B;  3ZQ5 A;  4HI4 A;  3F1N A;  3H7W A;  5G4Y A;  3UB9 A;  2OWJ A;  4DJ3 A;  5KIZ A;  2YKH A;  1OT6 A;  3A0R A;  4I3J A;  1EW0 A;  2ZOH A;  2A24 B;  2PDR A;  3EEH A;  3GDI A;  2OWH A;  3F1P A;  5TBM B;  1DRM A;  3MFX A;  1S4S A;  4KQD A;  4BBV A;  4BBT A;  1XFQ A;  2KX6 A;  1TS8 A;  2ZBB A;  3LI8 A;  4R6L A;  1LL8 A;  5HDS A;  3UE6 A;  5HSQ A;  4R3A A;  3LUQ A;  2R78 A;  4GHI B;  3K3D A;  4YWZ A;  3E4Q A;  3CLO A;  1V9Z A;  4NXG A;  5HDC A;  5IU1 A;  2WKR A;  4EET B;  2J80 A;  3MXQ A;  5TBM A;  3BWL A;  4I38 A;  4LRY C;  2HV1 A;  1TS7 A;  2QWS A;  2V0U A;  1S4R A;  2QJ7 A;  3F1N B;  3H7W B;  3NOU C;  1DP6 A; 
#chains in the Genus database with same CATH topology
 3N8L A;  2VGJ A;  4BMW A;  2HF6 A;  1FR1 A;  1NYY A;  5CXW A;  1W8Y A;  3L9K A;  1FIL A;  4WN5 A;  2J3T C;  1MPL A;  1OTD A;  5FSR A;  5E2H A;  1AWI A;  5FL3 A;  3G2Y A;  1EI5 A;  2YKF A;  2Z2L B;  2ZL1 A;  1T18 A;  2WGW A;  3MZD A;  4LEN A;  2VJW A;  5GHY A;  4G3W A;  3PR6 A;  3G31 A;  2J8Y A;  1KGG A;  5EM0 A;  1EWZ A;  1XX2 A;  4IHQ A;  3NUL A;  3OCL A;  1LI0 A;  2ZL1 B;  4WEJ A;  3GMW A;  1H3Q A;  2C6W B;  2P9V A;  2PD7 A;  2B02 A;  1ZC2 A;  4WZ5 C;  4P87 A;  2ZM0 A;  5FQI A;  2XSS A;  3I7J A;  4KG5 A;  4HEF A;  4G3V A;  4N9K A;  2O9A A;  3BQA A;  4OPR A;  4QHC A;  3VP2 A;  4X1M A;  4N9L A;  4D60 A;  1LT0 A;  1F5M A;  3LIE A;  5FQM A;  1KGF A;  3QP6 A;  4LLO B;  1IKI A;  4KQR A;  3LR4 A;  5GLD A;  2NUP C;  2YKH A;  3HVF A;  1S4S A;  1J3W A;  2EFX A;  2J7V A;  3HCY A;  5CEC A;  5FEG A;  1K56 A;  2Y2G A;  2J80 A;  5TBM A;  4GDB A;  1DP6 A;  3HL9 A;  3R4K A;  5AQA A;  4D2O A;  4RA7 A;  2JE5 A;  4P6Z M;  2V1A A;  3NEC A;  1LHY A;  1YMX A;  2JHE A;  4UHU A;  4ETZ A;  2V1Z A;  3HJI A;  3KYQ A;  3OZH A;  4R38 A;  1PFL A;  2J3T D;  1TF1 A;  1ERM A;  4KZ7 A;  5KZH A;  2P9V B;  1F98 A;  1OJ5 A;  4LCM A;  4F3L B;  2ZQC A;  1XA1 A;  4C3Q A;  1JTG A;  1NY0 A;  1XGI A;  4U3T A;  2HP5 A;  3K3C A;  2XA7 S;  3IBR A;  2XR0 A;  3UMD A;  1NWZ A;  3L7H A;  2VGL S;  3QNB A;  4ARZ B;  5HL1 A;  5IHV A;  5HDD A;  2PBD P;  2WAF A;  4BD1 A;  3OBF A;  3HLW A;  3VP4 A;  4WEK A;  3VP1 A;  5HAP A;  2WUQ A;  2KDK A;  4ZJ1 A;  5G4Z A;  3GVB A;  3VOZ A;  4WL9 A;  2HGV A;  5F1G A;  5FI6 A;  4M3K A;  1DJA A;  2Z6D A;  1ESU A;  3K2N A;  3C2W A;  4KZ8 A;  3RJU A;  3MFD A;  4DJ3 A;  1IOU A;  3FZC A;  4R3B A;  4RVA A;  3ZG8 B;  3HLF A;  3BLM A;  2JKT M;  2ZBB A;  4HES A;  5L8M A;  4L0L A;  1LL9 A;  2EXB A;  1PWD A;  2JKT I;  2AVX A;  1YSQ A;  4PKY G;  1KGE A;  1TS7 A;  3O86 A;  2VV7 A;  1K54 C;  2ZM2 A;  4ZDX A;  4BLM A;  5FEF A;  4O7D A;  5FDH A;  2O9C A;  3D72 A;  2WKP A;  4BL3 A;  1ZHH B;  1MWU A;  3VFH A;  1JNU A;  1S1Y A;  2XF3 A;  3LR3 A;  1O7E A;  3NY4 A;  3IX3 A;  4O01 A;  3A3F A;  2VV8 A;  3FPW A;  3TJZ C;  2Y2K A;  2P74 A;  2ZQ9 A;  1VET B;  1W5D A;  3AGF A;  1VB6 A;  1P0Z A;  1P9R A;  4P0M A;  5FI2 A;  1ES5 A;  4EQ1 A;  3ZGA B;  1W63 M;  1I2W A;  5EOO A;  1H0M A;  1ZKJ A;  1VQQ A;  3UDF A;  3TG9 A;  1YKD A;  2Q9M A;  1YLJ A;  1NRF A;  4OPQ A;  2B18 A;  4M4X A;  1CQA A;  5EUA A;  1ERO A;  4JGO A;  3O5Y A;  5EFW A;  4JBF A;  5DJU A;  1T1C A;  3GQZ A;  3UPO A;  2ZC3 B;  5FA7 A;  2PYP A;  1UGU A;  2O99 A;  4OPY A;  4YNR A;  3W4Q A;  4KZ6 A;  2LB5 A;  2HDR A;  3UY6 A;  3IWO A;  1NRJ A;  3T1Q B;  4DDY A;  3NI9 A;  4O0P A;  5HL6 A;  2HJE A;  3E98 A;  2Y2H A;  1A0K A;  1ONG A;  2NUT C;  3GTC A;  4BD0 A;  2R9W A;  4UAA A;  1W63 Q;  4Y0U A;  3UNW A;  2VGL M;  3SH9 A;  3N4I A;  5GLB A;  1HVB A;  3HLG A;  2VLG A;  2B95 A;  2A3U A;  3V67 A;  2VK3 A;  1FSW A;  2X71 A;  1XJ3 A;  3M2K A;  4UA7 A;  3BM6 A;  3UDI A;  2QJ5 A;  4DJ2 A;  3VOL A;  5CED A;  2PR5 A;  4X1L A;  5D3O A;  4HJ6 A;  3UN7 A;  3UDX A;  5F69 A;  5DTT A;  3UO9 A;  4E6X A;  3LYX A;  1P97 A;  2OAQ 1;  2V2F F;  2Z6C A;  1L0D A;  3D9Y A;  3P7N A;  1TVF A;  4RX3 A;  4EEU A;  3UB7 A;  4Z1W A;  4R70 A;  3P98 A;  3SW1 A;  4OP5 A;  2WK0 A;  1ES2 A;  4S2I A;  4B93 A;  4DXC A;  4K91 A;  3C7U A;  3Q07 A;  3EWK A;  4EU0 A;  4U0X A;  4HBT A;  3IS2 B;  4EER A;  4HH2 A;  2PYR A;  1L3L A;  2GZA A;  1AXB A;  4DE1 A;  4B4Z A;  5EVI D;  1K25 A;  1DP9 A;  3C30 A;  4WUJ A;  2W0N A;  3EGD C;  3RXW A;  5CHJ A;  1EW0 A;  2Y2L A;  2ZOH A;  5JYO A;  2MJ6 A;  1FSY A;  3F1P A;  1YSP A;  3ITA A;  4WYY A;  3GRJ A;  1W8Q A;  2J3W A;  4R3A A;  2DMW A;  2R78 A;  4NEE D;  5FAO A;  1NYM A;  4JXV A;  4E3K A;  5EVE A;  3DTE A;  5KSC A;  2W3F A;  1N9N A;  3F1O A;  3B3X A;  4HY8 A;  5F6A A;  1E25 A;  1XXM A;  2ZC4 B;  3BY9 A;  1XJ2 A;  1F9I A;  1FOF A;  1N9O A;  5HWV A;  2A24 A;  5IS1 A;  5HPF A;  4GLQ A;  5HX9 A;  3GV9 A;  4HIA A;  5FAQ A;  4Y13 A;  2P04 A;  1JWP A;  4JGP A;  2CC1 A;  4OP8 A;  1CK3 A;  1ODV A;  1MKI A;  1KOU A;  3IS2 A;  1CEG A;  4EWF A;  2EWV A;  1N9B A;  4PM5 A;  1D06 A;  2WKQ A;  3CUE C;  4S2M A;  1SCW A;  2XLN A;  3EQV A;  3GR2 A;  2QYB A;  3QP1 A;  2K2N A;  4EXO A;  4R4S A;  3DTM A;  3H9W A;  1T1A A;  2W1T B;  3W2Z A;  1W7F A;  3CMZ A;  4EEP A;  1PZP A;  4N1H A;  1CI8 A;  4CJN A;  2W1R A;  1YLZ A;  3LIB A;  1CEF A;  4L9G A;  2Y59 A;  3JVV A;  1DY6 A;  2I72 A;  5FQJ A;  5GLA A;  3ZG7 B;  3T4S A;  4PM8 A;  4PM7 A;  3IBJ A;  1ZG6 A;  3Q81 A;  2OWJ A;  5M1A A;  4IVI A;  4IVK A;  3BLS A;  4YWZ A;  1N4O A;  4EUZ A;  3BRM A;  2XEP A;  1ERQ A;  4MDZ A;  5FAS A;  4HBU A;  4GZB A;  3T4Q A;  1FCO A;  1K38 A;  3OPL A;  1JWV A;  4HP4 A;  1YMS A;  3N7W A;  4QPR A;  4GD6 A;  3BFD A;  4YFM A;  4Y5F A;  4JXG A;  2JCH A;  3CPT A;  1YLP A;  2OV5 A;  2PU4 A;  4KZ5 A;  2JC7 A;  4H6J A;  5EOE A;  4S2N C;  1UWP X;  1RGY A;  3QP2 A;  3BY8 A;  1S66 L;  2QHK A;  4QWO A;  3V39 A;  5CGX A;  2VA0 A;  1S0W A;  3IHA A;  1L2S A;  3IF5 A;  3FV7 A;  2PHY A;  2WYX A;  2G2U A;  4EV4 A;  3WWX A;  1E3U A;  3VP3 A;  4QY6 A;  5CGW A;  1FQG A;  1MXO A;  2ZOI A;  3MQQ A;  1OJG A;  3UB6 A;  3P01 A;  3BJN A;  3HRE A;  3OC2 A;  2W3D A;  4XT2 A;  2DNS A;  2G7U A;  2L0W A;  4WZ5 A;  4KZ4 A;  1GA9 A;  2WKE A;  3SOI A;  5CER A;  1OT6 A;  3C7V A;  4X69 A;  2X02 A;  4GNU A;  5CX7 A;  3DAV A;  5CEB A;  1Q2Q A;  1ACF A;  3LUQ A;  2HP9 A;  4NXG A;  5F83 A;  5HDC A;  4S2N A;  3MXQ A;  2HV1 A;  2QWS A;  2QZ6 A;  3M2J A;  3ZDJ A;  4DMZ A;  3CPT B;  4JGR A;  1PW8 A;  4EBL A;  4PKY A;  1YT4 A;  4EBP A;  3DWK A;  1MWT A;  1YQS A;  5EPH A;  4FH2 A;  2EX6 A;  3MBZ A;  1FCM A;  2QPN A;  2ZJ9 A;  2A49 A;  2VEA A;  2LB9 A;  2V20 A;  4IBX A;  4ESP A;  1WA9 A;  2D02 A;  2L1M A;  3PHY A;  4GD8 A;  3WS2 A;  1BTL A;  1PYY A;  2WKI A;  2Y2I A;  4MMN A;  5DKK A;  1VHM A;  1HLU P;  3IXG A;  3HLD A;  3Q7V A;  2OAP 1;  3SS3 A;  2VKS A;  3SS4 A;  4FOF A;  4UA6 A;  2Q0O A;  3HLC A;  4KZ3 A;  4NG2 A;  1XFN A;  4JXW A;  3FKV A;  3KX0 X;  2M7U A;  2ZD8 A;  4Q0H A;  1F2K A;  2Q9N A;  5HD3 A;  4PHT A;  3OLO A;  3LIC A;  4MCW A;  5HZH A;  4DRT A;  5AQ7 A;  1T1B A;  2VZW A;  3MXR A;  3UB8 A;  3MKF A;  2H10 A;  1YLW A;  5IT5 A;  1G5U A;  3CUE A;  3PBT A;  1MZU A;  4FUW A;  4MN6 A;  3GSG A;  5CRF A;  4KEN B;  5DTS A;  4CLC C;  3UB9 A;  3F1N A;  2PBY A;  3ZFZ A;  4PPR A;  5CHM A;  2PDR A;  3T12 B;  3EEH A;  4C6Y A;  4BBV A;  2GNX A;  4LFU A;  3OCN A;  2RCX A;  3CLO A;  4DE3 A;  4CLC A;  2GX5 A;  3F1N B;  4B9O A;  1Q2P A;  3IXH A;  1WYC A;  3IHB A;  3MXS A;  1V9Y A;  2Z2M B;  1DP8 A;  3MSH A;  5L2F A;  4OQ0 A;  2XFS A;  4WM9 A;  1N9L A;  5MC7 A;  4UA9 A;  1C3B A;  5F82 A;  2IWC A;  3S4X A;  3MR0 A;  4AFI A;  2XRN A;  3A0S A;  3TSG A;  1FCN A;  3MKE A;  5E2F A;  1NLY A;  4HJ3 A;  3S22 A;  3M6H A;  2D01 A;  1SKF A;  2V1B A;  1MKM A;  1JWZ A;  3PBO A;  3FPV A;  1BLC A;  1IEM A;  2ZQ8 A;  3MQO A;  3Q7V B;  1SZV A;  1DJB A;  2Y2M A;  3LID A;  2HDS A;  2JKR I;  3T4J A;  2Y2J A;  2BLS A;  2XRO A;  3ZG9 B;  4DF6 A;  4U0T A;  1OTB A;  2PT7 A;  3LIF A;  1ES3 A;  4NK3 A;  2K31 A;  4MNR A;  1GSW A;  2V0W A;  1ZG4 A;  4LRZ E;  4MBK A;  3QP5 A;  1OTA A;  4OKP A;  2VX8 A;  2OLU A;  2FFF B;  3G34 A;  3AGE A;  4X56 A;  2XGN A;  4BJP A;  1L0F A;  4WMC D;  3PTE A;  4I3J A;  4WBG A;  4KQD A;  1DRM A;  3MFX A;  3IF6 C;  3RFB A;  3LI8 A;  5DF7 A;  4KZB A;  3OPP A;  5HDS A;  2E8J A;  3K3D A;  4KQO A;  1WE4 A;  3EGX C;  4EET B;  4I38 A;  1H8Y A;  1OTE A;  1XPB A;  4ZBE A;  4IBR A;  3CZD A;  3BEB A;  3FC7 A;  3LEZ A;  3V3S A;  1Y28 A;  5CTM A;  1CJF A;  3IWQ A;  1K4F A;  2EX8 A;  3KSI A;  5F5Y A;  3S7Q A;  3SH7 A;  4E04 A;  4WLA A;  3C4O A;  3DTK A;  1MBL A;  4G3K A;  5EEC A;  4E3J A;  5E2E A;  4OLD A;  1MWR A;  4WEL A;  4YIN A;  4RX2 A;  3D3O A;  4CLC B;  4GS9 B;  3TOI A;  3LO7 A;  1RGZ A;  4PM9 A;  4LV0 A;  3FWL A;  4S2J A;  4L9F A;  3DWZ A;  3U4L P;  3G30 A;  2EX2 A;  1I2S A;  2KLI A;  1BLP A;  3R7W A;  3MZE A;  1YPR A;  3U2A A;  5GHX A;  3T4T A;  2Y8H A;  3CIT A;  1LL5 A;  5A93 A;  3V5M A;  3G35 A;  1X0O A;  4GJ4 A;  5TFQ A;  3B42 A;  5DTK A;  4X55 A;  4B4X A;  4P6Z S;  3EOI A;  5J7E A;  4MEZ A;  3C8C A;  3ZVT A;  4FSF A;  3EQU A;  3V3R A;  2X01 A;  4UEY A;  3IH9 A;  1TDG A;  2Y55 A;  2Y91 A;  3FKW A;  5HAR A;  3A3J A;  4E6W A;  3F1O B;  2ZC6 B;  4L9E A;  3H7W A;  3PAG A;  4KG2 A;  4KG6 A;  3M6B A;  3UE0 A;  5EVI C;  2H5S A;  3E4Q A;  1LLB A;  4FH4 A;  3H7W B;  2VGK A;  3ITB A;  1S67 L;  4OPZ A;  3TRC A;  4JLF A;  2FH5 A;  2PU2 A;  4P6B A;  4MLL A;  3UPN A;  1G6O A;  2P7J A;  2JKF A;  2WGV A;  3W4P A;  4GOG A;  3WRZ A;  4ID4 A;  1T19 A;  3QP8 A;  3P09 A;  4ME4 A;  3LEQ A;  2QMI A;  3MQ0 A;  2GDN A;  2INW A;  4UQI S;  1XKZ A;  3RTY A;  5L10 A;  2DRW A;  3NIA A;  3PXP A;  1CF0 A;  5A91 A;  3ZVW A;  4HNB A;  5FQ9 A;  2XD1 A;  1NZU A;  2BTF P;  2ZLY A;  4IUK A;  4N92 A;  1BUL A;  5JYP A;  1KDS A;  4HH3 A;  5TJJ A;  1QME A;  3G6O A;  1P9W A;  4GB7 A;  2EWW A;  1K57 C;  1FIK A;  3R7W B;  4FCF A;  2Y2N A;  3MZF A;  4DXB A;  3QP4 A;  5M19 A;  3N6I A;  4FTX A;  1SHV A;  4LGW A;  5DKL A;  4GN2 A;  3PYP A;  4K08 A;  4R0Q A;  5AVE A;  1YAX A;  3W4O A;  3WS1 A;  1KVM A;  4LV3 A;  2Y4A A;  4II7 A;  3A0R A;  5F1F A;  2ZQ7 A;  4JF6 A;  5GHZ A;  5M18 A;  4GHI B;  1BLH A;  2WKR A;  2DCF A;  3H82 A;  1NXY A;  1BUE A;  4QB8 A;  3CG5 A;  4H6J B;  3A3I A;  4GKU A;  4HQA A;  2HDU A;  5F68 A;  3IF6 A;  3E2K A;  1K55 A;  1PNE A;  5HAI A;  1GCE A;  5I5L A;  3HLB A;  3IXB A;  3D4F A;  1D1J A;  3S7N A;  2IWD A;  2ZMV A;  5CHU A;  1K6S A;  3IF6 B;  3UME A;  4E3L A;  1XP4 A;  4KZ9 A;  1NLZ A;  3E4P A;  3IT9 A;  1PZO A;  4BEN A;  2P08 A;  5EVI B;  1BLS A;  4KUO A;  2HJ9 C;  3HLE A;  4N1X A;  2PR6 A;  2ZMA A;  1PIO A;  2BAS A;  5DFX A;  3ISG A;  1LSX A;  3S7O A;  5EE8 A;  4Y15 A;  1NZO A;  5E2G A;  3T4K A;  4Y7P A;  2W3G A;  2ZQA A;  3PBS A;  2W3H A;  3BFG A;  2V8F A;  2EFU A;  2R9X A;  2ZQD A;  1UWN X;  2WGI A;  2O0Y A;  3G4P A;  4F3L A;  4DE2 A;  3JPU A;  4GW9 A;  4I39 A;  1I5Q A;  4NXB A;  1FR6 A;  1IYP A;  5EVL A;  4KUK A;  3Q7Z A;  4JGQ A;  5AJG A;  2O9B A;  3H82 B;  3ZQ5 A;  4O8G A;  3O3V A;  4ETX A;  2A24 B;  3NCK A;  3A3D A;  4BBT A;  4LCL A;  2XQZ A;  3OPR A;  5DF9 A;  4IED A;  4Y17 A;  1MC0 A;  1K0K A;  4FD8 A;  5U47 A;  1SDE A;  1W79 A;  1STZ A;  3KSG A;  4JXS A;  2V0U A;  4WMC A;  2PAV P;  1OME A;  3JVU A;  4NXE A;  3VP0 A;  1G6A A;  2PRF A;  4QY5 A;  2H28 A;  1QMF A;  4LPZ A;  1GHP A;  3BFE A;  5LBR A;  3QHY A;  3T4L A;  2XK1 A;  4S2O A;  2ACG A;  3NDG A;  3IH8 A;  1K6R A;  3DBA A;  3RH8 B;  5HAQ A;  3NOT C;  4BWI A;  1DJC A;  1S1Z A;  1H8Z A;  3CAX A;  1LSV A;  4MN7 A;  1K56 D;  3LFV A;  2IWB A;  4Y3I A;  1Z6F A;  1ZTU A;  5FAT A;  4OQH A;  1VET A;  5K5B A;  2HZ5 A;  4PM6 A;  2GJ3 A;  1OT9 A;  3G32 A;  5TR7 A;  1ALQ A;  3C5A A;  2EA9 A;  3WS5 A;  3OOV A;  5E43 A;  1YLY A;  3E0Y A;  1CI9 A;  2A2L A;  2ZM8 A;  3BFF A;  3NHQ A;  4K0X A;  1MWS A;  3MJQ A;  4JPM A;  1KE0 A;  4JF5 A;  4X6T A;  2B5R A;  3VV4 A;  1E4D A;  4DN0 A;  4OLG A;  3VFF A;  5KIZ A;  1Z09 A;  1OPX A;  4WZ4 A;  2H0Y A;  1BT5 A;  2WZX A;  4QU3 A;  3UE6 A;  4PMA A;  3T1X A;  4OOL A;  4H8R A;  5IU1 A;  3O87 A;  3WS0 A;  3HBR A;  1IKG A;  3C38 A;  2QJ7 A;  3B33 A;  3T1S A;  1LSW A;  3PBR A;  1VEU B;  3LGO A;  1GSV A;  1HD8 A;  1IFQ A;  5KMW A;  2FFY A;  4HHD A;  3PBQ A;  1KDW A;  1PI5 A;  4R23 A;  4R4R A;  5FAP A;  5HFO A;  3ZNT A;  1HZO A;  4PAU A;  3Q1F A;  3S7P A;  1L0E A;  4MBF A;  2J9O A;  4Q8I A;  4MN5 A;  4X53 A;  4HOI A;  4A5R A;  3IWI A;  1XA7 A;  4XT2 B;  1SKO A;  2Y2O A;  2W3E A;  1ONH A;  1XGJ A;  5J4E A;  3ULF A;  2L4R A;  4GCZ A;  5A8B A;  4EBN A;  3E4O A;  2RL3 A;  2CMN A;  2UV0 E;  1VM1 A;  1G28 A;  5EV0 A;  4EUV A;  5L09 A;  4E3I A;  2UWX A;  1IYS A;  4GS9 A;  2WGW B;  5FDS A;  3N8R A;  3Q82 A;  1TS6 A;  3V50 A;  3BW6 A;  3KSF A;  3N8S A;  1PRQ A;  4DE0 A;  1K4E A;  3ICY A;  2IA2 A;  1Y54 A;  4XUZ A;  1K57 A;  1M6K A;  5FQK A;  3FYZ A;  3IX4 A;  2K7S A;  3VE4 A;  2JKG A;  4HI4 A;  1TEM A;  2H0T A;  3ZCZ A;  2E8I A;  4R1G A;  3GDI A;  4ZJ2 A;  4B88 A;  3DTI A;  1TS8 A;  4Y0O A;  4R6L A;  2WKH A;  3VMA A;  3NC8 A;  2Y2Q A;  1K55 C;  3BWL A;  2OLV A;  4QD4 A;  2XFT A;  4X25 A;  3LY4 A;  3BEC A;  2W27 A;  4NET A;  4OOY A;  1XJ6 A;  1SDN A;  1S6R A;  1NJ4 A;  2V9A A;  1SKO B;  4DKI A;  5A90 A;  3SS5 A;  1KE3 A;  1OTI A;  3NJA A;  4S2L A;  3HJK A;  3UPP A;  3WS4 A;  4HP9 A;  4NKP A;  5HPI A;  3UB5 P;  3AGD A;  4K0W A;  1H5X A;  3PAE A;  1BZA A;  1M40 A;  4WF0 A;  4P85 A;  1TS0 A;  4E3N A;  4CLC E;  1D7E A;  2I9V A;  4KZA A;  3LIA A;  4EW7 A;  4E3O A;  4CPK A;  4GDN A;  2HP6 A;  4IUH A;  4I3I A;  4KQQ A;  4XUX A;  5DJT A;  1PI4 A;  4ZRR A;  3A3E A;  5BOH A;  4ZTK A;  1BYW A;  3ZNY A;  2KOI A;  3CJM A;  2JN7 A;  3IX8 A;  5HWT A;  3IQA A;  3KYE A;  2ZC5 B;  5TGF A;  1XJ4 A;  4S2K A;  3FG8 A;  2JBF A;  3SZT A;  4ARZ A;  1BSG A;  5G4Y A;  3T1R A;  3T4O A;  3TW8 A;  4DDS A;  4BQM A;  5CGS A;  1H8M A;  3B47 A;  5HSQ A;  3MF0 A;  2WAE A;  3G2Z A;  1V9Z A;  5EM1 A;  2BG1 A;  4BL2 A;  5CTN A;  3NOU C;  4E3M A;  3EEA A;  4RQ9 A;  5J8X A;  2PD8 A;  3HUM A;  5GLC A;  1KE4 A;  1JVJ A;  5G18 A;  4GHI A;  4OON A;  1KVL A;  4EQI A;  5EVI A;  3HUN A;  4JKT A;  1J9M A;  3UE3 A;  2ZMF A;  2J9P A;  1IYQ A;  5I94 A;  1PWC A;  3TE8 A;  4ZJ3 A;  3NOP C;  1K54 A;  4C75 A;  5AQB A;  3VSL A;  3NBL A;  4MBH A;  3LY3 A;  4OQI A;  2Y2P A;  4CLC D;  3T50 A;  3CWF A;  1ES4 A;  2WAD A;  5AQ9 A;  1LI9 A;  4Y0T A;  1E3U D;  1TDL A;  5DF8 A;  3ZG5 A;  1YLT A;  3KO6 A;  1GHI A;  3GEC A;  5FI7 A;  2Y79 A;  1Y4O A;  4I3A A;  5C5K A;  3LCE A;  5HD5 A;  4I5S A;  3DW0 A;  3UE1 A;  2C5W B;  3ZHH A;  4OQG A;  1GSX A;  3KYZ A;  4Y2F A;  1GA0 A;  3WRT A;  2EX9 A;  5A92 A;  3QNC A;  3A0V A;  4OOM A;  1TD5 A;  1YM1 A;  3S1Y A;  1XFQ A;  2EXA A;  2W1T A;  5DFY A;  2JKR M;  1RP5 A;  4OVD A;  4XXR A;  4LRY C;  3SH8 A;  3C4P A;  3VE3 A;  4F94 A;  3IXD A;  4X68 A;  1HTZ A;  1GHM A;  4RYE A;  5GL9 A;  4EES A;  4S2P A;  5HW3 A;  2XH9 A;  2XD5 A;  2OOL A;  4OH0 A;  2M7V A;  3MS6 A;  3ZG0 A;  4ZAM A;  4Q0I A;  4QJG A;  3O88 A;  3OPH A;  2XA7 M;  3E2L A;  3BFC A;  4Q0J A;  1PWG A;  3HUO A;  4BBU A;  2XDM A;  4LV1 A;  1VEU A;  2FZ0 A;  1JTD A;  4Z9Q A;  1IEL A;  5HWW A;  4LV2 A;  1L0G A;  4JF4 A;  4UQI M;  2M1C A;  4IJG A;  1G68 A;  1RCJ A;  5AVF A;  2HDQ A;  2QKP A;  2ZC7 A;  3BYD A;  1WYB A;  4LRX C;  3MMH A;  5DVA A;  3VOY A;  3NDE A;  3CHW P;  3LR5 A;  5L07 A;  4YOF A;  4NXF A;  1U60 A;  4HJ4 A;  3CI6 A;  3ZYT A;  3JYI A;  3PBN A;  2V8C A;  3F1P B;  4CQH A;  5J3W A;  2VV6 A;  3W8K A;  3KSH A;  3LI9 A;  3RXX A;  2G2W A;  1ESI A;  1O07 A;  1PW1 A;  5FQQ A;  3VSK A;  3LR0 A;  4R3J A;  2OWH A;  5TBM B;  2KX6 A;  2WZZ A;  1LL8 A;  1MY8 A;  3BQ8 A;  1IYO A;  2HPB A;  2OSU A;  1S4R A;  5KSH A; 
#chains in the Genus database with same CATH homology
 3B33 A;  1OTE A;  2W3F A;  1LSW A;  3PBR A;  4BMW A;  2HF6 A;  1N9N A;  3F1O A;  1GSV A;  4HY8 A;  1IFQ A;  3FC7 A;  4HHD A;  5F6A A;  3PBQ A;  1Y28 A;  4WN5 A;  2J3T C;  3BY9 A;  3KSI A;  5F5Y A;  3S7Q A;  4E04 A;  1XJ2 A;  4WLA A;  1OTD A;  1F9I A;  1N9O A;  4G3K A;  5HWV A;  2A24 A;  5IS1 A;  4PAU A;  5HPF A;  3S7P A;  4GLQ A;  5FL3 A;  4WEL A;  4HIA A;  2YKF A;  3D3O A;  2P04 A;  1T18 A;  4CLC B;  4GS9 B;  4MN5 A;  4JGP A;  4HOI A;  4XT2 B;  2VJW A;  2W3E A;  5J4E A;  1ODV A;  4G3W A;  1KOU A;  3PR6 A;  3IS2 A;  4L9F A;  3ULF A;  2L4R A;  4GCZ A;  4IHQ A;  5A8B A;  2EWV A;  3E4O A;  3OCL A;  2CMN A;  4WEJ A;  2KLI A;  1D06 A;  1H3Q A;  3R7W A;  1G28 A;  4EUV A;  2WKQ A;  2PD7 A;  3CUE C;  4GS9 A;  2B02 A;  3U2A A;  3EQV A;  2QYB A;  2K2N A;  3T4T A;  2Y8H A;  3CIT A;  4EXO A;  2XSS A;  1X0O A;  1TS6 A;  4GJ4 A;  3H9W A;  1T1A A;  3B42 A;  2W1T B;  4G3V A;  3W2Z A;  2O9A A;  4EEP A;  3BW6 A;  3BQA A;  4P6Z S;  3EOI A;  5J7E A;  3C8C A;  4FSF A;  3EQU A;  3KSF A;  2W1R A;  3LIB A;  3ICY A;  1LT0 A;  2IA2 A;  4L9G A;  4UEY A;  1F5M A;  3JVV A;  3LIE A;  3T4S A;  4LLO B;  3F1O B;  2K7S A;  4L9E A;  3VE4 A;  4HI4 A;  3H7W A;  3LR4 A;  3IBJ A;  2OWJ A;  2NUP C;  2YKH A;  3GDI A;  1S4S A;  1TS8 A;  4R6L A;  3HCY A;  4YWZ A;  3E4Q A;  2J80 A;  5TBM A;  3BWL A;  4MDZ A;  3H7W B;  1DP6 A;  1S67 L;  3TRC A;  3T4Q A;  3R4K A;  4P6Z M;  2FH5 A;  4HP4 A;  2W27 A;  2V1A A;  1XJ6 A;  4QPR A;  1G6O A;  2P7J A;  2JHE A;  2V9A A;  4ETZ A;  1T19 A;  4Y5F A;  4ME4 A;  3HJI A;  3MQ0 A;  3KYQ A;  1OTI A;  3NJA A;  3HJK A;  4HP9 A;  4NKP A;  2INW A;  4R38 A;  4UQI S;  5HPI A;  4H6J A;  2J3T D;  1TF1 A;  1UWP X;  3RTY A;  3BY8 A;  4WF0 A;  1S66 L;  3PXP A;  2QHK A;  1F98 A;  1OJ5 A;  1TS0 A;  4F3L B;  4CLC E;  1D7E A;  2I9V A;  4HNB A;  3LIA A;  4EW7 A;  2VA0 A;  4IUK A;  4IUH A;  4I3I A;  2PHY A;  5DJT A;  3K3C A;  2XA7 S;  3IBR A;  3UMD A;  4HH3 A;  4ZRR A;  1NWZ A;  5TJJ A;  2VGL S;  3G6O A;  1BYW A;  4ARZ B;  2KOI A;  5HDD A;  1P9W A;  2EWW A;  3OBF A;  2JN7 A;  2ZOI A;  3R7W B;  3MQQ A;  5HWT A;  1OJG A;  3UB6 A;  3P01 A;  4WEK A;  3BJN A;  3OC2 A;  2KDK A;  2W3D A;  5G4Z A;  1XJ4 A;  4XT2 A;  5DKL A;  3FG8 A;  4WL9 A;  3PYP A;  4K08 A;  2HGV A;  5AVE A;  1YAX A;  4ARZ A;  2G7U A;  2Z6D A;  2L0W A;  3K2N A;  3C2W A;  5G4Y A;  4DJ3 A;  1IOU A;  4II7 A;  1OT6 A;  3T4O A;  3A0R A;  3TW8 A;  1H8M A;  2JKT M;  2ZBB A;  3B47 A;  5CX7 A;  5L8M A;  5HSQ A;  3LUQ A;  4L0L A;  3MF0 A;  4GHI B;  1V9Z A;  4NXG A;  5HDC A;  2JKT I;  2WKR A;  3MXQ A;  1YSQ A;  4PKY G;  2HV1 A;  1TS7 A;  2QWS A;  3H82 A;  3NOU C;  2VV7 A;  4H6J B;  3EEA A;  4RQ9 A;  4DMZ A;  2PD8 A;  4HQA A;  4JGR A;  5F68 A;  4PKY A;  4GHI A;  2O9C A;  3D72 A;  2WKP A;  5I5L A;  3S7N A;  2VEA A;  1ZHH B;  2LB9 A;  2ZMV A;  1WA9 A;  2D02 A;  3UE3 A;  2ZMF A;  2L1M A;  1JNU A;  3PHY A;  1S1Y A;  3LR3 A;  3TE8 A;  3UME A;  4O01 A;  3NOP C;  1NLZ A;  3E4P A;  2VV8 A;  3FPW A;  4MMN A;  5DKK A;  1VHM A;  3TJZ C;  2P08 A;  1VB6 A;  2OAP 1;  1P0Z A;  1P9R A;  4KUO A;  2HJ9 C;  4CLC D;  2VKS A;  3T50 A;  4EQ1 A;  3CWF A;  2PR6 A;  4FOF A;  1W63 M;  1XFN A;  1YKD A;  2BAS A;  5DFX A;  1LSX A;  3S7O A;  3KX0 X;  2M7U A;  4Q0H A;  2B18 A;  3KO6 A;  5HD3 A;  4M4X A;  3T4K A;  2W3G A;  4PHT A;  3GEC A;  3OLO A;  4JGO A;  3LIC A;  3PBS A;  2Y79 A;  3O5Y A;  5EFW A;  4I3A A;  5C5K A;  5HD5 A;  4I5S A;  4MCW A;  2W3H A;  5HZH A;  5DJU A;  1T1C A;  1T1B A;  1GSX A;  2VZW A;  1UWN X;  2O0Y A;  4F3L A;  3UB8 A;  3KYZ A;  4Y2F A;  2PYP A;  4GW9 A;  5IT5 A;  4I39 A;  4NXB A;  3CUE A;  1UGU A;  3PBT A;  2O99 A;  3A0V A;  1MZU A;  4KUK A;  4OOM A;  4MN6 A;  4JGQ A;  4YNR A;  5AJG A;  4CLC C;  2O9B A;  3H82 B;  3ZQ5 A;  3UB9 A;  3F1N A;  4O8G A;  4ETX A;  1TD5 A;  2LB5 A;  2A24 B;  2PDR A;  3EEH A;  4BBV A;  4BBT A;  1XFQ A;  2GNX A;  5DF9 A;  1MC0 A;  1NRJ A;  2W1T A;  3OCN A;  5DFY A;  3CLO A;  2JKR M;  4CLC A;  1STZ A;  3KSG A;  2GX5 A;  4LRY C;  4O0P A;  3F1N B;  5HL6 A;  2V0U A;  2HJE A;  3E98 A;  4B9O A;  3VE3 A;  3JVU A;  4NXE A;  2NUT C;  1V9Y A;  1W63 Q;  2VGL M;  2H28 A;  4LPZ A;  4EES A;  2VLG A;  1DP8 A;  5LBR A;  2OOL A;  3T4L A;  2M7V A;  3V67 A;  1N9L A;  5MC7 A;  4Q0I A;  1XJ3 A;  2XA7 M;  3DBA A;  4Q0J A;  3RH8 B;  2QJ5 A;  3MR0 A;  4DJ2 A;  4AFI A;  2XRN A;  3VOL A;  3A0S A;  4BBU A;  2PR5 A;  2FZ0 A;  3NOT C;  4HJ6 A;  4BWI A;  1NLY A;  5F69 A;  4HJ3 A;  1S1Z A;  5HWW A;  3CAX A;  3LYX A;  1LSV A;  1P97 A;  4MN7 A;  2OAQ 1;  2Z6C A;  2M1C A;  3LFV A;  2D01 A;  4UQI M;  4IJG A;  3P7N A;  2V1B A;  4EEU A;  1MKM A;  3PBO A;  3FPV A;  4Y3I A;  3UB7 A;  5AVF A;  4Z1W A;  2QKP A;  4R70 A;  1ZTU A;  4LRX C;  3MMH A;  3SW1 A;  3MQO A;  5K5B A;  3LR5 A;  3LID A;  2JKR I;  2GJ3 A;  3T4J A;  4B93 A;  1OT9 A;  2XRO A;  2EA9 A;  3EWK A;  4YOF A;  4EU0 A;  4NXF A;  3OOV A;  3IS2 B;  3E0Y A;  4HJ4 A;  4EER A;  4HH2 A;  3CI6 A;  2PYR A;  3ZYT A;  2A2L A;  1OTB A;  2PT7 A;  3PBN A;  3LIF A;  3F1P B;  3NHQ A;  2GZA A;  2K31 A;  3MJQ A;  4CQH A;  1GSW A;  5J3W A;  2V0W A;  2VV6 A;  4LRZ E;  3KSH A;  1OTA A;  1DP9 A;  3LI9 A;  3VV4 A;  3C30 A;  2VX8 A;  4WUJ A;  2W0N A;  4DN0 A;  3EGD C;  4BJP A;  5KIZ A;  1OPX A;  3LR0 A;  4I3J A;  1EW0 A;  2ZOH A;  2MJ6 A;  2OWH A;  3F1P A;  1DRM A;  3MFX A;  4KQD A;  5TBM B;  2KX6 A;  1YSP A;  3RFB A;  3LI8 A;  1LL8 A;  5HDS A;  2J3W A;  3UE6 A;  4R3A A;  2DMW A;  2R78 A;  3K3D A;  4KQO A;  3BQ8 A;  4NEE D;  3EGX C;  4OOL A;  4EET B;  5IU1 A;  4I38 A;  3C38 A;  1S4R A;  2QJ7 A;  5KSH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...