3VOLA

X-ray crystal structure of pas-hamp aer2 in the cn-bound form
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
138
structure length
138
Chain Sequence
b'GSHMARIKSALDNVSANVMIADNDLNIIYMNRTVSEMLGRAEADIRKQLPNFDAGRLMGANIDVFHKNPAHQRHLLANLTGVHKAELNLGGRRFSLDVVPVFNDANERLGSAVQWTDRTEEHRAEQEVSQLVQAAAAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Aerotaxis transducer Aer2
publication title Structural basis for oxygen sensing and signal transduction of the heme-based sensor protein Aer2 from Pseudomonas aeruginosa
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Signaling protein
total genus 46
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13188 PAS_8 PAS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3volA00
2GJ3A 3LIBA 2YKFA 5HZHA 4HJ6A 3F1NB 3H82A 2QWSA 3VOLA 4LRZE 1T18A 3EEHA 5J3WA 3UB8A 3MQQA 4JGQA 5F5YA 4XT2A 2WKRA 5DJTA 4HP9A 3SW1A 4R38A 2K7SA 2OWJA 5HWWA 1DP8A 3LI8A 4I39A 5DKLA 5TBMA 4I5SA 2WKPA 2PR6A 3C2WA 2EA9A 4LLOB 3NJAA 4HIAA 2ZOHA 4GS9B 4NXEA 1JNUA 4BBUA 3F1OA 3EWKA 4MN6A 2B02A 3CWFA 4EEPA 1DP9A 3LIDA 1BYWA 1D06A 3VE3A 4WN5A 1DP6A 3F1PB 5F68A 1T1BA 2A24B 1N9LA 2V1BA 3LICA 3E4OA 3NHQA 1MZUA 2D02A 2JHEA 2L4RA 1LSVA 3UB7A 5IU1A 2P7JA 3E4QA 1D7EA 3BWLA 2HV1A 3A0VA 1OT6A 3A0RA 4NXBA 1F9IA 5G4ZA 5AVEA 5I5LA 4HOIA 2Z6DA 4JGOA 4YWZA 2QJ7A 4WLAA 4DJ3A 5G4YA 2KX6A 4F3LA 3IBRA 5HDSA 2L0WA 5HDCA 2V0UA 2V1AA 4I38A 2VLGA 3MJQA 3H82B 1UWNX 3KX0X 3FC7A 1GSXA 5F6AA 2R78A 1LL8A 1UGUA 4LRYC 4EXOA 1N9NA 2PR5A 4HJ3A 3RH8B 5AVFA 3LYXA 2VV7A 4HNBA 3E4PA 4HQAA 5HDDA 3CLOA 1KOUA 5TBMB 4JGRA 3P7NA 3H9WA 4H6JA 2QKPA 3HJKA 1ODVA 5HD3A 3F1OB 3NOPC 1OTEA 5IS1A 4HY8A 1LSWA 1S4RA 2PD7A 4EEUA 4EQ1A 1X0OA 1Y28A 4EETB 4I3AA 1OT9A 1XFNA 2KDKA 4BBTA 4GS9A 3K3CA 2BASA 1GSVA 3A0SA 3BY9A 1OTIA 3ULFA 2M1CA 2ZOIA 2VV6A 2V0WA 4PKYA 3NOUC 2QHKA 5HWTA 3GDIA 4HHDA 1LT0A 3LIAA 4KUOA 1S4SA 2ZBBA 5DJUA 1G28A 1OJGA 3UMEA 1TS7A 1S66L 2VEAA 1EW0A 1S67L 3CAXA 1DRMA 4HH2A 1XFQA 4DJ2A 1V9YA 3IS2A 1XJ3A 2PYPA 3MXQA 2INWA 3UE6A 1V9ZA 1TS8A 4KQDA 3UB9A 2PYRA 3H7WB 3RTYA 4HH3A 3C8CA 1N9OA 2OWHA 2D01A 2L1MA 4WUJA 3T50A 4GW9A 2OOLA 4KUKA 4E04A 2H28A 4GCZA 1T19A 3PHYA 2YKHA 4GHIA 5EFWA 1F98A 3F1NA 4XT2B 4MN5A 4NXFA 5J4EA 4EESA 1T1AA 2Z6CA 5J7EA 4I3IA 4RQ9A 5KIZA 1TS0A 1GSWA 3PYPA 3G6OA 2PHYA 3VE4A 4I3JA 2J80A 3GECA 3K3DA 4EW7A 3D72A 4R6LA 4NXGA 1NWZA 3MR0A 4H6JB 1P97A 3MQOA 5HWVA 5HD5A 3UB6A 4BBVA 1S1YA 1TS6A 4WL9A 3LI9A 5F69A 3LIEA 1WA9A 4K08A 2I9VA 3FG8A 1OTDA 2W0NA 3LIFA 3LUQA 2QJ5A 4B9OA 2PDRA 1T1CA 4HP4A 4WF0A 1VB6A 2CMNA 3UMDA 1P0ZA 3B33A 4L9GA 4R70A 1XJ4A 2WKQA 4M4XA 4HI4A 3F1PA 2A24A 3HJIA 1LSXA 4L9FA 1UWPX 2W27A 5HSQA 2PD8A 1OTBA 3IS2B 1OJ5A 1XJ2A 4R3AA 1OTAA 3BY8A 4F3LB 4LPZA 3NOTC 4PKYG 4JGPA 4EERA 5DKKA 2V9AA 4L9EA 3MFXA 1XJ6A 3OLOA 4HJ4A 3ZQ5A 1S1ZA 2VV8A 4LRXC 4GHIB 5A8BA 3H7WA 3ICYA 2JN7A
chains in the Genus database with same CATH superfamily
2WGIA 4YNRA 5KMWA 4YFMA 5HZHA 2ZM8A 3FPVA 1RGYA 5F1GA 4PM5A 3G2ZA 4QY5A 3VP2A 2VGKA 2HPBA 1TVFA 3PBRA 2A49A 3UB8A 3T1SA 2AVXA 2IWCA 3G31A 1PI5A 1ERMA 2OAP1 3KSHA 2V8CA 4EBPA 3IWQA 3S7QA 4P6BA 2GDNA 5E2EA 3LI8A 5DKLA 3M6HA 3Q1FA 4K91A 1PWGA 4I5SA 1Y4OA 1CQAA 2IWBA 1ZG6A 1NYMA 5U47A 1K4EA 1JNUA 1GHMA 4BBUA 2UV0E 5CTMA 2HDSA 2X01A 2WGWA 3TE8A 2XLNA 2Q9NA 4F94A 5FAOA 3IWIA 1VETA 4WZ4A 2ZL1B 1DP9A 3LIDA 1BYWA 4GB7A 3S1YA 3BQAA 3MS6A 4WN5A 4UA6A 3F1PB 5FA7A 3GQZA 2VZWA 3MXRA 2PAVP 4S2LA 2JKRI 2VX8A 3W4PA 4O0PA 5FI7A 3PBOA 5FI6A 3NHQA 2L4RA 1MWTA 1LSVA 3CPTB 4WELA 3UB7A 3ZNYA 4IEDA 2P7JA 1W8QA 1YLWA 3KYEA 3BWLA 1MY8A 1YLYA 1VEUA 3E0YA 3VFFA 3B47A 3B3XA 1K25A 2EXBA 1F9IA 1NLZA 2ZMFA 3Q07A 4CQHA 5DTKA 5AVEA 3CG5A 3KSFA 3IBJA 1ES2A 4JXWA 5AQ9A 2Z6DA 4YWZA 3BFGA 2JKGA 3V5MA 4F3LA 2Y2OA 3EQVA 2P9VA 4I38A 2XDMA 4C6YA 1UWNX 4KZ9A 3FV7A 1BTLA 2LB9A 3VSLA 3ZYTA 4EU0A 4LRYC 5DF9A 1N9NA 4EXOA 3PAEA 1Q2PA 3BM6A 2R9WA 4Y17A 2GZAA 1KE0A 2VV7A 4OVDA 3E4PA 5L07A 4HQAA 1K57A 3RJUA 1QMEA 3NDEA 5TBMB 4Z9QA 3FKVA 4BD1A 2EXAA 2Y55A 2J9PA 3H9WA 2V8FA 3LR5A 3UPOA 5HAIA 5GLCA 3QNCA 1OTEA 3MKEA 1PW8A 4HY8A 1S4RA 3L7HA 4WMCA 3C4PA 4EQ1A 3BECA 5E43A 4GD6A 3UPNA 1XFNA 2BASA 4HEFA 4KG6A 1GSVA 4DE3A 5L09A 3BY9A 2M7VA 2ZOIA 1GCEA 4QJGA 5F1FA 2ZQAA 2HP9A 3NOUC 3EGXC 3JVVA 2ZJ9A 1U60A 2XRNA 1CF0A 3N4IA 4KUOA 1S4SA 5CECA 1SKFA 4PM7A 3IH8A 2ZBBA 1G28A 4P6ZM 5E2GA 1JWVA 1TS7A 2VEAA 2ZC5B 1MXOA 3C38A 1EW0A 4OPZA 3CAXA 3ZG7B 4R3BA 4U0TA 3IF6A 4MBKA 4DJ2A 1V9YA 3C7VA 3KYZA 3IS2A 4BLMA 2INWA 3UE6A 4CLCB 3AGEA 5M19A 1IOUA 3NIAA 2OSUA 1TS8A 3ZVTA 1BZAA 1H8YA 4NETA 4UA9A 4NEED 3RTYA 2O9CA 2W3FA 4OLGA 3M6BA 4R0QA 5KSCA 2JE5A 2RL3A 1YMSA 1E3UA 4E3MA 4EBLA 3SS4A 3HLCA 1FCOA 3DTMA 2JC7A 3ZG5A 4PAUA 4E04A 4C3QA 4L0LA 3Q7VA 4X6TA 3FWLA 4CLCC 3UNWA 3TW8A 1H0MA 1H8MA 4EUVA 5GHXA 4E3NA 5FAPA 1K54C 4NXFA 2XK1A 4FCFA 5J7EA 4I3IA 3N8LA 4S2JA 2JKRM 4RA7A 4Y15A 1W8YA 3PYPA 3G6OA 2PHYA 3GECA 1ERQA 3MR0A 1AXBA 2VKSA 4H6JB 4NG2A 2VK3A 2RCXA 2HJEA 2WGWB 3WS5A 3UB6A 4WBGA 4BBVA 4RX3A 2O0YA 3LIEA 4MNRA 1TF1A 1WA9A 4JF4A 4E6XA 1WE4A 3T4LA 1OTDA 2W0NA 3GV9A 3LIFA 4HBUA 4KZAA 2E8IA 2PDRA 1T1CA 4Y7PA 2XR0A 2Y2MA 1VB6A 1GA0A 4M4XA 5TR7A 4GD8A 3F1PA 1BULA 1HVBA 3GVBA 2O99A 4ZJ1A 3AGDA 1E4DA 1GA9A 4OH0A 5C5KA 1UWPX 1G6AA 3W4QA 3LR3A 2OV5A 3GMWA 1VEUB 3N8SA 3EEAA 1FR6A 1H5XA 1HD8A 5GLDA 4C75A 1TD5A 2XSSA 3V39A 1OJ5A 3CPTA 5TJJA 1W63M 3NY4A 2WUQA 3BY8A 4F3LB 4DF6A 3PTEA 4Y0OA 3MXSA 4JGPA 2C5WB 4Q0JA 4JXSA 2P9VB 4ESPA 2V9AA 2EX6A 1XJ6A 3VOYA 3MKFA 1CEGA 2H5SA 5D3OA 3QP4A 1NZUA 1NZOA 3HLGA 1GHPA 4GHIB 3CJMA 3H7WA 3CLOA 4Z1WA 2GJ3A 3LIBA 2YKFA 5FASA 1RP5A 4HJ6A 3VFHA 2HF6A 5F82A 1CEFA 3VOLA 3VSKA 1WYBA 4E3IA 4LRZE 2LB5A 4BWIA 4P6ZS 1SZVA 2O9AA 3QP8A 4LV3A 3T1XA 4OQGA 4XT2A 3NI9A 4HP9A 4OP5A 1K6SA 3LR0A 1SKOB 2Y4AA 5TBMA 4FTXA 2K2NA 2WKPA 2PR6A 3C2WA 4LLOB 1IYOA 1KVLA 4QD4A 3NJAA 3G2YA 4NXEA 1ONHA 2VGJA 1DJAA 2ZMVA 5FEFA 3IX8A 3GR2A 1PW1A 2B02A 3WS4A 4R3JA 1Q2QA 3ZG9B 4KQRA 5TFQA 1DP6A 3ZNTA 3HREA 1MWRA 1T1BA 3SH9A 4LGWA 3ITBA 2ZMAA 1BT5A 3PBNA 1P9WA 3E4OA 2OAQ1 1K6RA 3IF6B 2PU4A 1BLHA 2D02A 1S6RA 5G18A 4RX2A 3LO7A 2Y2NA 3ZGAB 3KSGA 1YAXA 2XD1A 4BMWA 2HV1A 2EWWA 3A0VA 4DDYA 3BYDA 4PPRA 3TOIA 5HL6A 2DRWA 4DRTA 3G34A 4G3VA 4O8GA 4CLCA 3SZTA 5HPIA 5I5LA 3O86A 1SCWA 3WRTA 5FQJA 4JGOA 5CGWA 2QJ7A 4WLAA 4HBTA 4DJ3A 5G4YA 2OLVA 3Q7VB 5CGXA 5EPHA 2KLIA 2KX6A 2C6WB 1XGJA 4KZ4A 3VP1A 5EV0A 3IBRA 2L0WA 4D60A 5HDCA 4GN2A 5CHUA 2ZQ8A 4FSFA 4ETZA 1L2SA 3LCEA 3TG9A 3H82B 3BRMA 2WKIA 3FC7A 5F6AA 2R78A 3N6IA 1LL8A 2W1TA 4OPRA 1D1JA 2NUTC 5CERA 1NYYA 1A0KA 1XX2A 3ZG0A 4HNBA 3PBTA 1XP4A 4DXCA 1ZKJA 5EVLA 1FSYA 3VOZA 3BFFA 2BG1A 3VP4A 5L2FA 2B95A 3P7NA 3HLWA 2EFXA 4H6JA 1LI0A 1Z09A 2J9OA 4JF6A 2XH9A 3CZDA 4O7DA 5FSRA 1EWZA 3M2KA 1ODVA 5EECA 1OMEA 3NOPC 2ZC4B 2PD7A 2H10A 4QU3A 2VJWA 4IJGA 2DMWA 1Y28A 4EETB 1AWIA 4MDZA 3ZFZA 3HCYA 2E8JA 3ZCZA 4Q0IA 1OTIA 3LR4A 3S22A 2XD5A 2VV6A 3PR6A 2KOIA 5HWTA 2Y79A 4HHDA 4JLFA 4MCWA 2J8YA 1KE3A 2HDQA 3SOIA 3DAVA 1MKIA 2FFFB 2DNSA 2EX9A 3D3OA 5HARA 1HTZA 1DRMA 2I72A 3IXGA 1PIOA 3N7WA 1YT4A 1XFQA 1NRFA 4ETXA 2V1ZA 4OKPA 3LY3A 3IXDA 3D4FA 4DDSA 1V9ZA 4CLCD 3H7WB 2Y2QA 4R4RA 5BOHA 1YLTA 2PBYA 3T4TA 3C5AA 1FILA 4LCMA 3C8CA 3T4QA 4ZJ3A 3E2LA 2L1MA 1BSGA 3T50A 2OOLA 4GCZA 3PHYA 2YKHA 4GHIA 5EFWA 2WK0A 3MF0A 3HVFA 3T4JA 2BTFP 1M40A 5FQQA 3C4OA 1L0GA 2X02A 1F98A 2WAFA 4XT2B 5DFYA 2H0YA 2Z6CA 4ZJ2A 2FZ0A 5KIZA 1TS0A 4X55A 1GSWA 2Q9MA 2VA0A 3E2KA 1PRQA 1YMXA 5F83A 3VE4A 3K3DA 3UN7A 3EOIA 4NXGA 3NC8A 3UY6A 4WEJA 3MQOA 5HWVA 3V50A 2UWXA 1SKOA 4P0MA 1KGFA 4RYEA 1ES3A 4K08A 5EVIA 3LY4A 3S4XA 1LL9A 1JWPA 1HLUP 4Y0UA 4XUZA 4OQ0A 3LEQA 4R4SA 4BL2A 3IXBA 3B33A 4WEKA 1XJ4A 4Y2FA 2WKQA 4X69A 4DN0A 4DXBA 4HI4A 2ZLYA 3EQUA 1BLPA 5CHMA 2BLSA 5HAQA 5JYPA 1ESIA 4Y5FA 2WKEA 4ZTKA 1K38A 2XQZA 3CMZA 5GHYA 4AFIA 1H8ZA 2Y2LA 1HZOA 4KQQA 1XJ2A 3IX4A 4R3AA 5FEGA 4D2OA 2XA7M 4FH4A 3WS2A 3HLDA 4LPZA 3VMAA 1L0DA 2ACGA 4NKPA 4G3WA 1BLCA 2Y91A 3MBZA 4S2NC 5MC7A 5DTSA 2W1TB 3G4PA 2PRFA 3ICYA 4M3KA 1BLSA 1GHIA 2IA2A 3IXHA 3P98A 3KYQA 1F5MA 1ES5A 4CPKA 1CK3A 3H82A 2QWSA 1FIKA 3IT9A 3KSIA 3U2AA 2V20A 1VM1A 1QMFA 2XEPA 3EEHA 2QPNA 1KGEA 4JGQA 5F5YA 1FCMA 1XA1A 3LFVA 4R23A 5HL1A 4Q8IA 3UDFA 2Y2HA 1MWSA 3SW1A 1CJFA 4R38A 2K7SA 2OWJA 5FDSA 5CEDA 5HWWA 1DP8A 4OPQA 1YSPA 3HUOA 3NDGA 4G3KA 2EA9A 3T4SA 3QHYA 1PZPA 3A3EA 3HUNA 4WMCD 4HIAA 2ZOHA 4N1HA 3P01A 2DCFA 4Y0TA 4R1GA 1IELA 4MN6A 4ARZA 4QWOA 1FOFA 1RGZA 2A2LA 4CJNA 3A3IA 1JTDA 5CXWA 3VE3A 1XPBA 4LCLA 1FR1A 4YOFA 5F68A 1LHYA 2EWVA 2A24B 1KGGA 1N9LA 4YINA 4BQMA 4IUHA 4Y13A 4EQIA 5GLAA 2ZC3B 3O87A 4U0XA 2ZQ7A 2B18A 1MZUA 1IKGA 1TEMA 1IYQA 2JHEA 1L3LA 4GJ4A 4OQIA 4WZ5A 3T12B 1VQQA 5HX9A 2O9BA 3VV4A 1OT6A 4PHTA 3A0RA 4NXBA 5LBRA 1ZG4A 3NBLA 2WADA 4OLDA 1E25A 3BJNA 1E3UD 1G68A 2CC1A 4KZ7A 4O01A 3OZHA 5L10A 1ZHHB 2V0UA 4KQOA 4PM8A 2V1AA 4KZ5A 2VLGA 3MJQA 5GL9A 3FZCA 3HLEA 3OBFA 1BUEA 3UE0A 3KX0X 1GSXA 2G2WA 3GSGA 5CTNA 1PZOA 1UGUA 2PR5A 1NLYA 2ZM0A 1NY0A 4E3OA 5AJGA 3V3SA 2Y8HA 3LYXA 4GZBA 3O88A 2VGLM 5HDDA 3RXWA 4UEYA 4JF5A 4WM9A 3OC2A 1XXMA 2JCHA 4E3JA 1NJ4A 2XF3A 3D9YA 2QYBA 4FOFA 4FD8A 2XA7S 5J8XA 4PM6A 1DY6A 2WYXA 5EVIB 2QKPA 3A3DA 3DW0A 5TGFA 2H0TA 5HD3A 3F1OB 3R4KA 3T1RA 3Q81A 5IS1A 2FH5A 4EEUA 1S0WA 5HPFA 3CUEC 4GLQA 1X0OA 1OT9A 4K0WA 2X71A 3HBRA 5CHJA 3SS3A 4BL3A 3GTCA 2KDKA 1J9MA 4BBTA 4GS9A 3K3CA 2Z2MB 1O7EA 4IHQA 1YLPA 3E98A 3JYIA 3ULFA 2M1CA 5EVIC 3IH9A 2V0WA 4PKYA 1XGIA 2QHKA 1NXYA 1KVMA 1LT0A 2P08A 5FATA 3LIAA 4ME4A 1MBLA 1OJGA 2W3EA 4P85A 1S67L 2PU2A 1VHMA 5FQKA 4LV0A 3TSGA 3RFBA 3N8RA 5FL3A 1JVJA 4S2NA 2W1RA 4IVIA 3CI6A 1XJ3A 4FH2A 2HGVA 4DKIA 1JWZA 3MQ0A 5AQAA 3O5YA 3UB9A 2PYRA 1CI8A 4EUZA 2V2FF 2Y2JA 1YLZA 2ZM2A 4HH3A 1N9OA 2OWHA 4Y3IA 5DTTA 2J3TC 2D01A 4Q0HA 3R7WB 4WUJA 4B4XA 3QP6A 4B4ZA 4GW9A 3Q7ZA 4X1MA 1KDWA 5EOEA 5E2HA 3JPUA 1C3BA 2XROA 3QP5A 1SDNA 4MN5A 5J4EA 1STZA 3IQAA 2WZZA 1Z6FA 1W63Q 4JKTA 4I3JA 5CEBA 3PBSA 2Q0OA 5CRFA 3D72A 3OPLA 4U3TA 3WS0A 4DE2A 2WKHA 2QMIA 1I5QA 4BENA 1K55C 3DWKA 3UE3A 1TS6A 4WL9A 3LI9A 5F69A 4XXRA 5A91A 4ARZB 3Q82A 1YPRA 3L9KA 3BEBA 3AGFA 1FSWA 3NULA 5EUAA 4N9LA 4OPYA 4IBXA 2I9VA 1IEMA 3LUQA 2QJ5A 4B9OA 4GDBA 2PT7A 1EROA 3S7NA 2PBDP 3OPPA 3B42A 2CMNA 3UMDA 1YM1A 1ACFA 4OOMA 1EI5A 3T4OA 3TRCA 1PFLA 2P74A 2A24A 3HJIA 3V3RA 2VGLS 4GKUA 3HLFA 1W79A 4L9FA 2WZXA 3QP1A 3DTIA 3ITAA 3A3FA 1L0FA 5EM1A 5K5BA 5DFXA 5IT5A 4X25A 4GDNA 5GLBA 1PNEA 2GX5A 3G32A 3FYZA 5DF8A 4XUXA 1OTAA 2ZQDA 3EGDC 4UQIM 5HW3A 1WYCA 1LL5A 4WZ5C 3NOTC 3WRZA 3IF5A 3O3VA 4EERA 2J3WA 5DKKA 3MFXA 4B88A 4HJ4A 1S1ZA 1J3WA 2VV8A 3ZHHA 2ZD8A 3K2NA 5A8BA 2EX8A 4IVKA 1P9RA 1W5DA 5A90A 1PI4A 5GHZA 3F1NB 3CHWP 4EWFA 2XFSA 2K31A 1IYPA 3ISGA 1K4FA 1T18A 3NCKA 4MBFA 4MMNA 4A5RA 2G7UA 3OPHA 5J3WA 3MMHA 3MQQA 3SH7A 4BD0A 2WKRA 4QPRA 2Y59A 2ZC6B 5DJTA 5A93A 1O07A 3CUEA 3TJZC 4I39A 5DF7A 5FQIA 2HP5A 4II7A 4OOLA 5EE8A 3SS5A 3UDXA 3S7OA 1SHVA 3DTEA 3DBAA 5FQMA 3W4OA 1CI9A 1F2KA 4KZ3A 4RVAA 3JVUA 4ZDXA 4GS9B 2WAEA 3F1OA 4EBNA 1PWDA 1N4OA 3EWKA 4CLCE 1RCJA 4EEPA 3CWFA 2JBFA 2R9XA 1D06A 5DVAA 2M7UA 3BFDA 2V1BA 3LICA 3G35A 5FDHA 1MC0A 4KENB 4BJPA 1K56A 4PM9A 2HJ9C 3MSHA 1N9BA 4HESA 1FQGA 5IU1A 3GRJA 4JBFA 3E4QA 1D7EA 2EFUA 2A3UA 2NUPC 3T1QB 3I7JA 4QY6A 1XKZA 4E3LA 5G4ZA 4MN7A 3IWOA 4HOIA 5CGSA 1ESUA 5HDSA 2Y2KA 3MZDA 3WS1A 3FKWA 4JPMA 2JKTI 4LV1A 4ID4A 3PAGA 4S2KA 2EX2A 4DMZA 3R7WA 4N9KA 1IFQA 4WYYA 4ZAMA 3OPRA 4MEZA 3BW6A 1YSQA 4X68A 4KG5A 4HJ3A 4KZBA 3RH8B 5AVFA 2B5RA 4NK3A 1ALQA 3UPPA 4JXVA 1K55A 2HDUA 4IUKA 1KOUA 1MPLA 3LGOA 4B93A 5KSHA 4E3KA 2GNXA 4OONA 4LV2A 4X53A 3C7UA 3OCNA 2ZQCA 5EVEA 4MLLA 4UQIS 4JGRA 1KE4A 4KZ6A 3W2ZA 3ZVWA 4UHUA 3S7PA 3KO6A 5KZHA 2HDRA 3HJKA 1OPXA 2Y2PA 5EVID 3UE1A 1LSWA 2Z2LB 5HFOA 1IKIA 5M1AA 5E2FA 1ZTUA 4I3AA 4X56A 1VETB 5HAPA 4QB8A 3U4LP 3IHBA 4H8RA 3MZFA 4MBHA 3A0SA 5EM0A 3VP3A 5EOOA 4LFUA 4PMAA 1M6KA 3IX3A 3G30A 3OCLA 2FFYA 1DJCA 3GDIA 4UAAA 2ZL1A 3W8KA 3BLMA 5L8MA 5DJUA 3UMEA 1YLJA 1K56D 1S66L 3LEZA 4GNUA 5JYOA 2J7VA 2OLUA 3CITA 5IHVA 4HH2A 3ZG8B 3QNBA 3P09A 5AQBA 2Y2GA 2PYPA 3FPWA 3MXQA 3BFEA 2J3TD 2ZQ9A 5M18A 1YQSA 4OOYA 1G5UA 3PBQA 1KDSA 4OQHA 4KQDA 3V67A 2HP6A 1ZC2A 4S2IA 1DJBA 4OP8A 2MJ6A 3BFCA 1TDLA 2P04A 5FQ9A 2IWDA 4KUKA 2H28A 1T19A 3C30A 1IYSA 3RXXA 3F1NA 2HZ5A 4EESA 1T1AA 4S2MA 4N92A 4RQ9A 4JXGA 1L0EA 3OOVA 1YKDA 1SDEA 3HUMA 1Y54A 3MZEA 1MKMA 2J80A 4EW7A 3UO9A 4R6LA 5I94A 1W7FA 1NWZA 4E6WA 1P97A 4KG2A 4ZRRA 4IBRA 2W3HA 1K57C 1NRJA 5HD5A 4S2OA 3HLBA 4X1LA 5AQ7A 1S1YA 4DE0A 1I2SA 2XFTA 3M2JA 3QP2A 3FG8A 4GOGA 4N1XA 3ZDJA 4HP4A 4WF0A 2G2UA 1PWCA 3SH8A 4QHCA 1FCNA 1P0ZA 4L9GA 4S2PA 4R70A 2JKTM 1ES4A 1LI9A 1MWUA 3MFDA 3HL9A 3NECA 4KZ8A 1G6OA 4LENA 1LSXA 3A3JA 2Y2IA 2W27A 4ZBEA 5FI2A 2ZC7A 5HSQA 1H3QA 2PD8A 2JKFA 1OTBA 1LLBA 3IS2B 2QZ6A 3WWXA 1PYYA 2W3DA 2XGNA 2W3GA 3UB5P 4FUWA 4K0XA 3BLSA 1TDGA 4PKYG 1JTGA 1K0KA 4UA7A 3VP0A 3T4KA 3DWZA 4L9EA 4P87A 3OLOA 4EV4A 5A92A 3ZQ5A 3IF6C 3BQ8A 5FAQA 3UDIA 1ONGA 4LRXC 3DTKA 2WGVA 3PXPA 1XA7A 3IHAA 5CX7A 4DE1A 1K54A 1I2WA 2JN7A
chains in the Genus database with same CATH topology
2GJ3A 2IA2A 3LIBA 2YKFA 4YNRA 3KYQA 1P9RA 1F5MA 5HZHA 4HJ6A 3F1NB 2HF6A 3FPVA 3H82A 2K31A 2QWSA 3VOLA 3KSIA 3U2AA 4LRZE 1T18A 2LB5A 3EEHA 4MMNA 2G7UA 4BWIA 4P6ZS 3PBRA 2O9AA 5J3WA 3UB8A 3MMHA 3MQQA 4JGQA 5F5YA 4XT2A 2WKRA 4QPRA 2OAP1 5DJTA 3KSHA 3LFVA 3S7QA 4HP9A 3SW1A 3CUEA 4R38A 2K7SA 2OWJA 3TJZC 5HWWA 3LR0A 1DP8A 3LI8A 4I39A 5DKLA 5TBMA 1YSPA 4II7A 4OOLA 4I5SA 2K2NA 2WKPA 2PR6A 3S7OA 3C2WA 3DBAA 2EA9A 4G3KA 4LLOB 3T4SA 3NJAA 3JVUA 4HIAA 2ZOHA 4GS9B 3P01A 4NXEA 1JNUA 4BBUA 3F1OA 2ZMVA 3EWKA 4CLCE 4MN6A 4ARZA 3TE8A 2B02A 3CWFA 4EEPA 2A2LA 1DP9A 3LIDA 1BYWA 1D06A 3BQAA 3VE3A 4WN5A 1DP6A 3F1PB 4YOFA 5F68A 2VZWA 2EWVA 1T1BA 2M7UA 2A24B 1N9LA 2V1BA 3LICA 2JKRI 2VX8A 1MC0A 4IUHA 3PBNA 4BJPA 1P9WA 4O0PA 3E4OA 2OAQ1 3PBOA 2HJ9C 2B18A 3NHQA 1MZUA 2D02A 2JHEA 2L4RA 4GJ4A 1LSVA 4WELA 3UB7A 5IU1A 2P7JA 3E4QA 1D7EA 3KSGA 2O9BA 1YAXA 3BWLA 2NUPC 4BMWA 2HV1A 2EWWA 3A0VA 1OT6A 4PHTA 3VV4A 3E0YA 3B47A 3A0RA 4NXBA 1F9IA 1NLZA 5HL6A 5LBRA 2ZMFA 5G4ZA 4G3VA 4O8GA 4CQHA 5AVEA 4MN7A 4CLCA 5HPIA 3KSFA 5I5LA 3BJNA 3IBJA 4HOIA 2Z6DA 4JGOA 4YWZA 2QJ7A 4WLAA 4DJ3A 5G4YA 2KLIA 2KX6A 4F3LA 4O01A 3IBRA 5HDSA 2L0WA 5HDCA 1ZHHB 3EQVA 2V0UA 4KQOA 2V1AA 4I38A 2JKTI 4FSFA 2VLGA 3MJQA 4ETZA 3H82B 4DMZA 1UWNX 3OBFA 3R7WA 3KX0X 1IFQA 3FC7A 1GSXA 5F6AA 2R78A 1LL8A 2LB9A 3ZYTA 1UGUA 2W1TA 3BW6A 4EU0A 4LRYC 5DF9A 1N9NA 1YSQA 2PR5A 1NLYA 4EXOA 5AJGA 4HJ3A 3RH8B 2NUTC 5AVFA 2Y8HA 3LYXA 2GZAA 2VV7A 4HNBA 2VGLM 3E4PA 4IUKA 4HQAA 5HDDA 4UEYA 3CLOA 3PBTA 1KOUA 3OC2A 4B93A 5KSHA 2GNXA 5TBMB 2QYBA 3OCNA 4FOFA 4UQIS 2XA7S 4JGRA 3P7NA 3W2ZA 3H9WA 4H6JA 2QKPA 3S7PA 3LR5A 3KO6A 3HJKA 1ODVA 5HD3A 1OPXA 3F1OB 3NOPC 1OTEA 3R4KA 5IS1A 4HY8A 1LSWA 1S4RA 2FH5A 2PD7A 4EEUA 2VJWA 4IJGA 4EQ1A 1ZTUA 3CUEC 4GLQA 5HPFA 1X0OA 2DMWA 1Y28A 4EETB 4I3AA 1OT9A 4MDZA 3HCYA 1XFNA 2KDKA 4BBTA 4Q0IA 4GS9A 3K3CA 2BASA 1GSVA 3A0SA 3BY9A 4IHQA 3E98A 1OTIA 3ULFA 3LR4A 2M1CA 2M7VA 2ZOIA 2VV6A 3PR6A 2KOIA 2V0WA 4PKYA 3NOUC 2QHKA 3EGXC 3OCLA 3JVVA 2Y79A 3GDIA 4HHDA 4MCWA 1LT0A 2P08A 5HWTA 2XRNA 3LIAA 4KUOA 1S4SA 4ME4A 5L8MA 2ZBBA 5DJUA 1G28A 1OJGA 4P6ZM 3UMEA 2W3EA 1TS7A 1S66L 2VEAA 3C38A 1EW0A 1S67L 3D3OA 1VHMA 3CAXA 1DRMA 3CITA 4HH2A 3RFBA 5FL3A 1XFQA 4DJ2A 2W1RA 1V9YA 3KYZA 3IS2A 3CI6A 4ETXA 1XJ3A 2PYPA 3FPWA 3MXQA 2INWA 3UE6A 4CLCB 1IOUA 2HGVA 2J3TD 3MQ0A 1V9ZA 1TS8A 3O5YA 3PBQA 4KQDA 3UB9A 3V67A 4NEED 4CLCD 2PYRA 3H7WB 3RTYA 2O9CA 2W3FA 3T4TA 4HH3A 3C8CA 1N9OA 2MJ6A 2OWHA 4Y3IA 3T4QA 2J3TC 2P04A 2D01A 2L1MA 4Q0HA 3R7WB 4WUJA 3T50A 4GW9A 4PAUA 2OOLA 4KUKA 4E04A 2H28A 4L0LA 4GCZA 1T19A 4CLCC 3PHYA 2YKHA 4GHIA 5EFWA 3C30A 3MF0A 3T4JA 3TW8A 2XROA 1H8MA 4EUVA 1F98A 3F1NA 4XT2B 5DFYA 4MN5A 4NXFA 5J4EA 4EESA 1T1AA 1STZA 2Z6CA 5J7EA 4I3IA 4RQ9A 2FZ0A 5KIZA 1TS0A 3OOVA 1YKDA 1GSWA 1W63Q 2VA0A 2JKRM 3PYPA 3G6OA 2PHYA 3VE4A 1MKMA 4I3JA 3PBSA 2J80A 3GECA 3K3DA 4EW7A 3D72A 3EOIA 4R6LA 4NXGA 1NWZA 3MR0A 2VKSA 4H6JB 1P97A 4WEJA 3MQOA 5HWVA 4ZRRA 2HJEA 2W3HA 1NRJA 5HD5A 3UE3A 3UB6A 4BBVA 1S1YA 1TS6A 4WL9A 3LI9A 5F69A 4ARZB 2O0YA 3LIEA 1TF1A 1WA9A 4K08A 2I9VA 3FG8A 3T4LA 1OTDA 2W0NA 3LIFA 3LUQA 2QJ5A 4B9OA 2PT7A 3S7NA 2PDRA 1T1CA 4HP4A 3B42A 4WF0A 1VB6A 2CMNA 3UMDA 1P0ZA 3B33A 4L9GA 4OOMA 4WEKA 4R70A 2JKTM 1XJ4A 4Y2FA 2WKQA 4M4XA 4DN0A 4HI4A 3T4OA 3F1PA 3TRCA 3EQUA 2O99A 2A24A 1G6OA 3HJIA 1LSXA 2VGLS 4L9FA 5C5KA 4Y5FA 1UWPX 2W27A 3LR3A 5HSQA 1H3QA 3EEAA 2PD8A 4AFIA 5K5BA 1OTBA 1TD5A 3IS2B 5DFXA 2XSSA 1OJ5A 1XJ2A 5IT5A 5TJJA 2W3DA 2GX5A 4R3AA 1W63M 2W3GA 1OTAA 3EGDC 4UQIM 2XA7M 3BY8A 4F3LB 4LPZA 3NOTC 4PKYG 4JGPA 4EERA 2J3WA 4Q0JA 3T4KA 5DKKA 2V9AA 4L9EA 3MFXA 1XJ6A 4NKPA 4G3WA 3OLOA 4HJ4A 3ZQ5A 1S1ZA 2VV8A 3BQ8A 5MC7A 4LRXC 3PXPA 2W1TB 3K2NA 4GHIB 3H7WA 5CX7A 5A8BA 3ICYA 4Z1WA 2JN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GJ3 A;  3LIB A;  2YKF A;  5HZH A;  4HJ6 A;  3F1N B;  3H82 A;  2QWS A;  3VOL A;  4LRZ E;  1T18 A;  3EEH A;  5J3W A;  3UB8 A;  3MQQ A;  4JGQ A;  5F5Y A;  4XT2 A;  2WKR A;  5DJT A;  4HP9 A;  3SW1 A;  4R38 A;  2K7S A;  2OWJ A;  5HWW A;  1DP8 A;  3LI8 A;  4I39 A;  5DKL A;  5TBM A;  4I5S A;  2WKP A;  2PR6 A;  3C2W A;  2EA9 A;  4LLO B;  3NJA A;  4HIA A;  2ZOH A;  4GS9 B;  4NXE A;  1JNU A;  4BBU A;  3F1O A;  3EWK A;  4MN6 A;  2B02 A;  3CWF A;  4EEP A;  1DP9 A;  3LID A;  1BYW A;  1D06 A;  3VE3 A;  4WN5 A;  1DP6 A;  3F1P B;  5F68 A;  1T1B A;  2A24 B;  1N9L A;  2V1B A;  3LIC A;  3E4O A;  3NHQ A;  1MZU A;  2D02 A;  2JHE A;  2L4R A;  1LSV A;  3UB7 A;  5IU1 A;  2P7J A;  3E4Q A;  1D7E A;  3BWL A;  2HV1 A;  3A0V A;  1OT6 A;  3A0R A;  4NXB A;  1F9I A;  5G4Z A;  5AVE A;  5I5L A;  4HOI A;  2Z6D A;  4JGO A;  4YWZ A;  2QJ7 A;  4WLA A;  4DJ3 A;  5G4Y A;  2KX6 A;  4F3L A;  3IBR A;  5HDS A;  2L0W A;  5HDC A;  2V0U A;  2V1A A;  4I38 A;  2VLG A;  3MJQ A;  3H82 B;  1UWN X;  3KX0 X;  3FC7 A;  1GSX A;  5F6A A;  2R78 A;  1LL8 A;  1UGU A;  4LRY C;  4EXO A;  1N9N A;  2PR5 A;  4HJ3 A;  3RH8 B;  5AVF A;  3LYX A;  2VV7 A;  4HNB A;  3E4P A;  4HQA A;  5HDD A;  3CLO A;  1KOU A;  5TBM B;  4JGR A;  3P7N A;  3H9W A;  4H6J A;  2QKP A;  3HJK A;  1ODV A;  5HD3 A;  3F1O B;  3NOP C;  1OTE A;  5IS1 A;  4HY8 A;  1LSW A;  1S4R A;  2PD7 A;  4EEU A;  4EQ1 A;  1X0O A;  1Y28 A;  4EET B;  4I3A A;  1OT9 A;  1XFN A;  2KDK A;  4BBT A;  4GS9 A;  3K3C A;  2BAS A;  1GSV A;  3A0S A;  3BY9 A;  1OTI A;  3ULF A;  2M1C A;  2ZOI A;  2VV6 A;  2V0W A;  4PKY A;  3NOU C;  2QHK A;  5HWT A;  3GDI A;  4HHD A;  1LT0 A;  3LIA A;  4KUO A;  1S4S A;  2ZBB A;  5DJU A;  1G28 A;  1OJG A;  3UME A;  1TS7 A;  1S66 L;  2VEA A;  1EW0 A;  1S67 L;  3CAX A;  1DRM A;  4HH2 A;  1XFQ A;  4DJ2 A;  1V9Y A;  3IS2 A;  1XJ3 A;  2PYP A;  3MXQ A;  2INW A;  3UE6 A;  1V9Z A;  1TS8 A;  4KQD A;  3UB9 A;  2PYR A;  3H7W B;  3RTY A;  4HH3 A;  3C8C A;  1N9O A;  2OWH A;  2D01 A;  2L1M A;  4WUJ A;  3T50 A;  4GW9 A;  2OOL A;  4KUK A;  4E04 A;  2H28 A;  4GCZ A;  1T19 A;  3PHY A;  2YKH A;  4GHI A;  5EFW A;  1F98 A;  3F1N A;  4XT2 B;  4MN5 A;  4NXF A;  5J4E A;  4EES A;  1T1A A;  2Z6C A;  5J7E A;  4I3I A;  4RQ9 A;  5KIZ A;  1TS0 A;  1GSW A;  3PYP A;  3G6O A;  2PHY A;  3VE4 A;  4I3J A;  2J80 A;  3GEC A;  3K3D A;  4EW7 A;  3D72 A;  4R6L A;  4NXG A;  1NWZ A;  3MR0 A;  4H6J B;  1P97 A;  3MQO A;  5HWV A;  5HD5 A;  3UB6 A;  4BBV A;  1S1Y A;  1TS6 A;  4WL9 A;  3LI9 A;  5F69 A;  3LIE A;  1WA9 A;  4K08 A;  2I9V A;  3FG8 A;  1OTD A;  2W0N A;  3LIF A;  3LUQ A;  2QJ5 A;  4B9O A;  2PDR A;  1T1C A;  4HP4 A;  4WF0 A;  1VB6 A;  2CMN A;  3UMD A;  1P0Z A;  3B33 A;  4L9G A;  4R70 A;  1XJ4 A;  2WKQ A;  4M4X A;  4HI4 A;  3F1P A;  2A24 A;  3HJI A;  1LSX A;  4L9F A;  1UWP X;  2W27 A;  5HSQ A;  2PD8 A;  1OTB A;  3IS2 B;  1OJ5 A;  1XJ2 A;  4R3A A;  1OTA A;  3BY8 A;  4F3L B;  4LPZ A;  3NOT C;  4PKY G;  4JGP A;  4EER A;  5DKK A;  2V9A A;  4L9E A;  3MFX A;  1XJ6 A;  3OLO A;  4HJ4 A;  3ZQ5 A;  1S1Z A;  2VV8 A;  4LRX C;  4GHI B;  5A8B A;  3H7W A;  3ICY A;  2JN7 A; 
#chains in the Genus database with same CATH topology
 2WGI A;  4YNR A;  5KMW A;  4YFM A;  5HZH A;  2ZM8 A;  3FPV A;  1RGY A;  5F1G A;  4PM5 A;  3G2Z A;  4QY5 A;  3VP2 A;  2VGK A;  2HPB A;  1TVF A;  3PBR A;  2A49 A;  3UB8 A;  3T1S A;  2AVX A;  2IWC A;  3G31 A;  1PI5 A;  1ERM A;  2OAP 1;  3KSH A;  2V8C A;  4EBP A;  3IWQ A;  3S7Q A;  4P6B A;  2GDN A;  5E2E A;  3LI8 A;  5DKL A;  3M6H A;  3Q1F A;  4K91 A;  1PWG A;  4I5S A;  1Y4O A;  1CQA A;  2IWB A;  1ZG6 A;  1NYM A;  5U47 A;  1K4E A;  1JNU A;  1GHM A;  4BBU A;  2UV0 E;  5CTM A;  2HDS A;  2X01 A;  2WGW A;  3TE8 A;  2XLN A;  2Q9N A;  4F94 A;  5FAO A;  3IWI A;  1VET A;  4WZ4 A;  2ZL1 B;  1DP9 A;  3LID A;  1BYW A;  4GB7 A;  3S1Y A;  3BQA A;  3MS6 A;  4WN5 A;  4UA6 A;  3F1P B;  5FA7 A;  3GQZ A;  2VZW A;  3MXR A;  2PAV P;  4S2L A;  2JKR I;  2VX8 A;  3W4P A;  4O0P A;  5FI7 A;  3PBO A;  5FI6 A;  3NHQ A;  2L4R A;  1MWT A;  1LSV A;  3CPT B;  4WEL A;  3UB7 A;  3ZNY A;  4IED A;  2P7J A;  1W8Q A;  1YLW A;  3KYE A;  3BWL A;  1MY8 A;  1YLY A;  1VEU A;  3E0Y A;  3VFF A;  3B47 A;  3B3X A;  1K25 A;  2EXB A;  1F9I A;  1NLZ A;  2ZMF A;  3Q07 A;  4CQH A;  5DTK A;  5AVE A;  3CG5 A;  3KSF A;  3IBJ A;  1ES2 A;  4JXW A;  5AQ9 A;  2Z6D A;  4YWZ A;  3BFG A;  2JKG A;  3V5M A;  4F3L A;  2Y2O A;  3EQV A;  2P9V A;  4I38 A;  2XDM A;  4C6Y A;  1UWN X;  4KZ9 A;  3FV7 A;  1BTL A;  2LB9 A;  3VSL A;  3ZYT A;  4EU0 A;  4LRY C;  5DF9 A;  1N9N A;  4EXO A;  3PAE A;  1Q2P A;  3BM6 A;  2R9W A;  4Y17 A;  2GZA A;  1KE0 A;  2VV7 A;  4OVD A;  3E4P A;  5L07 A;  4HQA A;  1K57 A;  3RJU A;  1QME A;  3NDE A;  5TBM B;  4Z9Q A;  3FKV A;  4BD1 A;  2EXA A;  2Y55 A;  2J9P A;  3H9W A;  2V8F A;  3LR5 A;  3UPO A;  5HAI A;  5GLC A;  3QNC A;  1OTE A;  3MKE A;  1PW8 A;  4HY8 A;  1S4R A;  3L7H A;  4WMC A;  3C4P A;  4EQ1 A;  3BEC A;  5E43 A;  4GD6 A;  3UPN A;  1XFN A;  2BAS A;  4HEF A;  4KG6 A;  1GSV A;  4DE3 A;  5L09 A;  3BY9 A;  2M7V A;  2ZOI A;  1GCE A;  4QJG A;  5F1F A;  2ZQA A;  2HP9 A;  3NOU C;  3EGX C;  3JVV A;  2ZJ9 A;  1U60 A;  2XRN A;  1CF0 A;  3N4I A;  4KUO A;  1S4S A;  5CEC A;  1SKF A;  4PM7 A;  3IH8 A;  2ZBB A;  1G28 A;  4P6Z M;  5E2G A;  1JWV A;  1TS7 A;  2VEA A;  2ZC5 B;  1MXO A;  3C38 A;  1EW0 A;  4OPZ A;  3CAX A;  3ZG7 B;  4R3B A;  4U0T A;  3IF6 A;  4MBK A;  4DJ2 A;  1V9Y A;  3C7V A;  3KYZ A;  3IS2 A;  4BLM A;  2INW A;  3UE6 A;  4CLC B;  3AGE A;  5M19 A;  1IOU A;  3NIA A;  2OSU A;  1TS8 A;  3ZVT A;  1BZA A;  1H8Y A;  4NET A;  4UA9 A;  4NEE D;  3RTY A;  2O9C A;  2W3F A;  4OLG A;  3M6B A;  4R0Q A;  5KSC A;  2JE5 A;  2RL3 A;  1YMS A;  1E3U A;  4E3M A;  4EBL A;  3SS4 A;  3HLC A;  1FCO A;  3DTM A;  2JC7 A;  3ZG5 A;  4PAU A;  4E04 A;  4C3Q A;  4L0L A;  3Q7V A;  4X6T A;  3FWL A;  4CLC C;  3UNW A;  3TW8 A;  1H0M A;  1H8M A;  4EUV A;  5GHX A;  4E3N A;  5FAP A;  1K54 C;  4NXF A;  2XK1 A;  4FCF A;  5J7E A;  4I3I A;  3N8L A;  4S2J A;  2JKR M;  4RA7 A;  4Y15 A;  1W8Y A;  3PYP A;  3G6O A;  2PHY A;  3GEC A;  1ERQ A;  3MR0 A;  1AXB A;  2VKS A;  4H6J B;  4NG2 A;  2VK3 A;  2RCX A;  2HJE A;  2WGW B;  3WS5 A;  3UB6 A;  4WBG A;  4BBV A;  4RX3 A;  2O0Y A;  3LIE A;  4MNR A;  1TF1 A;  1WA9 A;  4JF4 A;  4E6X A;  1WE4 A;  3T4L A;  1OTD A;  2W0N A;  3GV9 A;  3LIF A;  4HBU A;  4KZA A;  2E8I A;  2PDR A;  1T1C A;  4Y7P A;  2XR0 A;  2Y2M A;  1VB6 A;  1GA0 A;  4M4X A;  5TR7 A;  4GD8 A;  3F1P A;  1BUL A;  1HVB A;  3GVB A;  2O99 A;  4ZJ1 A;  3AGD A;  1E4D A;  1GA9 A;  4OH0 A;  5C5K A;  1UWP X;  1G6A A;  3W4Q A;  3LR3 A;  2OV5 A;  3GMW A;  1VEU B;  3N8S A;  3EEA A;  1FR6 A;  1H5X A;  1HD8 A;  5GLD A;  4C75 A;  1TD5 A;  2XSS A;  3V39 A;  1OJ5 A;  3CPT A;  5TJJ A;  1W63 M;  3NY4 A;  2WUQ A;  3BY8 A;  4F3L B;  4DF6 A;  3PTE A;  4Y0O A;  3MXS A;  4JGP A;  2C5W B;  4Q0J A;  4JXS A;  2P9V B;  4ESP A;  2V9A A;  2EX6 A;  1XJ6 A;  3VOY A;  3MKF A;  1CEG A;  2H5S A;  5D3O A;  3QP4 A;  1NZU A;  1NZO A;  3HLG A;  1GHP A;  4GHI B;  3CJM A;  3H7W A;  3CLO A;  4Z1W A;  2GJ3 A;  3LIB A;  2YKF A;  5FAS A;  1RP5 A;  4HJ6 A;  3VFH A;  2HF6 A;  5F82 A;  1CEF A;  3VOL A;  3VSK A;  1WYB A;  4E3I A;  4LRZ E;  2LB5 A;  4BWI A;  4P6Z S;  1SZV A;  2O9A A;  3QP8 A;  4LV3 A;  3T1X A;  4OQG A;  4XT2 A;  3NI9 A;  4HP9 A;  4OP5 A;  1K6S A;  3LR0 A;  1SKO B;  2Y4A A;  5TBM A;  4FTX A;  2K2N A;  2WKP A;  2PR6 A;  3C2W A;  4LLO B;  1IYO A;  1KVL A;  4QD4 A;  3NJA A;  3G2Y A;  4NXE A;  1ONH A;  2VGJ A;  1DJA A;  2ZMV A;  5FEF A;  3IX8 A;  3GR2 A;  1PW1 A;  2B02 A;  3WS4 A;  4R3J A;  1Q2Q A;  3ZG9 B;  4KQR A;  5TFQ A;  1DP6 A;  3ZNT A;  3HRE A;  1MWR A;  1T1B A;  3SH9 A;  4LGW A;  3ITB A;  2ZMA A;  1BT5 A;  3PBN A;  1P9W A;  3E4O A;  2OAQ 1;  1K6R A;  3IF6 B;  2PU4 A;  1BLH A;  2D02 A;  1S6R A;  5G18 A;  4RX2 A;  3LO7 A;  2Y2N A;  3ZGA B;  3KSG A;  1YAX A;  2XD1 A;  4BMW A;  2HV1 A;  2EWW A;  3A0V A;  4DDY A;  3BYD A;  4PPR A;  3TOI A;  5HL6 A;  2DRW A;  4DRT A;  3G34 A;  4G3V A;  4O8G A;  4CLC A;  3SZT A;  5HPI A;  5I5L A;  3O86 A;  1SCW A;  3WRT A;  5FQJ A;  4JGO A;  5CGW A;  2QJ7 A;  4WLA A;  4HBT A;  4DJ3 A;  5G4Y A;  2OLV A;  3Q7V B;  5CGX A;  5EPH A;  2KLI A;  2KX6 A;  2C6W B;  1XGJ A;  4KZ4 A;  3VP1 A;  5EV0 A;  3IBR A;  2L0W A;  4D60 A;  5HDC A;  4GN2 A;  5CHU A;  2ZQ8 A;  4FSF A;  4ETZ A;  1L2S A;  3LCE A;  3TG9 A;  3H82 B;  3BRM A;  2WKI A;  3FC7 A;  5F6A A;  2R78 A;  3N6I A;  1LL8 A;  2W1T A;  4OPR A;  1D1J A;  2NUT C;  5CER A;  1NYY A;  1A0K A;  1XX2 A;  3ZG0 A;  4HNB A;  3PBT A;  1XP4 A;  4DXC A;  1ZKJ A;  5EVL A;  1FSY A;  3VOZ A;  3BFF A;  2BG1 A;  3VP4 A;  5L2F A;  2B95 A;  3P7N A;  3HLW A;  2EFX A;  4H6J A;  1LI0 A;  1Z09 A;  2J9O A;  4JF6 A;  2XH9 A;  3CZD A;  4O7D A;  5FSR A;  1EWZ A;  3M2K A;  1ODV A;  5EEC A;  1OME A;  3NOP C;  2ZC4 B;  2PD7 A;  2H10 A;  4QU3 A;  2VJW A;  4IJG A;  2DMW A;  1Y28 A;  4EET B;  1AWI A;  4MDZ A;  3ZFZ A;  3HCY A;  2E8J A;  3ZCZ A;  4Q0I A;  1OTI A;  3LR4 A;  3S22 A;  2XD5 A;  2VV6 A;  3PR6 A;  2KOI A;  5HWT A;  2Y79 A;  4HHD A;  4JLF A;  4MCW A;  2J8Y A;  1KE3 A;  2HDQ A;  3SOI A;  3DAV A;  1MKI A;  2FFF B;  2DNS A;  2EX9 A;  3D3O A;  5HAR A;  1HTZ A;  1DRM A;  2I72 A;  3IXG A;  1PIO A;  3N7W A;  1YT4 A;  1XFQ A;  1NRF A;  4ETX A;  2V1Z A;  4OKP A;  3LY3 A;  3IXD A;  3D4F A;  4DDS A;  1V9Z A;  4CLC D;  3H7W B;  2Y2Q A;  4R4R A;  5BOH A;  1YLT A;  2PBY A;  3T4T A;  3C5A A;  1FIL A;  4LCM A;  3C8C A;  3T4Q A;  4ZJ3 A;  3E2L A;  2L1M A;  1BSG A;  3T50 A;  2OOL A;  4GCZ A;  3PHY A;  2YKH A;  4GHI A;  5EFW A;  2WK0 A;  3MF0 A;  3HVF A;  3T4J A;  2BTF P;  1M40 A;  5FQQ A;  3C4O A;  1L0G A;  2X02 A;  1F98 A;  2WAF A;  4XT2 B;  5DFY A;  2H0Y A;  2Z6C A;  4ZJ2 A;  2FZ0 A;  5KIZ A;  1TS0 A;  4X55 A;  1GSW A;  2Q9M A;  2VA0 A;  3E2K A;  1PRQ A;  1YMX A;  5F83 A;  3VE4 A;  3K3D A;  3UN7 A;  3EOI A;  4NXG A;  3NC8 A;  3UY6 A;  4WEJ A;  3MQO A;  5HWV A;  3V50 A;  2UWX A;  1SKO A;  4P0M A;  1KGF A;  4RYE A;  1ES3 A;  4K08 A;  5EVI A;  3LY4 A;  3S4X A;  1LL9 A;  1JWP A;  1HLU P;  4Y0U A;  4XUZ A;  4OQ0 A;  3LEQ A;  4R4S A;  4BL2 A;  3IXB A;  3B33 A;  4WEK A;  1XJ4 A;  4Y2F A;  2WKQ A;  4X69 A;  4DN0 A;  4DXB A;  4HI4 A;  2ZLY A;  3EQU A;  1BLP A;  5CHM A;  2BLS A;  5HAQ A;  5JYP A;  1ESI A;  4Y5F A;  2WKE A;  4ZTK A;  1K38 A;  2XQZ A;  3CMZ A;  5GHY A;  4AFI A;  1H8Z A;  2Y2L A;  1HZO A;  4KQQ A;  1XJ2 A;  3IX4 A;  4R3A A;  5FEG A;  4D2O A;  2XA7 M;  4FH4 A;  3WS2 A;  3HLD A;  4LPZ A;  3VMA A;  1L0D A;  2ACG A;  4NKP A;  4G3W A;  1BLC A;  2Y91 A;  3MBZ A;  4S2N C;  5MC7 A;  5DTS A;  2W1T B;  3G4P A;  2PRF A;  3ICY A;  4M3K A;  1BLS A;  1GHI A;  2IA2 A;  3IXH A;  3P98 A;  3KYQ A;  1F5M A;  1ES5 A;  4CPK A;  1CK3 A;  3H82 A;  2QWS A;  1FIK A;  3IT9 A;  3KSI A;  3U2A A;  2V20 A;  1VM1 A;  1QMF A;  2XEP A;  3EEH A;  2QPN A;  1KGE A;  4JGQ A;  5F5Y A;  1FCM A;  1XA1 A;  3LFV A;  4R23 A;  5HL1 A;  4Q8I A;  3UDF A;  2Y2H A;  1MWS A;  3SW1 A;  1CJF A;  4R38 A;  2K7S A;  2OWJ A;  5FDS A;  5CED A;  5HWW A;  1DP8 A;  4OPQ A;  1YSP A;  3HUO A;  3NDG A;  4G3K A;  2EA9 A;  3T4S A;  3QHY A;  1PZP A;  3A3E A;  3HUN A;  4WMC D;  4HIA A;  2ZOH A;  4N1H A;  3P01 A;  2DCF A;  4Y0T A;  4R1G A;  1IEL A;  4MN6 A;  4ARZ A;  4QWO A;  1FOF A;  1RGZ A;  2A2L A;  4CJN A;  3A3I A;  1JTD A;  5CXW A;  3VE3 A;  1XPB A;  4LCL A;  1FR1 A;  4YOF A;  5F68 A;  1LHY A;  2EWV A;  2A24 B;  1KGG A;  1N9L A;  4YIN A;  4BQM A;  4IUH A;  4Y13 A;  4EQI A;  5GLA A;  2ZC3 B;  3O87 A;  4U0X A;  2ZQ7 A;  2B18 A;  1MZU A;  1IKG A;  1TEM A;  1IYQ A;  2JHE A;  1L3L A;  4GJ4 A;  4OQI A;  4WZ5 A;  3T12 B;  1VQQ A;  5HX9 A;  2O9B A;  3VV4 A;  1OT6 A;  4PHT A;  3A0R A;  4NXB A;  5LBR A;  1ZG4 A;  3NBL A;  2WAD A;  4OLD A;  1E25 A;  3BJN A;  1E3U D;  1G68 A;  2CC1 A;  4KZ7 A;  4O01 A;  3OZH A;  5L10 A;  1ZHH B;  2V0U A;  4KQO A;  4PM8 A;  2V1A A;  4KZ5 A;  2VLG A;  3MJQ A;  5GL9 A;  3FZC A;  3HLE A;  3OBF A;  1BUE A;  3UE0 A;  3KX0 X;  1GSX A;  2G2W A;  3GSG A;  5CTN A;  1PZO A;  1UGU A;  2PR5 A;  1NLY A;  2ZM0 A;  1NY0 A;  4E3O A;  5AJG A;  3V3S A;  2Y8H A;  3LYX A;  4GZB A;  3O88 A;  2VGL M;  5HDD A;  3RXW A;  4UEY A;  4JF5 A;  4WM9 A;  3OC2 A;  1XXM A;  2JCH A;  4E3J A;  1NJ4 A;  2XF3 A;  3D9Y A;  2QYB A;  4FOF A;  4FD8 A;  2XA7 S;  5J8X A;  4PM6 A;  1DY6 A;  2WYX A;  5EVI B;  2QKP A;  3A3D A;  3DW0 A;  5TGF A;  2H0T A;  5HD3 A;  3F1O B;  3R4K A;  3T1R A;  3Q81 A;  5IS1 A;  2FH5 A;  4EEU A;  1S0W A;  5HPF A;  3CUE C;  4GLQ A;  1X0O A;  1OT9 A;  4K0W A;  2X71 A;  3HBR A;  5CHJ A;  3SS3 A;  4BL3 A;  3GTC A;  2KDK A;  1J9M A;  4BBT A;  4GS9 A;  3K3C A;  2Z2M B;  1O7E A;  4IHQ A;  1YLP A;  3E98 A;  3JYI A;  3ULF A;  2M1C A;  5EVI C;  3IH9 A;  2V0W A;  4PKY A;  1XGI A;  2QHK A;  1NXY A;  1KVM A;  1LT0 A;  2P08 A;  5FAT A;  3LIA A;  4ME4 A;  1MBL A;  1OJG A;  2W3E A;  4P85 A;  1S67 L;  2PU2 A;  1VHM A;  5FQK A;  4LV0 A;  3TSG A;  3RFB A;  3N8R A;  5FL3 A;  1JVJ A;  4S2N A;  2W1R A;  4IVI A;  3CI6 A;  1XJ3 A;  4FH2 A;  2HGV A;  4DKI A;  1JWZ A;  3MQ0 A;  5AQA A;  3O5Y A;  3UB9 A;  2PYR A;  1CI8 A;  4EUZ A;  2V2F F;  2Y2J A;  1YLZ A;  2ZM2 A;  4HH3 A;  1N9O A;  2OWH A;  4Y3I A;  5DTT A;  2J3T C;  2D01 A;  4Q0H A;  3R7W B;  4WUJ A;  4B4X A;  3QP6 A;  4B4Z A;  4GW9 A;  3Q7Z A;  4X1M A;  1KDW A;  5EOE A;  5E2H A;  3JPU A;  1C3B A;  2XRO A;  3QP5 A;  1SDN A;  4MN5 A;  5J4E A;  1STZ A;  3IQA A;  2WZZ A;  1Z6F A;  1W63 Q;  4JKT A;  4I3J A;  5CEB A;  3PBS A;  2Q0O A;  5CRF A;  3D72 A;  3OPL A;  4U3T A;  3WS0 A;  4DE2 A;  2WKH A;  2QMI A;  1I5Q A;  4BEN A;  1K55 C;  3DWK A;  3UE3 A;  1TS6 A;  4WL9 A;  3LI9 A;  5F69 A;  4XXR A;  5A91 A;  4ARZ B;  3Q82 A;  1YPR A;  3L9K A;  3BEB A;  3AGF A;  1FSW A;  3NUL A;  5EUA A;  4N9L A;  4OPY A;  4IBX A;  2I9V A;  1IEM A;  3LUQ A;  2QJ5 A;  4B9O A;  4GDB A;  2PT7 A;  1ERO A;  3S7N A;  2PBD P;  3OPP A;  3B42 A;  2CMN A;  3UMD A;  1YM1 A;  1ACF A;  4OOM A;  1EI5 A;  3T4O A;  3TRC A;  1PFL A;  2P74 A;  2A24 A;  3HJI A;  3V3R A;  2VGL S;  4GKU A;  3HLF A;  1W79 A;  4L9F A;  2WZX A;  3QP1 A;  3DTI A;  3ITA A;  3A3F A;  1L0F A;  5EM1 A;  5K5B A;  5DFX A;  5IT5 A;  4X25 A;  4GDN A;  5GLB A;  1PNE A;  2GX5 A;  3G32 A;  3FYZ A;  5DF8 A;  4XUX A;  1OTA A;  2ZQD A;  3EGD C;  4UQI M;  5HW3 A;  1WYC A;  1LL5 A;  4WZ5 C;  3NOT C;  3WRZ A;  3IF5 A;  3O3V A;  4EER A;  2J3W A;  5DKK A;  3MFX A;  4B88 A;  4HJ4 A;  1S1Z A;  1J3W A;  2VV8 A;  3ZHH A;  2ZD8 A;  3K2N A;  5A8B A;  2EX8 A;  4IVK A;  1P9R A;  1W5D A;  5A90 A;  1PI4 A;  5GHZ A;  3F1N B;  3CHW P;  4EWF A;  2XFS A;  2K31 A;  1IYP A;  3ISG A;  1K4F A;  1T18 A;  3NCK A;  4MBF A;  4MMN A;  4A5R A;  2G7U A;  3OPH A;  5J3W A;  3MMH A;  3MQQ A;  3SH7 A;  4BD0 A;  2WKR A;  4QPR A;  2Y59 A;  2ZC6 B;  5DJT A;  5A93 A;  1O07 A;  3CUE A;  3TJZ C;  4I39 A;  5DF7 A;  5FQI A;  2HP5 A;  4II7 A;  4OOL A;  5EE8 A;  3SS5 A;  3UDX A;  3S7O A;  1SHV A;  3DTE A;  3DBA A;  5FQM A;  3W4O A;  1CI9 A;  1F2K A;  4KZ3 A;  4RVA A;  3JVU A;  4ZDX A;  4GS9 B;  2WAE A;  3F1O A;  4EBN A;  1PWD A;  1N4O A;  3EWK A;  4CLC E;  1RCJ A;  4EEP A;  3CWF A;  2JBF A;  2R9X A;  1D06 A;  5DVA A;  2M7U A;  3BFD A;  2V1B A;  3LIC A;  3G35 A;  5FDH A;  1MC0 A;  4KEN B;  4BJP A;  1K56 A;  4PM9 A;  2HJ9 C;  3MSH A;  1N9B A;  4HES A;  1FQG A;  5IU1 A;  3GRJ A;  4JBF A;  3E4Q A;  1D7E A;  2EFU A;  2A3U A;  2NUP C;  3T1Q B;  3I7J A;  4QY6 A;  1XKZ A;  4E3L A;  5G4Z A;  4MN7 A;  3IWO A;  4HOI A;  5CGS A;  1ESU A;  5HDS A;  2Y2K A;  3MZD A;  3WS1 A;  3FKW A;  4JPM A;  2JKT I;  4LV1 A;  4ID4 A;  3PAG A;  4S2K A;  2EX2 A;  4DMZ A;  3R7W A;  4N9K A;  1IFQ A;  4WYY A;  4ZAM A;  3OPR A;  4MEZ A;  3BW6 A;  1YSQ A;  4X68 A;  4KG5 A;  4HJ3 A;  4KZB A;  3RH8 B;  5AVF A;  2B5R A;  4NK3 A;  1ALQ A;  3UPP A;  4JXV A;  1K55 A;  2HDU A;  4IUK A;  1KOU A;  1MPL A;  3LGO A;  4B93 A;  5KSH A;  4E3K A;  2GNX A;  4OON A;  4LV2 A;  4X53 A;  3C7U A;  3OCN A;  2ZQC A;  5EVE A;  4MLL A;  4UQI S;  4JGR A;  1KE4 A;  4KZ6 A;  3W2Z A;  3ZVW A;  4UHU A;  3S7P A;  3KO6 A;  5KZH A;  2HDR A;  3HJK A;  1OPX A;  2Y2P A;  5EVI D;  3UE1 A;  1LSW A;  2Z2L B;  5HFO A;  1IKI A;  5M1A A;  5E2F A;  1ZTU A;  4I3A A;  4X56 A;  1VET B;  5HAP A;  4QB8 A;  3U4L P;  3IHB A;  4H8R A;  3MZF A;  4MBH A;  3A0S A;  5EM0 A;  3VP3 A;  5EOO A;  4LFU A;  4PMA A;  1M6K A;  3IX3 A;  3G30 A;  3OCL A;  2FFY A;  1DJC A;  3GDI A;  4UAA A;  2ZL1 A;  3W8K A;  3BLM A;  5L8M A;  5DJU A;  3UME A;  1YLJ A;  1K56 D;  1S66 L;  3LEZ A;  4GNU A;  5JYO A;  2J7V A;  2OLU A;  3CIT A;  5IHV A;  4HH2 A;  3ZG8 B;  3QNB A;  3P09 A;  5AQB A;  2Y2G A;  2PYP A;  3FPW A;  3MXQ A;  3BFE A;  2J3T D;  2ZQ9 A;  5M18 A;  1YQS A;  4OOY A;  1G5U A;  3PBQ A;  1KDS A;  4OQH A;  4KQD A;  3V67 A;  2HP6 A;  1ZC2 A;  4S2I A;  1DJB A;  4OP8 A;  2MJ6 A;  3BFC A;  1TDL A;  2P04 A;  5FQ9 A;  2IWD A;  4KUK A;  2H28 A;  1T19 A;  3C30 A;  1IYS A;  3RXX A;  3F1N A;  2HZ5 A;  4EES A;  1T1A A;  4S2M A;  4N92 A;  4RQ9 A;  4JXG A;  1L0E A;  3OOV A;  1YKD A;  1SDE A;  3HUM A;  1Y54 A;  3MZE A;  1MKM A;  2J80 A;  4EW7 A;  3UO9 A;  4R6L A;  5I94 A;  1W7F A;  1NWZ A;  4E6W A;  1P97 A;  4KG2 A;  4ZRR A;  4IBR A;  2W3H A;  1K57 C;  1NRJ A;  5HD5 A;  4S2O A;  3HLB A;  4X1L A;  5AQ7 A;  1S1Y A;  4DE0 A;  1I2S A;  2XFT A;  3M2J A;  3QP2 A;  3FG8 A;  4GOG A;  4N1X A;  3ZDJ A;  4HP4 A;  4WF0 A;  2G2U A;  1PWC A;  3SH8 A;  4QHC A;  1FCN A;  1P0Z A;  4L9G A;  4S2P A;  4R70 A;  2JKT M;  1ES4 A;  1LI9 A;  1MWU A;  3MFD A;  3HL9 A;  3NEC A;  4KZ8 A;  1G6O A;  4LEN A;  1LSX A;  3A3J A;  2Y2I A;  2W27 A;  4ZBE A;  5FI2 A;  2ZC7 A;  5HSQ A;  1H3Q A;  2PD8 A;  2JKF A;  1OTB A;  1LLB A;  3IS2 B;  2QZ6 A;  3WWX A;  1PYY A;  2W3D A;  2XGN A;  2W3G A;  3UB5 P;  4FUW A;  4K0X A;  3BLS A;  1TDG A;  4PKY G;  1JTG A;  1K0K A;  4UA7 A;  3VP0 A;  3T4K A;  3DWZ A;  4L9E A;  4P87 A;  3OLO A;  4EV4 A;  5A92 A;  3ZQ5 A;  3IF6 C;  3BQ8 A;  5FAQ A;  3UDI A;  1ONG A;  4LRX C;  3DTK A;  2WGV A;  3PXP A;  1XA7 A;  3IHA A;  5CX7 A;  4DE1 A;  1K54 A;  1I2W A;  2JN7 A; 
#chains in the Genus database with same CATH homology
 2GJ3 A;  2IA2 A;  3LIB A;  2YKF A;  4YNR A;  3KYQ A;  1P9R A;  1F5M A;  5HZH A;  4HJ6 A;  3F1N B;  2HF6 A;  3FPV A;  3H82 A;  2K31 A;  2QWS A;  3VOL A;  3KSI A;  3U2A A;  4LRZ E;  1T18 A;  2LB5 A;  3EEH A;  4MMN A;  2G7U A;  4BWI A;  4P6Z S;  3PBR A;  2O9A A;  5J3W A;  3UB8 A;  3MMH A;  3MQQ A;  4JGQ A;  5F5Y A;  4XT2 A;  2WKR A;  4QPR A;  2OAP 1;  5DJT A;  3KSH A;  3LFV A;  3S7Q A;  4HP9 A;  3SW1 A;  3CUE A;  4R38 A;  2K7S A;  2OWJ A;  3TJZ C;  5HWW A;  3LR0 A;  1DP8 A;  3LI8 A;  4I39 A;  5DKL A;  5TBM A;  1YSP A;  4II7 A;  4OOL A;  4I5S A;  2K2N A;  2WKP A;  2PR6 A;  3S7O A;  3C2W A;  3DBA A;  2EA9 A;  4G3K A;  4LLO B;  3T4S A;  3NJA A;  3JVU A;  4HIA A;  2ZOH A;  4GS9 B;  3P01 A;  4NXE A;  1JNU A;  4BBU A;  3F1O A;  2ZMV A;  3EWK A;  4CLC E;  4MN6 A;  4ARZ A;  3TE8 A;  2B02 A;  3CWF A;  4EEP A;  2A2L A;  1DP9 A;  3LID A;  1BYW A;  1D06 A;  3BQA A;  3VE3 A;  4WN5 A;  1DP6 A;  3F1P B;  4YOF A;  5F68 A;  2VZW A;  2EWV A;  1T1B A;  2M7U A;  2A24 B;  1N9L A;  2V1B A;  3LIC A;  2JKR I;  2VX8 A;  1MC0 A;  4IUH A;  3PBN A;  4BJP A;  1P9W A;  4O0P A;  3E4O A;  2OAQ 1;  3PBO A;  2HJ9 C;  2B18 A;  3NHQ A;  1MZU A;  2D02 A;  2JHE A;  2L4R A;  4GJ4 A;  1LSV A;  4WEL A;  3UB7 A;  5IU1 A;  2P7J A;  3E4Q A;  1D7E A;  3KSG A;  2O9B A;  1YAX A;  3BWL A;  2NUP C;  4BMW A;  2HV1 A;  2EWW A;  3A0V A;  1OT6 A;  4PHT A;  3VV4 A;  3E0Y A;  3B47 A;  3A0R A;  4NXB A;  1F9I A;  1NLZ A;  5HL6 A;  5LBR A;  2ZMF A;  5G4Z A;  4G3V A;  4O8G A;  4CQH A;  5AVE A;  4MN7 A;  4CLC A;  5HPI A;  3KSF A;  5I5L A;  3BJN A;  3IBJ A;  4HOI A;  2Z6D A;  4JGO A;  4YWZ A;  2QJ7 A;  4WLA A;  4DJ3 A;  5G4Y A;  2KLI A;  2KX6 A;  4F3L A;  4O01 A;  3IBR A;  5HDS A;  2L0W A;  5HDC A;  1ZHH B;  3EQV A;  2V0U A;  4KQO A;  2V1A A;  4I38 A;  2JKT I;  4FSF A;  2VLG A;  3MJQ A;  4ETZ A;  3H82 B;  4DMZ A;  1UWN X;  3OBF A;  3R7W A;  3KX0 X;  1IFQ A;  3FC7 A;  1GSX A;  5F6A A;  2R78 A;  1LL8 A;  2LB9 A;  3ZYT A;  1UGU A;  2W1T A;  3BW6 A;  4EU0 A;  4LRY C;  5DF9 A;  1N9N A;  1YSQ A;  2PR5 A;  1NLY A;  4EXO A;  5AJG A;  4HJ3 A;  3RH8 B;  2NUT C;  5AVF A;  2Y8H A;  3LYX A;  2GZA A;  2VV7 A;  4HNB A;  2VGL M;  3E4P A;  4IUK A;  4HQA A;  5HDD A;  4UEY A;  3CLO A;  3PBT A;  1KOU A;  3OC2 A;  4B93 A;  5KSH A;  2GNX A;  5TBM B;  2QYB A;  3OCN A;  4FOF A;  4UQI S;  2XA7 S;  4JGR A;  3P7N A;  3W2Z A;  3H9W A;  4H6J A;  2QKP A;  3S7P A;  3LR5 A;  3KO6 A;  3HJK A;  1ODV A;  5HD3 A;  1OPX A;  3F1O B;  3NOP C;  1OTE A;  3R4K A;  5IS1 A;  4HY8 A;  1LSW A;  1S4R A;  2FH5 A;  2PD7 A;  4EEU A;  2VJW A;  4IJG A;  4EQ1 A;  1ZTU A;  3CUE C;  4GLQ A;  5HPF A;  1X0O A;  2DMW A;  1Y28 A;  4EET B;  4I3A A;  1OT9 A;  4MDZ A;  3HCY A;  1XFN A;  2KDK A;  4BBT A;  4Q0I A;  4GS9 A;  3K3C A;  2BAS A;  1GSV A;  3A0S A;  3BY9 A;  4IHQ A;  3E98 A;  1OTI A;  3ULF A;  3LR4 A;  2M1C A;  2M7V A;  2ZOI A;  2VV6 A;  3PR6 A;  2KOI A;  2V0W A;  4PKY A;  3NOU C;  2QHK A;  3EGX C;  3OCL A;  3JVV A;  2Y79 A;  3GDI A;  4HHD A;  4MCW A;  1LT0 A;  2P08 A;  5HWT A;  2XRN A;  3LIA A;  4KUO A;  1S4S A;  4ME4 A;  5L8M A;  2ZBB A;  5DJU A;  1G28 A;  1OJG A;  4P6Z M;  3UME A;  2W3E A;  1TS7 A;  1S66 L;  2VEA A;  3C38 A;  1EW0 A;  1S67 L;  3D3O A;  1VHM A;  3CAX A;  1DRM A;  3CIT A;  4HH2 A;  3RFB A;  5FL3 A;  1XFQ A;  4DJ2 A;  2W1R A;  1V9Y A;  3KYZ A;  3IS2 A;  3CI6 A;  4ETX A;  1XJ3 A;  2PYP A;  3FPW A;  3MXQ A;  2INW A;  3UE6 A;  4CLC B;  1IOU A;  2HGV A;  2J3T D;  3MQ0 A;  1V9Z A;  1TS8 A;  3O5Y A;  3PBQ A;  4KQD A;  3UB9 A;  3V67 A;  4NEE D;  4CLC D;  2PYR A;  3H7W B;  3RTY A;  2O9C A;  2W3F A;  3T4T A;  4HH3 A;  3C8C A;  1N9O A;  2MJ6 A;  2OWH A;  4Y3I A;  3T4Q A;  2J3T C;  2P04 A;  2D01 A;  2L1M A;  4Q0H A;  3R7W B;  4WUJ A;  3T50 A;  4GW9 A;  4PAU A;  2OOL A;  4KUK A;  4E04 A;  2H28 A;  4L0L A;  4GCZ A;  1T19 A;  4CLC C;  3PHY A;  2YKH A;  4GHI A;  5EFW A;  3C30 A;  3MF0 A;  3T4J A;  3TW8 A;  2XRO A;  1H8M A;  4EUV A;  1F98 A;  3F1N A;  4XT2 B;  5DFY A;  4MN5 A;  4NXF A;  5J4E A;  4EES A;  1T1A A;  1STZ A;  2Z6C A;  5J7E A;  4I3I A;  4RQ9 A;  2FZ0 A;  5KIZ A;  1TS0 A;  3OOV A;  1YKD A;  1GSW A;  1W63 Q;  2VA0 A;  2JKR M;  3PYP A;  3G6O A;  2PHY A;  3VE4 A;  1MKM A;  4I3J A;  3PBS A;  2J80 A;  3GEC A;  3K3D A;  4EW7 A;  3D72 A;  3EOI A;  4R6L A;  4NXG A;  1NWZ A;  3MR0 A;  2VKS A;  4H6J B;  1P97 A;  4WEJ A;  3MQO A;  5HWV A;  4ZRR A;  2HJE A;  2W3H A;  1NRJ A;  5HD5 A;  3UE3 A;  3UB6 A;  4BBV A;  1S1Y A;  1TS6 A;  4WL9 A;  3LI9 A;  5F69 A;  4ARZ B;  2O0Y A;  3LIE A;  1TF1 A;  1WA9 A;  4K08 A;  2I9V A;  3FG8 A;  3T4L A;  1OTD A;  2W0N A;  3LIF A;  3LUQ A;  2QJ5 A;  4B9O A;  2PT7 A;  3S7N A;  2PDR A;  1T1C A;  4HP4 A;  3B42 A;  4WF0 A;  1VB6 A;  2CMN A;  3UMD A;  1P0Z A;  3B33 A;  4L9G A;  4OOM A;  4WEK A;  4R70 A;  2JKT M;  1XJ4 A;  4Y2F A;  2WKQ A;  4M4X A;  4DN0 A;  4HI4 A;  3T4O A;  3F1P A;  3TRC A;  3EQU A;  2O99 A;  2A24 A;  1G6O A;  3HJI A;  1LSX A;  2VGL S;  4L9F A;  5C5K A;  4Y5F A;  1UWP X;  2W27 A;  3LR3 A;  5HSQ A;  1H3Q A;  3EEA A;  2PD8 A;  4AFI A;  5K5B A;  1OTB A;  1TD5 A;  3IS2 B;  5DFX A;  2XSS A;  1OJ5 A;  1XJ2 A;  5IT5 A;  5TJJ A;  2W3D A;  2GX5 A;  4R3A A;  1W63 M;  2W3G A;  1OTA A;  3EGD C;  4UQI M;  2XA7 M;  3BY8 A;  4F3L B;  4LPZ A;  3NOT C;  4PKY G;  4JGP A;  4EER A;  2J3W A;  4Q0J A;  3T4K A;  5DKK A;  2V9A A;  4L9E A;  3MFX A;  1XJ6 A;  4NKP A;  4G3W A;  3OLO A;  4HJ4 A;  3ZQ5 A;  1S1Z A;  2VV8 A;  3BQ8 A;  5MC7 A;  4LRX C;  3PXP A;  2W1T B;  3K2N A;  4GHI B;  3H7W A;  5CX7 A;  5A8B A;  3ICY A;  4Z1W A;  2JN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...