3VOMA

Structure of a putative phosphoserine aminotransferase from mycobacterium tuberculosis
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
368
structure length
368
Chain Sequence
LEIPTAIKPRDGRFGSGPSKVRLEQLQTLTTTAAALFGTSHRQAPVKNLVGRVRSGLAELFSLPDGYEVILGNGGATAFWDAAAFGLIDKRSLHLTYGEFSAKFASAVSKNPFVGEPIIITSDPGSAPEPQTDPSVDVIAWAHNETSTGVAVAVRRPEGSDDALVVIDATSGAGGLPVDIAETDAYYFAPQKNFASDGGLWLAIMSPAALSRIEAIAATGRWVPDFLSLPIAVENSLKNQTYNTPAIATLALLAEQIDWLVGNGGLDWAVKRTADSSQRLYSWAQERPYTTPFVTDPGLRSQVVGTIDFVDDVDAGTVAKILRANGIVDTEPYRKLGRNQLRVAMFPAVEPDDVSALTECVDWVVERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative phosphoserine aminotransferase
publication title Structure of phosphoserine aminotransferase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 136
structure length 368
sequence length 368
chains with identical sequence B
ec nomenclature ec 2.6.1.52: Phosphoserine transaminase.
pdb deposition date 2012-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00266 Aminotran_5 Aminotransferase class-V
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 3vomA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 3vomA02
1I48A 1C4KA 4LNLA 2FM1A 1C7NA 4B9BA 9AATA 3GZDC 4MKKA 3TCMA 3PDXA 4F4EA 2AY2A 2WK8A 2VGZA 1TOKA 2Z9UA 3PAAA 4UHMA 2BI1A 3E2ZA 1BJWA 3MKJA 3EI5A 4Q76A 1ARHA 2VGTA 2GQNA 3W1IA 4F5IA 3GBXA 1ASMA 4R5FA 4WD2A 4U1TA 3L44A 1DGDA 3HVYA 3IF2A 3HL2A 4OMAA 5K8BA 3DZZA 4AOAA 1YNUA 1M6SA 3MAUA 1C7GA 4ATPA 2HZPA 4IX8A 2AATA 1LK9A 2VGWA 8AATA 1JG8A 1VJOA 2BYLA 4J8LA 3BWNC 3FSLA 4WB0B 4IYOA 1S07A 4XEWA 3NX3A 1C7OA 2VMSA 2CJHA 3E6GA 1V2FA 3GETA 4MY5A 5EQCA 5BJ3A 5FT8A 3GZDA 5EIGB 1QITA 2D65A 2O1BA 4CXRA 1CJ0A 1G7WA 3A9ZA 1W23A 3P6KA 4W8IA 4R8DA 3EZSA 1N31A 1M0OA 4P3MA 1JF9A 4ISYA 1M0QA 4CXQA 1CZEA 2YRIA 4MGRA 2W7GA 3FQAA 4N0BA 3FVXA 3EIBA 4PIWA 1ASAA 3NUIA 1TOIA 1IX6A 1SZSA 2PB2A 1AIAA 1RVUA 2W7DA 3AEJC 1RV3A 4JEXA 3EZ1A 3MC6C 1O69A 3K40A 1AHXA 3E2ZB 4DQ6A 5M49A 1GEXA 1CS1A 3BWNA 3CBFA 5EUEA 3JTXA 2CSTA 3AOWA 3KKIA 3WGBA 4OTLA 4BA4A 5BJ4A 1W7NA 5DB5A 4MQRA 7AATA 1OHVA 3ASAA 1AKAA 4ZASA 3TQXA 5M4BA 1B4XA 1DJUA 1GC4A 4LW2A 3FFHA 4WP0A 1AICA 2JJEA 3BCAA 4BHDA 1ARGA 4ADDA 2GMSA 3BV0A 2AY3A 2D5YA 5G2PA 1OHWA 1D7RA 3FDBA 3RBLA 1QZ9A 1PFFA 4IYOB 4N0WA 1X28A 1KKPA 3PDBA 1IX7A 3F9TA 3FVSA 4MQQA 1AJSA 1MAPA 1WKGA 3A8UX 4OYTA 5DJ9A 3PD6B 1V72A 2V1PA 2YCNA 1ZC9A 3EI9A 3AEJA 1GC2A 4F5LA 4BA5A 3MC6A 4W1XA 1FG7A 4WYGA 3NYUA 3AENA 1ZOBA 2AEVA 3FZ6A 4JEVA 2W7HA 5HHYA 1JS6A 2CB1A 3QM2A 2JJFA 4W1VA 3LVJA 4CVQA 3G7QA 3G8MA 4DGTA 2DOUA 3VAXA 1ASEA 1PMMA 2W7FA 2ZY2A 2E54A 3F6TA 2VMZA 1LC5A 2CH1A 1E5FA 1AAMA 2AY4A 2O7CA 5JAYA 3RBFA 1MGVA 4GE7A 3UE8A 4ZLVA 2VMNA 4IXZA 1LW5A 3QBOA 2BWOA 3E9KA 2ZC0A 3ZZJA 2AY9A 1YIZA 1AMSA 3DR7A 1MDOA 2VLHA 3JWAA 3QHXA 1BQAA 1ASLA 2ZJGA 2YOBA 1ARTA 2CINA 3NDNA 4JF0A 3WKRA 2BYJA 1LW4A 1FC4A 4ZM4A 4ZDLA 1CQ8A 1IAXA 3OKSA 2BIAA 2BIGA 2VMRA 1V2EA 4M2MA 3B1DA 3DR4A 5M4DA 2X8UA 4AH3A 4I8AA 3GR9A 2GMUA 3PA9A 4R5ZA 5HDMA 2EGYA 3NNKA 3QGUA 4KAMA 4MKJA 4LC3A 2ZY4A 1DKAA 1IVRA 2VMYA 2Z20A 3AEMC 1GEWA 2YKYA 1AHYA 1AJSB 2D66A 2R5CA 4A0HA 2VMPA 3AOVA 3FTBA 4WXFA 4ZWMA 3WCOA 3TFTA 4JF1A 2JG2A 3JWBA 4MQPA 2W7MA 1S0AA 3H7FA 2WKAA 3B1EA 1J32A 4PFNA 5EUDA 4B98A 3FRKA 1SPAA 4LW4A 4W91A 4XQ2A 1DGEA 3P1TA 3QPGA 1Z7DA 4WLJA 1RV4A 4L0OA 3WGCA 1M0NA 1AIBA 2JJGA 4Y0HA 3DU4A 3PPLA 4XJPA 2VLFA 1TPLA 4RITA 5EAVA 4CBSA 1SVVA 2VGVA 1GCKA 5C6UA 4XJMA 1UU2A 1WYVB 1GEYA 2C81A 3A9YA 2AY5A 3R4TA 5G2QA 2ZY3A 3GSBA 3NYSA 4A6TA 4WYFA 3AV7A 1SF2A 3VOMA 1D2FA 3AATA 1QJ3A 2JGTA 1CQ7A 1WYTB 1TOJA 1KKJA 1KL2A 1YJSA 2W8TA 1TARA 1T3IA 1VEFA 3CAIA 1QISA 3F0HA 1DJ9A 2Z1ZA 4AO4A 2CFBA 1UKJA 4Q75A 4JEZA 4Y0DA 2W8UA 3WY7A 2E7JA 2YKVA 3ASBA 5FT5A 2X3LA 3KGXA 3BB8A 1U08A 4AZKA 1M4NA 1OHYA 3EI7A 3BWOA 4ITXA 2VMWA 2DGKA 4GDYA 4U2HA 1BJOA 1ELUA 3N5MA 2W7KA 3ACZA 2Z9WA 1C9CA 3LY1A 2VGUA 4EU1A 3RCHA 2BWNA 2OKKA 4Q31A 3DC1A 3ATHA 3EI8A 4TMRA 2EPJA 3LG0A 4JE5D 1W7MA 4ZAHA 4KXKA 2W8VA 1O4SA 1B5OA 4RAEA 3B1CA 4FL0A 3EIAA 2Z67A 3AELA 3FDDA 2VIAA 2QBTA 2F8JA 5DJ1A 1C0NA 2HUUA 5AX8A 4RJ0A 1I43A 1H0CA 2X5FA 2XH1A 5D5SA 5EUNA 4EFFA 5FT4A 2Q7WA 3EI6A 3MAFA 2AY1A 2R5EA 2W7LA 3UWCA 3MEBA 3WKSA 5E3KA 1KMJA 5E5IA 4K2IA 2DGMA 1FG3A 5DX5A 3DXWA 1AHEA 1B8GA 5LH9A 4XK1A 1P3WA 1E5EA 5F9SA 4W5KA 4Q6RA 2R2NA 3RI6A 3DRDA 2W8JA 5M46A 2E7IA 1WYUA 1AX4A 1JS3A 2D7YA 4JEWA 1IX8A 3IHJA 3MADA 2HOZA 3LV2A 3NTJA 3I16A 1WSTA 2HOYA 2JISA 3ECDA 4KYOA 1TOGA 1GC3A 1QJ5A 3B8XA 3RQ1A 1B5PA 1TOEA 3HLMA 1GBNA 2VYCA 3N75A 4P7YA 2YHKA 4WYDA 1IUGA 2YKUA 5G4IA 3FCRA 1ARSA 2W7IA 2VMOA 5TF5A 2GSAA 3I4JA 4GSAA 4WXBA 2CH2A 1S08A 2AEUA 3QI6A 3LVLB 1BW0A 3A2BA 4A0RA 4HF8A 4A0FA 4BQ0A 3ZRPA 1YOOA 4EMYA 3GWPA 4ZSWA 1I41A 1BQDA 1MLZA 2HORA 2EZ1A 2AY6A 5D95A 2VMXA 1ORDA 2EZ2A 5LHAA 1CQ6A 4F5JA 3N0LA 1V2DA 3MAFB 1Y4IA 2FYFA 2FQ6A 4EB7A 2D63A 1CL2A 1D7VA 4Y0IA 3GJUA 4F5KA 5IWQA 4TN4A 2ZP7A 5HXXA 3QN6A 3R9AA 1LC7A 2BI3A 3FVUA 3PDBB 3GZCA 2OGAA 4RKDA 2BIEA 3W1JA 1DJEA 4A00A 3VP6A 2EO5A 1ASDA 2D7ZA 4F5FA 3BCBA 1BT4A 2FNIA 2C7TA 2G6WA 1EQBA 4A0GA 4ZSYA 1G7XA 4ZM3A 1BS0A 1J04A 5EAAA 1BJ4A 3AENB 2QMAA 2CANA 5EIGA 3UAKA 3H14A 4OCAA 2JJHA 1QGNA 4F5GA 1ASCA 4DBCA 1MDXA 5E4ZA 1ASGA 1AMAA 4PVFA 1M32A 1O62A 2FNUA 3USFA 1UU0A 1ZODA 4TV7A 2BI2A 2DKBA 3M5UA 1AY8A 2FN6A 4WLHA 3FQ7A 1DTYA 2HP2A 1G4XA 2RFVA 2C0RA 1LKCA 3COGA 3E2FA 3JZLA 4GEBA 4WYCA 5G0AA 3BCXA 4ADCA 1B9IA 2CTZA 3FZ8A 2WK7A 4K2BA 1YJYA 2TPLA 2OGEA 4E3RA 2CJDA 1KMKA 1N8PA 2VMUA 3FKDA 4UHOA 3K7YA 4OBUA 2AY7A 4XJOA 2OKJA 1M7YA 3AEMA 2E7UA 1ASFA 3JU7A 3KGWA 1YIYA 3HQTA 3NU8A 4WYAA 2ZY5A 3HT4A 1I29A 3T32A 4ZDOA 1IAYA 4GRXA 3ELPA 1SZUA 2PB0A 2Z9VA 3FD0A 4IW7A 4NOGA 1WKHA 2QB2A 1YJZA 2QA3A 5F8VA 3Q8NA 1IBJA 2V0YA 1QIRA 2YRRA 3ISLA 2W7JA 1TATA 1ECXA 2ORDA 4MSOA 4AZJA 4JEYA 2BWPA 2VI8A 4RKCA 4RLGA 4RIZA 1AY4A 2R0TA 2AY8A 2R5CB 4ZDPA 2QLRA 4ZWVA 1IJIA 3L8AA 2DKJA 1S06A 3TFUA 4A6UA 1S09A 4UOYA 3NU7A 4E3QA 2BI5A 1LS3A 3A9XA 3WX9A 3VK3A 3PD6A 3PIUA 3WLXA 1AHFA 3AEOA 1MLYA 2EH6A 2Z1YA 4ATQA 1SZKA 3DODA 4O6ZA 3E77A 1CL1A 3I5TA 3ZZKA 1W3UA 2YCTA 1LC8A 1YAAA 3WZFA 4E1OA 2BHXA 1N2TA 4IXOA 2QB3A 3FZ7A 2DR1A 4QGRA 4F5MA 1W7LA 1ELQA 1Z3ZA 1GDEA 4XJLA 2WK9A 4ITGA 1EJIA 4IXSA 3HDOA 1AAWA 2DGLA 4WYEA 1AMRA 3HMUA 4IY7A 4LNJA 4EB5A 5I92A 4GE4A 2VIBA 2VI9A 3CQ6A 3HBXA 1G4VA 3W1HA 3VK4A 2VMQA 1AJRA 3KE3A 1AKBA 4BMKA 4F5HA 1AMQA 1RVYA 2HP1A 4K2MA 4RJYA 1H1CA 2HUFA 1GC0A 3NUBA 4A72A 1X0MA 3LVKA 4PFFA 1AY5A 3D6KA 3OP7A 2NMPA 3DYDA 1BJOB 2D61A 4AO9A 2BI9A 4XAUA 3RCHB 2O0RA 3B46A 3CQ4A 1MDZA 2OQXA 3E2YA 2CJGA 5G4JA 1ASNA 1B9HA 4UQVA 3VK2A 4HVKA 4GE9A 1BKGA 1KL1A 3NYTA 3NRAA 1MAQA 3K28A 3JW9A 3PGYA 3EUCA 2VMVA 3AEPA 1OXOA 1PMOA 4JE5A 1SFFA 4FFCA 1OATA 1PG8A 1UU1A 3WCNA 2BKWA 4WXGA 1ARIA 2HUIA 3BC8A 4R2NA 3DXVA 2CY8A 2VGSA 3PJ0A 3CQ5A 3BN1A 3ZRRA 1DFOA 4OT8A 4W1WA 2YCPA 3TATA 3LVMA 2Z61A 1XEYA 5FT6A 2PO3A 4OBVA 1M0PA 4LNMA 1WYVA 2VMTA 3ELEA 4WBTA 4ADEA 1EG5A 2C44A 2W8WA 3BS8A 2HOXA 4M2JA 1X2AA 3LWSA 4ADBA 2W7EA 2ZSMA 1CZCA 3FFRA 3MBBA 3II0A 4E77A 1WYTA 1OXPA 4WB0A 1D7UA 2XBNA 2ZSLA 4M2KA 4OC9A 1TASA 4A6RA 4RM1A 1WYUB 2ZYJA 5J8QA 4UHNA 3FQ8A 4J5UA 2Z9XA 4CBRA 2GB3A 2ZUKA 1BJNA 2OATA 5G09A 1ASBA 3G0TA 5EFSA 1XI9A 2YKXA 1AKCA 4H51A 1O61A 2D64A 3RUYA 3ZRQA 1AHGA 2X5DA 1D7SA 1VP4A 1X29A 1GD9A
chains in the Genus database with same CATH superfamily
1I48A 1C4KA 4LNLA 2FM1A 1C7NA 4B9BA 9AATA 3GZDC 4MKKA 3TCMA 3PDXA 4F4EA 2AY2A 2WK8A 2VGZA 1TOKA 2Z9UA 3PAAA 4UHMA 2BI1A 3E2ZA 1BJWA 3MKJA 3EI5A 4Q76A 1ARHA 2VGTA 1KAFA 2GQNA 3W1IA 4F5IA 3GBXA 1ASMA 4R5FA 4WD2A 4U1TA 3L44A 1DGDA 3HVYA 3IF2A 3HL2A 4OMAA 5K8BA 3DZZA 4AOAA 1YNUA 1M6SA 3MAUA 1C7GA 4ATPA 2HZPA 4IX8A 2AATA 1LK9A 2VGWA 8AATA 1JG8A 1VJOA 2BYLA 4J8LA 3BWNC 3FSLA 4WB0B 4IYOA 1S07A 4XEWA 3N4SA 3NX3A 1C7OA 2VMSA 2CJHA 3E6GA 1V2FA 3GETA 4MY5A 5EQCA 5BJ3A 5FT8A 3GZDA 5EIGB 1QITA 2D65A 2O1BA 2KFPA 4CXRA 1CJ0A 1G7WA 3A9ZA 1W23A 3P6KA 4W8IA 4R8DA 3EZSA 1N31A 1M0OA 4P3MA 1JF9A 4ISYA 1M0QA 4CXQA 1CZEA 2YRIA 4MGRA 2W7GA 3FQAA 4N0BA 3FVXA 3EIBA 4PIWA 1ASAA 3NUIA 1TOIA 1IX6A 1SZSA 2PB2A 1AIAA 1RVUA 2W7DA 3AEJC 1RV3A 4JEXA 3EZ1A 3MC6C 1O69A 3K40A 1AHXA 3E2ZB 4DQ6A 5M49A 1GEXA 1CS1A 3BWNA 3CBFA 5EUEA 3JTXA 2CSTA 3AOWA 3KKIA 3WGBA 4OTLA 4BA4A 5BJ4A 1W7NA 5DB5A 4MQRA 7AATA 1OHVA 3ASAA 1AKAA 4ZASA 3TQXA 5M4BA 2FKIA 1B4XA 1DJUA 1GC4A 4LW2A 3FFHA 4WP0A 1AICA 2JJEA 3BCAA 4BHDA 1ARGA 4ADDA 2GMSA 3BV0A 2AY3A 2D5YA 5G2PA 1OHWA 1D7RA 3FDBA 3RBLA 1QZ9A 1PFFA 4IYOB 4N0WA 1X28A 1KKPA 3PDBA 1IX7A 3F9TA 3FVSA 4MQQA 1AJSA 1MAPA 1WKGA 3A8UX 4OYTA 5DJ9A 3PD6B 1V72A 2V1PA 2YCNA 1ZC9A 3EI9A 3AEJA 1GC2A 4F5LA 3N4XA 4BA5A 3MC6A 4W1XA 1FG7A 4WYGA 3NYUA 3AENA 1ZOBA 2AEVA 3FZ6A 4JEVA 2W7HA 5HHYA 1JS6A 2CB1A 3QM2A 2JJFA 4W1VA 3LVJA 4CVQA 3G7QA 3G8MA 4DGTA 2DOUA 3VAXA 1ASEA 1PMMA 2W7FA 2ZY2A 2E54A 3F6TA 2VMZA 1LC5A 2CH1A 1E5FA 1AAMA 2AY4A 2O7CA 5JAYA 3RBFA 1MGVA 4GE7A 3UE8A 4ZLVA 2VMNA 4IXZA 1LW5A 3QBOA 2BWOA 3E9KA 2ZC0A 3ZZJA 2AY9A 1YIZA 1AMSA 3DR7A 1MDOA 2VLHA 3JWAA 3QHXA 2QSRA 1BQAA 1ASLA 2ZJGA 2YOBA 1ARTA 2CINA 3NDNA 4JF0A 3WKRA 2BYJA 1LW4A 1FC4A 4ZM4A 4ZDLA 1CQ8A 1IAXA 3OKSA 2BIAA 2BIGA 2VMRA 1V2EA 4M2MA 3B1DA 3DR4A 5M4DA 2X8UA 4AH3A 4I8AA 3GR9A 2GMUA 3PA9A 4R5ZA 5HDMA 2EGYA 3NNKA 3QGUA 4KAMA 4MKJA 4LC3A 2ZY4A 1DKAA 1IVRA 2VMYA 2Z20A 3AEMC 1GEWA 2YKYA 1AHYA 1AJSB 2D66A 2R5CA 4A0HA 2VMPA 3AOVA 3FTBA 4WXFA 4ZWMA 3WCOA 3TFTA 4JF1A 2JG2A 3JWBA 4MQPA 2W7MA 1S0AA 3H7FA 2WKAA 3B1EA 1J32A 4PFNA 5EUDA 4B98A 3FRKA 1SPAA 4LW4A 4W91A 4XQ2A 1DGEA 3P1TA 3QPGA 1Z7DA 4WLJA 2G7JA 1RV4A 4L0OA 3WGCA 1M0NA 1AIBA 2JJGA 4Y0HA 3DU4A 3PPLA 4XJPA 2VLFA 1TPLA 4RITA 5EAVA 4CBSA 1SVVA 2VGVA 1GCKA 5C6UA 4XJMA 1UU2A 1WYVB 1GEYA 2C81A 3A9YA 2AY5A 3R4TA 5G2QA 2ZY3A 3GSBA 3NYSA 4A6TA 4WYFA 3AV7A 1SF2A 3VOMA 1D2FA 3AATA 1QJ3A 2JGTA 1CQ7A 1WYTB 1TOJA 1KKJA 1KL2A 1YJSA 2W8TA 1TARA 1T3IA 1VEFA 3CAIA 1QISA 3F0HA 1DJ9A 2Z1ZA 4AO4A 2CFBA 1UKJA 4Q75A 4JEZA 4Y0DA 2W8UA 3WY7A 2E7JA 2YKVA 3ASBA 5FT5A 2X3LA 3KGXA 3BB8A 1U08A 4AZKA 1M4NA 1OHYA 3EI7A 3BWOA 4ITXA 2VMWA 2DGKA 4GDYA 4U2HA 1BJOA 1ELUA 3N5MA 2W7KA 3ACZA 2Z9WA 1C9CA 3LY1A 2VGUA 4EU1A 3RCHA 2BWNA 2OKKA 4Q31A 3DC1A 3ATHA 3EI8A 4TMRA 2EPJA 3LG0A 4JE5D 1W7MA 4ZAHA 4KXKA 2W8VA 1O4SA 1B5OA 4RAEA 3B1CA 4FL0A 3EIAA 2Z67A 3AELA 3FDDA 2VIAA 2QBTA 2F8JA 5DJ1A 1C0NA 2HUUA 5AX8A 4RJ0A 1I43A 1H0CA 2X5FA 2XH1A 5D5SA 5EUNA 4EFFA 5FT4A 2Q7WA 3EI6A 3MAFA 2AY1A 2R5EA 2W7LA 3UWCA 3MEBA 3WKSA 5E3KA 3H9XA 1KMJA 5E5IA 4K2IA 2DGMA 1FG3A 5DX5A 3DXWA 1AHEA 1B8GA 5LH9A 4XK1A 1P3WA 1E5EA 5F9SA 4W5KA 4Q6RA 2R2NA 3RI6A 3DRDA 2W8JA 5M46A 2E7IA 1WYUA 1AX4A 1JS3A 2D7YA 4JEWA 1IX8A 3IHJA 3MADA 2HOZA 3LV2A 3NTJA 3I16A 1WSTA 2HOYA 2JISA 3ECDA 4KYOA 1TOGA 1GC3A 1QJ5A 3B8XA 3RQ1A 1B5PA 1TOEA 3HLMA 1GBNA 2VYCA 3N75A 4P7YA 2YHKA 4WYDA 1IUGA 2YKUA 5G4IA 3FCRA 1ARSA 2W7IA 2VMOA 5TF5A 2GSAA 3I4JA 4GSAA 4WXBA 2CH2A 1S08A 2AEUA 3QI6A 3LVLB 1BW0A 3A2BA 4A0RA 4HF8A 4A0FA 4BQ0A 3ZRPA 1YOOA 4EMYA 3GWPA 4ZSWA 1I41A 1BQDA 1MLZA 2HORA 2EZ1A 2AY6A 5D95A 2VMXA 1ORDA 2EZ2A 5LHAA 1CQ6A 4F5JA 3N0LA 1V2DA 3MAFB 1Y4IA 2FYFA 2FQ6A 4EB7A 2D63A 1CL2A 1D7VA 4Y0IA 3GJUA 4F5KA 5IWQA 4TN4A 2ZP7A 5HXXA 3QN6A 3R9AA 1LC7A 2BI3A 3FVUA 3PDBB 3GZCA 2OGAA 4RKDA 2BIEA 3W1JA 1DJEA 4A00A 3VP6A 2EO5A 1ASDA 2D7ZA 4F5FA 3BCBA 1BT4A 2FNIA 2C7TA 2G6WA 1EQBA 4A0GA 4ZSYA 1G7XA 4ZM3A 1BS0A 1J04A 5EAAA 1BJ4A 3AENB 2QMAA 2CANA 5EIGA 3UAKA 3H14A 4OCAA 2JJHA 1QGNA 4F5GA 1ASCA 4DBCA 1MDXA 5E4ZA 1ASGA 1AMAA 4PVFA 1M32A 1O62A 2FNUA 3USFA 1UU0A 1ZODA 4TV7A 2BI2A 2DKBA 3M5UA 1AY8A 2FN6A 4WLHA 3FQ7A 1DTYA 2HP2A 1G4XA 2RFVA 2C0RA 1LKCA 3COGA 3E2FA 3JZLA 4GEBA 4WYCA 5G0AA 3BCXA 4ADCA 1B9IA 2CTZA 3FZ8A 2WK7A 4K2BA 1YJYA 2TPLA 2OGEA 4E3RA 2CJDA 1KMKA 2WB6A 1N8PA 2VMUA 3FKDA 4UHOA 3K7YA 4OBUA 2AY7A 4XJOA 2OKJA 1M7YA 3AEMA 2E7UA 1ASFA 3JU7A 3KGWA 1YIYA 3HQTA 3NU8A 4WYAA 2ZY5A 3HT4A 1I29A 3T32A 4ZDOA 1IAYA 4GRXA 3ELPA 1SZUA 2PB0A 2Z9VA 3FD0A 4IW7A 4NOGA 1WKHA 2QB2A 1YJZA 2QA3A 5F8VA 3Q8NA 1IBJA 2V0YA 1QIRA 2YRRA 3ISLA 2W7JA 1TATA 1ECXA 2ORDA 4MSOA 4AZJA 4JEYA 2BWPA 2VI8A 4RKCA 4RLGA 4RIZA 1AY4A 2R0TA 2AY8A 2R5CB 4ZDPA 2QLRA 4ZWVA 1IJIA 3L8AA 2DKJA 1S06A 3TFUA 4A6UA 1S09A 4UOYA 3NU7A 4E3QA 2BI5A 1LS3A 3A9XA 3WX9A 3VK3A 3PD6A 3PIUA 3WLXA 1AHFA 3AEOA 1MLYA 2EH6A 2Z1YA 4ATQA 1SZKA 3DODA 4O6ZA 3E77A 1CL1A 3I5TA 3ZZKA 1W3UA 2YCTA 1LC8A 1YAAA 3WZFA 4E1OA 2BHXA 1N2TA 4IXOA 2QB3A 3FZ7A 2DR1A 4QGRA 4F5MA 1W7LA 1ELQA 1Z3ZA 1GDEA 4XJLA 2WK9A 4ITGA 1EJIA 4IXSA 3HDOA 1AAWA 2DGLA 4WYEA 1AMRA 3HMUA 4IY7A 4LNJA 4K05A 4EB5A 5I92A 4GE4A 2VIBA 2VI9A 3CQ6A 3HBXA 3N4RA 2A1VA 1G4VA 3W1HA 3VK4A 2VMQA 1AJRA 3KE3A 1AKBA 4BMKA 4F5HA 1AMQA 1RVYA 2HP1A 4K2MA 4RJYA 1H1CA 2HUFA 1GC0A 3NUBA 4A72A 1X0MA 3LVKA 4PFFA 1AY5A 3D6KA 3OP7A 2NMPA 3DYDA 1BJOB 2D61A 4AO9A 2BI9A 4XAUA 3RCHB 2O0RA 3B46A 3CQ4A 1MDZA 2OQXA 3E2YA 2CJGA 5G4JA 1ASNA 1B9HA 4UQVA 3VK2A 4HVKA 4GE9A 1BKGA 1KL1A 3NYTA 3NRAA 1MAQA 3K28A 3JW9A 3PGYA 3EUCA 2VMVA 3AEPA 1OXOA 1PMOA 4JE5A 1SFFA 4FFCA 1OATA 1PG8A 1UU1A 3WCNA 2BKWA 4WXGA 1ARIA 5KTBA 2HUIA 3BC8A 4R2NA 3DXVA 2CY8A 2VGSA 3PJ0A 3CQ5A 3BN1A 3ZRRA 1DFOA 4OT8A 4W1WA 2YCPA 3TATA 3LVMA 2Z61A 1XEYA 5FT6A 2PO3A 4OBVA 1M0PA 4LNMA 4H63Q 1WYVA 2VMTA 3ELEA 4WBTA 4ADEA 1EG5A 2C44A 2W8WA 3BS8A 2HOXA 4M2JA 1X2AA 3LWSA 4ADBA 2W7EA 2ZSMA 1CZCA 3FFRA 3MBBA 3N7NA 3II0A 4E77A 1WYTA 1OXPA 4WB0A 1D7UA 2XBNA 2ZSLA 4M2KA 4OC9A 2EYQA 1TASA 4A6RA 4RM1A 1WYUB 2ZYJA 5J8QA 4UHNA 3FQ8A 4J5UA 2Z9XA 4CBRA 2GB3A 2ZUKA 1BJNA 2OATA 5G09A 1ASBA 3G0TA 5EFSA 1XI9A 2YKXA 1AKCA 4H51A 1O61A 2D64A 3RUYA 3ZRQA 1AHGA 2X5DA 1D7SA 1VP4A 1X29A 1GD9A
chains in the Genus database with same CATH topology
1I48A 1C4KA 4LNLA 2FM1A 1C7NA 4B9BA 9AATA 3GZDC 4MKKA 3TCMA 3PDXA 4F4EA 2AY2A 2WK8A 2VGZA 1TOKA 2Z9UA 3PAAA 4UHMA 2BI1A 3E2ZA 1BJWA 3MKJA 3EI5A 4Q76A 1ARHA 2VGTA 2GQNA 3W1IA 4F5IA 3GBXA 1ASMA 4R5FA 4WD2A 4U1TA 3L44A 1DGDA 3HVYA 3IF2A 3HL2A 4OMAA 5K8BA 3DZZA 4AOAA 1YNUA 1M6SA 3MAUA 1C7GA 4ATPA 2HZPA 4IX8A 2AATA 1LK9A 2VGWA 8AATA 1JG8A 1VJOA 2BYLA 4J8LA 3BWNC 3FSLA 4WB0B 4IYOA 1S07A 4XEWA 3N4SA 3NX3A 1C7OA 2VMSA 2CJHA 3E6GA 1V2FA 3GETA 4MY5A 5EQCA 5BJ3A 5FT8A 3GZDA 5EIGB 1QITA 2D65A 2O1BA 2KFPA 4CXRA 1CJ0A 1G7WA 3A9ZA 1W23A 3P6KA 4W8IA 4R8DA 3EZSA 1N31A 1M0OA 4P3MA 1JF9A 4ISYA 1M0QA 4CXQA 1CZEA 2YRIA 4MGRA 2W7GA 3FQAA 4N0BA 3FVXA 3EIBA 4PIWA 1ASAA 3NUIA 1TOIA 1IX6A 1SZSA 2PB2A 1AIAA 1RVUA 2W7DA 3AEJC 1RV3A 4JEXA 3EZ1A 3MC6C 1O69A 3K40A 1AHXA 3E2ZB 4DQ6A 5M49A 1GEXA 1CS1A 3BWNA 3CBFA 5EUEA 3JTXA 2CSTA 3AOWA 3KKIA 3WGBA 4OTLA 4BA4A 5BJ4A 1W7NA 5DB5A 4MQRA 7AATA 1OHVA 3ASAA 1AKAA 4ZASA 3TQXA 5M4BA 2FKIA 1B4XA 1DJUA 1GC4A 4LW2A 3FFHA 4WP0A 1AICA 2JJEA 3BCAA 4BHDA 1ARGA 4ADDA 2GMSA 3BV0A 2AY3A 2D5YA 5G2PA 1OHWA 1D7RA 3FDBA 3RBLA 1QZ9A 1PFFA 4IYOB 4N0WA 1X28A 1KKPA 3PDBA 1IX7A 3F9TA 3FVSA 4MQQA 1AJSA 1MAPA 1WKGA 3A8UX 4OYTA 5DJ9A 3PD6B 1V72A 2V1PA 2YCNA 1ZC9A 3EI9A 3AEJA 1GC2A 4F5LA 3N4XA 4BA5A 3MC6A 4W1XA 1FG7A 4WYGA 3NYUA 3AENA 1ZOBA 2AEVA 3FZ6A 4JEVA 2W7HA 5HHYA 1JS6A 2CB1A 3QM2A 2JJFA 4W1VA 3LVJA 4CVQA 3G7QA 3G8MA 4DGTA 2DOUA 3VAXA 1ASEA 1PMMA 2W7FA 2ZY2A 2E54A 3F6TA 2VMZA 1LC5A 2CH1A 1E5FA 1AAMA 2AY4A 2O7CA 5JAYA 3RBFA 1MGVA 4GE7A 3UE8A 4ZLVA 2VMNA 4IXZA 1LW5A 3QBOA 2BWOA 3E9KA 2ZC0A 3ZZJA 2AY9A 1YIZA 1AMSA 3DR7A 1MDOA 2VLHA 3JWAA 3QHXA 2QSRA 1BQAA 1ASLA 2ZJGA 2YOBA 1ARTA 2CINA 3NDNA 4JF0A 3WKRA 2BYJA 1LW4A 1FC4A 4ZM4A 4ZDLA 1CQ8A 1IAXA 3OKSA 2BIAA 2BIGA 2VMRA 1V2EA 4M2MA 3B1DA 3DR4A 5M4DA 2X8UA 4AH3A 4I8AA 3GR9A 2GMUA 3PA9A 4R5ZA 5HDMA 2EGYA 3NNKA 3QGUA 4KAMA 4MKJA 4LC3A 2ZY4A 1DKAA 1IVRA 2VMYA 2Z20A 3AEMC 1GEWA 2YKYA 1AHYA 1AJSB 2D66A 2R5CA 4A0HA 2VMPA 3AOVA 3FTBA 4WXFA 4ZWMA 3WCOA 3TFTA 4JF1A 2JG2A 3JWBA 4MQPA 2W7MA 1S0AA 3H7FA 2WKAA 3B1EA 1J32A 4PFNA 5EUDA 4B98A 3FRKA 1SPAA 4LW4A 4W91A 4XQ2A 1DGEA 3P1TA 3QPGA 1Z7DA 4WLJA 2G7JA 1RV4A 4L0OA 3WGCA 1M0NA 1AIBA 2JJGA 4Y0HA 3DU4A 3PPLA 4XJPA 2VLFA 1TPLA 4RITA 5EAVA 4CBSA 1SVVA 2VGVA 1GCKA 5C6UA 4XJMA 1UU2A 1WYVB 1GEYA 2C81A 3A9YA 2AY5A 3R4TA 5G2QA 2ZY3A 3GSBA 3NYSA 4A6TA 4WYFA 3AV7A 1SF2A 3VOMA 1D2FA 3AATA 1QJ3A 2JGTA 1CQ7A 1WYTB 1TOJA 1KKJA 1KL2A 1YJSA 2W8TA 1TARA 1T3IA 1VEFA 3CAIA 1QISA 3F0HA 1DJ9A 2Z1ZA 4AO4A 2CFBA 1UKJA 4Q75A 4JEZA 4Y0DA 2W8UA 3WY7A 2E7JA 2YKVA 3ASBA 5FT5A 2X3LA 3KGXA 3BB8A 1U08A 4AZKA 1M4NA 1OHYA 3EI7A 3BWOA 4ITXA 2VMWA 2DGKA 4GDYA 4U2HA 1BJOA 1ELUA 3N5MA 2W7KA 3ACZA 2Z9WA 1C9CA 3LY1A 2VGUA 4EU1A 3RCHA 2BWNA 2OKKA 4Q31A 3DC1A 3ATHA 3EI8A 4TMRA 2EPJA 3LG0A 4JE5D 1W7MA 4ZAHA 4KXKA 2W8VA 1O4SA 1B5OA 4RAEA 3B1CA 4FL0A 3EIAA 2Z67A 3AELA 3FDDA 2VIAA 2QBTA 2F8JA 5DJ1A 1C0NA 2HUUA 5AX8A 4RJ0A 1I43A 1H0CA 2X5FA 2XH1A 5D5SA 5EUNA 4EFFA 5FT4A 2Q7WA 3EI6A 3MAFA 2AY1A 2R5EA 2W7LA 3UWCA 3MEBA 3WKSA 5E3KA 3H9XA 1KMJA 5E5IA 4K2IA 2DGMA 1FG3A 5DX5A 3DXWA 1AHEA 1B8GA 5LH9A 4XK1A 1P3WA 1E5EA 5F9SA 4W5KA 4Q6RA 2R2NA 3RI6A 3DRDA 2W8JA 5M46A 2E7IA 1WYUA 1AX4A 1JS3A 2D7YA 4JEWA 1IX8A 3IHJA 3MADA 2HOZA 3LV2A 3NTJA 3I16A 1WSTA 2HOYA 2JISA 3ECDA 4KYOA 1TOGA 1GC3A 1QJ5A 3B8XA 3RQ1A 1B5PA 1TOEA 3HLMA 1GBNA 2VYCA 3N75A 4P7YA 2YHKA 4WYDA 1IUGA 2YKUA 5G4IA 3FCRA 1ARSA 2W7IA 2VMOA 5TF5A 2GSAA 3I4JA 4GSAA 4WXBA 2CH2A 1S08A 2AEUA 3QI6A 3LVLB 1BW0A 3A2BA 4A0RA 4HF8A 4A0FA 4BQ0A 3ZRPA 1YOOA 4EMYA 3GWPA 4ZSWA 1I41A 1BQDA 1MLZA 2HORA 2EZ1A 2AY6A 5D95A 2VMXA 1ORDA 2EZ2A 5LHAA 1CQ6A 4F5JA 3N0LA 1V2DA 3MAFB 1Y4IA 2FYFA 2FQ6A 4EB7A 2D63A 1CL2A 1D7VA 4Y0IA 3GJUA 4F5KA 5IWQA 4TN4A 2ZP7A 5HXXA 3QN6A 3R9AA 1LC7A 2BI3A 3FVUA 3PDBB 3GZCA 2OGAA 4RKDA 2BIEA 3W1JA 1DJEA 4A00A 3VP6A 2EO5A 1ASDA 2D7ZA 4F5FA 3BCBA 1BT4A 2FNIA 2C7TA 2G6WA 1EQBA 4A0GA 4ZSYA 1G7XA 4ZM3A 1BS0A 1J04A 5EAAA 1BJ4A 3AENB 2QMAA 2CANA 5EIGA 3UAKA 3H14A 4OCAA 2JJHA 1QGNA 4F5GA 1ASCA 4DBCA 1MDXA 5E4ZA 1ASGA 1AMAA 4PVFA 1M32A 1O62A 2FNUA 3USFA 1UU0A 1ZODA 4TV7A 2BI2A 2DKBA 3M5UA 1AY8A 2FN6A 4WLHA 3FQ7A 1DTYA 2HP2A 1G4XA 2RFVA 2C0RA 1LKCA 3COGA 3E2FA 3JZLA 4GEBA 4WYCA 5G0AA 3BCXA 4ADCA 1B9IA 2CTZA 3FZ8A 2WK7A 4K2BA 1YJYA 2TPLA 2OGEA 4E3RA 2CJDA 1KMKA 2WB6A 1N8PA 2VMUA 3FKDA 4UHOA 3K7YA 4OBUA 2AY7A 4XJOA 2OKJA 1M7YA 3AEMA 2E7UA 1ASFA 3JU7A 3KGWA 1YIYA 3HQTA 3NU8A 4WYAA 2ZY5A 3HT4A 1I29A 3T32A 4ZDOA 1IAYA 4GRXA 3ELPA 1SZUA 2PB0A 2Z9VA 3FD0A 4IW7A 4NOGA 1WKHA 2QB2A 1YJZA 2QA3A 5F8VA 3Q8NA 1IBJA 2V0YA 1QIRA 2YRRA 3ISLA 2W7JA 1TATA 1ECXA 2ORDA 4MSOA 4AZJA 4JEYA 2BWPA 2VI8A 4RKCA 4RLGA 4RIZA 1AY4A 2R0TA 2AY8A 2R5CB 4ZDPA 2QLRA 4ZWVA 1IJIA 3L8AA 2DKJA 1S06A 3TFUA 4A6UA 1S09A 4UOYA 3NU7A 4E3QA 2BI5A 1LS3A 3A9XA 3WX9A 3VK3A 3PD6A 3PIUA 3WLXA 1AHFA 3AEOA 1MLYA 2EH6A 2Z1YA 4ATQA 1SZKA 3DODA 4O6ZA 3E77A 1CL1A 3I5TA 3ZZKA 1W3UA 2YCTA 1LC8A 1YAAA 3WZFA 4E1OA 2BHXA 1N2TA 4IXOA 2QB3A 3FZ7A 2DR1A 4QGRA 4F5MA 1W7LA 1ELQA 1Z3ZA 1GDEA 4XJLA 2WK9A 4ITGA 1EJIA 4IXSA 3HDOA 1AAWA 2DGLA 4WYEA 1AMRA 3HMUA 4IY7A 4LNJA 4K05A 4EB5A 5I92A 4GE4A 2VIBA 2VI9A 3CQ6A 3HBXA 3N4RA 2A1VA 1G4VA 3W1HA 3VK4A 2VMQA 1AJRA 3KE3A 1AKBA 4BMKA 4F5HA 1AMQA 1RVYA 2HP1A 4K2MA 4RJYA 1H1CA 2HUFA 1GC0A 3NUBA 4A72A 1X0MA 3LVKA 4PFFA 1AY5A 3D6KA 3OP7A 2NMPA 3DYDA 1BJOB 2D61A 4AO9A 2BI9A 4XAUA 3RCHB 2O0RA 3B46A 3CQ4A 1MDZA 2OQXA 3E2YA 2CJGA 5G4JA 1ASNA 1B9HA 4UQVA 3VK2A 4HVKA 4GE9A 1BKGA 1KL1A 3NYTA 3NRAA 1MAQA 3K28A 3JW9A 3PGYA 3EUCA 2VMVA 3AEPA 1OXOA 1PMOA 4JE5A 1SFFA 4FFCA 1OATA 1PG8A 1UU1A 3WCNA 2BKWA 4WXGA 1ARIA 5KTBA 2HUIA 3BC8A 4R2NA 3DXVA 2CY8A 2VGSA 3PJ0A 3CQ5A 3BN1A 3ZRRA 1DFOA 4OT8A 4W1WA 2YCPA 3TATA 3LVMA 2Z61A 1XEYA 5FT6A 2PO3A 4OBVA 1M0PA 4LNMA 4H63Q 1WYVA 2VMTA 3ELEA 4WBTA 4ADEA 1EG5A 2C44A 2W8WA 3BS8A 2HOXA 4M2JA 1X2AA 3LWSA 4ADBA 2W7EA 2ZSMA 1CZCA 3FFRA 3MBBA 3N7NA 3II0A 4E77A 1WYTA 1OXPA 4WB0A 1D7UA 2XBNA 2ZSLA 4M2KA 4OC9A 2EYQA 1TASA 4A6RA 4RM1A 1WYUB 2ZYJA 5J8QA 4UHNA 3FQ8A 4J5UA 2Z9XA 4CBRA 2GB3A 2ZUKA 1BJNA 2OATA 5G09A 1ASBA 3G0TA 5EFSA 1XI9A 2YKXA 1AKCA 4H51A 1O61A 2D64A 3RUYA 3ZRQA 1AHGA 2X5DA 1D7SA 1VP4A 1X29A 1GD9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I48 A;  1C4K A;  4LNL A;  2FM1 A;  1C7N A;  4B9B A;  9AAT A;  3GZD C;  4MKK A;  3TCM A;  3PDX A;  4F4E A;  2AY2 A;  2WK8 A;  2VGZ A;  1TOK A;  2Z9U A;  3PAA A;  4UHM A;  2BI1 A;  3E2Z A;  1BJW A;  3MKJ A;  3EI5 A;  4Q76 A;  1ARH A;  2VGT A;  2GQN A;  3W1I A;  4F5I A;  3GBX A;  1ASM A;  4R5F A;  4WD2 A;  4U1T A;  3L44 A;  1DGD A;  3HVY A;  3IF2 A;  3HL2 A;  4OMA A;  5K8B A;  3DZZ A;  4AOA A;  1YNU A;  1M6S A;  3MAU A;  1C7G A;  4ATP A;  2HZP A;  4IX8 A;  2AAT A;  1LK9 A;  2VGW A;  8AAT A;  1JG8 A;  1VJO A;  2BYL A;  4J8L A;  3BWN C;  3FSL A;  4WB0 B;  4IYO A;  1S07 A;  4XEW A;  3NX3 A;  1C7O A;  2VMS A;  2CJH A;  3E6G A;  1V2F A;  3GET A;  4MY5 A;  5EQC A;  5BJ3 A;  5FT8 A;  3GZD A;  5EIG B;  1QIT A;  2D65 A;  2O1B A;  4CXR A;  1CJ0 A;  1G7W A;  3A9Z A;  1W23 A;  3P6K A;  4W8I A;  4R8D A;  3EZS A;  1N31 A;  1M0O A;  4P3M A;  1JF9 A;  4ISY A;  1M0Q A;  4CXQ A;  1CZE A;  2YRI A;  4MGR A;  2W7G A;  3FQA A;  4N0B A;  3FVX A;  3EIB A;  4PIW A;  1ASA A;  3NUI A;  1TOI A;  1IX6 A;  1SZS A;  2PB2 A;  1AIA A;  1RVU A;  2W7D A;  3AEJ C;  1RV3 A;  4JEX A;  3EZ1 A;  3MC6 C;  1O69 A;  3K40 A;  1AHX A;  3E2Z B;  4DQ6 A;  5M49 A;  1GEX A;  1CS1 A;  3BWN A;  3CBF A;  5EUE A;  3JTX A;  2CST A;  3AOW A;  3KKI A;  3WGB A;  4OTL A;  4BA4 A;  5BJ4 A;  1W7N A;  5DB5 A;  4MQR A;  7AAT A;  1OHV A;  3ASA A;  1AKA A;  4ZAS A;  3TQX A;  5M4B A;  1B4X A;  1DJU A;  1GC4 A;  4LW2 A;  3FFH A;  4WP0 A;  1AIC A;  2JJE A;  3BCA A;  4BHD A;  1ARG A;  4ADD A;  2GMS A;  3BV0 A;  2AY3 A;  2D5Y A;  5G2P A;  1OHW A;  1D7R A;  3FDB A;  3RBL A;  1QZ9 A;  1PFF A;  4IYO B;  4N0W A;  1X28 A;  1KKP A;  3PDB A;  1IX7 A;  3F9T A;  3FVS A;  4MQQ A;  1AJS A;  1MAP A;  1WKG A;  3A8U X;  4OYT A;  5DJ9 A;  3PD6 B;  1V72 A;  2V1P A;  2YCN A;  1ZC9 A;  3EI9 A;  3AEJ A;  1GC2 A;  4F5L A;  4BA5 A;  3MC6 A;  4W1X A;  1FG7 A;  4WYG A;  3NYU A;  3AEN A;  1ZOB A;  2AEV A;  3FZ6 A;  4JEV A;  2W7H A;  5HHY A;  1JS6 A;  2CB1 A;  3QM2 A;  2JJF A;  4W1V A;  3LVJ A;  4CVQ A;  3G7Q A;  3G8M A;  4DGT A;  2DOU A;  3VAX A;  1ASE A;  1PMM A;  2W7F A;  2ZY2 A;  2E54 A;  3F6T A;  2VMZ A;  1LC5 A;  2CH1 A;  1E5F A;  1AAM A;  2AY4 A;  2O7C A;  5JAY A;  3RBF A;  1MGV A;  4GE7 A;  3UE8 A;  4ZLV A;  2VMN A;  4IXZ A;  1LW5 A;  3QBO A;  2BWO A;  3E9K A;  2ZC0 A;  3ZZJ A;  2AY9 A;  1YIZ A;  1AMS A;  3DR7 A;  1MDO A;  2VLH A;  3JWA A;  3QHX A;  1BQA A;  1ASL A;  2ZJG A;  2YOB A;  1ART A;  2CIN A;  3NDN A;  4JF0 A;  3WKR A;  2BYJ A;  1LW4 A;  1FC4 A;  4ZM4 A;  4ZDL A;  1CQ8 A;  1IAX A;  3OKS A;  2BIA A;  2BIG A;  2VMR A;  1V2E A;  4M2M A;  3B1D A;  3DR4 A;  5M4D A;  2X8U A;  4AH3 A;  4I8A A;  3GR9 A;  2GMU A;  3PA9 A;  4R5Z A;  5HDM A;  2EGY A;  3NNK A;  3QGU A;  4KAM A;  4MKJ A;  4LC3 A;  2ZY4 A;  1DKA A;  1IVR A;  2VMY A;  2Z20 A;  3AEM C;  1GEW A;  2YKY A;  1AHY A;  1AJS B;  2D66 A;  2R5C A;  4A0H A;  2VMP A;  3AOV A;  3FTB A;  4WXF A;  4ZWM A;  3WCO A;  3TFT A;  4JF1 A;  2JG2 A;  3JWB A;  4MQP A;  2W7M A;  1S0A A;  3H7F A;  2WKA A;  3B1E A;  1J32 A;  4PFN A;  5EUD A;  4B98 A;  3FRK A;  1SPA A;  4LW4 A;  4W91 A;  4XQ2 A;  1DGE A;  3P1T A;  3QPG A;  1Z7D A;  4WLJ A;  1RV4 A;  4L0O A;  3WGC A;  1M0N A;  1AIB A;  2JJG A;  4Y0H A;  3DU4 A;  3PPL A;  4XJP A;  2VLF A;  1TPL A;  4RIT A;  5EAV A;  4CBS A;  1SVV A;  2VGV A;  1GCK A;  5C6U A;  4XJM A;  1UU2 A;  1WYV B;  1GEY A;  2C81 A;  3A9Y A;  2AY5 A;  3R4T A;  5G2Q A;  2ZY3 A;  3GSB A;  3NYS A;  4A6T A;  4WYF A;  3AV7 A;  1SF2 A;  3VOM A;  1D2F A;  3AAT A;  1QJ3 A;  2JGT A;  1CQ7 A;  1WYT B;  1TOJ A;  1KKJ A;  1KL2 A;  1YJS A;  2W8T A;  1TAR A;  1T3I A;  1VEF A;  3CAI A;  1QIS A;  3F0H A;  1DJ9 A;  2Z1Z A;  4AO4 A;  2CFB A;  1UKJ A;  4Q75 A;  4JEZ A;  4Y0D A;  2W8U A;  3WY7 A;  2E7J A;  2YKV A;  3ASB A;  5FT5 A;  2X3L A;  3KGX A;  3BB8 A;  1U08 A;  4AZK A;  1M4N A;  1OHY A;  3EI7 A;  3BWO A;  4ITX A;  2VMW A;  2DGK A;  4GDY A;  4U2H A;  1BJO A;  1ELU A;  3N5M A;  2W7K A;  3ACZ A;  2Z9W A;  1C9C A;  3LY1 A;  2VGU A;  4EU1 A;  3RCH A;  2BWN A;  2OKK A;  4Q31 A;  3DC1 A;  3ATH A;  3EI8 A;  4TMR A;  2EPJ A;  3LG0 A;  4JE5 D;  1W7M A;  4ZAH A;  4KXK A;  2W8V A;  1O4S A;  1B5O A;  4RAE A;  3B1C A;  4FL0 A;  3EIA A;  2Z67 A;  3AEL A;  3FDD A;  2VIA A;  2QBT A;  2F8J A;  5DJ1 A;  1C0N A;  2HUU A;  5AX8 A;  4RJ0 A;  1I43 A;  1H0C A;  2X5F A;  2XH1 A;  5D5S A;  5EUN A;  4EFF A;  5FT4 A;  2Q7W A;  3EI6 A;  3MAF A;  2AY1 A;  2R5E A;  2W7L A;  3UWC A;  3MEB A;  3WKS A;  5E3K A;  1KMJ A;  5E5I A;  4K2I A;  2DGM A;  1FG3 A;  5DX5 A;  3DXW A;  1AHE A;  1B8G A;  5LH9 A;  4XK1 A;  1P3W A;  1E5E A;  5F9S A;  4W5K A;  4Q6R A;  2R2N A;  3RI6 A;  3DRD A;  2W8J A;  5M46 A;  2E7I A;  1WYU A;  1AX4 A;  1JS3 A;  2D7Y A;  4JEW A;  1IX8 A;  3IHJ A;  3MAD A;  2HOZ A;  3LV2 A;  3NTJ A;  3I16 A;  1WST A;  2HOY A;  2JIS A;  3ECD A;  4KYO A;  1TOG A;  1GC3 A;  1QJ5 A;  3B8X A;  3RQ1 A;  1B5P A;  1TOE A;  3HLM A;  1GBN A;  2VYC A;  3N75 A;  4P7Y A;  2YHK A;  4WYD A;  1IUG A;  2YKU A;  5G4I A;  3FCR A;  1ARS A;  2W7I A;  2VMO A;  5TF5 A;  2GSA A;  3I4J A;  4GSA A;  4WXB A;  2CH2 A;  1S08 A;  2AEU A;  3QI6 A;  3LVL B;  1BW0 A;  3A2B A;  4A0R A;  4HF8 A;  4A0F A;  4BQ0 A;  3ZRP A;  1YOO A;  4EMY A;  3GWP A;  4ZSW A;  1I41 A;  1BQD A;  1MLZ A;  2HOR A;  2EZ1 A;  2AY6 A;  5D95 A;  2VMX A;  1ORD A;  2EZ2 A;  5LHA A;  1CQ6 A;  4F5J A;  3N0L A;  1V2D A;  3MAF B;  1Y4I A;  2FYF A;  2FQ6 A;  4EB7 A;  2D63 A;  1CL2 A;  1D7V A;  4Y0I A;  3GJU A;  4F5K A;  5IWQ A;  4TN4 A;  2ZP7 A;  5HXX A;  3QN6 A;  3R9A A;  1LC7 A;  2BI3 A;  3FVU A;  3PDB B;  3GZC A;  2OGA A;  4RKD A;  2BIE A;  3W1J A;  1DJE A;  4A00 A;  3VP6 A;  2EO5 A;  1ASD A;  2D7Z A;  4F5F A;  3BCB A;  1BT4 A;  2FNI A;  2C7T A;  2G6W A;  1EQB A;  4A0G A;  4ZSY A;  1G7X A;  4ZM3 A;  1BS0 A;  1J04 A;  5EAA A;  1BJ4 A;  3AEN B;  2QMA A;  2CAN A;  5EIG A;  3UAK A;  3H14 A;  4OCA A;  2JJH A;  1QGN A;  4F5G A;  1ASC A;  4DBC A;  1MDX A;  5E4Z A;  1ASG A;  1AMA A;  4PVF A;  1M32 A;  1O62 A;  2FNU A;  3USF A;  1UU0 A;  1ZOD A;  4TV7 A;  2BI2 A;  2DKB A;  3M5U A;  1AY8 A;  2FN6 A;  4WLH A;  3FQ7 A;  1DTY A;  2HP2 A;  1G4X A;  2RFV A;  2C0R A;  1LKC A;  3COG A;  3E2F A;  3JZL A;  4GEB A;  4WYC A;  5G0A A;  3BCX A;  4ADC A;  1B9I A;  2CTZ A;  3FZ8 A;  2WK7 A;  4K2B A;  1YJY A;  2TPL A;  2OGE A;  4E3R A;  2CJD A;  1KMK A;  1N8P A;  2VMU A;  3FKD A;  4UHO A;  3K7Y A;  4OBU A;  2AY7 A;  4XJO A;  2OKJ A;  1M7Y A;  3AEM A;  2E7U A;  1ASF A;  3JU7 A;  3KGW A;  1YIY A;  3HQT A;  3NU8 A;  4WYA A;  2ZY5 A;  3HT4 A;  1I29 A;  3T32 A;  4ZDO A;  1IAY A;  4GRX A;  3ELP A;  1SZU A;  2PB0 A;  2Z9V A;  3FD0 A;  4IW7 A;  4NOG A;  1WKH A;  2QB2 A;  1YJZ A;  2QA3 A;  5F8V A;  3Q8N A;  1IBJ A;  2V0Y A;  1QIR A;  2YRR A;  3ISL A;  2W7J A;  1TAT A;  1ECX A;  2ORD A;  4MSO A;  4AZJ A;  4JEY A;  2BWP A;  2VI8 A;  4RKC A;  4RLG A;  4RIZ A;  1AY4 A;  2R0T A;  2AY8 A;  2R5C B;  4ZDP A;  2QLR A;  4ZWV A;  1IJI A;  3L8A A;  2DKJ A;  1S06 A;  3TFU A;  4A6U A;  1S09 A;  4UOY A;  3NU7 A;  4E3Q A;  2BI5 A;  1LS3 A;  3A9X A;  3WX9 A;  3VK3 A;  3PD6 A;  3PIU A;  3WLX A;  1AHF A;  3AEO A;  1MLY A;  2EH6 A;  2Z1Y A;  4ATQ A;  1SZK A;  3DOD A;  4O6Z A;  3E77 A;  1CL1 A;  3I5T A;  3ZZK A;  1W3U A;  2YCT A;  1LC8 A;  1YAA A;  3WZF A;  4E1O A;  2BHX A;  1N2T A;  4IXO A;  2QB3 A;  3FZ7 A;  2DR1 A;  4QGR A;  4F5M A;  1W7L A;  1ELQ A;  1Z3Z A;  1GDE A;  4XJL A;  2WK9 A;  4ITG A;  1EJI A;  4IXS A;  3HDO A;  1AAW A;  2DGL A;  4WYE A;  1AMR A;  3HMU A;  4IY7 A;  4LNJ A;  4EB5 A;  5I92 A;  4GE4 A;  2VIB A;  2VI9 A;  3CQ6 A;  3HBX A;  1G4V A;  3W1H A;  3VK4 A;  2VMQ A;  1AJR A;  3KE3 A;  1AKB A;  4BMK A;  4F5H A;  1AMQ A;  1RVY A;  2HP1 A;  4K2M A;  4RJY A;  1H1C A;  2HUF A;  1GC0 A;  3NUB A;  4A72 A;  1X0M A;  3LVK A;  4PFF A;  1AY5 A;  3D6K A;  3OP7 A;  2NMP A;  3DYD A;  1BJO B;  2D61 A;  4AO9 A;  2BI9 A;  4XAU A;  3RCH B;  2O0R A;  3B46 A;  3CQ4 A;  1MDZ A;  2OQX A;  3E2Y A;  2CJG A;  5G4J A;  1ASN A;  1B9H A;  4UQV A;  3VK2 A;  4HVK A;  4GE9 A;  1BKG A;  1KL1 A;  3NYT A;  3NRA A;  1MAQ A;  3K28 A;  3JW9 A;  3PGY A;  3EUC A;  2VMV A;  3AEP A;  1OXO A;  1PMO A;  4JE5 A;  1SFF A;  4FFC A;  1OAT A;  1PG8 A;  1UU1 A;  3WCN A;  2BKW A;  4WXG A;  1ARI A;  2HUI A;  3BC8 A;  4R2N A;  3DXV A;  2CY8 A;  2VGS A;  3PJ0 A;  3CQ5 A;  3BN1 A;  3ZRR A;  1DFO A;  4OT8 A;  4W1W A;  2YCP A;  3TAT A;  3LVM A;  2Z61 A;  1XEY A;  5FT6 A;  2PO3 A;  4OBV A;  1M0P A;  4LNM A;  1WYV A;  2VMT A;  3ELE A;  4WBT A;  4ADE A;  1EG5 A;  2C44 A;  2W8W A;  3BS8 A;  2HOX A;  4M2J A;  1X2A A;  3LWS A;  4ADB A;  2W7E A;  2ZSM A;  1CZC A;  3FFR A;  3MBB A;  3II0 A;  4E77 A;  1WYT A;  1OXP A;  4WB0 A;  1D7U A;  2XBN A;  2ZSL A;  4M2K A;  4OC9 A;  1TAS A;  4A6R A;  4RM1 A;  1WYU B;  2ZYJ A;  5J8Q A;  4UHN A;  3FQ8 A;  4J5U A;  2Z9X A;  4CBR A;  2GB3 A;  2ZUK A;  1BJN A;  2OAT A;  5G09 A;  1ASB A;  3G0T A;  5EFS A;  1XI9 A;  2YKX A;  1AKC A;  4H51 A;  1O61 A;  2D64 A;  3RUY A;  3ZRQ A;  1AHG A;  2X5D A;  1D7S A;  1VP4 A;  1X29 A;  1GD9 A; 
#chains in the Genus database with same CATH topology
 1I48 A;  1C4K A;  4LNL A;  2FM1 A;  1C7N A;  4B9B A;  9AAT A;  3GZD C;  4MKK A;  3TCM A;  3PDX A;  4F4E A;  2AY2 A;  2WK8 A;  2VGZ A;  1TOK A;  2Z9U A;  3PAA A;  4UHM A;  2BI1 A;  3E2Z A;  1BJW A;  3MKJ A;  3EI5 A;  4Q76 A;  1ARH A;  2VGT A;  1KAF A;  2GQN A;  3W1I A;  4F5I A;  3GBX A;  1ASM A;  4R5F A;  4WD2 A;  4U1T A;  3L44 A;  1DGD A;  3HVY A;  3IF2 A;  3HL2 A;  4OMA A;  5K8B A;  3DZZ A;  4AOA A;  1YNU A;  1M6S A;  3MAU A;  1C7G A;  4ATP A;  2HZP A;  4IX8 A;  2AAT A;  1LK9 A;  2VGW A;  8AAT A;  1JG8 A;  1VJO A;  2BYL A;  4J8L A;  3BWN C;  3FSL A;  4WB0 B;  4IYO A;  1S07 A;  4XEW A;  3N4S A;  3NX3 A;  1C7O A;  2VMS A;  2CJH A;  3E6G A;  1V2F A;  3GET A;  4MY5 A;  5EQC A;  5BJ3 A;  5FT8 A;  3GZD A;  5EIG B;  1QIT A;  2D65 A;  2O1B A;  2KFP A;  4CXR A;  1CJ0 A;  1G7W A;  3A9Z A;  1W23 A;  3P6K A;  4W8I A;  4R8D A;  3EZS A;  1N31 A;  1M0O A;  4P3M A;  1JF9 A;  4ISY A;  1M0Q A;  4CXQ A;  1CZE A;  2YRI A;  4MGR A;  2W7G A;  3FQA A;  4N0B A;  3FVX A;  3EIB A;  4PIW A;  1ASA A;  3NUI A;  1TOI A;  1IX6 A;  1SZS A;  2PB2 A;  1AIA A;  1RVU A;  2W7D A;  3AEJ C;  1RV3 A;  4JEX A;  3EZ1 A;  3MC6 C;  1O69 A;  3K40 A;  1AHX A;  3E2Z B;  4DQ6 A;  5M49 A;  1GEX A;  1CS1 A;  3BWN A;  3CBF A;  5EUE A;  3JTX A;  2CST A;  3AOW A;  3KKI A;  3WGB A;  4OTL A;  4BA4 A;  5BJ4 A;  1W7N A;  5DB5 A;  4MQR A;  7AAT A;  1OHV A;  3ASA A;  1AKA A;  4ZAS A;  3TQX A;  5M4B A;  2FKI A;  1B4X A;  1DJU A;  1GC4 A;  4LW2 A;  3FFH A;  4WP0 A;  1AIC A;  2JJE A;  3BCA A;  4BHD A;  1ARG A;  4ADD A;  2GMS A;  3BV0 A;  2AY3 A;  2D5Y A;  5G2P A;  1OHW A;  1D7R A;  3FDB A;  3RBL A;  1QZ9 A;  1PFF A;  4IYO B;  4N0W A;  1X28 A;  1KKP A;  3PDB A;  1IX7 A;  3F9T A;  3FVS A;  4MQQ A;  1AJS A;  1MAP A;  1WKG A;  3A8U X;  4OYT A;  5DJ9 A;  3PD6 B;  1V72 A;  2V1P A;  2YCN A;  1ZC9 A;  3EI9 A;  3AEJ A;  1GC2 A;  4F5L A;  3N4X A;  4BA5 A;  3MC6 A;  4W1X A;  1FG7 A;  4WYG A;  3NYU A;  3AEN A;  1ZOB A;  2AEV A;  3FZ6 A;  4JEV A;  2W7H A;  5HHY A;  1JS6 A;  2CB1 A;  3QM2 A;  2JJF A;  4W1V A;  3LVJ A;  4CVQ A;  3G7Q A;  3G8M A;  4DGT A;  2DOU A;  3VAX A;  1ASE A;  1PMM A;  2W7F A;  2ZY2 A;  2E54 A;  3F6T A;  2VMZ A;  1LC5 A;  2CH1 A;  1E5F A;  1AAM A;  2AY4 A;  2O7C A;  5JAY A;  3RBF A;  1MGV A;  4GE7 A;  3UE8 A;  4ZLV A;  2VMN A;  4IXZ A;  1LW5 A;  3QBO A;  2BWO A;  3E9K A;  2ZC0 A;  3ZZJ A;  2AY9 A;  1YIZ A;  1AMS A;  3DR7 A;  1MDO A;  2VLH A;  3JWA A;  3QHX A;  2QSR A;  1BQA A;  1ASL A;  2ZJG A;  2YOB A;  1ART A;  2CIN A;  3NDN A;  4JF0 A;  3WKR A;  2BYJ A;  1LW4 A;  1FC4 A;  4ZM4 A;  4ZDL A;  1CQ8 A;  1IAX A;  3OKS A;  2BIA A;  2BIG A;  2VMR A;  1V2E A;  4M2M A;  3B1D A;  3DR4 A;  5M4D A;  2X8U A;  4AH3 A;  4I8A A;  3GR9 A;  2GMU A;  3PA9 A;  4R5Z A;  5HDM A;  2EGY A;  3NNK A;  3QGU A;  4KAM A;  4MKJ A;  4LC3 A;  2ZY4 A;  1DKA A;  1IVR A;  2VMY A;  2Z20 A;  3AEM C;  1GEW A;  2YKY A;  1AHY A;  1AJS B;  2D66 A;  2R5C A;  4A0H A;  2VMP A;  3AOV A;  3FTB A;  4WXF A;  4ZWM A;  3WCO A;  3TFT A;  4JF1 A;  2JG2 A;  3JWB A;  4MQP A;  2W7M A;  1S0A A;  3H7F A;  2WKA A;  3B1E A;  1J32 A;  4PFN A;  5EUD A;  4B98 A;  3FRK A;  1SPA A;  4LW4 A;  4W91 A;  4XQ2 A;  1DGE A;  3P1T A;  3QPG A;  1Z7D A;  4WLJ A;  2G7J A;  1RV4 A;  4L0O A;  3WGC A;  1M0N A;  1AIB A;  2JJG A;  4Y0H A;  3DU4 A;  3PPL A;  4XJP A;  2VLF A;  1TPL A;  4RIT A;  5EAV A;  4CBS A;  1SVV A;  2VGV A;  1GCK A;  5C6U A;  4XJM A;  1UU2 A;  1WYV B;  1GEY A;  2C81 A;  3A9Y A;  2AY5 A;  3R4T A;  5G2Q A;  2ZY3 A;  3GSB A;  3NYS A;  4A6T A;  4WYF A;  3AV7 A;  1SF2 A;  3VOM A;  1D2F A;  3AAT A;  1QJ3 A;  2JGT A;  1CQ7 A;  1WYT B;  1TOJ A;  1KKJ A;  1KL2 A;  1YJS A;  2W8T A;  1TAR A;  1T3I A;  1VEF A;  3CAI A;  1QIS A;  3F0H A;  1DJ9 A;  2Z1Z A;  4AO4 A;  2CFB A;  1UKJ A;  4Q75 A;  4JEZ A;  4Y0D A;  2W8U A;  3WY7 A;  2E7J A;  2YKV A;  3ASB A;  5FT5 A;  2X3L A;  3KGX A;  3BB8 A;  1U08 A;  4AZK A;  1M4N A;  1OHY A;  3EI7 A;  3BWO A;  4ITX A;  2VMW A;  2DGK A;  4GDY A;  4U2H A;  1BJO A;  1ELU A;  3N5M A;  2W7K A;  3ACZ A;  2Z9W A;  1C9C A;  3LY1 A;  2VGU A;  4EU1 A;  3RCH A;  2BWN A;  2OKK A;  4Q31 A;  3DC1 A;  3ATH A;  3EI8 A;  4TMR A;  2EPJ A;  3LG0 A;  4JE5 D;  1W7M A;  4ZAH A;  4KXK A;  2W8V A;  1O4S A;  1B5O A;  4RAE A;  3B1C A;  4FL0 A;  3EIA A;  2Z67 A;  3AEL A;  3FDD A;  2VIA A;  2QBT A;  2F8J A;  5DJ1 A;  1C0N A;  2HUU A;  5AX8 A;  4RJ0 A;  1I43 A;  1H0C A;  2X5F A;  2XH1 A;  5D5S A;  5EUN A;  4EFF A;  5FT4 A;  2Q7W A;  3EI6 A;  3MAF A;  2AY1 A;  2R5E A;  2W7L A;  3UWC A;  3MEB A;  3WKS A;  5E3K A;  3H9X A;  1KMJ A;  5E5I A;  4K2I A;  2DGM A;  1FG3 A;  5DX5 A;  3DXW A;  1AHE A;  1B8G A;  5LH9 A;  4XK1 A;  1P3W A;  1E5E A;  5F9S A;  4W5K A;  4Q6R A;  2R2N A;  3RI6 A;  3DRD A;  2W8J A;  5M46 A;  2E7I A;  1WYU A;  1AX4 A;  1JS3 A;  2D7Y A;  4JEW A;  1IX8 A;  3IHJ A;  3MAD A;  2HOZ A;  3LV2 A;  3NTJ A;  3I16 A;  1WST A;  2HOY A;  2JIS A;  3ECD A;  4KYO A;  1TOG A;  1GC3 A;  1QJ5 A;  3B8X A;  3RQ1 A;  1B5P A;  1TOE A;  3HLM A;  1GBN A;  2VYC A;  3N75 A;  4P7Y A;  2YHK A;  4WYD A;  1IUG A;  2YKU A;  5G4I A;  3FCR A;  1ARS A;  2W7I A;  2VMO A;  5TF5 A;  2GSA A;  3I4J A;  4GSA A;  4WXB A;  2CH2 A;  1S08 A;  2AEU A;  3QI6 A;  3LVL B;  1BW0 A;  3A2B A;  4A0R A;  4HF8 A;  4A0F A;  4BQ0 A;  3ZRP A;  1YOO A;  4EMY A;  3GWP A;  4ZSW A;  1I41 A;  1BQD A;  1MLZ A;  2HOR A;  2EZ1 A;  2AY6 A;  5D95 A;  2VMX A;  1ORD A;  2EZ2 A;  5LHA A;  1CQ6 A;  4F5J A;  3N0L A;  1V2D A;  3MAF B;  1Y4I A;  2FYF A;  2FQ6 A;  4EB7 A;  2D63 A;  1CL2 A;  1D7V A;  4Y0I A;  3GJU A;  4F5K A;  5IWQ A;  4TN4 A;  2ZP7 A;  5HXX A;  3QN6 A;  3R9A A;  1LC7 A;  2BI3 A;  3FVU A;  3PDB B;  3GZC A;  2OGA A;  4RKD A;  2BIE A;  3W1J A;  1DJE A;  4A00 A;  3VP6 A;  2EO5 A;  1ASD A;  2D7Z A;  4F5F A;  3BCB A;  1BT4 A;  2FNI A;  2C7T A;  2G6W A;  1EQB A;  4A0G A;  4ZSY A;  1G7X A;  4ZM3 A;  1BS0 A;  1J04 A;  5EAA A;  1BJ4 A;  3AEN B;  2QMA A;  2CAN A;  5EIG A;  3UAK A;  3H14 A;  4OCA A;  2JJH A;  1QGN A;  4F5G A;  1ASC A;  4DBC A;  1MDX A;  5E4Z A;  1ASG A;  1AMA A;  4PVF A;  1M32 A;  1O62 A;  2FNU A;  3USF A;  1UU0 A;  1ZOD A;  4TV7 A;  2BI2 A;  2DKB A;  3M5U A;  1AY8 A;  2FN6 A;  4WLH A;  3FQ7 A;  1DTY A;  2HP2 A;  1G4X A;  2RFV A;  2C0R A;  1LKC A;  3COG A;  3E2F A;  3JZL A;  4GEB A;  4WYC A;  5G0A A;  3BCX A;  4ADC A;  1B9I A;  2CTZ A;  3FZ8 A;  2WK7 A;  4K2B A;  1YJY A;  2TPL A;  2OGE A;  4E3R A;  2CJD A;  1KMK A;  2WB6 A;  1N8P A;  2VMU A;  3FKD A;  4UHO A;  3K7Y A;  4OBU A;  2AY7 A;  4XJO A;  2OKJ A;  1M7Y A;  3AEM A;  2E7U A;  1ASF A;  3JU7 A;  3KGW A;  1YIY A;  3HQT A;  3NU8 A;  4WYA A;  2ZY5 A;  3HT4 A;  1I29 A;  3T32 A;  4ZDO A;  1IAY A;  4GRX A;  3ELP A;  1SZU A;  2PB0 A;  2Z9V A;  3FD0 A;  4IW7 A;  4NOG A;  1WKH A;  2QB2 A;  1YJZ A;  2QA3 A;  5F8V A;  3Q8N A;  1IBJ A;  2V0Y A;  1QIR A;  2YRR A;  3ISL A;  2W7J A;  1TAT A;  1ECX A;  2ORD A;  4MSO A;  4AZJ A;  4JEY A;  2BWP A;  2VI8 A;  4RKC A;  4RLG A;  4RIZ A;  1AY4 A;  2R0T A;  2AY8 A;  2R5C B;  4ZDP A;  2QLR A;  4ZWV A;  1IJI A;  3L8A A;  2DKJ A;  1S06 A;  3TFU A;  4A6U A;  1S09 A;  4UOY A;  3NU7 A;  4E3Q A;  2BI5 A;  1LS3 A;  3A9X A;  3WX9 A;  3VK3 A;  3PD6 A;  3PIU A;  3WLX A;  1AHF A;  3AEO A;  1MLY A;  2EH6 A;  2Z1Y A;  4ATQ A;  1SZK A;  3DOD A;  4O6Z A;  3E77 A;  1CL1 A;  3I5T A;  3ZZK A;  1W3U A;  2YCT A;  1LC8 A;  1YAA A;  3WZF A;  4E1O A;  2BHX A;  1N2T A;  4IXO A;  2QB3 A;  3FZ7 A;  2DR1 A;  4QGR A;  4F5M A;  1W7L A;  1ELQ A;  1Z3Z A;  1GDE A;  4XJL A;  2WK9 A;  4ITG A;  1EJI A;  4IXS A;  3HDO A;  1AAW A;  2DGL A;  4WYE A;  1AMR A;  3HMU A;  4IY7 A;  4LNJ A;  4K05 A;  4EB5 A;  5I92 A;  4GE4 A;  2VIB A;  2VI9 A;  3CQ6 A;  3HBX A;  3N4R A;  2A1V A;  1G4V A;  3W1H A;  3VK4 A;  2VMQ A;  1AJR A;  3KE3 A;  1AKB A;  4BMK A;  4F5H A;  1AMQ A;  1RVY A;  2HP1 A;  4K2M A;  4RJY A;  1H1C A;  2HUF A;  1GC0 A;  3NUB A;  4A72 A;  1X0M A;  3LVK A;  4PFF A;  1AY5 A;  3D6K A;  3OP7 A;  2NMP A;  3DYD A;  1BJO B;  2D61 A;  4AO9 A;  2BI9 A;  4XAU A;  3RCH B;  2O0R A;  3B46 A;  3CQ4 A;  1MDZ A;  2OQX A;  3E2Y A;  2CJG A;  5G4J A;  1ASN A;  1B9H A;  4UQV A;  3VK2 A;  4HVK A;  4GE9 A;  1BKG A;  1KL1 A;  3NYT A;  3NRA A;  1MAQ A;  3K28 A;  3JW9 A;  3PGY A;  3EUC A;  2VMV A;  3AEP A;  1OXO A;  1PMO A;  4JE5 A;  1SFF A;  4FFC A;  1OAT A;  1PG8 A;  1UU1 A;  3WCN A;  2BKW A;  4WXG A;  1ARI A;  5KTB A;  2HUI A;  3BC8 A;  4R2N A;  3DXV A;  2CY8 A;  2VGS A;  3PJ0 A;  3CQ5 A;  3BN1 A;  3ZRR A;  1DFO A;  4OT8 A;  4W1W A;  2YCP A;  3TAT A;  3LVM A;  2Z61 A;  1XEY A;  5FT6 A;  2PO3 A;  4OBV A;  1M0P A;  4LNM A;  4H63 Q;  1WYV A;  2VMT A;  3ELE A;  4WBT A;  4ADE A;  1EG5 A;  2C44 A;  2W8W A;  3BS8 A;  2HOX A;  4M2J A;  1X2A A;  3LWS A;  4ADB A;  2W7E A;  2ZSM A;  1CZC A;  3FFR A;  3MBB A;  3N7N A;  3II0 A;  4E77 A;  1WYT A;  1OXP A;  4WB0 A;  1D7U A;  2XBN A;  2ZSL A;  4M2K A;  4OC9 A;  2EYQ A;  1TAS A;  4A6R A;  4RM1 A;  1WYU B;  2ZYJ A;  5J8Q A;  4UHN A;  3FQ8 A;  4J5U A;  2Z9X A;  4CBR A;  2GB3 A;  2ZUK A;  1BJN A;  2OAT A;  5G09 A;  1ASB A;  3G0T A;  5EFS A;  1XI9 A;  2YKX A;  1AKC A;  4H51 A;  1O61 A;  2D64 A;  3RUY A;  3ZRQ A;  1AHG A;  2X5D A;  1D7S A;  1VP4 A;  1X29 A;  1GD9 A; 
#chains in the Genus database with same CATH homology
 1I48 A;  1C4K A;  4LNL A;  2FM1 A;  1C7N A;  4B9B A;  9AAT A;  3GZD C;  4MKK A;  3TCM A;  3PDX A;  4F4E A;  2AY2 A;  2WK8 A;  2VGZ A;  1TOK A;  2Z9U A;  3PAA A;  4UHM A;  2BI1 A;  3E2Z A;  1BJW A;  3MKJ A;  3EI5 A;  4Q76 A;  1ARH A;  2VGT A;  2GQN A;  3W1I A;  4F5I A;  3GBX A;  1ASM A;  4R5F A;  4WD2 A;  4U1T A;  3L44 A;  1DGD A;  3HVY A;  3IF2 A;  3HL2 A;  4OMA A;  5K8B A;  3DZZ A;  4AOA A;  1YNU A;  1M6S A;  3MAU A;  1C7G A;  4ATP A;  2HZP A;  4IX8 A;  2AAT A;  1LK9 A;  2VGW A;  8AAT A;  1JG8 A;  1VJO A;  2BYL A;  4J8L A;  3BWN C;  3FSL A;  4WB0 B;  4IYO A;  1S07 A;  4XEW A;  3N4S A;  3NX3 A;  1C7O A;  2VMS A;  2CJH A;  3E6G A;  1V2F A;  3GET A;  4MY5 A;  5EQC A;  5BJ3 A;  5FT8 A;  3GZD A;  5EIG B;  1QIT A;  2D65 A;  2O1B A;  2KFP A;  4CXR A;  1CJ0 A;  1G7W A;  3A9Z A;  1W23 A;  3P6K A;  4W8I A;  4R8D A;  3EZS A;  1N31 A;  1M0O A;  4P3M A;  1JF9 A;  4ISY A;  1M0Q A;  4CXQ A;  1CZE A;  2YRI A;  4MGR A;  2W7G A;  3FQA A;  4N0B A;  3FVX A;  3EIB A;  4PIW A;  1ASA A;  3NUI A;  1TOI A;  1IX6 A;  1SZS A;  2PB2 A;  1AIA A;  1RVU A;  2W7D A;  3AEJ C;  1RV3 A;  4JEX A;  3EZ1 A;  3MC6 C;  1O69 A;  3K40 A;  1AHX A;  3E2Z B;  4DQ6 A;  5M49 A;  1GEX A;  1CS1 A;  3BWN A;  3CBF A;  5EUE A;  3JTX A;  2CST A;  3AOW A;  3KKI A;  3WGB A;  4OTL A;  4BA4 A;  5BJ4 A;  1W7N A;  5DB5 A;  4MQR A;  7AAT A;  1OHV A;  3ASA A;  1AKA A;  4ZAS A;  3TQX A;  5M4B A;  2FKI A;  1B4X A;  1DJU A;  1GC4 A;  4LW2 A;  3FFH A;  4WP0 A;  1AIC A;  2JJE A;  3BCA A;  4BHD A;  1ARG A;  4ADD A;  2GMS A;  3BV0 A;  2AY3 A;  2D5Y A;  5G2P A;  1OHW A;  1D7R A;  3FDB A;  3RBL A;  1QZ9 A;  1PFF A;  4IYO B;  4N0W A;  1X28 A;  1KKP A;  3PDB A;  1IX7 A;  3F9T A;  3FVS A;  4MQQ A;  1AJS A;  1MAP A;  1WKG A;  3A8U X;  4OYT A;  5DJ9 A;  3PD6 B;  1V72 A;  2V1P A;  2YCN A;  1ZC9 A;  3EI9 A;  3AEJ A;  1GC2 A;  4F5L A;  3N4X A;  4BA5 A;  3MC6 A;  4W1X A;  1FG7 A;  4WYG A;  3NYU A;  3AEN A;  1ZOB A;  2AEV A;  3FZ6 A;  4JEV A;  2W7H A;  5HHY A;  1JS6 A;  2CB1 A;  3QM2 A;  2JJF A;  4W1V A;  3LVJ A;  4CVQ A;  3G7Q A;  3G8M A;  4DGT A;  2DOU A;  3VAX A;  1ASE A;  1PMM A;  2W7F A;  2ZY2 A;  2E54 A;  3F6T A;  2VMZ A;  1LC5 A;  2CH1 A;  1E5F A;  1AAM A;  2AY4 A;  2O7C A;  5JAY A;  3RBF A;  1MGV A;  4GE7 A;  3UE8 A;  4ZLV A;  2VMN A;  4IXZ A;  1LW5 A;  3QBO A;  2BWO A;  3E9K A;  2ZC0 A;  3ZZJ A;  2AY9 A;  1YIZ A;  1AMS A;  3DR7 A;  1MDO A;  2VLH A;  3JWA A;  3QHX A;  2QSR A;  1BQA A;  1ASL A;  2ZJG A;  2YOB A;  1ART A;  2CIN A;  3NDN A;  4JF0 A;  3WKR A;  2BYJ A;  1LW4 A;  1FC4 A;  4ZM4 A;  4ZDL A;  1CQ8 A;  1IAX A;  3OKS A;  2BIA A;  2BIG A;  2VMR A;  1V2E A;  4M2M A;  3B1D A;  3DR4 A;  5M4D A;  2X8U A;  4AH3 A;  4I8A A;  3GR9 A;  2GMU A;  3PA9 A;  4R5Z A;  5HDM A;  2EGY A;  3NNK A;  3QGU A;  4KAM A;  4MKJ A;  4LC3 A;  2ZY4 A;  1DKA A;  1IVR A;  2VMY A;  2Z20 A;  3AEM C;  1GEW A;  2YKY A;  1AHY A;  1AJS B;  2D66 A;  2R5C A;  4A0H A;  2VMP A;  3AOV A;  3FTB A;  4WXF A;  4ZWM A;  3WCO A;  3TFT A;  4JF1 A;  2JG2 A;  3JWB A;  4MQP A;  2W7M A;  1S0A A;  3H7F A;  2WKA A;  3B1E A;  1J32 A;  4PFN A;  5EUD A;  4B98 A;  3FRK A;  1SPA A;  4LW4 A;  4W91 A;  4XQ2 A;  1DGE A;  3P1T A;  3QPG A;  1Z7D A;  4WLJ A;  2G7J A;  1RV4 A;  4L0O A;  3WGC A;  1M0N A;  1AIB A;  2JJG A;  4Y0H A;  3DU4 A;  3PPL A;  4XJP A;  2VLF A;  1TPL A;  4RIT A;  5EAV A;  4CBS A;  1SVV A;  2VGV A;  1GCK A;  5C6U A;  4XJM A;  1UU2 A;  1WYV B;  1GEY A;  2C81 A;  3A9Y A;  2AY5 A;  3R4T A;  5G2Q A;  2ZY3 A;  3GSB A;  3NYS A;  4A6T A;  4WYF A;  3AV7 A;  1SF2 A;  3VOM A;  1D2F A;  3AAT A;  1QJ3 A;  2JGT A;  1CQ7 A;  1WYT B;  1TOJ A;  1KKJ A;  1KL2 A;  1YJS A;  2W8T A;  1TAR A;  1T3I A;  1VEF A;  3CAI A;  1QIS A;  3F0H A;  1DJ9 A;  2Z1Z A;  4AO4 A;  2CFB A;  1UKJ A;  4Q75 A;  4JEZ A;  4Y0D A;  2W8U A;  3WY7 A;  2E7J A;  2YKV A;  3ASB A;  5FT5 A;  2X3L A;  3KGX A;  3BB8 A;  1U08 A;  4AZK A;  1M4N A;  1OHY A;  3EI7 A;  3BWO A;  4ITX A;  2VMW A;  2DGK A;  4GDY A;  4U2H A;  1BJO A;  1ELU A;  3N5M A;  2W7K A;  3ACZ A;  2Z9W A;  1C9C A;  3LY1 A;  2VGU A;  4EU1 A;  3RCH A;  2BWN A;  2OKK A;  4Q31 A;  3DC1 A;  3ATH A;  3EI8 A;  4TMR A;  2EPJ A;  3LG0 A;  4JE5 D;  1W7M A;  4ZAH A;  4KXK A;  2W8V A;  1O4S A;  1B5O A;  4RAE A;  3B1C A;  4FL0 A;  3EIA A;  2Z67 A;  3AEL A;  3FDD A;  2VIA A;  2QBT A;  2F8J A;  5DJ1 A;  1C0N A;  2HUU A;  5AX8 A;  4RJ0 A;  1I43 A;  1H0C A;  2X5F A;  2XH1 A;  5D5S A;  5EUN A;  4EFF A;  5FT4 A;  2Q7W A;  3EI6 A;  3MAF A;  2AY1 A;  2R5E A;  2W7L A;  3UWC A;  3MEB A;  3WKS A;  5E3K A;  3H9X A;  1KMJ A;  5E5I A;  4K2I A;  2DGM A;  1FG3 A;  5DX5 A;  3DXW A;  1AHE A;  1B8G A;  5LH9 A;  4XK1 A;  1P3W A;  1E5E A;  5F9S A;  4W5K A;  4Q6R A;  2R2N A;  3RI6 A;  3DRD A;  2W8J A;  5M46 A;  2E7I A;  1WYU A;  1AX4 A;  1JS3 A;  2D7Y A;  4JEW A;  1IX8 A;  3IHJ A;  3MAD A;  2HOZ A;  3LV2 A;  3NTJ A;  3I16 A;  1WST A;  2HOY A;  2JIS A;  3ECD A;  4KYO A;  1TOG A;  1GC3 A;  1QJ5 A;  3B8X A;  3RQ1 A;  1B5P A;  1TOE A;  3HLM A;  1GBN A;  2VYC A;  3N75 A;  4P7Y A;  2YHK A;  4WYD A;  1IUG A;  2YKU A;  5G4I A;  3FCR A;  1ARS A;  2W7I A;  2VMO A;  5TF5 A;  2GSA A;  3I4J A;  4GSA A;  4WXB A;  2CH2 A;  1S08 A;  2AEU A;  3QI6 A;  3LVL B;  1BW0 A;  3A2B A;  4A0R A;  4HF8 A;  4A0F A;  4BQ0 A;  3ZRP A;  1YOO A;  4EMY A;  3GWP A;  4ZSW A;  1I41 A;  1BQD A;  1MLZ A;  2HOR A;  2EZ1 A;  2AY6 A;  5D95 A;  2VMX A;  1ORD A;  2EZ2 A;  5LHA A;  1CQ6 A;  4F5J A;  3N0L A;  1V2D A;  3MAF B;  1Y4I A;  2FYF A;  2FQ6 A;  4EB7 A;  2D63 A;  1CL2 A;  1D7V A;  4Y0I A;  3GJU A;  4F5K A;  5IWQ A;  4TN4 A;  2ZP7 A;  5HXX A;  3QN6 A;  3R9A A;  1LC7 A;  2BI3 A;  3FVU A;  3PDB B;  3GZC A;  2OGA A;  4RKD A;  2BIE A;  3W1J A;  1DJE A;  4A00 A;  3VP6 A;  2EO5 A;  1ASD A;  2D7Z A;  4F5F A;  3BCB A;  1BT4 A;  2FNI A;  2C7T A;  2G6W A;  1EQB A;  4A0G A;  4ZSY A;  1G7X A;  4ZM3 A;  1BS0 A;  1J04 A;  5EAA A;  1BJ4 A;  3AEN B;  2QMA A;  2CAN A;  5EIG A;  3UAK A;  3H14 A;  4OCA A;  2JJH A;  1QGN A;  4F5G A;  1ASC A;  4DBC A;  1MDX A;  5E4Z A;  1ASG A;  1AMA A;  4PVF A;  1M32 A;  1O62 A;  2FNU A;  3USF A;  1UU0 A;  1ZOD A;  4TV7 A;  2BI2 A;  2DKB A;  3M5U A;  1AY8 A;  2FN6 A;  4WLH A;  3FQ7 A;  1DTY A;  2HP2 A;  1G4X A;  2RFV A;  2C0R A;  1LKC A;  3COG A;  3E2F A;  3JZL A;  4GEB A;  4WYC A;  5G0A A;  3BCX A;  4ADC A;  1B9I A;  2CTZ A;  3FZ8 A;  2WK7 A;  4K2B A;  1YJY A;  2TPL A;  2OGE A;  4E3R A;  2CJD A;  1KMK A;  2WB6 A;  1N8P A;  2VMU A;  3FKD A;  4UHO A;  3K7Y A;  4OBU A;  2AY7 A;  4XJO A;  2OKJ A;  1M7Y A;  3AEM A;  2E7U A;  1ASF A;  3JU7 A;  3KGW A;  1YIY A;  3HQT A;  3NU8 A;  4WYA A;  2ZY5 A;  3HT4 A;  1I29 A;  3T32 A;  4ZDO A;  1IAY A;  4GRX A;  3ELP A;  1SZU A;  2PB0 A;  2Z9V A;  3FD0 A;  4IW7 A;  4NOG A;  1WKH A;  2QB2 A;  1YJZ A;  2QA3 A;  5F8V A;  3Q8N A;  1IBJ A;  2V0Y A;  1QIR A;  2YRR A;  3ISL A;  2W7J A;  1TAT A;  1ECX A;  2ORD A;  4MSO A;  4AZJ A;  4JEY A;  2BWP A;  2VI8 A;  4RKC A;  4RLG A;  4RIZ A;  1AY4 A;  2R0T A;  2AY8 A;  2R5C B;  4ZDP A;  2QLR A;  4ZWV A;  1IJI A;  3L8A A;  2DKJ A;  1S06 A;  3TFU A;  4A6U A;  1S09 A;  4UOY A;  3NU7 A;  4E3Q A;  2BI5 A;  1LS3 A;  3A9X A;  3WX9 A;  3VK3 A;  3PD6 A;  3PIU A;  3WLX A;  1AHF A;  3AEO A;  1MLY A;  2EH6 A;  2Z1Y A;  4ATQ A;  1SZK A;  3DOD A;  4O6Z A;  3E77 A;  1CL1 A;  3I5T A;  3ZZK A;  1W3U A;  2YCT A;  1LC8 A;  1YAA A;  3WZF A;  4E1O A;  2BHX A;  1N2T A;  4IXO A;  2QB3 A;  3FZ7 A;  2DR1 A;  4QGR A;  4F5M A;  1W7L A;  1ELQ A;  1Z3Z A;  1GDE A;  4XJL A;  2WK9 A;  4ITG A;  1EJI A;  4IXS A;  3HDO A;  1AAW A;  2DGL A;  4WYE A;  1AMR A;  3HMU A;  4IY7 A;  4LNJ A;  4K05 A;  4EB5 A;  5I92 A;  4GE4 A;  2VIB A;  2VI9 A;  3CQ6 A;  3HBX A;  3N4R A;  2A1V A;  1G4V A;  3W1H A;  3VK4 A;  2VMQ A;  1AJR A;  3KE3 A;  1AKB A;  4BMK A;  4F5H A;  1AMQ A;  1RVY A;  2HP1 A;  4K2M A;  4RJY A;  1H1C A;  2HUF A;  1GC0 A;  3NUB A;  4A72 A;  1X0M A;  3LVK A;  4PFF A;  1AY5 A;  3D6K A;  3OP7 A;  2NMP A;  3DYD A;  1BJO B;  2D61 A;  4AO9 A;  2BI9 A;  4XAU A;  3RCH B;  2O0R A;  3B46 A;  3CQ4 A;  1MDZ A;  2OQX A;  3E2Y A;  2CJG A;  5G4J A;  1ASN A;  1B9H A;  4UQV A;  3VK2 A;  4HVK A;  4GE9 A;  1BKG A;  1KL1 A;  3NYT A;  3NRA A;  1MAQ A;  3K28 A;  3JW9 A;  3PGY A;  3EUC A;  2VMV A;  3AEP A;  1OXO A;  1PMO A;  4JE5 A;  1SFF A;  4FFC A;  1OAT A;  1PG8 A;  1UU1 A;  3WCN A;  2BKW A;  4WXG A;  1ARI A;  5KTB A;  2HUI A;  3BC8 A;  4R2N A;  3DXV A;  2CY8 A;  2VGS A;  3PJ0 A;  3CQ5 A;  3BN1 A;  3ZRR A;  1DFO A;  4OT8 A;  4W1W A;  2YCP A;  3TAT A;  3LVM A;  2Z61 A;  1XEY A;  5FT6 A;  2PO3 A;  4OBV A;  1M0P A;  4LNM A;  4H63 Q;  1WYV A;  2VMT A;  3ELE A;  4WBT A;  4ADE A;  1EG5 A;  2C44 A;  2W8W A;  3BS8 A;  2HOX A;  4M2J A;  1X2A A;  3LWS A;  4ADB A;  2W7E A;  2ZSM A;  1CZC A;  3FFR A;  3MBB A;  3N7N A;  3II0 A;  4E77 A;  1WYT A;  1OXP A;  4WB0 A;  1D7U A;  2XBN A;  2ZSL A;  4M2K A;  4OC9 A;  2EYQ A;  1TAS A;  4A6R A;  4RM1 A;  1WYU B;  2ZYJ A;  5J8Q A;  4UHN A;  3FQ8 A;  4J5U A;  2Z9X A;  4CBR A;  2GB3 A;  2ZUK A;  1BJN A;  2OAT A;  5G09 A;  1ASB A;  3G0T A;  5EFS A;  1XI9 A;  2YKX A;  1AKC A;  4H51 A;  1O61 A;  2D64 A;  3RUY A;  3ZRQ A;  1AHG A;  2X5D A;  1D7S A;  1VP4 A;  1X29 A;  1GD9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...