3VP5A

X-ray crystal structure of wild type hrtr in the holo form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
185
structure length
185
Chain Sequence
PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKPQSSATVPASENDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transcription
total genus 78
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vp5A00
3ZQIA 5CXGA 3CJDA 3WHBA 5D19A 5F0CA 2XB5A 3WHCA 3HTIA 3B6AA 5EFYA 4D5CA 5CXIA 5FGLA 3LSJA 2O7TA 3EGQA 3VW1A 4GFKA 3BT9A 1UI5A 3GZIA 2DG7A 3QBMA 2GUHA 5F04A 3JSJA 3QQAA 5J3LA 2G3BA 5EYRA 3HIMA 5FHPA 2HQ5A 5J1RA 4MK6A 4GCKA 5FKLA 3HGGA 2ZOZA 4I76A 4JL3A 4AF5A 5IP6A 2XPWA 3B6CA 5J1UA 3C07A 3V6GA 1U9NA 3S5RA 2IU5A 2IBDA 3ZQGA 2WGBA 3NXCA 3G1MA 2DTZA 3VP5A 3LOCA 2FBQA 3PM1A 2W53A 5K58A 2NX4A 4AUXA 2ZB9A 3NRGA 3ANGA 2ZCMA 5HSZA 2HYTA 4CGRA 3TP0A 4M3BA 4NELA 1JTXA 3VVZA 2WUIA 2IEKA 2REKA 3P9TA 3BQZA 2QTQA 5DAJA 3LJLA 3O8HA 1T33A 5GPAA 2PBXA 2RAEA 3O60A 3KKCA 2WV1A 4W97A 2FQ4A 2RASA 3HGYA 5C4YA 3LWJA 3NI7A 3DCFA 1ZK8A 1U9OA 2O7OA 4M3DA 3KNWA 3F0CA 3ANPA 3IUVA 2GENA 3BHQA 3VW2A 1BJZA 1JUMA 3BQYA 2Q24A 2QOPA 3FK6A 5J1YA 1Z0XA 2UXOA 1JUSA 3RH2A 3FIWA 1SGMA 4NN1A 3NPIA 2FX0A 2VKVA 3MVPA 1ORKA 3BNIA 3Q0UA 2JK3A 4V2FA 3BJBA 3ZQFA 5HBUA 3AQTA 3SDGA 3BR6A 3IH2A 1QPIA 3VIBA 4XK4A 3O8GA 3B81A 4X1EA 3LSRA 3VOKA 2HXIA 4PXIA 3BTLA 3ON2A 3ZQHA 5FKOA 2ID6A 3ZQLA 3CDLA 2Y31A 3TP3A 2OERA 3AQSA 3Q3SA 2XPUA 2HYJA 3HTHA 4GCTA 3IH3A 2Y30A 3VUQA 2X9DA 4AC0A 4JYKA 3FRQA 3PASA 5GP9A 2D6YA 3HE0A 5D1RA 2V57A 5EZGA 3BTIA 2GFNA 2G0EA 2FD5A 3G1OA 1QVUA 4M3FA 2DG8A 2ZOYA 3CCYA 3QPLA 4B1RA 2XGDA 3FK7A 2NP5A 2XRLA 4ICHA 2JJ7A 5EZHA 4I6ZA 1RPWA 2EH3A 4W1UA 2XGEA 3LHQA 2OI8A 1UI6A 5IPAA 1JUPA 2YVHA 5FKKA 4D7MA 2QCOA 5K7FA 3E7QA 1Z77A 4GFLA 2XDNA 2ID3A 3VPRA 3G1LA 5H9TA 3NNRA 3Q0VA 2UXUA 4JKZA 4M3GA 3CWRA 3RD3A 3Q0WA 2UXPA 2GBYA 3ON4A 1JT0A 1A6IA 2NP3A 2XGCA 5FKNA 3KZ9A 2QKOA 3VVXA 2TCTA 3BR1A 2VKEA 2RHAA 3EUPA 1VI0A 4G12A 2XPVA 5F27A 4KWAA 2G7SA 2I10A 4JNNA 3HTAA 3GEUA 3BRUA 2OF7A 3BR3A 4ACIA 4DW6A 3BR2A 5D18A 2QIBA 2G7LA 2FJ1A 3COLA 3BTJA 4L62A 2IAIA 2YVEA 4ME9A 2Y2ZA 2UXHA 2TRTA 5FMPA 2G7GA 3G56A 4HKUA 5CW8A 5IOYA 3HTJA 3VW0A 3DEWA 3MNLA 3V78A 2NS8A 3IH4A 4D7NA 5F08A 5FKMA 1T56A 5K7HA 2F07A 1RKWA 3DPJA 2OPTA 4D5FA 3G7RA 3BTCA 3F1BA 5GPCA 5F1JA 2PZ9A 5F0HA 3T6NA 3C2BA 4M3EA 1QVTA 2QWTA 3VOXA 4MXMA 4GCLA 3VVYA 2VPRA 2UXIA 2HKUA 4V2GA 4YZEA 3KKDA 1JTYA 3BCGA 4ABZA 4B3AA 3PPBA 1ZKGA 3BR0A 5F0FA 3LSPA 2HXOA 3SFIA 3CRJA 3QPSA 3BR5A 1JT6A 2ZCNA 1RKTA 2ZCXA 2X6OA 5AQCA 5HAWA 4MO7A 5IOZA 2NS7A 3QKXA 5K7ZA 4UDSA 4AC6A
chains in the Genus database with same CATH superfamily
3ZQIA 5CXGA 3CJDA 3WHBA 5D19A 5F0CA 4U9LA 2XB5A 2R7UA 3WHCA 3HTIA 3B6AA 5EFYA 4D5CA 5CXIA 5FGLA 3LSJA 2O7TA 3EGQA 3VW1A 4GFKA 3BT9A 1UI5A 3GZIA 2DG7A 3QBMA 2GUHA 5F04A 3QQAA 3JSJA 5J3LA 2G3BA 5EYRA 3HIMA 5FHPA 2HQ5A 4OD5A 5J1RA 4MK6A 4GCKA 5FKLA 3HGGA 2ZOZA 4I76A 4JL3A 4AF5A 5IP6A 2XPWA 3B6CA 5J1UA 3C07A 3V6GA 1U9NA 3S5RA 2IU5A 2IBDA 3ZQGA 2WGBA 2R7SA 3NXCA 4U9NA 3G1MA 2R7WA 2DTZA 3VP5A 3LOCA 2FBQA 3PM1A 2W53A 5K58A 2B3WA 2NX4A 4AUXA 2ZB9A 3NRGA 3ANGA 2R7XA 2ZCMA 4OD4A 5HSZA 2HYTA 4CGRA 2R7RA 3TP0A 4M3BA 4NELA 1JTXA 2R7QA 3VVZA 2WUIA 2IEKA 2REKA 3P9TA 3BQZA 2QTQA 5DAJA 3LJLA 3O8HA 1T33A 5GPAA 2PBXA 2RAEA 3O60A 3KKCA 2WV1A 4W97A 2FQ4A 2RASA 2YVXA 3HGYA 5C4YA 3LWJA 3NI7A 3DCFA 1ZK8A 1U9OA 2O7OA 4M3DA 3KNWA 3F0CA 3ANPA 3IUVA 2GENA 3BHQA 3VW2A 1BJZA 1JUMA 3BQYA 2Q24A 2QOPA 3FK6A 5J1YA 1Z0XA 2UXOA 4C2MA 4WIBA 1JUSA 2A2FX 3RH2A 3FIWA 1SGMA 4NN1A 3NPIA 2FX0A 2VKVA 3MVPA 1ORKA 3BNIA 3Q0UA 2JK3A 4V2FA 3BJBA 3ZQFA 5HBUA 3AQTA 3SDGA 3BR6A 3IH2A 1QPIA 5CQGA 3VIBA 4XK4A 4DVYP 3O8GA 3B81A 4X1EA 3LSRA 3VOKA 2HXIA 4PXIA 3BTLA 3ON2A 3ZQHA 5FKOA 2ID6A 3ZQLA 3CDLA 3VTIA 2Y31A 3TP3A 2OERA 3AQSA 3Q3SA 2XPUA 2HYJA 3HTHA 4GCTA 3IH3A 2Y30A 3VUQA 2X9DA 4AC0A 2R7OA 4JYKA 3FRQA 3PASA 5GP9A 2D6YA 3HE0A 5D1RA 2V57A 5EZGA 3BTIA 2GFNA 3K8PC 2G0EA 2FD5A 3G1OA 1QVUA 4M3FA 2DG8A 2ZOYA 3CCYA 3QPLA 4B1RA 2XGDA 3FK7A 2NP5A 2XRLA 3DU6A 4IRVA 4ICHA 2JJ7A 5EZHA 4I6ZA 1RPWA 2EH3A 4W1UA 2XGEA 3LHQA 2OI8A 1UI6A 5IPAA 1JUPA 2R7VA 2FJI1 2YVHA 5FKKA 4D7MA 2QCOA 5K7FA 3E7QA 1Z77A 4GFLA 2XDNA 2ID3A 3VPRA 3G1LA 5H9TA 3SWHA 3NNRA 3Q0VA 2UXUA 4JKZA 4M3GA 3CWRA 3RD3A 3Q0WA 2UXPA 2GBYA 3ON4A 1JT0A 1A6IA 2NP3A 2XGCA 2PFVA 5FKNA 3KZ9A 2QKOA 3VVXA 2TCTA 3BR1A 2VKEA 2RHAA 3EUPA 1VI0A 4G12A 2XPVA 5F27A 4KWAA 2G7SA 2I10A 4JNNA 3HTAA 3GEUA 3BRUA 2OF7A 3BR3A 4ACIA 4DW6A 3BR2A 5D18A 2QIBA 2G7LA 2FJ1A 3COLA 3BTJA 4L62A 2IAIA 2YVEA 3NS4A 4ME9A 2Y2ZA 2UXHA 2B1EA 2TRTA 5FMPA 2G7GA 3G56A 4HKUA 5CW8A 5IOYA 3HTJA 3MNLA 3DEWA 3V78A 3DU5A 3VW0A 2NS8A 3IH4A 4D7NA 5F08A 5FKMA 1T56A 5K7HA 2F07A 1RKWA 3DPJA 3KYLA 2OPTA 2ZY9A 4D5FA 3G7RA 3BTCA 3F1BA 5GPCA 5F1JA 2PZ9A 5F0HA 3T6NA 3C2BA 4M3EA 1QVTA 2QWTA 3VOXA 4MXMA 4GCLA 3VVYA 2VPRA 2UXIA 2HKUA 4V2GA 4YZEA 3KKDA 1JTYA 3BCGA 4ABZA 4B3AA 3PPBA 1ZKGA 3BR0A 5F0FA 3LSPA 2HXOA 3SFIA 3FHNA 3CRJA 3QPSA 3BR5A 1JT6A 2ZCNA 1RKTA 2ZCXA 2X6OA 5AQCA 5HAWA 4MO7A 5IOZA 2NS7A 3QKXA 5K7ZA 4UDSA 4AC6A 2R7TA
chains in the Genus database with same CATH topology
3ZQIA 5CXGA 3CJDA 3WHBA 5D19A 5F0CA 2XB5A 3WHCA 3HTIA 3B6AA 5EFYA 4D5CA 5CXIA 5FGLA 3LSJA 2O7TA 3EGQA 3VW1A 4GFKA 3BT9A 1UI5A 3GZIA 2DG7A 3QBMA 2GUHA 5F04A 3JSJA 3QQAA 5J3LA 2G3BA 5EYRA 3HIMA 5FHPA 2HQ5A 5J1RA 4MK6A 4GCKA 5FKLA 3HGGA 2ZOZA 4I76A 4JL3A 4AF5A 5IP6A 2XPWA 3B6CA 5J1UA 3C07A 3V6GA 1U9NA 3S5RA 2IU5A 2IBDA 3ZQGA 2WGBA 3NXCA 3G1MA 2DTZA 3VP5A 3LOCA 2FBQA 3PM1A 2W53A 5K58A 2NX4A 4AUXA 2ZB9A 3NRGA 3ANGA 2ZCMA 5HSZA 2HYTA 4CGRA 3TP0A 4M3BA 4NELA 1JTXA 3VVZA 2WUIA 2IEKA 2REKA 3P9TA 3BQZA 2QTQA 5DAJA 3LJLA 3O8HA 1T33A 5GPAA 2PBXA 2RAEA 3O60A 3KKCA 2WV1A 4W97A 2FQ4A 2RASA 3HGYA 5C4YA 3LWJA 3NI7A 3DCFA 1ZK8A 1U9OA 2O7OA 4M3DA 3KNWA 3F0CA 3ANPA 3IUVA 2GENA 3BHQA 3VW2A 1BJZA 1JUMA 3BQYA 2Q24A 2QOPA 3FK6A 5J1YA 1Z0XA 2UXOA 1JUSA 3RH2A 3FIWA 1SGMA 4NN1A 3NPIA 2FX0A 2VKVA 3MVPA 1ORKA 3BNIA 3Q0UA 2JK3A 4V2FA 3BJBA 3ZQFA 5HBUA 3AQTA 3SDGA 3BR6A 3IH2A 1QPIA 3VIBA 4XK4A 3O8GA 3B81A 4X1EA 3LSRA 3VOKA 2HXIA 4PXIA 3BTLA 3ON2A 3ZQHA 5FKOA 2ID6A 3ZQLA 3CDLA 2Y31A 3TP3A 2OERA 3AQSA 3Q3SA 2XPUA 2HYJA 3HTHA 4GCTA 3IH3A 2Y30A 3VUQA 2X9DA 4AC0A 4JYKA 3FRQA 3PASA 5GP9A 2D6YA 3HE0A 5D1RA 2V57A 5EZGA 3BTIA 2GFNA 2G0EA 2FD5A 3G1OA 1QVUA 4M3FA 2DG8A 2ZOYA 3CCYA 3QPLA 4B1RA 2XGDA 3FK7A 2NP5A 2XRLA 4ICHA 2JJ7A 5EZHA 4I6ZA 1RPWA 2EH3A 4W1UA 2XGEA 3LHQA 2OI8A 1UI6A 5IPAA 1JUPA 2YVHA 5FKKA 4D7MA 2QCOA 5K7FA 3E7QA 1Z77A 4GFLA 2XDNA 2ID3A 3VPRA 3G1LA 5H9TA 3NNRA 3Q0VA 2UXUA 4JKZA 4M3GA 3CWRA 3RD3A 3Q0WA 2UXPA 2GBYA 3ON4A 1JT0A 1A6IA 2NP3A 2XGCA 5FKNA 3KZ9A 2QKOA 3VVXA 2TCTA 3BR1A 2VKEA 2RHAA 3EUPA 1VI0A 4G12A 2XPVA 5F27A 4KWAA 2G7SA 2I10A 4JNNA 3HTAA 3GEUA 3BRUA 2OF7A 3BR3A 4ACIA 4DW6A 3BR2A 5D18A 2QIBA 2G7LA 2FJ1A 3COLA 3BTJA 4L62A 2IAIA 2YVEA 4ME9A 2Y2ZA 2UXHA 2TRTA 5FMPA 2G7GA 3G56A 4HKUA 5CW8A 5IOYA 3HTJA 3VW0A 3DEWA 3MNLA 3V78A 2NS8A 3IH4A 4D7NA 5F08A 5FKMA 1T56A 5K7HA 2F07A 1RKWA 3DPJA 2OPTA 4D5FA 3G7RA 3BTCA 3F1BA 5GPCA 5F1JA 2PZ9A 5F0HA 3T6NA 3C2BA 4M3EA 1QVTA 2QWTA 3VOXA 4MXMA 4GCLA 3VVYA 2VPRA 2UXIA 2HKUA 4V2GA 4YZEA 3KKDA 1JTYA 3BCGA 4ABZA 4B3AA 3PPBA 1ZKGA 3BR0A 5F0FA 3LSPA 2HXOA 3SFIA 3CRJA 3QPSA 3BR5A 1JT6A 2ZCNA 1RKTA 2ZCXA 2X6OA 5AQCA 5HAWA 4MO7A 5IOZA 2NS7A 3QKXA 5K7ZA 4UDSA 4AC6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQI A;  5CXG A;  3CJD A;  3WHB A;  5D19 A;  5F0C A;  2XB5 A;  3WHC A;  3HTI A;  3B6A A;  5EFY A;  4D5C A;  5CXI A;  5FGL A;  3LSJ A;  2O7T A;  3EGQ A;  3VW1 A;  4GFK A;  3BT9 A;  1UI5 A;  3GZI A;  2DG7 A;  3QBM A;  2GUH A;  5F04 A;  3JSJ A;  3QQA A;  5J3L A;  2G3B A;  5EYR A;  3HIM A;  5FHP A;  2HQ5 A;  5J1R A;  4MK6 A;  4GCK A;  5FKL A;  3HGG A;  2ZOZ A;  4I76 A;  4JL3 A;  4AF5 A;  5IP6 A;  2XPW A;  3B6C A;  5J1U A;  3C07 A;  3V6G A;  1U9N A;  3S5R A;  2IU5 A;  2IBD A;  3ZQG A;  2WGB A;  3NXC A;  3G1M A;  2DTZ A;  3VP5 A;  3LOC A;  2FBQ A;  3PM1 A;  2W53 A;  5K58 A;  2NX4 A;  4AUX A;  2ZB9 A;  3NRG A;  3ANG A;  2ZCM A;  5HSZ A;  2HYT A;  4CGR A;  3TP0 A;  4M3B A;  4NEL A;  1JTX A;  3VVZ A;  2WUI A;  2IEK A;  2REK A;  3P9T A;  3BQZ A;  2QTQ A;  5DAJ A;  3LJL A;  3O8H A;  1T33 A;  5GPA A;  2PBX A;  2RAE A;  3O60 A;  3KKC A;  2WV1 A;  4W97 A;  2FQ4 A;  2RAS A;  3HGY A;  5C4Y A;  3LWJ A;  3NI7 A;  3DCF A;  1ZK8 A;  1U9O A;  2O7O A;  4M3D A;  3KNW A;  3F0C A;  3ANP A;  3IUV A;  2GEN A;  3BHQ A;  3VW2 A;  1BJZ A;  1JUM A;  3BQY A;  2Q24 A;  2QOP A;  3FK6 A;  5J1Y A;  1Z0X A;  2UXO A;  1JUS A;  3RH2 A;  3FIW A;  1SGM A;  4NN1 A;  3NPI A;  2FX0 A;  2VKV A;  3MVP A;  1ORK A;  3BNI A;  3Q0U A;  2JK3 A;  4V2F A;  3BJB A;  3ZQF A;  5HBU A;  3AQT A;  3SDG A;  3BR6 A;  3IH2 A;  1QPI A;  3VIB A;  4XK4 A;  3O8G A;  3B81 A;  4X1E A;  3LSR A;  3VOK A;  2HXI A;  4PXI A;  3BTL A;  3ON2 A;  3ZQH A;  5FKO A;  2ID6 A;  3ZQL A;  3CDL A;  2Y31 A;  3TP3 A;  2OER A;  3AQS A;  3Q3S A;  2XPU A;  2HYJ A;  3HTH A;  4GCT A;  3IH3 A;  2Y30 A;  3VUQ A;  2X9D A;  4AC0 A;  4JYK A;  3FRQ A;  3PAS A;  5GP9 A;  2D6Y A;  3HE0 A;  5D1R A;  2V57 A;  5EZG A;  3BTI A;  2GFN A;  2G0E A;  2FD5 A;  3G1O A;  1QVU A;  4M3F A;  2DG8 A;  2ZOY A;  3CCY A;  3QPL A;  4B1R A;  2XGD A;  3FK7 A;  2NP5 A;  2XRL A;  4ICH A;  2JJ7 A;  5EZH A;  4I6Z A;  1RPW A;  2EH3 A;  4W1U A;  2XGE A;  3LHQ A;  2OI8 A;  1UI6 A;  5IPA A;  1JUP A;  2YVH A;  5FKK A;  4D7M A;  2QCO A;  5K7F A;  3E7Q A;  1Z77 A;  4GFL A;  2XDN A;  2ID3 A;  3VPR A;  3G1L A;  5H9T A;  3NNR A;  3Q0V A;  2UXU A;  4JKZ A;  4M3G A;  3CWR A;  3RD3 A;  3Q0W A;  2UXP A;  2GBY A;  3ON4 A;  1JT0 A;  1A6I A;  2NP3 A;  2XGC A;  5FKN A;  3KZ9 A;  2QKO A;  3VVX A;  2TCT A;  3BR1 A;  2VKE A;  2RHA A;  3EUP A;  1VI0 A;  4G12 A;  2XPV A;  5F27 A;  4KWA A;  2G7S A;  2I10 A;  4JNN A;  3HTA A;  3GEU A;  3BRU A;  2OF7 A;  3BR3 A;  4ACI A;  4DW6 A;  3BR2 A;  5D18 A;  2QIB A;  2G7L A;  2FJ1 A;  3COL A;  3BTJ A;  4L62 A;  2IAI A;  2YVE A;  4ME9 A;  2Y2Z A;  2UXH A;  2TRT A;  5FMP A;  2G7G A;  3G56 A;  4HKU A;  5CW8 A;  5IOY A;  3HTJ A;  3VW0 A;  3DEW A;  3MNL A;  3V78 A;  2NS8 A;  3IH4 A;  4D7N A;  5F08 A;  5FKM A;  1T56 A;  5K7H A;  2F07 A;  1RKW A;  3DPJ A;  2OPT A;  4D5F A;  3G7R A;  3BTC A;  3F1B A;  5GPC A;  5F1J A;  2PZ9 A;  5F0H A;  3T6N A;  3C2B A;  4M3E A;  1QVT A;  2QWT A;  3VOX A;  4MXM A;  4GCL A;  3VVY A;  2VPR A;  2UXI A;  2HKU A;  4V2G A;  4YZE A;  3KKD A;  1JTY A;  3BCG A;  4ABZ A;  4B3A A;  3PPB A;  1ZKG A;  3BR0 A;  5F0F A;  3LSP A;  2HXO A;  3SFI A;  3CRJ A;  3QPS A;  3BR5 A;  1JT6 A;  2ZCN A;  1RKT A;  2ZCX A;  2X6O A;  5AQC A;  5HAW A;  4MO7 A;  5IOZ A;  2NS7 A;  3QKX A;  5K7Z A;  4UDS A;  4AC6 A; 
#chains in the Genus database with same CATH topology
 3ZQI A;  5CXG A;  3CJD A;  3WHB A;  5D19 A;  5F0C A;  4U9L A;  2XB5 A;  2R7U A;  3WHC A;  3HTI A;  3B6A A;  5EFY A;  4D5C A;  5CXI A;  5FGL A;  3LSJ A;  2O7T A;  3EGQ A;  3VW1 A;  4GFK A;  3BT9 A;  1UI5 A;  3GZI A;  2DG7 A;  3QBM A;  2GUH A;  5F04 A;  3QQA A;  3JSJ A;  5J3L A;  2G3B A;  5EYR A;  3HIM A;  5FHP A;  2HQ5 A;  4OD5 A;  5J1R A;  4MK6 A;  4GCK A;  5FKL A;  3HGG A;  2ZOZ A;  4I76 A;  4JL3 A;  4AF5 A;  5IP6 A;  2XPW A;  3B6C A;  5J1U A;  3C07 A;  3V6G A;  1U9N A;  3S5R A;  2IU5 A;  2IBD A;  3ZQG A;  2WGB A;  2R7S A;  3NXC A;  4U9N A;  3G1M A;  2R7W A;  2DTZ A;  3VP5 A;  3LOC A;  2FBQ A;  3PM1 A;  2W53 A;  5K58 A;  2B3W A;  2NX4 A;  4AUX A;  2ZB9 A;  3NRG A;  3ANG A;  2R7X A;  2ZCM A;  4OD4 A;  5HSZ A;  2HYT A;  4CGR A;  2R7R A;  3TP0 A;  4M3B A;  4NEL A;  1JTX A;  2R7Q A;  3VVZ A;  2WUI A;  2IEK A;  2REK A;  3P9T A;  3BQZ A;  2QTQ A;  5DAJ A;  3LJL A;  3O8H A;  1T33 A;  5GPA A;  2PBX A;  2RAE A;  3O60 A;  3KKC A;  2WV1 A;  4W97 A;  2FQ4 A;  2RAS A;  2YVX A;  3HGY A;  5C4Y A;  3LWJ A;  3NI7 A;  3DCF A;  1ZK8 A;  1U9O A;  2O7O A;  4M3D A;  3KNW A;  3F0C A;  3ANP A;  3IUV A;  2GEN A;  3BHQ A;  3VW2 A;  1BJZ A;  1JUM A;  3BQY A;  2Q24 A;  2QOP A;  3FK6 A;  5J1Y A;  1Z0X A;  2UXO A;  4C2M A;  4WIB A;  1JUS A;  2A2F X;  3RH2 A;  3FIW A;  1SGM A;  4NN1 A;  3NPI A;  2FX0 A;  2VKV A;  3MVP A;  1ORK A;  3BNI A;  3Q0U A;  2JK3 A;  4V2F A;  3BJB A;  3ZQF A;  5HBU A;  3AQT A;  3SDG A;  3BR6 A;  3IH2 A;  1QPI A;  5CQG A;  3VIB A;  4XK4 A;  4DVY P;  3O8G A;  3B81 A;  4X1E A;  3LSR A;  3VOK A;  2HXI A;  4PXI A;  3BTL A;  3ON2 A;  3ZQH A;  5FKO A;  2ID6 A;  3ZQL A;  3CDL A;  3VTI A;  2Y31 A;  3TP3 A;  2OER A;  3AQS A;  3Q3S A;  2XPU A;  2HYJ A;  3HTH A;  4GCT A;  3IH3 A;  2Y30 A;  3VUQ A;  2X9D A;  4AC0 A;  2R7O A;  4JYK A;  3FRQ A;  3PAS A;  5GP9 A;  2D6Y A;  3HE0 A;  5D1R A;  2V57 A;  5EZG A;  3BTI A;  2GFN A;  3K8P C;  2G0E A;  2FD5 A;  3G1O A;  1QVU A;  4M3F A;  2DG8 A;  2ZOY A;  3CCY A;  3QPL A;  4B1R A;  2XGD A;  3FK7 A;  2NP5 A;  2XRL A;  3DU6 A;  4IRV A;  4ICH A;  2JJ7 A;  5EZH A;  4I6Z A;  1RPW A;  2EH3 A;  4W1U A;  2XGE A;  3LHQ A;  2OI8 A;  1UI6 A;  5IPA A;  1JUP A;  2R7V A;  2FJI 1;  2YVH A;  5FKK A;  4D7M A;  2QCO A;  5K7F A;  3E7Q A;  1Z77 A;  4GFL A;  2XDN A;  2ID3 A;  3VPR A;  3G1L A;  5H9T A;  3SWH A;  3NNR A;  3Q0V A;  2UXU A;  4JKZ A;  4M3G A;  3CWR A;  3RD3 A;  3Q0W A;  2UXP A;  2GBY A;  3ON4 A;  1JT0 A;  1A6I A;  2NP3 A;  2XGC A;  2PFV A;  5FKN A;  3KZ9 A;  2QKO A;  3VVX A;  2TCT A;  3BR1 A;  2VKE A;  2RHA A;  3EUP A;  1VI0 A;  4G12 A;  2XPV A;  5F27 A;  4KWA A;  2G7S A;  2I10 A;  4JNN A;  3HTA A;  3GEU A;  3BRU A;  2OF7 A;  3BR3 A;  4ACI A;  4DW6 A;  3BR2 A;  5D18 A;  2QIB A;  2G7L A;  2FJ1 A;  3COL A;  3BTJ A;  4L62 A;  2IAI A;  2YVE A;  3NS4 A;  4ME9 A;  2Y2Z A;  2UXH A;  2B1E A;  2TRT A;  5FMP A;  2G7G A;  3G56 A;  4HKU A;  5CW8 A;  5IOY A;  3HTJ A;  3MNL A;  3DEW A;  3V78 A;  3DU5 A;  3VW0 A;  2NS8 A;  3IH4 A;  4D7N A;  5F08 A;  5FKM A;  1T56 A;  5K7H A;  2F07 A;  1RKW A;  3DPJ A;  3KYL A;  2OPT A;  2ZY9 A;  4D5F A;  3G7R A;  3BTC A;  3F1B A;  5GPC A;  5F1J A;  2PZ9 A;  5F0H A;  3T6N A;  3C2B A;  4M3E A;  1QVT A;  2QWT A;  3VOX A;  4MXM A;  4GCL A;  3VVY A;  2VPR A;  2UXI A;  2HKU A;  4V2G A;  4YZE A;  3KKD A;  1JTY A;  3BCG A;  4ABZ A;  4B3A A;  3PPB A;  1ZKG A;  3BR0 A;  5F0F A;  3LSP A;  2HXO A;  3SFI A;  3FHN A;  3CRJ A;  3QPS A;  3BR5 A;  1JT6 A;  2ZCN A;  1RKT A;  2ZCX A;  2X6O A;  5AQC A;  5HAW A;  4MO7 A;  5IOZ A;  2NS7 A;  3QKX A;  5K7Z A;  4UDS A;  4AC6 A;  2R7T A; 
#chains in the Genus database with same CATH homology
 3ZQI A;  5CXG A;  3CJD A;  3WHB A;  5D19 A;  5F0C A;  2XB5 A;  3WHC A;  3HTI A;  3B6A A;  5EFY A;  4D5C A;  5CXI A;  5FGL A;  3LSJ A;  2O7T A;  3EGQ A;  3VW1 A;  4GFK A;  3BT9 A;  1UI5 A;  3GZI A;  2DG7 A;  3QBM A;  2GUH A;  5F04 A;  3JSJ A;  3QQA A;  5J3L A;  2G3B A;  5EYR A;  3HIM A;  5FHP A;  2HQ5 A;  5J1R A;  4MK6 A;  4GCK A;  5FKL A;  3HGG A;  2ZOZ A;  4I76 A;  4JL3 A;  4AF5 A;  5IP6 A;  2XPW A;  3B6C A;  5J1U A;  3C07 A;  3V6G A;  1U9N A;  3S5R A;  2IU5 A;  2IBD A;  3ZQG A;  2WGB A;  3NXC A;  3G1M A;  2DTZ A;  3VP5 A;  3LOC A;  2FBQ A;  3PM1 A;  2W53 A;  5K58 A;  2NX4 A;  4AUX A;  2ZB9 A;  3NRG A;  3ANG A;  2ZCM A;  5HSZ A;  2HYT A;  4CGR A;  3TP0 A;  4M3B A;  4NEL A;  1JTX A;  3VVZ A;  2WUI A;  2IEK A;  2REK A;  3P9T A;  3BQZ A;  2QTQ A;  5DAJ A;  3LJL A;  3O8H A;  1T33 A;  5GPA A;  2PBX A;  2RAE A;  3O60 A;  3KKC A;  2WV1 A;  4W97 A;  2FQ4 A;  2RAS A;  3HGY A;  5C4Y A;  3LWJ A;  3NI7 A;  3DCF A;  1ZK8 A;  1U9O A;  2O7O A;  4M3D A;  3KNW A;  3F0C A;  3ANP A;  3IUV A;  2GEN A;  3BHQ A;  3VW2 A;  1BJZ A;  1JUM A;  3BQY A;  2Q24 A;  2QOP A;  3FK6 A;  5J1Y A;  1Z0X A;  2UXO A;  1JUS A;  3RH2 A;  3FIW A;  1SGM A;  4NN1 A;  3NPI A;  2FX0 A;  2VKV A;  3MVP A;  1ORK A;  3BNI A;  3Q0U A;  2JK3 A;  4V2F A;  3BJB A;  3ZQF A;  5HBU A;  3AQT A;  3SDG A;  3BR6 A;  3IH2 A;  1QPI A;  3VIB A;  4XK4 A;  3O8G A;  3B81 A;  4X1E A;  3LSR A;  3VOK A;  2HXI A;  4PXI A;  3BTL A;  3ON2 A;  3ZQH A;  5FKO A;  2ID6 A;  3ZQL A;  3CDL A;  2Y31 A;  3TP3 A;  2OER A;  3AQS A;  3Q3S A;  2XPU A;  2HYJ A;  3HTH A;  4GCT A;  3IH3 A;  2Y30 A;  3VUQ A;  2X9D A;  4AC0 A;  4JYK A;  3FRQ A;  3PAS A;  5GP9 A;  2D6Y A;  3HE0 A;  5D1R A;  2V57 A;  5EZG A;  3BTI A;  2GFN A;  2G0E A;  2FD5 A;  3G1O A;  1QVU A;  4M3F A;  2DG8 A;  2ZOY A;  3CCY A;  3QPL A;  4B1R A;  2XGD A;  3FK7 A;  2NP5 A;  2XRL A;  4ICH A;  2JJ7 A;  5EZH A;  4I6Z A;  1RPW A;  2EH3 A;  4W1U A;  2XGE A;  3LHQ A;  2OI8 A;  1UI6 A;  5IPA A;  1JUP A;  2YVH A;  5FKK A;  4D7M A;  2QCO A;  5K7F A;  3E7Q A;  1Z77 A;  4GFL A;  2XDN A;  2ID3 A;  3VPR A;  3G1L A;  5H9T A;  3NNR A;  3Q0V A;  2UXU A;  4JKZ A;  4M3G A;  3CWR A;  3RD3 A;  3Q0W A;  2UXP A;  2GBY A;  3ON4 A;  1JT0 A;  1A6I A;  2NP3 A;  2XGC A;  5FKN A;  3KZ9 A;  2QKO A;  3VVX A;  2TCT A;  3BR1 A;  2VKE A;  2RHA A;  3EUP A;  1VI0 A;  4G12 A;  2XPV A;  5F27 A;  4KWA A;  2G7S A;  2I10 A;  4JNN A;  3HTA A;  3GEU A;  3BRU A;  2OF7 A;  3BR3 A;  4ACI A;  4DW6 A;  3BR2 A;  5D18 A;  2QIB A;  2G7L A;  2FJ1 A;  3COL A;  3BTJ A;  4L62 A;  2IAI A;  2YVE A;  4ME9 A;  2Y2Z A;  2UXH A;  2TRT A;  5FMP A;  2G7G A;  3G56 A;  4HKU A;  5CW8 A;  5IOY A;  3HTJ A;  3VW0 A;  3DEW A;  3MNL A;  3V78 A;  2NS8 A;  3IH4 A;  4D7N A;  5F08 A;  5FKM A;  1T56 A;  5K7H A;  2F07 A;  1RKW A;  3DPJ A;  2OPT A;  4D5F A;  3G7R A;  3BTC A;  3F1B A;  5GPC A;  5F1J A;  2PZ9 A;  5F0H A;  3T6N A;  3C2B A;  4M3E A;  1QVT A;  2QWT A;  3VOX A;  4MXM A;  4GCL A;  3VVY A;  2VPR A;  2UXI A;  2HKU A;  4V2G A;  4YZE A;  3KKD A;  1JTY A;  3BCG A;  4ABZ A;  4B3A A;  3PPB A;  1ZKG A;  3BR0 A;  5F0F A;  3LSP A;  2HXO A;  3SFI A;  3CRJ A;  3QPS A;  3BR5 A;  1JT6 A;  2ZCN A;  1RKT A;  2ZCX A;  2X6O A;  5AQC A;  5HAW A;  4MO7 A;  5IOZ A;  2NS7 A;  3QKX A;  5K7Z A;  4UDS A;  4AC6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...