3VP5A

X-ray crystal structure of wild type hrtr in the holo form
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
185
structure length
185
Chain Sequence
PKSTYFSLSDEKRNRVYDACLNEFQTHSFHEAKIMHIVKALDIPRGSFYQYFEDLKDAYFYVLSQETLEIHDLFFNLLKDNSIEESLDKYKYLLLENLIDSPQYKLYKYRFLDWTYELERDWKPQSSATVPASENDNPISQVLKSVVHNLVYRLFSENWTEKTFIENYDKEIKLVTEGLLNYITD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Transcriptional Regulation of Heme Homeostasis in Lactococcus lactis.
pubmed doi rcsb
source organism Lactococcus lactis
molecule tags Transcription
molecule keywords Transcriptional regulator
total genus 78
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2012-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3vp5A00
1JTYA 3ZQFA 2IEKA 1U9NA 2YVEA 2G7SA 4DW6A 5GP9A 5FKNA 4GFLA 4B1RA 3GEUA 3IH3A 3B81A 1QPIA 3P9TA 1T33A 3AQTA 2RASA 3RH2A 3NXCA 2HYTA 4MXMA 2QTQA 2XGEA 3BTLA 2QWTA 4V2GA 2O7OA 3HTIA 3SDGA 3F1BA 3HIMA 2JJ7A 2ZOZA 2XGDA 2Y2ZA 3IH2A 3Q0UA 2XPWA 2QOPA 3JSJA 5F08A 5GPAA 3VOKA 3LOCA 2G7LA 2X9DA 1Z0XA 2UXPA 2UXOA 4PXIA 2QIBA 2WV1A 4ICHA 2ZCXA 2G7GA 3Q0WA 3ZQHA 5EYRA 2Q24A 4M3BA 4JL3A 3FK7A 2XB5A 3CDLA 3EGQA 3VW1A 3CWRA 2TCTA 3VW2A 4AC6A 3BR3A 4AUXA 4ME9A 5K7FA 2IBDA 4XK4A 2I10A 4I6ZA 2IAIA 5HSZA 2XPVA 5EZHA 3O8GA 3LWJA 5HAWA 4GCLA 4M3DA 3O8HA 3LHQA 3Q0VA 2UXUA 2NS8A 2V57A 3ON2A 4D7NA 2X6OA 4M3EA 2NP5A 3SFIA 4JKZA 1JUMA 3DPJA 4GCKA 2TRTA 3BR0A 2D6YA 1JTXA 3V78A 5F04A 3HTHA 2NX4A 4D5FA 3BT9A 3G1MA 2XGCA 5CW8A 3VP5A 4GFKA 4M3GA 2QCOA 2G3BA 2YVHA 2F07A 2QKOA 1RKWA 1JT6A 2WGBA 5FHPA 5K7ZA 3LSRA 3B6CA 4W97A 3CCYA 2ID6A 3ANGA 5CXIA 2WUIA 3KNWA 3QQAA 3NNRA 2DG7A 3WHBA 3BTCA 4B3AA 3BR2A 5GPCA 5D1RA 5CXGA 1BJZA 3BHQA 4L62A 2G0EA 2XPUA 3DCFA 2ZCNA 5FKLA 2VKEA 3BR6A 5F0HA 1JUPA 2O7TA 5IOYA 2HXOA 2GENA 2UXIA 3C07A 1RPWA 5D19A 5F1JA 2HXIA 5IPAA 2OF7A 4D5CA 3GZIA 3HGGA 4V2FA 3CRJA 2ID3A 3Q3SA 3G7RA 2ZCMA 2OPTA 2DG8A 3VW0A 2NS7A 1VI0A 3S5RA 2REKA 2NP3A 3BJBA 2IU5A 3PASA 3PPBA 3VVZA 3EUPA 3IH4A 4UDSA 3FK6A 2HQ5A 3BNIA 4CGRA 3PM1A 3VVYA 2PBXA 4AF5A 3RD3A 3BR1A 3T6NA 4JYKA 2HKUA 3VUQA 2VKVA 3NPIA 5F0FA 3IUVA 3NRGA 3LJLA 3VVXA 3AQSA 3VPRA 5IP6A 2DTZA 5K7HA 5J1UA 2XRLA 3ON4A 5F0CA 3ZQGA 3ZQLA 5H9TA 4AC0A 3KZ9A 2RAEA 3QBMA 4NELA 5EFYA 1JUSA 3NI7A 5FMPA 3DEWA 1A6IA 2W53A 3HGYA 1UI5A 2OI8A 5F27A 1ZK8A 5J3LA 5AQCA 2RHAA 3CJDA 5D18A 2UXHA 3HE0A 3WHCA 4X1EA 1QVTA 3VOXA 5J1YA 2FD5A 2FBQA 3B6AA 3QPSA 5FKKA 3KKDA 3BCGA 2Y31A 3TP3A 3F0CA 2Y30A 2PZ9A 1U9OA 1Z77A 2HYJA 3O60A 1JT0A 1UI6A 3BQZA 4KWAA 3TP0A 5FKOA 3G56A 1QVUA 4MO7A 2FX0A 3BRUA 5EZGA 3FIWA 1T56A 3BTJA 4GCTA 3ANPA 5K58A 4YZEA 4NN1A 5J1RA 4MK6A 5DAJA 3LSPA 3G1LA 2ZOYA 2ZB9A 2OERA 3HTJA 4M3FA 5C4YA 2FJ1A 3MNLA 5FKMA 3COLA 3MVPA 4I76A 3BQYA 2XDNA 3V6GA 4W1UA 3QKXA 5FGLA 3KKCA 5HBUA 2JK3A 1ZKGA 3BTIA 5IOZA 3C2BA 3VIBA 4JNNA 1ORKA 3HTAA 2FQ4A 3ZQIA 4G12A 2GUHA 3LSJA 1RKTA 2GFNA 4ABZA 1SGMA 2GBYA 3FRQA 2EH3A 2VPRA 4ACIA 4HKUA 3E7QA 3G1OA 4D7MA 3QPLA 3BR5A
chains in the Genus database with same CATH superfamily
1JTYA 2B3WA 2FJI1 2IEKA 3ZQFA 1U9NA 2YVEA 2G7SA 4DW6A 5GP9A 5FKNA 4GFLA 4DVYP 4B1RA 3GEUA 3IH3A 5CQGA 3B81A 1QPIA 3P9TA 1T33A 3AQTA 2RASA 3RH2A 3NXCA 2HYTA 4MXMA 2QTQA 2XGEA 3BTLA 2QWTA 4V2GA 2O7OA 3HTIA 3SDGA 3F1BA 3HIMA 2JJ7A 2ZOZA 2XGDA 2Y2ZA 3IH2A 3Q0UA 2XPWA 2QOPA 3JSJA 5F08A 5GPAA 2R7XA 3VOKA 3LOCA 2G7LA 2X9DA 1Z0XA 2UXPA 2UXOA 4PXIA 2R7RA 2QIBA 2WV1A 4ICHA 2ZCXA 2R7SA 2G7GA 2R7WA 3ZQHA 3Q0WA 5EYRA 2Q24A 4M3BA 4JL3A 3FK7A 2XB5A 3CDLA 3EGQA 3VW1A 3CWRA 2TCTA 3VW2A 4AC6A 3BR3A 4AUXA 4ME9A 5K7FA 2IBDA 3K8PC 4XK4A 2I10A 4I6ZA 2IAIA 5HSZA 2XPVA 5EZHA 3O8GA 3LWJA 5HAWA 4GCLA 4OD4A 4M3DA 3O8HA 3LHQA 3Q0VA 2UXUA 2NS8A 2V57A 3ON2A 4D7NA 2X6OA 4M3EA 2NP5A 3SFIA 4JKZA 1JUMA 3DPJA 4GCKA 2TRTA 3BR0A 2D6YA 1JTXA 3V78A 5F04A 3HTHA 2NX4A 4D5FA 3BT9A 3G1MA 2XGCA 5CW8A 3VP5A 4GFKA 4M3GA 2QCOA 2G3BA 2YVHA 2F07A 2QKOA 1RKWA 1JT6A 2WGBA 2PFVA 5FHPA 5K7ZA 3LSRA 2A2FX 3B6CA 4W97A 3CCYA 3KYLA 2ID6A 3ANGA 5CXIA 2WUIA 3KNWA 3QQAA 4WIBA 3NNRA 2DG7A 3WHBA 3BTCA 4B3AA 3BR2A 5GPCA 5D1RA 5CXGA 1BJZA 3BHQA 4IRVA 3NS4A 4L62A 2G0EA 2XPUA 3DCFA 2ZCNA 5FKLA 2VKEA 3BR6A 5F0HA 1JUPA 2O7TA 5IOYA 2HXOA 2GENA 2UXIA 3C07A 1RPWA 5D19A 5F1JA 2HXIA 5IPAA 2OF7A 4D5CA 3GZIA 3HGGA 4V2FA 3CRJA 2ID3A 3Q3SA 3G7RA 2R7OA 2ZCMA 4C2MA 2OPTA 2DG8A 3VW0A 2NS7A 1VI0A 3S5RA 2REKA 2NP3A 3BJBA 2IU5A 3PASA 3PPBA 3VVZA 3EUPA 3IH4A 4U9LA 4UDSA 3SWHA 3FK6A 2HQ5A 3BNIA 4CGRA 3PM1A 3VVYA 3VTIA 2R7TA 2PBXA 4AF5A 3RD3A 3BR1A 3T6NA 4JYKA 3DU6A 2HKUA 3VUQA 2VKVA 3NPIA 5F0FA 3IUVA 3DU5A 3NRGA 3LJLA 3VVXA 3AQSA 3VPRA 5IP6A 2DTZA 5K7HA 5J1UA 2XRLA 3ON4A 5F0CA 3ZQGA 3ZQLA 5H9TA 4AC0A 3KZ9A 4OD5A 2RAEA 3QBMA 4NELA 5EFYA 1JUSA 3NI7A 5FMPA 3DEWA 1A6IA 2W53A 3HGYA 1UI5A 2OI8A 5F27A 1ZK8A 5J3LA 5AQCA 2RHAA 3CJDA 5D18A 2UXHA 3HE0A 2R7UA 3WHCA 4X1EA 1QVTA 3VOXA 5J1YA 2FD5A 2FBQA 3B6AA 3QPSA 5FKKA 3KKDA 3BCGA 2Y31A 3TP3A 3F0CA 2Y30A 2PZ9A 1U9OA 1Z77A 2HYJA 3O60A 1JT0A 1UI6A 3BQZA 2R7QA 4KWAA 3TP0A 5FKOA 3FHNA 3G56A 1QVUA 4MO7A 2FX0A 3BRUA 5EZGA 3FIWA 1T56A 3BTJA 4GCTA 3ANPA 5K58A 4YZEA 4NN1A 5J1RA 4MK6A 5DAJA 3LSPA 3G1LA 2ZOYA 2ZB9A 5C4YA 2OERA 3HTJA 2YVXA 4M3FA 2FJ1A 3MNLA 5FKMA 3COLA 3MVPA 4I76A 3BQYA 2XDNA 2B1EA 3V6GA 2R7VA 4W1UA 3QKXA 5FGLA 3KKCA 5HBUA 2JK3A 1ZKGA 3BTIA 5IOZA 3C2BA 3VIBA 4JNNA 1ORKA 3HTAA 2FQ4A 3ZQIA 4G12A 2GUHA 3LSJA 1RKTA 2GFNA 4ABZA 1SGMA 2GBYA 3FRQA 4U9NA 2ZY9A 2EH3A 2VPRA 4ACIA 4HKUA 3E7QA 3G1OA 4D7MA 3QPLA 3BR5A
chains in the Genus database with same CATH topology
1JTYA 3ZQFA 2IEKA 1U9NA 2YVEA 2G7SA 4DW6A 5GP9A 5FKNA 4GFLA 4B1RA 3GEUA 3IH3A 3B81A 1QPIA 3P9TA 1T33A 3AQTA 2RASA 3RH2A 3NXCA 2HYTA 4MXMA 2QTQA 2XGEA 3BTLA 2QWTA 4V2GA 2O7OA 3HTIA 3SDGA 3F1BA 3HIMA 2JJ7A 2ZOZA 2XGDA 2Y2ZA 3IH2A 3Q0UA 2XPWA 2QOPA 3JSJA 5F08A 5GPAA 3VOKA 3LOCA 2G7LA 2X9DA 1Z0XA 2UXPA 2UXOA 4PXIA 2QIBA 2WV1A 4ICHA 2ZCXA 2G7GA 3Q0WA 3ZQHA 5EYRA 2Q24A 4M3BA 4JL3A 3FK7A 2XB5A 3CDLA 3EGQA 3VW1A 3CWRA 2TCTA 3VW2A 4AC6A 3BR3A 4AUXA 4ME9A 5K7FA 2IBDA 4XK4A 2I10A 4I6ZA 2IAIA 5HSZA 2XPVA 5EZHA 3O8GA 3LWJA 5HAWA 4GCLA 4M3DA 3O8HA 3LHQA 3Q0VA 2UXUA 2NS8A 2V57A 3ON2A 4D7NA 2X6OA 4M3EA 2NP5A 3SFIA 4JKZA 1JUMA 3DPJA 4GCKA 2TRTA 3BR0A 2D6YA 1JTXA 3V78A 5F04A 3HTHA 2NX4A 4D5FA 3BT9A 3G1MA 2XGCA 5CW8A 3VP5A 4GFKA 4M3GA 2QCOA 2G3BA 2YVHA 2F07A 2QKOA 1RKWA 1JT6A 2WGBA 5FHPA 5K7ZA 3LSRA 3B6CA 4W97A 3CCYA 2ID6A 3ANGA 5CXIA 2WUIA 3KNWA 3QQAA 3NNRA 2DG7A 3WHBA 3BTCA 4B3AA 3BR2A 5GPCA 5D1RA 5CXGA 1BJZA 3BHQA 4L62A 2G0EA 2XPUA 3DCFA 2ZCNA 5FKLA 2VKEA 3BR6A 5F0HA 1JUPA 2O7TA 5IOYA 2HXOA 2GENA 2UXIA 3C07A 1RPWA 5D19A 5F1JA 2HXIA 5IPAA 2OF7A 4D5CA 3GZIA 3HGGA 4V2FA 3CRJA 2ID3A 3Q3SA 3G7RA 2ZCMA 2OPTA 2DG8A 3VW0A 2NS7A 1VI0A 3S5RA 2REKA 2NP3A 3BJBA 2IU5A 3PASA 3PPBA 3VVZA 3EUPA 3IH4A 4UDSA 3FK6A 2HQ5A 3BNIA 4CGRA 3PM1A 3VVYA 2PBXA 4AF5A 3RD3A 3BR1A 3T6NA 4JYKA 2HKUA 3VUQA 2VKVA 3NPIA 5F0FA 3IUVA 3NRGA 3LJLA 3VVXA 3AQSA 3VPRA 5IP6A 2DTZA 5K7HA 5J1UA 2XRLA 3ON4A 5F0CA 3ZQGA 3ZQLA 5H9TA 4AC0A 3KZ9A 2RAEA 3QBMA 4NELA 5EFYA 1JUSA 3NI7A 5FMPA 3DEWA 1A6IA 2W53A 3HGYA 1UI5A 2OI8A 5F27A 1ZK8A 5J3LA 5AQCA 2RHAA 3CJDA 5D18A 2UXHA 3HE0A 3WHCA 4X1EA 1QVTA 3VOXA 5J1YA 2FD5A 2FBQA 3B6AA 3QPSA 5FKKA 3KKDA 3BCGA 2Y31A 3TP3A 3F0CA 2Y30A 2PZ9A 1U9OA 1Z77A 2HYJA 3O60A 1JT0A 1UI6A 3BQZA 4KWAA 3TP0A 5FKOA 3G56A 1QVUA 4MO7A 2FX0A 3BRUA 5EZGA 3FIWA 1T56A 3BTJA 4GCTA 3ANPA 5K58A 4YZEA 4NN1A 5J1RA 4MK6A 5DAJA 3LSPA 3G1LA 2ZOYA 2ZB9A 2OERA 3HTJA 4M3FA 5C4YA 2FJ1A 3MNLA 5FKMA 3COLA 3MVPA 4I76A 3BQYA 2XDNA 3V6GA 4W1UA 3QKXA 5FGLA 3KKCA 5HBUA 2JK3A 1ZKGA 3BTIA 5IOZA 3C2BA 3VIBA 4JNNA 1ORKA 3HTAA 2FQ4A 3ZQIA 4G12A 2GUHA 3LSJA 1RKTA 2GFNA 4ABZA 1SGMA 2GBYA 3FRQA 2EH3A 2VPRA 4ACIA 4HKUA 3E7QA 3G1OA 4D7MA 3QPLA 3BR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JTY A;  3ZQF A;  2IEK A;  1U9N A;  2YVE A;  2G7S A;  4DW6 A;  5GP9 A;  5FKN A;  4GFL A;  4B1R A;  3GEU A;  3IH3 A;  3B81 A;  1QPI A;  3P9T A;  1T33 A;  3AQT A;  2RAS A;  3RH2 A;  3NXC A;  2HYT A;  4MXM A;  2QTQ A;  2XGE A;  3BTL A;  2QWT A;  4V2G A;  2O7O A;  3HTI A;  3SDG A;  3F1B A;  3HIM A;  2JJ7 A;  2ZOZ A;  2XGD A;  2Y2Z A;  3IH2 A;  3Q0U A;  2XPW A;  2QOP A;  3JSJ A;  5F08 A;  5GPA A;  3VOK A;  3LOC A;  2G7L A;  2X9D A;  1Z0X A;  2UXP A;  2UXO A;  4PXI A;  2QIB A;  2WV1 A;  4ICH A;  2ZCX A;  2G7G A;  3Q0W A;  3ZQH A;  5EYR A;  2Q24 A;  4M3B A;  4JL3 A;  3FK7 A;  2XB5 A;  3CDL A;  3EGQ A;  3VW1 A;  3CWR A;  2TCT A;  3VW2 A;  4AC6 A;  3BR3 A;  4AUX A;  4ME9 A;  5K7F A;  2IBD A;  4XK4 A;  2I10 A;  4I6Z A;  2IAI A;  5HSZ A;  2XPV A;  5EZH A;  3O8G A;  3LWJ A;  5HAW A;  4GCL A;  4M3D A;  3O8H A;  3LHQ A;  3Q0V A;  2UXU A;  2NS8 A;  2V57 A;  3ON2 A;  4D7N A;  2X6O A;  4M3E A;  2NP5 A;  3SFI A;  4JKZ A;  1JUM A;  3DPJ A;  4GCK A;  2TRT A;  3BR0 A;  2D6Y A;  1JTX A;  3V78 A;  5F04 A;  3HTH A;  2NX4 A;  4D5F A;  3BT9 A;  3G1M A;  2XGC A;  5CW8 A;  3VP5 A;  4GFK A;  4M3G A;  2QCO A;  2G3B A;  2YVH A;  2F07 A;  2QKO A;  1RKW A;  1JT6 A;  2WGB A;  5FHP A;  5K7Z A;  3LSR A;  3B6C A;  4W97 A;  3CCY A;  2ID6 A;  3ANG A;  5CXI A;  2WUI A;  3KNW A;  3QQA A;  3NNR A;  2DG7 A;  3WHB A;  3BTC A;  4B3A A;  3BR2 A;  5GPC A;  5D1R A;  5CXG A;  1BJZ A;  3BHQ A;  4L62 A;  2G0E A;  2XPU A;  3DCF A;  2ZCN A;  5FKL A;  2VKE A;  3BR6 A;  5F0H A;  1JUP A;  2O7T A;  5IOY A;  2HXO A;  2GEN A;  2UXI A;  3C07 A;  1RPW A;  5D19 A;  5F1J A;  2HXI A;  5IPA A;  2OF7 A;  4D5C A;  3GZI A;  3HGG A;  4V2F A;  3CRJ A;  2ID3 A;  3Q3S A;  3G7R A;  2ZCM A;  2OPT A;  2DG8 A;  3VW0 A;  2NS7 A;  1VI0 A;  3S5R A;  2REK A;  2NP3 A;  3BJB A;  2IU5 A;  3PAS A;  3PPB A;  3VVZ A;  3EUP A;  3IH4 A;  4UDS A;  3FK6 A;  2HQ5 A;  3BNI A;  4CGR A;  3PM1 A;  3VVY A;  2PBX A;  4AF5 A;  3RD3 A;  3BR1 A;  3T6N A;  4JYK A;  2HKU A;  3VUQ A;  2VKV A;  3NPI A;  5F0F A;  3IUV A;  3NRG A;  3LJL A;  3VVX A;  3AQS A;  3VPR A;  5IP6 A;  2DTZ A;  5K7H A;  5J1U A;  2XRL A;  3ON4 A;  5F0C A;  3ZQG A;  3ZQL A;  5H9T A;  4AC0 A;  3KZ9 A;  2RAE A;  3QBM A;  4NEL A;  5EFY A;  1JUS A;  3NI7 A;  5FMP A;  3DEW A;  1A6I A;  2W53 A;  3HGY A;  1UI5 A;  2OI8 A;  5F27 A;  1ZK8 A;  5J3L A;  5AQC A;  2RHA A;  3CJD A;  5D18 A;  2UXH A;  3HE0 A;  3WHC A;  4X1E A;  1QVT A;  3VOX A;  5J1Y A;  2FD5 A;  2FBQ A;  3B6A A;  3QPS A;  5FKK A;  3KKD A;  3BCG A;  2Y31 A;  3TP3 A;  3F0C A;  2Y30 A;  2PZ9 A;  1U9O A;  1Z77 A;  2HYJ A;  3O60 A;  1JT0 A;  1UI6 A;  3BQZ A;  4KWA A;  3TP0 A;  5FKO A;  3G56 A;  1QVU A;  4MO7 A;  2FX0 A;  3BRU A;  5EZG A;  3FIW A;  1T56 A;  3BTJ A;  4GCT A;  3ANP A;  5K58 A;  4YZE A;  4NN1 A;  5J1R A;  4MK6 A;  5DAJ A;  3LSP A;  3G1L A;  2ZOY A;  2ZB9 A;  2OER A;  3HTJ A;  4M3F A;  5C4Y A;  2FJ1 A;  3MNL A;  5FKM A;  3COL A;  3MVP A;  4I76 A;  3BQY A;  2XDN A;  3V6G A;  4W1U A;  3QKX A;  5FGL A;  3KKC A;  5HBU A;  2JK3 A;  1ZKG A;  3BTI A;  5IOZ A;  3C2B A;  3VIB A;  4JNN A;  1ORK A;  3HTA A;  2FQ4 A;  3ZQI A;  4G12 A;  2GUH A;  3LSJ A;  1RKT A;  2GFN A;  4ABZ A;  1SGM A;  2GBY A;  3FRQ A;  2EH3 A;  2VPR A;  4ACI A;  4HKU A;  3E7Q A;  3G1O A;  4D7M A;  3QPL A;  3BR5 A; 
#chains in the Genus database with same CATH topology
 1JTY A;  2B3W A;  2FJI 1;  2IEK A;  3ZQF A;  1U9N A;  2YVE A;  2G7S A;  4DW6 A;  5GP9 A;  5FKN A;  4GFL A;  4DVY P;  4B1R A;  3GEU A;  3IH3 A;  5CQG A;  3B81 A;  1QPI A;  3P9T A;  1T33 A;  3AQT A;  2RAS A;  3RH2 A;  3NXC A;  2HYT A;  4MXM A;  2QTQ A;  2XGE A;  3BTL A;  2QWT A;  4V2G A;  2O7O A;  3HTI A;  3SDG A;  3F1B A;  3HIM A;  2JJ7 A;  2ZOZ A;  2XGD A;  2Y2Z A;  3IH2 A;  3Q0U A;  2XPW A;  2QOP A;  3JSJ A;  5F08 A;  5GPA A;  2R7X A;  3VOK A;  3LOC A;  2G7L A;  2X9D A;  1Z0X A;  2UXP A;  2UXO A;  4PXI A;  2R7R A;  2QIB A;  2WV1 A;  4ICH A;  2ZCX A;  2R7S A;  2G7G A;  2R7W A;  3ZQH A;  3Q0W A;  5EYR A;  2Q24 A;  4M3B A;  4JL3 A;  3FK7 A;  2XB5 A;  3CDL A;  3EGQ A;  3VW1 A;  3CWR A;  2TCT A;  3VW2 A;  4AC6 A;  3BR3 A;  4AUX A;  4ME9 A;  5K7F A;  2IBD A;  3K8P C;  4XK4 A;  2I10 A;  4I6Z A;  2IAI A;  5HSZ A;  2XPV A;  5EZH A;  3O8G A;  3LWJ A;  5HAW A;  4GCL A;  4OD4 A;  4M3D A;  3O8H A;  3LHQ A;  3Q0V A;  2UXU A;  2NS8 A;  2V57 A;  3ON2 A;  4D7N A;  2X6O A;  4M3E A;  2NP5 A;  3SFI A;  4JKZ A;  1JUM A;  3DPJ A;  4GCK A;  2TRT A;  3BR0 A;  2D6Y A;  1JTX A;  3V78 A;  5F04 A;  3HTH A;  2NX4 A;  4D5F A;  3BT9 A;  3G1M A;  2XGC A;  5CW8 A;  3VP5 A;  4GFK A;  4M3G A;  2QCO A;  2G3B A;  2YVH A;  2F07 A;  2QKO A;  1RKW A;  1JT6 A;  2WGB A;  2PFV A;  5FHP A;  5K7Z A;  3LSR A;  2A2F X;  3B6C A;  4W97 A;  3CCY A;  3KYL A;  2ID6 A;  3ANG A;  5CXI A;  2WUI A;  3KNW A;  3QQA A;  4WIB A;  3NNR A;  2DG7 A;  3WHB A;  3BTC A;  4B3A A;  3BR2 A;  5GPC A;  5D1R A;  5CXG A;  1BJZ A;  3BHQ A;  4IRV A;  3NS4 A;  4L62 A;  2G0E A;  2XPU A;  3DCF A;  2ZCN A;  5FKL A;  2VKE A;  3BR6 A;  5F0H A;  1JUP A;  2O7T A;  5IOY A;  2HXO A;  2GEN A;  2UXI A;  3C07 A;  1RPW A;  5D19 A;  5F1J A;  2HXI A;  5IPA A;  2OF7 A;  4D5C A;  3GZI A;  3HGG A;  4V2F A;  3CRJ A;  2ID3 A;  3Q3S A;  3G7R A;  2R7O A;  2ZCM A;  4C2M A;  2OPT A;  2DG8 A;  3VW0 A;  2NS7 A;  1VI0 A;  3S5R A;  2REK A;  2NP3 A;  3BJB A;  2IU5 A;  3PAS A;  3PPB A;  3VVZ A;  3EUP A;  3IH4 A;  4U9L A;  4UDS A;  3SWH A;  3FK6 A;  2HQ5 A;  3BNI A;  4CGR A;  3PM1 A;  3VVY A;  3VTI A;  2R7T A;  2PBX A;  4AF5 A;  3RD3 A;  3BR1 A;  3T6N A;  4JYK A;  3DU6 A;  2HKU A;  3VUQ A;  2VKV A;  3NPI A;  5F0F A;  3IUV A;  3DU5 A;  3NRG A;  3LJL A;  3VVX A;  3AQS A;  3VPR A;  5IP6 A;  2DTZ A;  5K7H A;  5J1U A;  2XRL A;  3ON4 A;  5F0C A;  3ZQG A;  3ZQL A;  5H9T A;  4AC0 A;  3KZ9 A;  4OD5 A;  2RAE A;  3QBM A;  4NEL A;  5EFY A;  1JUS A;  3NI7 A;  5FMP A;  3DEW A;  1A6I A;  2W53 A;  3HGY A;  1UI5 A;  2OI8 A;  5F27 A;  1ZK8 A;  5J3L A;  5AQC A;  2RHA A;  3CJD A;  5D18 A;  2UXH A;  3HE0 A;  2R7U A;  3WHC A;  4X1E A;  1QVT A;  3VOX A;  5J1Y A;  2FD5 A;  2FBQ A;  3B6A A;  3QPS A;  5FKK A;  3KKD A;  3BCG A;  2Y31 A;  3TP3 A;  3F0C A;  2Y30 A;  2PZ9 A;  1U9O A;  1Z77 A;  2HYJ A;  3O60 A;  1JT0 A;  1UI6 A;  3BQZ A;  2R7Q A;  4KWA A;  3TP0 A;  5FKO A;  3FHN A;  3G56 A;  1QVU A;  4MO7 A;  2FX0 A;  3BRU A;  5EZG A;  3FIW A;  1T56 A;  3BTJ A;  4GCT A;  3ANP A;  5K58 A;  4YZE A;  4NN1 A;  5J1R A;  4MK6 A;  5DAJ A;  3LSP A;  3G1L A;  2ZOY A;  2ZB9 A;  5C4Y A;  2OER A;  3HTJ A;  2YVX A;  4M3F A;  2FJ1 A;  3MNL A;  5FKM A;  3COL A;  3MVP A;  4I76 A;  3BQY A;  2XDN A;  2B1E A;  3V6G A;  2R7V A;  4W1U A;  3QKX A;  5FGL A;  3KKC A;  5HBU A;  2JK3 A;  1ZKG A;  3BTI A;  5IOZ A;  3C2B A;  3VIB A;  4JNN A;  1ORK A;  3HTA A;  2FQ4 A;  3ZQI A;  4G12 A;  2GUH A;  3LSJ A;  1RKT A;  2GFN A;  4ABZ A;  1SGM A;  2GBY A;  3FRQ A;  4U9N A;  2ZY9 A;  2EH3 A;  2VPR A;  4ACI A;  4HKU A;  3E7Q A;  3G1O A;  4D7M A;  3QPL A;  3BR5 A; 
#chains in the Genus database with same CATH homology
 1JTY A;  3ZQF A;  2IEK A;  1U9N A;  2YVE A;  2G7S A;  4DW6 A;  5GP9 A;  5FKN A;  4GFL A;  4B1R A;  3GEU A;  3IH3 A;  3B81 A;  1QPI A;  3P9T A;  1T33 A;  3AQT A;  2RAS A;  3RH2 A;  3NXC A;  2HYT A;  4MXM A;  2QTQ A;  2XGE A;  3BTL A;  2QWT A;  4V2G A;  2O7O A;  3HTI A;  3SDG A;  3F1B A;  3HIM A;  2JJ7 A;  2ZOZ A;  2XGD A;  2Y2Z A;  3IH2 A;  3Q0U A;  2XPW A;  2QOP A;  3JSJ A;  5F08 A;  5GPA A;  3VOK A;  3LOC A;  2G7L A;  2X9D A;  1Z0X A;  2UXP A;  2UXO A;  4PXI A;  2QIB A;  2WV1 A;  4ICH A;  2ZCX A;  2G7G A;  3Q0W A;  3ZQH A;  5EYR A;  2Q24 A;  4M3B A;  4JL3 A;  3FK7 A;  2XB5 A;  3CDL A;  3EGQ A;  3VW1 A;  3CWR A;  2TCT A;  3VW2 A;  4AC6 A;  3BR3 A;  4AUX A;  4ME9 A;  5K7F A;  2IBD A;  4XK4 A;  2I10 A;  4I6Z A;  2IAI A;  5HSZ A;  2XPV A;  5EZH A;  3O8G A;  3LWJ A;  5HAW A;  4GCL A;  4M3D A;  3O8H A;  3LHQ A;  3Q0V A;  2UXU A;  2NS8 A;  2V57 A;  3ON2 A;  4D7N A;  2X6O A;  4M3E A;  2NP5 A;  3SFI A;  4JKZ A;  1JUM A;  3DPJ A;  4GCK A;  2TRT A;  3BR0 A;  2D6Y A;  1JTX A;  3V78 A;  5F04 A;  3HTH A;  2NX4 A;  4D5F A;  3BT9 A;  3G1M A;  2XGC A;  5CW8 A;  3VP5 A;  4GFK A;  4M3G A;  2QCO A;  2G3B A;  2YVH A;  2F07 A;  2QKO A;  1RKW A;  1JT6 A;  2WGB A;  5FHP A;  5K7Z A;  3LSR A;  3B6C A;  4W97 A;  3CCY A;  2ID6 A;  3ANG A;  5CXI A;  2WUI A;  3KNW A;  3QQA A;  3NNR A;  2DG7 A;  3WHB A;  3BTC A;  4B3A A;  3BR2 A;  5GPC A;  5D1R A;  5CXG A;  1BJZ A;  3BHQ A;  4L62 A;  2G0E A;  2XPU A;  3DCF A;  2ZCN A;  5FKL A;  2VKE A;  3BR6 A;  5F0H A;  1JUP A;  2O7T A;  5IOY A;  2HXO A;  2GEN A;  2UXI A;  3C07 A;  1RPW A;  5D19 A;  5F1J A;  2HXI A;  5IPA A;  2OF7 A;  4D5C A;  3GZI A;  3HGG A;  4V2F A;  3CRJ A;  2ID3 A;  3Q3S A;  3G7R A;  2ZCM A;  2OPT A;  2DG8 A;  3VW0 A;  2NS7 A;  1VI0 A;  3S5R A;  2REK A;  2NP3 A;  3BJB A;  2IU5 A;  3PAS A;  3PPB A;  3VVZ A;  3EUP A;  3IH4 A;  4UDS A;  3FK6 A;  2HQ5 A;  3BNI A;  4CGR A;  3PM1 A;  3VVY A;  2PBX A;  4AF5 A;  3RD3 A;  3BR1 A;  3T6N A;  4JYK A;  2HKU A;  3VUQ A;  2VKV A;  3NPI A;  5F0F A;  3IUV A;  3NRG A;  3LJL A;  3VVX A;  3AQS A;  3VPR A;  5IP6 A;  2DTZ A;  5K7H A;  5J1U A;  2XRL A;  3ON4 A;  5F0C A;  3ZQG A;  3ZQL A;  5H9T A;  4AC0 A;  3KZ9 A;  2RAE A;  3QBM A;  4NEL A;  5EFY A;  1JUS A;  3NI7 A;  5FMP A;  3DEW A;  1A6I A;  2W53 A;  3HGY A;  1UI5 A;  2OI8 A;  5F27 A;  1ZK8 A;  5J3L A;  5AQC A;  2RHA A;  3CJD A;  5D18 A;  2UXH A;  3HE0 A;  3WHC A;  4X1E A;  1QVT A;  3VOX A;  5J1Y A;  2FD5 A;  2FBQ A;  3B6A A;  3QPS A;  5FKK A;  3KKD A;  3BCG A;  2Y31 A;  3TP3 A;  3F0C A;  2Y30 A;  2PZ9 A;  1U9O A;  1Z77 A;  2HYJ A;  3O60 A;  1JT0 A;  1UI6 A;  3BQZ A;  4KWA A;  3TP0 A;  5FKO A;  3G56 A;  1QVU A;  4MO7 A;  2FX0 A;  3BRU A;  5EZG A;  3FIW A;  1T56 A;  3BTJ A;  4GCT A;  3ANP A;  5K58 A;  4YZE A;  4NN1 A;  5J1R A;  4MK6 A;  5DAJ A;  3LSP A;  3G1L A;  2ZOY A;  2ZB9 A;  2OER A;  3HTJ A;  4M3F A;  5C4Y A;  2FJ1 A;  3MNL A;  5FKM A;  3COL A;  3MVP A;  4I76 A;  3BQY A;  2XDN A;  3V6G A;  4W1U A;  3QKX A;  5FGL A;  3KKC A;  5HBU A;  2JK3 A;  1ZKG A;  3BTI A;  5IOZ A;  3C2B A;  3VIB A;  4JNN A;  1ORK A;  3HTA A;  2FQ4 A;  3ZQI A;  4G12 A;  2GUH A;  3LSJ A;  1RKT A;  2GFN A;  4ABZ A;  1SGM A;  2GBY A;  3FRQ A;  2EH3 A;  2VPR A;  4ACI A;  4HKU A;  3E7Q A;  3G1O A;  4D7M A;  3QPL A;  3BR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...