3VP8A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
75
structure length
75
Chain Sequence
SVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords General transcriptional corepressor TUP1
total genus 35
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp8A00
1WT6A 3BATA 5BU8B 2JEEA 3U1CA 3U59A 1NKNA 5BVZA 4O9BA 2FXMA 4GIFA 3U1AA 3VP8A 4N3YB 4N78D 2POHA 4ZKUA 3N7NA 3N4XA 4I1LA 3VP9A 3BASA 1X79B 1IC2A 3C9IA 3P8CD 5BU5A 5KTBA 3HRNA 3OJAB 4ZKPA
chains in the Genus database with same CATH superfamily
1FDOA 1KILD 2B88A 1NO4A 2KB7P 1AFOA 2IDBA 1L4AC 1NKZB 3AEEC 4BWNA 3PP5A 2WT7A 1GK4A 1S9KE 1PL5A 1T8ZA 1LTJC 1NH4A 2WPSA 2E74B 2P1JA 2Y0EA 5KKZB 2M5AA 5AW6B 1RE3C 1KORA 2B9BA 2YIUC 3R4YA 1R5SA 4IL6E 3JCUH 4WY4C 1HUCA 2JR8A 2Q3IA 2XDJA 3CI9A 2E74C 1EC5A 3H1JE 3CWBG 2SPZA 3NTNA 3SWKA 1BGYD 1UIIA 3CX5H 1SQBK 1N73C 5H2FH 1QL2A 2D2CB 3T97A 1L0LK 1OW8A 1SQPG 2Y9YA 1HGVA 2KK7A 3RBZA 1YHQP 3IFMA 3O6QA 5CMZA 5CCGC 2QEXP 3SFDC 1DX7A 3MIWA 4AUWA 2E75C 2K9JA 3Q5RA 1HVVA 4TT3H 1FDMA 3I5CA 4GODA 3G3ZA 4U3FE 3L72G 5AVWB 1VQ9P 1NTME 1FZCB 1SQQD 2DW3A 3KZIE 3L71E 3HD7C 4LGDE 3CCVP 1H0TA 2JEEA 2K1AA 5B66E 4I2LC 2KXPB 2ZXEB 4D6TE 4OGQD 1FOSE 3L75D 3RL0g 1DH3A 3KXDA 1M1JB 1NWQA 1GL2A 2OTKE 3AE4C 1GW4A 1KQFB 3RK3D 3TGUD 1R5LA 4U3FG 2HPCA 1OFCX 3M06A 4ASVA 2IBZE 1KYOE 4M3LA 2RMZA 2XNXA 3L37A 3L73G 3H1HD 4N3YB 2ZXXA 2A45I 1BCCE 2YKOA 2WVRA 2ZYGA 1JEKA 3N4XA 4H44D 5AVVB 5M1BA 2BEZF 3WUVA 2O1KA 3BCCE 3GW6A 4YPCA 3AECC 3GF3A 4XFJA 1FE6A 4GT1A 1S4XA 4HJGH 1W2EA 1RE3A 3AE7C 3QH9A 4WY4A 2QVAA 3CC2P 2BCCE 3H1KJ 1RF1A 1NTZE 4L76A 1NAYA 3BCCJ 5AW4B 4I7ZB 1NYHA 3U1CA 1MV8A 3B5ND 2Y9ZA 3H1HE 4PV1C 5BVZA 1AVYA 1QL1A 3L75J 3PTZA 4O9BA 1YITP 1SQQJ 2WMMA 1M56D 1QVGO 2E42A 1ZR4A 1OVUA 1KB9E 2KZJA 3E1RA 3OA7A 3R2PA 1VQPP 1U7MA 3L72E 3C1LA 1YTZT 2QJKB 3VN0A 3ZDMA 4C7RA 1KMIZ 4RJTA 5AW5B 3CCLP 3RL0D 1CW5A 2E5YA 2CK3H 1N7SB 1XTGB 1RHZB 1LT1A 4XA4A 4EOTA 1H0TB 2WSCH 1M90Q 2M3BA 1L4AB 1R8EA 1SQPE 3H1HJ 4U3FD 1URQB 2WSFJ 3GF7A 5KAFH 5EFWB 1N8RQ 1JY2P 5KKZC 1AV1A 1JOCA 1P84H 2LXCB 1G1JA 1L0LE 2LKMA 4WBAA 2HFED 2YKQA 5DJUB 2BCCD 3F89A 4PV1B 3TDKA 2FYUK 2I1KA 1JCCA 1QX8A 1LJ2A 2W6BA 2YXQB 3HTKB 1KQGB 1KYOI 1SFCA 1SQQG 4Y28J 3CCMP 1KQLA 2L5GB 1VQ8P 1JO5A 3H1LE 2IZ1A 2D2CC 1NU1D 3BCCD 1QLED 2IFNA 2XNDH 1IJDB 2FBWC 1SQBD 1E5WA 2GUVA 3Q1MA 2FFDC 2H7HA 1SQXK 2QM7A 3M9HA 3VP8A 3H1KG 1L0NJ 3M91A 1AJYA 1SP4A 1K05A 2M0BA 2OYHA 1NTKE 2YKPA 3CXHH 2POHA 2G3AA 3MUDC 1JM0A 1VQNP 3A0BH 4K35A 3TGUE 1J2JB 1QVFO 3RK3E 1X0TA 2H89C 3HTKA 2E43A 2OYIC 5CHXA 4K3AA 3CXHI 1AA0A 1GL2D 3KDPB 4Z1MH 1HJ0A 1Q90D 3V6IA 1PP9J 3II6A 1P84E 1PP9D 3CLQA 3EFGA 1NU1G 1OX3A 1VF5D 3JC22 1RE4C 1NVOA 1S2EA 1SQXD 1GDTA 2PGDA 4U3FJ 1NAFA 3H1LJ 4JYCA 4YXDC 3B8EB 5CCHD 3CMAP 1FOSF 2J58A 1N7SA 4IFFA 2FFDB 1GD2E 4ZNCA 1FJKA 1BGYJ 1NTMG 1CI6B 1DEEG 5DJTB 2QA4P 1Y8AA 2R3SA 3H1JG 2IBZG 3AE5C 5APVA 3BRVB 1NTZK 3V4WA 1HF9A 2NPSB 3M9QA 2FKWB 1RF1C 1YTZI 1N86A 2C9LY 3D6YA 2QJKC 2K37A 2Q7CA 3D71A 1USEA 3VP9A 1L2PA 4UB8H 1PV3A 3RK2C 2W6JH 2IYPA 3CCQP 5KJ7C 2FY8A 2P67A 4IFDK 1PPJD 1JUNA 4GKGA 3CX5D 3WUUA 2AXTE 1T6AA 2OQQA 3L70J 2JWDA 5APXA 5AW9B 1KTMA 1LTGC 1YJNP 2CPSA 3H1ID 1PZQA 3H1IJ 3KPEA 3L72J 1JY2O 1JY3O 5AVRB 5CJ0A 1UIXA 3LW5H 2KS1B 1JTHA 1IO4A 3D70A 1N7LA 1IFJA 1KILE 1M1JC 3HD7D 3PLNA 1EXJA 1YIJP 4PD4D 1X9VA 2FXPA 2NZ2A 3TGUG 5KAIH 2FYUG 2C0XA 2Y0DA 3V4QA 1L0LG 1SQPK 2Q6QA 1NOHA 4GOEA 1JNMA 1FZFA 5B5EE 3A2AA 3B5NB 3MUDA 3PH0A 3AE6C 2ZT9C 4KJMA 1NGMB 2K9JB 1Q2NA 5APTA 5APWA 1M57D 5CBNA 2FYUE 4H0LD 3BVHA 1N73B 1RF0C 2E76D 2N9YB 2XKMA 3BCCG 4I1LA 1LTTC 2ZT9B 3A0BE 3HUSA 5APSA 1KILA 1IFPA 3AEAC 1MFZA 2HYNA 5AW0B 3RL0B 4R4MA 3G6EP 1G2CA 2FYZA 1BGYE 1VPCA 3D6ZA 1SQXE 1URQA 4Y99B 4JYBA 3CC4P 3S1KA 1WT6A 2ZFCA 1NTKK 3RBXA 3VOPA 2O3JA 2I8DA 2WSEH 3CX5I 1J1DB 1LTIC 3H32A 5AVYB 3G4SP 1X22A 1KD1Q 1KN7A 3HUSB 1N73A 2GUSA 3L74G 2OTJP 2JJLA 3B5NC 1L0NG 3V2PA 3L73E 2M8RA 4PV1D 2H43A 1ZXGA 1AQ5A 4DZOA 5AVZB 1OXZA 1SQBG 2QIWA 3AEGC 3CX5E 5APQA 1ZN5A 2YNYA 1JMBA 2JO1A 5B5EH 1VQ6P 1KZUB 2Q1KA 4KT0J 5KLIC 5TJHA 1NTKJ 3HE4A 3USSA 5KAIE 4ZKUA 1RY3A 2NPSC 2QG4A 1L0NE 1H88A 1A02F 1W2BO 2Q3EA 2NRGA 3LW5J 1URQC 3CCJP 1USDA 3L71G 1EDLA 1IZNB 3OW2O 2WT7B 3OJAB 1FZAA 1YQ3C 1BE3G 2YO3A 3RGUA 2R5BA 2M3EA 1L0LD 4LLHA 2IFMA 2JDIH 2O1JA 1ZP0C 2P58A 1M1KQ 1PFIA 1S72P 2QE7H 1KFMA 4H13C 1VQKP 4ZMDA 3GHGB 4GOFA 4OWFA 5GTIE 4UB8E 5GTIH 1VF5B 1GMJA 2WSCJ 3GMAA 4TLFA 4I7ZC 2AEMA 1YI2P 3BRTB 1Z56A 2ZAEB 3CWBJ 3L36A 4H13B 1IK7A 1GU4A 2D2CD 1RF1B 1MUUA 2JP3A 2V4HA 3P8CE 1ZRTE 3IR9A 5KJ7A 1CI6A 1ZLLA 5AW8B 1PGJA 2WSSH 3M9BA 4WVZA 3MHVA 1MZ9A 4N78D 1JY3N 3B4SA 1HGZA 1OZHA 2JKVA 3N7NA 1NTKD 2W8ZA 2FXOA 3A7OA 1GTWA 3L74J 1IC2A 2AEFA 4C46A 5KLVK 1A02J 2OARA 1FZCA 2KP8A 1SFCC 1KYOH 2E75D 5CCGA 2NPSA 1NU1E 3I56P 4U7JA 3GG2A 3LIEA 3H1KD 1EDJA 4OGQB 3P8MC 3TSIA 1L0LJ 4HYTB 4AYCA 4NPDA 4KHXA 3CL3D 3V5BA 2O01N 4RO0A 2QJPB 5CCHC 2N1TD 4HB1A 4HH2A 5AVSB 2OYHB 1PGQA 1YBKA 2QSIA 1LTBC 3FX0A 3HD7B 5B66H 3M0AA 2GM4A 2KZIA 1LWUA 2FXMA 1SQVK 2KNCA 1BE3J 3HE5A 1BE3D 1SQPD 1N7SC 3AE2C 4A7PA 1FS0E 2WZ7A 1FZEA 1Q81Q 2A06G 2Z5IA 1H89A 3W67A 1EQ7A 1GK6A 1LGHB 1SFCB 3BASA 4H44C 2HODB 4PJ0H 1GU5A 3P8CD 3M0DC 3L75E 4GDOA 3L72D 4IL6X 2ZVOB 3LIDA 1EZVD 3FWNA 3T97B 5CCHA 3CWBE 1KV4A 1GW3A 1KILC 2J59M 2R3CA 2A45G 3HUSC 3S9OA 4ZKPA 1SQVD 3H1IG 1SQVJ 1JMMA 1LWUB 3K5BA 5CJ4A 1BE3E 1DEBA 1NTZJ 2KNCB 2YIUB 1BSNA 3L70G 3CXHD 2Q9IA 2OYHC 1FC2C 1L0NK 3HD7A 1KILB 1VQLP 3FXDA 2WSEJ 2A06D 2Z5HA 2ITAA 4WY4D 3NMDA 4BXLA 4WWIA 2P7JA 1NTKG 5KLIB 2E74D 4GIFA 4I6MC 2WPRA 1SQBJ 3UIAA 4EDFA 2A45H 2KSEA 2O01J 4XE5B 2YMYA 3H25A 2AXTH 2C0WA 1NU1J 3MGNA 2AEJA 3H1JD 3OAKA 3P7KA 1VQMP 2OYIB 5KLVD 3O8ZA 2H8PD 3EQ2A 2N9BA 2OTLP 1FBMA 1X79B 2B89A 1S5LX 1JY3P 5L8RJ 2OGUA 1LWUC 2B87B 3F5HA 1S1CX 3VYIA 3TF5A 3L73D 2IX7C 3L73J 2YO2A 2MKVA 3PJSK 2ZJSE 3AEBC 3NXSA 4BRYB 3Q2YA 1FZBA 1ZRTD 2IYOA 2KI7B 3TGUJ 5AVUB 5BU8B 4OGQC 1ZOYC 2HLOA 5KLVE 1LNQA 1E79H 2KSJA 1RQVA 4WB4A 1S3JA 1N2DC 3A3YB 1RH5B 1G1IA 3AEDC 3L35A 3G9RA 1D7MA 1NU1K 2RN0A 2WITA 2ZYAA 3FGAD 4ASWA 1YJ9P 4AQRD 1LTAC 1SLQA 2XU6A 3RK2B 1SQVG 1IFDA 3RK3B 3AE8C 2XZRA 3ITKA 2WQYC 4RKUJ 2FYNB 4W80A 4OVNF 4RESB 5APUA 4DT0A 5KLVG 1YYCA 2PFXA 3CXHE 3E7KA 2UWJE 1U57A 5BU5A 5GTHE 1L0ND 1VQOP 1P84I 3KZIH 1SQVE 3VMAA 1FDIA 2Y0CA 4NPFX 5KLVJ 4PJ0E 1GL2C 4L74A 3SWYA 1IFNA 3VMXA 4DJGA 1EZVE 3KYQA 5CBOA 3GHGC 3CMEP 1BSHA 3V2NA 3L75G 4DOJA 2E75B 1M7LA 2W6AA 2AXCA 5TISE 2R5DA 1VQ5P 1S9KD 1J1DC 2WWWA 1CZQA 2KLVA 4JQ0D 1FU1A 2C9NY 5H2FE 3L70E 1SS1A 1LP1B 1YQ4C 1EZVG 2N1TB 1PP9G 2LXBA 3HE5B 5KAFE 4EIJA 3MTUE 1T2KD 2FYNC 4LC1A 5E79H 2E5TA 3IAOA 3L74D 3L4FA 3RL0C 1NHLA 2QJYC 1OW6A 3H1LG 2BEQD 4C7NA 1IFMA 1Y47A 2HODA 2W27A 2KS1A 2V7QH 3EFFK 3P32A 3PHLA 2BCCJ 2MJZA 2OYOA 3H1KE 1BDCA 1WRGA 2A06E 4IOIH 4CPGA 3Q3DA 1SFCD 1MKMA 1KB9H 2KOGA 1HH0A 3A0HE 3B5NA 1CSBA 1L4AD 2P2UA 3SFEC 1VQ4P 1PGOA 2LR2A 3FXEA 5AVXB 5AVQB 1EDKA 3WU2H 4N6JA 4W7YA 1T3UA 1KB9I 3TNUA 1U7JA 1FJPA 1LT9C 1IK9A 1PPJG 1X8YA 2N1TC 2YMKA 2VRSA 3NFQA 4PD4E 4UB6H 5AW7B 3G71P 1T3JA 2YXRB 1DD4A 3SSUA 4NPEA 4WY4B 1J1EC 4PD4I 2JWAA 3SWFA 3VMYA 3TNUB 2ZT9D 4D6TJ 5CCGD 1KFNA 3Q5SA 1PPJE 1SQQK 3ABVC 3AE1C 1Q86Q 2H88C 1OIPA 3C9IA 1PIXA 2PP6A 3AE9C 3HRNA 1YJWP 4MN4C 1QEXA 2GA1A 4YXWH 1NTZD 2L91A 1NTZG 1ZR2A 1GZLA 2I1JA 2K88A 3MD0A 1TU3F 4L75A 4W7ZA 1RE4A 3CCSP 4EYYQ 1BDDA 1GL2B 1VQ7P 1Q82Q 1LT9B 2WPQA 3H1HG 1HWTC 4PD4H 2IPPA 2Z4EA 4C7NB 4Y99C 3HE4B 1IFIA 1QGKB 2FFDA 1AVOA 3QWOC 3RK3C 2QRXA 1PGPA 2PRRA 2WPVB 1SQPJ 2IBZD 3H1JJ 3TYYA 1BGYG 1LP1A 1VDFA 3CWBD 3CCEP 1P84D 1PP9E 2O01H 3S4RA 1WMKA 3E1IA 1SVFA 3RK2D 3O6QB 1OMIA 2NPSD 1FAVA 2V7QJ 5KJ7D 2RKLA 3TK1A 2QJYB 1W5CE 2KUBA 3V2QA 1KB9D 1RQUA 2K9YA 4L73A 2W90A 3CC7P 5E79E 3I55P 3CPWO 1OVVA 1SQXJ 2QJPC 2BCCG 1XTCC 1G2CB 2KYVA 1JCDA 2N1TA 3JCUE 1LTJB 1ZV8A 5AVTB 4IL6H 1NJIQ 2R44A 1SQBE 1K9MQ 3BATA 4H13D 2M5AB 4JPZB 3H1LD 3MP7B 3MZWB 2FYUD 3U59A 2FYUJ 1NKNA 5TISH 3A5TA 1ZW0A 1OWAA 1OVRA 3H32B 3U1AA 5C39A 1KQSO 2HG5D 1EDIA 2IZ0A 2ZYDA 3H6PA 3EWKA 2WTYA 1LTJA 1KC8Q 4H44B 3C8VA 1BCCJ 1L4AA 2RH0A 1NTMK 2WSFH 4H0LC 3VMZA 1RF0A 2E76C 1AQTA 1OW7A 2BASA 1FZGA 5GTHH 1EXIA 1MFTA 1HBWA 2G8YA 3CCUP 1LTSC 4N78E 1BCCG 2QM8A 4H0LB 4YTPC 1LT9A 5AW2B 2E76B 3H1IE 2J5UA 2K3RA 1FZCC 1Y9BA 1K8AQ 4QMAA 1S5LH 5K5GB 2IBZI 2XV5A 2KIKA 4JBZA 3KHUA 4D6TD 1HJBA 3W68A 1DIPA 2KLUA 4EI2A 2ZVNB 3FWLA 2W83C 4JF7A 1SQQE 3L71D 3L71J 1NTMD 2PAJA 1NTMJ 1J1EB 3CCRP 3B71A 3GHGA 3IF4A 5APYA 2OYIA 2Q5UA 1H8AA 3WUTA 1S5LE 1M8OB 4BRYA 1JTHB 3WMM0 1VL2A 1SQXG 1HTLC 4IFMA 1T2KC 3AE3C 3KQGA 5AW3B 1N7SD 1K73Q 4R4LA 1M1JA 1K04A 4UB6E 1EZVI 2B87A 3Q5PA 1JY2N 2HR3A 2R32A 2CPBA 3AEFC 4D6TG 1URQD 3L74E 4OH8B 5AW1B 3WU2E 5KTBA 1JB0J 3PRJA 3IN6A 4HKZH 1BCCD 2P10A 3M0DA 1Q7YQ 1ZMEC 1DD3A 3CD6P 3V2RA 3GLMA 3JSVC 3A0HH 4B86A 4DCKA 2HPCB 3VTPC 1KYOD 3L70D 1VF5C
chains in the Genus database with same CATH topology
1KILD 2KB7P 1AFOA 1NO4A 1L4AC 1NKZB 2WT7A 1S9KE 3PP5A 1GK4A 1T8ZA 1LTJC 1NH4A 2WPSA 2P1JA 5AW6B 1RE3C 4WY4C 3TNUB 1HUCA 2Q3IA 2XDJA 3CI9A 3NTNA 1N73C 1SQBK 1QL2A 3T97A 1L0LK 1HGVA 3IFMA 5CMZA 5CCGC 1DX7A 3MIWA 4AUWA 1HVVA 1FDMA 3I5CA 3G3ZA 5AVWB 1FZCB 4LGDE 3HD7C 2JEEA 4I2LC 2ZXEB 1FOSE 1DH3A 1M1JB 1NWQA 1GL2A 1GW4A 3RK3D 2HPCA 3M06A 4M3LA 2XNXA 3L37A 4N3YB 2A45I 2YKOA 5AVVB 3N4XA 1IO4A 2O1KA 4GT1A 1W2EA 1RE3A 4WY4A 1RF1A 5AW4B 3U1CA 1MV8A 3B5ND 5BVZA 1QL1A 4O9BA 2E42A 1ZR4A 3OA7A 3R2PA 1YTZT 3VN0A 4C7RA 5AW5B 3RL0D 1CW5A 1N7SB 1XTGB 4XA4A 4EOTA 2WSCH 2M3BA 1L4AB 1URQB 1JY2P 1JOCA 1G1JA 2LKMA 4WBAA 2HFED 2YKQA 2FYUK 2I1KA 1JCCA 2W6BA 3HTKB 1SFCA 1JO5A 1KQLA 2L5GB 2IFNA 2FFDC 1IJDB 2GUVA 1E5WA 2H7HA 1SQXK 2QM7A 3M9HA 3VP8A 3M91A 1SP4A 2OYHA 2YKPA 2POHA 1J2JB 3HTKA 2E43A 2OYIC 5CHXA 1GL2D 3KDPB 3II6A 3EFGA 3CLQA 1RE4C 1GDTA 1NAFA 4JYCA 5CCHD 3B8EB 1FOSF 2J58A 1N7SA 4IFFA 2FFDB 1GD2E 1FJKA 1CI6B 5APVA 3BRVB 1NTZK 3V4WA 2NPSB 3M9QA 2FKWB 1RF1C 1YTZI 1N86A 2C9LY 2Q7CA 3VP9A 3RK2C 5KJ7C 4IFDK 2P67A 1JUNA 4GKGA 5AW9B 5APXA 1LTGC 2CPSA 3KPEA 1JY2O 1JY3O 5AVRB 5CJ0A 3LW5H 1JTHA 1N7LA 1IFJA 1M1JC 3HD7D 1X9VA 2C0XA 3V4QA 1SQPK 1JNMA 1NOHA 1FZFA 3A2AA 3B5NB 3MUDA 5APTA 5APWA 3BVHA 1N73B 1RF0C 2XKMA 4I1LA 1LTTC 3HUSA 5APSA 1KILA 1MFZA 2HYNA 5AW0B 3RL0B 1G2CA 2FYZA 1VPCA 1URQA 4Y99B 4JYBA 1WT6A 2ZFCA 1NTKK 3VOPA 2WSEH 3H32A 1J1DB 1LTIC 5AVYB 3HUSB 1N73A 2GUSA 2JJLA 3B5NC 3V2PA 2H43A 1AQ5A 2M8RA 4DZOA 5AVZB 1OXZA 5APQA 1ZN5A 2YNYA 1KZUB 3HE4A 4ZKUA 1RY3A 2NPSC 1H88A 1A02F 1URQC 2WT7B 3OJAB 1FZAA 2YO3A 2R5BA 4LLHA 2IFMA 2O1JA 1PFIA 1KFMA 3GHGB 3BRTB 1Z56A 3L36A 1RF1B 1GU4A 1MUUA 3P8CE 3IR9A 5KJ7A 1CI6A 1ZLLA 5AW8B 3M9BA 1MZ9A 4N78D 1JY3N 1HGZA 3N7NA 3A7OA 1GTWA 1IC2A 4C46A 5KLVK 1A02J 2OARA 1FZCA 2KP8A 1SFCC 5CCGA 2NPSA 3LIEA 3P8MC 3TSIA 4HYTB 4AYCA 4KHXA 3CL3D 3V5BA 5CCHC 2N1TD 4HH2A 5AVSB 2OYHB 1LTBC 3HD7B 2GM4A 3M0AA 1LWUA 2FXMA 1SQVK 3HE5A 1N7SC 2WZ7A 1FZEA 2Z5IA 1H89A 1EQ7A 1GK6A 1LGHB 1SFCB 3BASA 2HODB 1GU5A 3P8CD 3M0DC 3LIDA 5CCHA 1GW3A 1KILC 2J59M 2R3CA 2A45G 3HUSC 4ZKPA 5CJ4A 1JMMA 1LWUB 1DEBA 2Q9IA 2OYHC 1L0NK 3HD7A 1KILB 2Z5HA 4WY4D 3NMDA 2P7JA 4GIFA 4I6MC 2WPRA 3UIAA 2A45H 4XE5B 2YMYA 2C0WA 3MGNA 2OYIB 3OAKA 3P7KA 3O8ZA 2H8PD 3EQ2A 2N9BA 1FBMA 1X79B 1JY3P 1LWUC 3VYIA 2IX7C 2YO2A 3NXSA 1FZBA 5BU8B 5AVUB 2HLOA 2KSJA 4WB4A 1N2DC 3A3YB 1G1IA 3L35A 1NU1K 2WITA 4AQRD 1LTAC 1SLQA 2XU6A 3RK2B 1IFDA 3RK3B 2XZRA 4W80A 5APUA 2Z4EA 4RESB 1YYCA 5BU5A 3VMXA 1GL2C 3SWYA 1IFNA 3KYQA 3GHGC 3V2NA 4DOJA 1M7LA 2W6AA 2R5DA 1S9KD 1J1DC 2WWWA 1CZQA 2KLVA 1FU1A 2C9NY 2N1TB 3HE5B 1T2KD 4EIJA 3MTUE 4LC1A 3L4FA 3RL0C 1NHLA 4C7NA 1IFMA 2HODA 2W27A 3P32A 2MJZA 1WRGA 1SFCD 2KOGA 1HH0A 3B5NA 1CSBA 1L4AD 2P2UA 5AVXB 5AVQB 4N6JA 4W7YA 1T3UA 3TNUA 1FJPA 1LT9C 1IK9A 2N1TC 1X8YA 5AW7B 3NFQA 2VRSA 3U59A 1T3JA 4WY4B 1J1EC 3SWFA 3VMYA 5CCGD 1KFNA 1SQQK 3C9IA 2PP6A 3HRNA 1ZR2A 3MD0A 1GZLA 2I1JA 4W7ZA 1RE4A 1GL2B 1LT9B 2WPQA 1HWTC 2IPPA 4C7NB 4Y99C 3HE4B 1IFIA 2FFDA 3RK3C 3TYYA 1VDFA 2O01H 3E1IA 1SVFA 3RK2D 5KJ7D 2NPSD 1FAVA 3TK1A 3V2QA 1XTCC 1G2CB 2KYVA 1JCDA 2N1TA 5AVTB 1LTJB 1ZV8A 3BATA 1NKNA 3A5TA 1OWAA 3H32B 3U1AA 2HG5D 3H6PA 2WTYA 1LTJA 1L4AA 1NTMK 2WSFH 3VMZA 1RF0A 2BASA 1FZGA 1HBWA 1LTSC 4N78E 2QM8A 1LT9A 5AW2B 1FZCC 2XV5A 1HJBA 4JF7A 2PAJA 1J1EB 3GHGA 5APYA 2OYIA 2Q5UA 1H8AA 1JTHB 3WMM0 4IFMA 1HTLC 1T2KC 3KQGA 5AW3B 1N7SD 1M1JA 1JY2N 2R32A 2CPBA 1URQD 4OH8B 5AW1B 5KTBA 3M0DA 3V2RA 4B86A 2HPCB 3VTPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT6 A;  3BAT A;  5BU8 B;  2JEE A;  3U1C A;  3U59 A;  1NKN A;  5BVZ A;  4O9B A;  2FXM A;  4GIF A;  3U1A A;  3VP8 A;  4N3Y B;  4N78 D;  2POH A;  4ZKU A;  3N7N A;  3N4X A;  4I1L A;  3VP9 A;  3BAS A;  1X79 B;  1IC2 A;  3C9I A;  3P8C D;  5BU5 A;  5KTB A;  3HRN A;  3OJA B;  4ZKP A; 
#chains in the Genus database with same CATH topology
 1FDO A;  1KIL D;  2B88 A;  1NO4 A;  2KB7 P;  1AFO A;  2IDB A;  1L4A C;  1NKZ B;  3AEE C;  4BWN A;  3PP5 A;  2WT7 A;  1GK4 A;  1S9K E;  1PL5 A;  1T8Z A;  1LTJ C;  1NH4 A;  2WPS A;  2E74 B;  2P1J A;  2Y0E A;  5KKZ B;  2M5A A;  5AW6 B;  1RE3 C;  1KOR A;  2B9B A;  2YIU C;  3R4Y A;  1R5S A;  4IL6 E;  3JCU H;  4WY4 C;  1HUC A;  2JR8 A;  2Q3I A;  2XDJ A;  3CI9 A;  2E74 C;  1EC5 A;  3H1J E;  3CWB G;  2SPZ A;  3NTN A;  3SWK A;  1BGY D;  1UII A;  3CX5 H;  1SQB K;  1N73 C;  5H2F H;  1QL2 A;  2D2C B;  3T97 A;  1L0L K;  1OW8 A;  1SQP G;  2Y9Y A;  1HGV A;  2KK7 A;  3RBZ A;  1YHQ P;  3IFM A;  3O6Q A;  5CMZ A;  5CCG C;  2QEX P;  3SFD C;  1DX7 A;  3MIW A;  4AUW A;  2E75 C;  2K9J A;  3Q5R A;  1HVV A;  4TT3 H;  1FDM A;  3I5C A;  4GOD A;  3G3Z A;  4U3F E;  3L72 G;  5AVW B;  1VQ9 P;  1NTM E;  1FZC B;  1SQQ D;  2DW3 A;  3KZI E;  3L71 E;  3HD7 C;  4LGD E;  3CCV P;  1H0T A;  2JEE A;  2K1A A;  5B66 E;  4I2L C;  2KXP B;  2ZXE B;  4D6T E;  4OGQ D;  1FOS E;  3L75 D;  3RL0 g;  1DH3 A;  3KXD A;  1M1J B;  1NWQ A;  1GL2 A;  2OTK E;  3AE4 C;  1GW4 A;  1KQF B;  3RK3 D;  3TGU D;  1R5L A;  4U3F G;  2HPC A;  1OFC X;  3M06 A;  4ASV A;  2IBZ E;  1KYO E;  4M3L A;  2RMZ A;  2XNX A;  3L37 A;  3L73 G;  3H1H D;  4N3Y B;  2ZXX A;  2A45 I;  1BCC E;  2YKO A;  2WVR A;  2ZYG A;  1JEK A;  3N4X A;  4H44 D;  5AVV B;  5M1B A;  2BEZ F;  3WUV A;  2O1K A;  3BCC E;  3GW6 A;  4YPC A;  3AEC C;  3GF3 A;  4XFJ A;  1FE6 A;  4GT1 A;  1S4X A;  4HJG H;  1W2E A;  1RE3 A;  3AE7 C;  3QH9 A;  4WY4 A;  2QVA A;  3CC2 P;  2BCC E;  3H1K J;  1RF1 A;  1NTZ E;  4L76 A;  1NAY A;  3BCC J;  5AW4 B;  4I7Z B;  1NYH A;  3U1C A;  1MV8 A;  3B5N D;  2Y9Z A;  3H1H E;  4PV1 C;  5BVZ A;  1AVY A;  1QL1 A;  3L75 J;  3PTZ A;  4O9B A;  1YIT P;  1SQQ J;  2WMM A;  1M56 D;  1QVG O;  2E42 A;  1ZR4 A;  1OVU A;  1KB9 E;  2KZJ A;  3E1R A;  3OA7 A;  3R2P A;  1VQP P;  1U7M A;  3L72 E;  3C1L A;  1YTZ T;  2QJK B;  3VN0 A;  3ZDM A;  4C7R A;  1KMI Z;  4RJT A;  5AW5 B;  3CCL P;  3RL0 D;  1CW5 A;  2E5Y A;  2CK3 H;  1N7S B;  1XTG B;  1RHZ B;  1LT1 A;  4XA4 A;  4EOT A;  1H0T B;  2WSC H;  1M90 Q;  2M3B A;  1L4A B;  1R8E A;  1SQP E;  3H1H J;  4U3F D;  1URQ B;  2WSF J;  3GF7 A;  5KAF H;  5EFW B;  1N8R Q;  1JY2 P;  5KKZ C;  1AV1 A;  1JOC A;  1P84 H;  2LXC B;  1G1J A;  1L0L E;  2LKM A;  4WBA A;  2HFE D;  2YKQ A;  5DJU B;  2BCC D;  3F89 A;  4PV1 B;  3TDK A;  2FYU K;  2I1K A;  1JCC A;  1QX8 A;  1LJ2 A;  2W6B A;  2YXQ B;  3HTK B;  1KQG B;  1KYO I;  1SFC A;  1SQQ G;  4Y28 J;  3CCM P;  1KQL A;  2L5G B;  1VQ8 P;  1JO5 A;  3H1L E;  2IZ1 A;  2D2C C;  1NU1 D;  3BCC D;  1QLE D;  2IFN A;  2XND H;  1IJD B;  2FBW C;  1SQB D;  1E5W A;  2GUV A;  3Q1M A;  2FFD C;  2H7H A;  1SQX K;  2QM7 A;  3M9H A;  3VP8 A;  3H1K G;  1L0N J;  3M91 A;  1AJY A;  1SP4 A;  1K05 A;  2M0B A;  2OYH A;  1NTK E;  2YKP A;  3CXH H;  2POH A;  2G3A A;  3MUD C;  1JM0 A;  1VQN P;  3A0B H;  4K35 A;  3TGU E;  1J2J B;  1QVF O;  3RK3 E;  1X0T A;  2H89 C;  3HTK A;  2E43 A;  2OYI C;  5CHX A;  4K3A A;  3CXH I;  1AA0 A;  1GL2 D;  3KDP B;  4Z1M H;  1HJ0 A;  1Q90 D;  3V6I A;  1PP9 J;  3II6 A;  1P84 E;  1PP9 D;  3CLQ A;  3EFG A;  1NU1 G;  1OX3 A;  1VF5 D;  3JC2 2;  1RE4 C;  1NVO A;  1S2E A;  1SQX D;  1GDT A;  2PGD A;  4U3F J;  1NAF A;  3H1L J;  4JYC A;  4YXD C;  3B8E B;  5CCH D;  3CMA P;  1FOS F;  2J58 A;  1N7S A;  4IFF A;  2FFD B;  1GD2 E;  4ZNC A;  1FJK A;  1BGY J;  1NTM G;  1CI6 B;  1DEE G;  5DJT B;  2QA4 P;  1Y8A A;  2R3S A;  3H1J G;  2IBZ G;  3AE5 C;  5APV A;  3BRV B;  1NTZ K;  3V4W A;  1HF9 A;  2NPS B;  3M9Q A;  2FKW B;  1RF1 C;  1YTZ I;  1N86 A;  2C9L Y;  3D6Y A;  2QJK C;  2K37 A;  2Q7C A;  3D71 A;  1USE A;  3VP9 A;  1L2P A;  4UB8 H;  1PV3 A;  3RK2 C;  2W6J H;  2IYP A;  3CCQ P;  5KJ7 C;  2FY8 A;  2P67 A;  4IFD K;  1PPJ D;  1JUN A;  4GKG A;  3CX5 D;  3WUU A;  2AXT E;  1T6A A;  2OQQ A;  3L70 J;  2JWD A;  5APX A;  5AW9 B;  1KTM A;  1LTG C;  1YJN P;  2CPS A;  3H1I D;  1PZQ A;  3H1I J;  3KPE A;  3L72 J;  1JY2 O;  1JY3 O;  5AVR B;  5CJ0 A;  1UIX A;  3LW5 H;  2KS1 B;  1JTH A;  1IO4 A;  3D70 A;  1N7L A;  1IFJ A;  1KIL E;  1M1J C;  3HD7 D;  3PLN A;  1EXJ A;  1YIJ P;  4PD4 D;  1X9V A;  2FXP A;  2NZ2 A;  3TGU G;  5KAI H;  2FYU G;  2C0X A;  2Y0D A;  3V4Q A;  1L0L G;  1SQP K;  2Q6Q A;  1NOH A;  4GOE A;  1JNM A;  1FZF A;  5B5E E;  3A2A A;  3B5N B;  3MUD A;  3PH0 A;  3AE6 C;  2ZT9 C;  4KJM A;  1NGM B;  2K9J B;  1Q2N A;  5APT A;  5APW A;  1M57 D;  5CBN A;  2FYU E;  4H0L D;  3BVH A;  1N73 B;  1RF0 C;  2E76 D;  2N9Y B;  2XKM A;  3BCC G;  4I1L A;  1LTT C;  2ZT9 B;  3A0B E;  3HUS A;  5APS A;  1KIL A;  1IFP A;  3AEA C;  1MFZ A;  2HYN A;  5AW0 B;  3RL0 B;  4R4M A;  3G6E P;  1G2C A;  2FYZ A;  1BGY E;  1VPC A;  3D6Z A;  1SQX E;  1URQ A;  4Y99 B;  4JYB A;  3CC4 P;  3S1K A;  1WT6 A;  2ZFC A;  1NTK K;  3RBX A;  3VOP A;  2O3J A;  2I8D A;  2WSE H;  3CX5 I;  1J1D B;  1LTI C;  3H32 A;  5AVY B;  3G4S P;  1X22 A;  1KD1 Q;  1KN7 A;  3HUS B;  1N73 A;  2GUS A;  3L74 G;  2OTJ P;  2JJL A;  3B5N C;  1L0N G;  3V2P A;  3L73 E;  2M8R A;  4PV1 D;  2H43 A;  1ZXG A;  1AQ5 A;  4DZO A;  5AVZ B;  1OXZ A;  1SQB G;  2QIW A;  3AEG C;  3CX5 E;  5APQ A;  1ZN5 A;  2YNY A;  1JMB A;  2JO1 A;  5B5E H;  1VQ6 P;  1KZU B;  2Q1K A;  4KT0 J;  5KLI C;  5TJH A;  1NTK J;  3HE4 A;  3USS A;  5KAI E;  4ZKU A;  1RY3 A;  2NPS C;  2QG4 A;  1L0N E;  1H88 A;  1A02 F;  1W2B O;  2Q3E A;  2NRG A;  3LW5 J;  1URQ C;  3CCJ P;  1USD A;  3L71 G;  1EDL A;  1IZN B;  3OW2 O;  2WT7 B;  3OJA B;  1FZA A;  1YQ3 C;  1BE3 G;  2YO3 A;  3RGU A;  2R5B A;  2M3E A;  1L0L D;  4LLH A;  2IFM A;  2JDI H;  2O1J A;  1ZP0 C;  2P58 A;  1M1K Q;  1PFI A;  1S72 P;  2QE7 H;  1KFM A;  4H13 C;  1VQK P;  4ZMD A;  3GHG B;  4GOF A;  4OWF A;  5GTI E;  4UB8 E;  5GTI H;  1VF5 B;  1GMJ A;  2WSC J;  3GMA A;  4TLF A;  4I7Z C;  2AEM A;  1YI2 P;  3BRT B;  1Z56 A;  2ZAE B;  3CWB J;  3L36 A;  4H13 B;  1IK7 A;  1GU4 A;  2D2C D;  1RF1 B;  1MUU A;  2JP3 A;  2V4H A;  3P8C E;  1ZRT E;  3IR9 A;  5KJ7 A;  1CI6 A;  1ZLL A;  5AW8 B;  1PGJ A;  2WSS H;  3M9B A;  4WVZ A;  3MHV A;  1MZ9 A;  4N78 D;  1JY3 N;  3B4S A;  1HGZ A;  1OZH A;  2JKV A;  3N7N A;  1NTK D;  2W8Z A;  2FXO A;  3A7O A;  1GTW A;  3L74 J;  1IC2 A;  2AEF A;  4C46 A;  5KLV K;  1A02 J;  2OAR A;  1FZC A;  2KP8 A;  1SFC C;  1KYO H;  2E75 D;  5CCG A;  2NPS A;  1NU1 E;  3I56 P;  4U7J A;  3GG2 A;  3LIE A;  3H1K D;  1EDJ A;  4OGQ B;  3P8M C;  3TSI A;  1L0L J;  4HYT B;  4AYC A;  4NPD A;  4KHX A;  3CL3 D;  3V5B A;  2O01 N;  4RO0 A;  2QJP B;  5CCH C;  2N1T D;  4HB1 A;  4HH2 A;  5AVS B;  2OYH B;  1PGQ A;  1YBK A;  2QSI A;  1LTB C;  3FX0 A;  3HD7 B;  5B66 H;  3M0A A;  2GM4 A;  2KZI A;  1LWU A;  2FXM A;  1SQV K;  2KNC A;  1BE3 J;  3HE5 A;  1BE3 D;  1SQP D;  1N7S C;  3AE2 C;  4A7P A;  1FS0 E;  2WZ7 A;  1FZE A;  1Q81 Q;  2A06 G;  2Z5I A;  1H89 A;  3W67 A;  1EQ7 A;  1GK6 A;  1LGH B;  1SFC B;  3BAS A;  4H44 C;  2HOD B;  4PJ0 H;  1GU5 A;  3P8C D;  3M0D C;  3L75 E;  4GDO A;  3L72 D;  4IL6 X;  2ZVO B;  3LID A;  1EZV D;  3FWN A;  3T97 B;  5CCH A;  3CWB E;  1KV4 A;  1GW3 A;  1KIL C;  2J59 M;  2R3C A;  2A45 G;  3HUS C;  3S9O A;  4ZKP A;  1SQV D;  3H1I G;  1SQV J;  1JMM A;  1LWU B;  3K5B A;  5CJ4 A;  1BE3 E;  1DEB A;  1NTZ J;  2KNC B;  2YIU B;  1BSN A;  3L70 G;  3CXH D;  2Q9I A;  2OYH C;  1FC2 C;  1L0N K;  3HD7 A;  1KIL B;  1VQL P;  3FXD A;  2WSE J;  2A06 D;  2Z5H A;  2ITA A;  4WY4 D;  3NMD A;  4BXL A;  4WWI A;  2P7J A;  1NTK G;  5KLI B;  2E74 D;  4GIF A;  4I6M C;  2WPR A;  1SQB J;  3UIA A;  4EDF A;  2A45 H;  2KSE A;  2O01 J;  4XE5 B;  2YMY A;  3H25 A;  2AXT H;  2C0W A;  1NU1 J;  3MGN A;  2AEJ A;  3H1J D;  3OAK A;  3P7K A;  1VQM P;  2OYI B;  5KLV D;  3O8Z A;  2H8P D;  3EQ2 A;  2N9B A;  2OTL P;  1FBM A;  1X79 B;  2B89 A;  1S5L X;  1JY3 P;  5L8R J;  2OGU A;  1LWU C;  2B87 B;  3F5H A;  1S1C X;  3VYI A;  3TF5 A;  3L73 D;  2IX7 C;  3L73 J;  2YO2 A;  2MKV A;  3PJS K;  2ZJS E;  3AEB C;  3NXS A;  4BRY B;  3Q2Y A;  1FZB A;  1ZRT D;  2IYO A;  2KI7 B;  3TGU J;  5AVU B;  5BU8 B;  4OGQ C;  1ZOY C;  2HLO A;  5KLV E;  1LNQ A;  1E79 H;  2KSJ A;  1RQV A;  4WB4 A;  1S3J A;  1N2D C;  3A3Y B;  1RH5 B;  1G1I A;  3AED C;  3L35 A;  3G9R A;  1D7M A;  1NU1 K;  2RN0 A;  2WIT A;  2ZYA A;  3FGA D;  4ASW A;  1YJ9 P;  4AQR D;  1LTA C;  1SLQ A;  2XU6 A;  3RK2 B;  1SQV G;  1IFD A;  3RK3 B;  3AE8 C;  2XZR A;  3ITK A;  2WQY C;  4RKU J;  2FYN B;  4W80 A;  4OVN F;  4RES B;  5APU A;  4DT0 A;  5KLV G;  1YYC A;  2PFX A;  3CXH E;  3E7K A;  2UWJ E;  1U57 A;  5BU5 A;  5GTH E;  1L0N D;  1VQO P;  1P84 I;  3KZI H;  1SQV E;  3VMA A;  1FDI A;  2Y0C A;  4NPF X;  5KLV J;  4PJ0 E;  1GL2 C;  4L74 A;  3SWY A;  1IFN A;  3VMX A;  4DJG A;  1EZV E;  3KYQ A;  5CBO A;  3GHG C;  3CME P;  1BSH A;  3V2N A;  3L75 G;  4DOJ A;  2E75 B;  1M7L A;  2W6A A;  2AXC A;  5TIS E;  2R5D A;  1VQ5 P;  1S9K D;  1J1D C;  2WWW A;  1CZQ A;  2KLV A;  4JQ0 D;  1FU1 A;  2C9N Y;  5H2F E;  3L70 E;  1SS1 A;  1LP1 B;  1YQ4 C;  1EZV G;  2N1T B;  1PP9 G;  2LXB A;  3HE5 B;  5KAF E;  4EIJ A;  3MTU E;  1T2K D;  2FYN C;  4LC1 A;  5E79 H;  2E5T A;  3IAO A;  3L74 D;  3L4F A;  3RL0 C;  1NHL A;  2QJY C;  1OW6 A;  3H1L G;  2BEQ D;  4C7N A;  1IFM A;  1Y47 A;  2HOD A;  2W27 A;  2KS1 A;  2V7Q H;  3EFF K;  3P32 A;  3PHL A;  2BCC J;  2MJZ A;  2OYO A;  3H1K E;  1BDC A;  1WRG A;  2A06 E;  4IOI H;  4CPG A;  3Q3D A;  1SFC D;  1MKM A;  1KB9 H;  2KOG A;  1HH0 A;  3A0H E;  3B5N A;  1CSB A;  1L4A D;  2P2U A;  3SFE C;  1VQ4 P;  1PGO A;  2LR2 A;  3FXE A;  5AVX B;  5AVQ B;  1EDK A;  3WU2 H;  4N6J A;  4W7Y A;  1T3U A;  1KB9 I;  3TNU A;  1U7J A;  1FJP A;  1LT9 C;  1IK9 A;  1PPJ G;  1X8Y A;  2N1T C;  2YMK A;  2VRS A;  3NFQ A;  4PD4 E;  4UB6 H;  5AW7 B;  3G71 P;  1T3J A;  2YXR B;  1DD4 A;  3SSU A;  4NPE A;  4WY4 B;  1J1E C;  4PD4 I;  2JWA A;  3SWF A;  3VMY A;  3TNU B;  2ZT9 D;  4D6T J;  5CCG D;  1KFN A;  3Q5S A;  1PPJ E;  1SQQ K;  3ABV C;  3AE1 C;  1Q86 Q;  2H88 C;  1OIP A;  3C9I A;  1PIX A;  2PP6 A;  3AE9 C;  3HRN A;  1YJW P;  4MN4 C;  1QEX A;  2GA1 A;  4YXW H;  1NTZ D;  2L91 A;  1NTZ G;  1ZR2 A;  1GZL A;  2I1J A;  2K88 A;  3MD0 A;  1TU3 F;  4L75 A;  4W7Z A;  1RE4 A;  3CCS P;  4EYY Q;  1BDD A;  1GL2 B;  1VQ7 P;  1Q82 Q;  1LT9 B;  2WPQ A;  3H1H G;  1HWT C;  4PD4 H;  2IPP A;  2Z4E A;  4C7N B;  4Y99 C;  3HE4 B;  1IFI A;  1QGK B;  2FFD A;  1AVO A;  3QWO C;  3RK3 C;  2QRX A;  1PGP A;  2PRR A;  2WPV B;  1SQP J;  2IBZ D;  3H1J J;  3TYY A;  1BGY G;  1LP1 A;  1VDF A;  3CWB D;  3CCE P;  1P84 D;  1PP9 E;  2O01 H;  3S4R A;  1WMK A;  3E1I A;  1SVF A;  3RK2 D;  3O6Q B;  1OMI A;  2NPS D;  1FAV A;  2V7Q J;  5KJ7 D;  2RKL A;  3TK1 A;  2QJY B;  1W5C E;  2KUB A;  3V2Q A;  1KB9 D;  1RQU A;  2K9Y A;  4L73 A;  2W90 A;  3CC7 P;  5E79 E;  3I55 P;  3CPW O;  1OVV A;  1SQX J;  2QJP C;  2BCC G;  1XTC C;  1G2C B;  2KYV A;  1JCD A;  2N1T A;  3JCU E;  1LTJ B;  1ZV8 A;  5AVT B;  4IL6 H;  1NJI Q;  2R44 A;  1SQB E;  1K9M Q;  3BAT A;  4H13 D;  2M5A B;  4JPZ B;  3H1L D;  3MP7 B;  3MZW B;  2FYU D;  3U59 A;  2FYU J;  1NKN A;  5TIS H;  3A5T A;  1ZW0 A;  1OWA A;  1OVR A;  3H32 B;  3U1A A;  5C39 A;  1KQS O;  2HG5 D;  1EDI A;  2IZ0 A;  2ZYD A;  3H6P A;  3EWK A;  2WTY A;  1LTJ A;  1KC8 Q;  4H44 B;  3C8V A;  1BCC J;  1L4A A;  2RH0 A;  1NTM K;  2WSF H;  4H0L C;  3VMZ A;  1RF0 A;  2E76 C;  1AQT A;  1OW7 A;  2BAS A;  1FZG A;  5GTH H;  1EXI A;  1MFT A;  1HBW A;  2G8Y A;  3CCU P;  1LTS C;  4N78 E;  1BCC G;  2QM8 A;  4H0L B;  4YTP C;  1LT9 A;  5AW2 B;  2E76 B;  3H1I E;  2J5U A;  2K3R A;  1FZC C;  1Y9B A;  1K8A Q;  4QMA A;  1S5L H;  5K5G B;  2IBZ I;  2XV5 A;  2KIK A;  4JBZ A;  3KHU A;  4D6T D;  1HJB A;  3W68 A;  1DIP A;  2KLU A;  4EI2 A;  2ZVN B;  3FWL A;  2W83 C;  4JF7 A;  1SQQ E;  3L71 D;  3L71 J;  1NTM D;  2PAJ A;  1NTM J;  1J1E B;  3CCR P;  3B71 A;  3GHG A;  3IF4 A;  5APY A;  2OYI A;  2Q5U A;  1H8A A;  3WUT A;  1S5L E;  1M8O B;  4BRY A;  1JTH B;  3WMM 0;  1VL2 A;  1SQX G;  1HTL C;  4IFM A;  1T2K C;  3AE3 C;  3KQG A;  5AW3 B;  1N7S D;  1K73 Q;  4R4L A;  1M1J A;  1K04 A;  4UB6 E;  1EZV I;  2B87 A;  3Q5P A;  1JY2 N;  2HR3 A;  2R32 A;  2CPB A;  3AEF C;  4D6T G;  1URQ D;  3L74 E;  4OH8 B;  5AW1 B;  3WU2 E;  5KTB A;  1JB0 J;  3PRJ A;  3IN6 A;  4HKZ H;  1BCC D;  2P10 A;  3M0D A;  1Q7Y Q;  1ZME C;  1DD3 A;  3CD6 P;  3V2R A;  3GLM A;  3JSV C;  3A0H H;  4B86 A;  4DCK A;  2HPC B;  3VTP C;  1KYO D;  3L70 D;  1VF5 C; 
#chains in the Genus database with same CATH homology
 1KIL D;  2KB7 P;  1AFO A;  1NO4 A;  1L4A C;  1NKZ B;  2WT7 A;  1S9K E;  3PP5 A;  1GK4 A;  1T8Z A;  1LTJ C;  1NH4 A;  2WPS A;  2P1J A;  5AW6 B;  1RE3 C;  4WY4 C;  3TNU B;  1HUC A;  2Q3I A;  2XDJ A;  3CI9 A;  3NTN A;  1N73 C;  1SQB K;  1QL2 A;  3T97 A;  1L0L K;  1HGV A;  3IFM A;  5CMZ A;  5CCG C;  1DX7 A;  3MIW A;  4AUW A;  1HVV A;  1FDM A;  3I5C A;  3G3Z A;  5AVW B;  1FZC B;  4LGD E;  3HD7 C;  2JEE A;  4I2L C;  2ZXE B;  1FOS E;  1DH3 A;  1M1J B;  1NWQ A;  1GL2 A;  1GW4 A;  3RK3 D;  2HPC A;  3M06 A;  4M3L A;  2XNX A;  3L37 A;  4N3Y B;  2A45 I;  2YKO A;  5AVV B;  3N4X A;  1IO4 A;  2O1K A;  4GT1 A;  1W2E A;  1RE3 A;  4WY4 A;  1RF1 A;  5AW4 B;  3U1C A;  1MV8 A;  3B5N D;  5BVZ A;  1QL1 A;  4O9B A;  2E42 A;  1ZR4 A;  3OA7 A;  3R2P A;  1YTZ T;  3VN0 A;  4C7R A;  5AW5 B;  3RL0 D;  1CW5 A;  1N7S B;  1XTG B;  4XA4 A;  4EOT A;  2WSC H;  2M3B A;  1L4A B;  1URQ B;  1JY2 P;  1JOC A;  1G1J A;  2LKM A;  4WBA A;  2HFE D;  2YKQ A;  2FYU K;  2I1K A;  1JCC A;  2W6B A;  3HTK B;  1SFC A;  1JO5 A;  1KQL A;  2L5G B;  2IFN A;  2FFD C;  1IJD B;  2GUV A;  1E5W A;  2H7H A;  1SQX K;  2QM7 A;  3M9H A;  3VP8 A;  3M91 A;  1SP4 A;  2OYH A;  2YKP A;  2POH A;  1J2J B;  3HTK A;  2E43 A;  2OYI C;  5CHX A;  1GL2 D;  3KDP B;  3II6 A;  3EFG A;  3CLQ A;  1RE4 C;  1GDT A;  1NAF A;  4JYC A;  5CCH D;  3B8E B;  1FOS F;  2J58 A;  1N7S A;  4IFF A;  2FFD B;  1GD2 E;  1FJK A;  1CI6 B;  5APV A;  3BRV B;  1NTZ K;  3V4W A;  2NPS B;  3M9Q A;  2FKW B;  1RF1 C;  1YTZ I;  1N86 A;  2C9L Y;  2Q7C A;  3VP9 A;  3RK2 C;  5KJ7 C;  4IFD K;  2P67 A;  1JUN A;  4GKG A;  5AW9 B;  5APX A;  1LTG C;  2CPS A;  3KPE A;  1JY2 O;  1JY3 O;  5AVR B;  5CJ0 A;  3LW5 H;  1JTH A;  1N7L A;  1IFJ A;  1M1J C;  3HD7 D;  1X9V A;  2C0X A;  3V4Q A;  1SQP K;  1JNM A;  1NOH A;  1FZF A;  3A2A A;  3B5N B;  3MUD A;  5APT A;  5APW A;  3BVH A;  1N73 B;  1RF0 C;  2XKM A;  4I1L A;  1LTT C;  3HUS A;  5APS A;  1KIL A;  1MFZ A;  2HYN A;  5AW0 B;  3RL0 B;  1G2C A;  2FYZ A;  1VPC A;  1URQ A;  4Y99 B;  4JYB A;  1WT6 A;  2ZFC A;  1NTK K;  3VOP A;  2WSE H;  3H32 A;  1J1D B;  1LTI C;  5AVY B;  3HUS B;  1N73 A;  2GUS A;  2JJL A;  3B5N C;  3V2P A;  2H43 A;  1AQ5 A;  2M8R A;  4DZO A;  5AVZ B;  1OXZ A;  5APQ A;  1ZN5 A;  2YNY A;  1KZU B;  3HE4 A;  4ZKU A;  1RY3 A;  2NPS C;  1H88 A;  1A02 F;  1URQ C;  2WT7 B;  3OJA B;  1FZA A;  2YO3 A;  2R5B A;  4LLH A;  2IFM A;  2O1J A;  1PFI A;  1KFM A;  3GHG B;  3BRT B;  1Z56 A;  3L36 A;  1RF1 B;  1GU4 A;  1MUU A;  3P8C E;  3IR9 A;  5KJ7 A;  1CI6 A;  1ZLL A;  5AW8 B;  3M9B A;  1MZ9 A;  4N78 D;  1JY3 N;  1HGZ A;  3N7N A;  3A7O A;  1GTW A;  1IC2 A;  4C46 A;  5KLV K;  1A02 J;  2OAR A;  1FZC A;  2KP8 A;  1SFC C;  5CCG A;  2NPS A;  3LIE A;  3P8M C;  3TSI A;  4HYT B;  4AYC A;  4KHX A;  3CL3 D;  3V5B A;  5CCH C;  2N1T D;  4HH2 A;  5AVS B;  2OYH B;  1LTB C;  3HD7 B;  2GM4 A;  3M0A A;  1LWU A;  2FXM A;  1SQV K;  3HE5 A;  1N7S C;  2WZ7 A;  1FZE A;  2Z5I A;  1H89 A;  1EQ7 A;  1GK6 A;  1LGH B;  1SFC B;  3BAS A;  2HOD B;  1GU5 A;  3P8C D;  3M0D C;  3LID A;  5CCH A;  1GW3 A;  1KIL C;  2J59 M;  2R3C A;  2A45 G;  3HUS C;  4ZKP A;  5CJ4 A;  1JMM A;  1LWU B;  1DEB A;  2Q9I A;  2OYH C;  1L0N K;  3HD7 A;  1KIL B;  2Z5H A;  4WY4 D;  3NMD A;  2P7J A;  4GIF A;  4I6M C;  2WPR A;  3UIA A;  2A45 H;  4XE5 B;  2YMY A;  2C0W A;  3MGN A;  2OYI B;  3OAK A;  3P7K A;  3O8Z A;  2H8P D;  3EQ2 A;  2N9B A;  1FBM A;  1X79 B;  1JY3 P;  1LWU C;  3VYI A;  2IX7 C;  2YO2 A;  3NXS A;  1FZB A;  5BU8 B;  5AVU B;  2HLO A;  2KSJ A;  4WB4 A;  1N2D C;  3A3Y B;  1G1I A;  3L35 A;  1NU1 K;  2WIT A;  4AQR D;  1LTA C;  1SLQ A;  2XU6 A;  3RK2 B;  1IFD A;  3RK3 B;  2XZR A;  4W80 A;  5APU A;  2Z4E A;  4RES B;  1YYC A;  5BU5 A;  3VMX A;  1GL2 C;  3SWY A;  1IFN A;  3KYQ A;  3GHG C;  3V2N A;  4DOJ A;  1M7L A;  2W6A A;  2R5D A;  1S9K D;  1J1D C;  2WWW A;  1CZQ A;  2KLV A;  1FU1 A;  2C9N Y;  2N1T B;  3HE5 B;  1T2K D;  4EIJ A;  3MTU E;  4LC1 A;  3L4F A;  3RL0 C;  1NHL A;  4C7N A;  1IFM A;  2HOD A;  2W27 A;  3P32 A;  2MJZ A;  1WRG A;  1SFC D;  2KOG A;  1HH0 A;  3B5N A;  1CSB A;  1L4A D;  2P2U A;  5AVX B;  5AVQ B;  4N6J A;  4W7Y A;  1T3U A;  3TNU A;  1FJP A;  1LT9 C;  1IK9 A;  2N1T C;  1X8Y A;  5AW7 B;  3NFQ A;  2VRS A;  3U59 A;  1T3J A;  4WY4 B;  1J1E C;  3SWF A;  3VMY A;  5CCG D;  1KFN A;  1SQQ K;  3C9I A;  2PP6 A;  3HRN A;  1ZR2 A;  3MD0 A;  1GZL A;  2I1J A;  4W7Z A;  1RE4 A;  1GL2 B;  1LT9 B;  2WPQ A;  1HWT C;  2IPP A;  4C7N B;  4Y99 C;  3HE4 B;  1IFI A;  2FFD A;  3RK3 C;  3TYY A;  1VDF A;  2O01 H;  3E1I A;  1SVF A;  3RK2 D;  5KJ7 D;  2NPS D;  1FAV A;  3TK1 A;  3V2Q A;  1XTC C;  1G2C B;  2KYV A;  1JCD A;  2N1T A;  5AVT B;  1LTJ B;  1ZV8 A;  3BAT A;  1NKN A;  3A5T A;  1OWA A;  3H32 B;  3U1A A;  2HG5 D;  3H6P A;  2WTY A;  1LTJ A;  1L4A A;  1NTM K;  2WSF H;  3VMZ A;  1RF0 A;  2BAS A;  1FZG A;  1HBW A;  1LTS C;  4N78 E;  2QM8 A;  1LT9 A;  5AW2 B;  1FZC C;  2XV5 A;  1HJB A;  4JF7 A;  2PAJ A;  1J1E B;  3GHG A;  5APY A;  2OYI A;  2Q5U A;  1H8A A;  1JTH B;  3WMM 0;  4IFM A;  1HTL C;  1T2K C;  3KQG A;  5AW3 B;  1N7S D;  1M1J A;  1JY2 N;  2R32 A;  2CPB A;  1URQ D;  4OH8 B;  5AW1 B;  5KTB A;  3M0D A;  3V2R A;  4B86 A;  2HPC B;  3VTP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...