3VP8A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
75
structure length
75
Chain Sequence
b'SVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General transcriptional corepressor TUP1
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 35
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp8A00
3U1CA 2JEEA 4O9BA 4ZKPA 5BU5A 2FXMA 4I1LA 1NKNA 3U1AA 1IC2A 5KTBA 2POHA 3VP8A 1WT6A 4ZKUA 3VP9A 4N3YB 1X79B 3C9IA 3N7NA 3HRNA 5BVZA 4GIFA 3OJAB 3U59A 4N78D 3BATA 3BASA 3P8CD 3N4XA 5BU8B
chains in the Genus database with same CATH superfamily
1KYOH 3TNUB 1SS1A 2N1TB 1DEBA 2AXTE 1NKNA 1VQ4P 2KK7A 2JP3A 3H25A 4WBAA 3IN6A 2W8ZA 4BRYB 2ITAA 4CPGA 2ZYDA 1IFMA 1LTJC 4BXLA 1IFDA 2FFDB 2LXCB 5AW9B 1P84E 1URQA 1U7MA 1Q7YQ 2GUVA 4WY4A 1L0NE 1EZVG 3RK3B 3L75E 4PV1B 3KZIE 1S9KE 2E42A 1FZCA 3HD7B 2BCCE 3R2PA 1EXIA 2IZ0A 1JCCA 2KZIA 5C39A 1IK9A 1BGYG 2A06G 1FU1A 3VYIA 2WMMA 4DZOA 3L74E 5AW2B 4OGQC 2KB7P 4L73A 1P84D 2FYNC 1FJKA 3H1IG 4PJ0E 4ZMDA 1ZR2A 1L0ND 1VQ6P 3PH0A 1LTTC 1Q2NA 3L75D 3CC7P 1OW7A 3AE4C 2V7QJ 2YIUC 4H13D 1NU1E 2OYIA 1DH3A 1L0NJ 3SWFA 1GZLA 2Q1KA 2KP8A 1GDTA 3AEGC 1ZMEC 2IBZE 2QRXA 1YQ3C 1NAYA 3OAKA 1AQ5A 3L74D 2IFMA 2QSIA 5CJ4A 3L70E 1SQBE 3CCSP 3L74J 4WY4C 5KAFE 3L4FA 3CL3D 2P1JA 3A0HH 1NU1D 3LIEA 1N73B 5TISH 5APTA 5L8RJ 1L2PA 3AEEC 1NTKK 1USDA 1OMIA 2R3SA 2IBZD 3MHVA 2WPSA 1FZCC 1NU1J 2HODB 1LWUA 1PL5A 5KLVG 1T3JA 5K5GB 2Y9YA 4O9BA 2Q6QA 1OFCX 3ZDMA 1SQPG 4HB1A 3KPEA 3EQ2A 2PFXA 2W83C 2R5DA 3L70D 3ABVC 2W6BA 1EDIA 3Q2YA 2FYZA 1JEKA 3L70J 2OYIC 3CX5H 4HYTB 2K9JA 2XNXA 5E79H 1P84I 3BRTB 2K88A 3P32A 2CPBA 4JYCA 2C9NY 2E43A 1LTJB 2FYUE 3KQGA 4ASVA 1S2EA 1JY2O 1YYCA 2P10A 5AW5B 4LLHA 3BCCE 2GUSA 3VTPC 1KQFB 1FDOA 1W5CE 1Y9BA 3BASA 5CCGA 3ITKA 1YQ4C 4A7PA 1M1KQ 1KB9E 2ZAEB 1VQ7P 3TGUE 4OWFA 1SQPD 2OARA 2KS1B 1KC8Q 4PD4H 4OGQB 1KILE 1SQPJ 1SQBK 5AW4B 2FYNB 5AW7B 1KV4A 1EC5A 4OH8B 4XE5B 2WITA 3A0BE 1CSBA 3CI9A 2ZYAA 1HJBA 2P2UA 2IYOA 1LTBC 2IBZI 3RBZA 2YIUB 3AE1C 3CXHE 2E76C 3WU2H 2W6JH 1JY2N 1HUCA 2P67A 3BRVB 4BRYA 1KB9D 3HUSC 1SVFA 3JC22 1ZW0A 2YMKA 1NWQA 2JO1A 2FFDA 3B4SA 5AVTB 1DX7A 1BE3G 2FKWB 2QG4A 4H13C 3H6PA 4WY4B 3FX0A 3PJSK 2AXCA 1CW5A 3TDKA 3CXHD 1GL2D 4QMAA 4NPFX 4ASWA 5CCGC 3WUUA 4UB6E 5APSA 2GA1A 1FZCB 1A02J 2WWWA 1PGJA 1S1CX 2WT7A 3KDPB 2KNCB 2FYUK 3CLQA 1GW4A 1EDLA 3B5ND 1S5LE 4U3FE 1KMIZ 1NTME 3L73G 4K35A 1NTZK 5KAIE 3OA7A 5DJTB 3IF4A 2H89C 1DEEG 4TLFA 3Q5SA 3D6ZA 1DIPA 2RKLA 2OYIB 1OX3A 3H1JD 1GMJA 3L71E 1Y47A 3VMZA 1JTHB 2XKMA 1L0LK 2Z5IA 1QVGO 4AUWA 3H1JJ 4LC1A 2NZ2A 3H1LG 2LKMA 4L76A 1MZ9A 4U3FD 1NTMD 1JCDA 4L74A 1GU5A 3FWLA 1N73A 1SQQE 4PV1C 4K3AA 1XTCC 4D6TD 1IFJA 1H8AA 4EIJA 3Q5PA 4U3FJ 1NTMJ 2HODA 2D2CD 2OQQA 2OTKE 3L71D 3Q5RA 4D6TJ 4YTPC 3FWNA 3G3ZA 3C8VA 2E75D 1GW3A 1VDFA 1OXZA 3HE5A 3L71J 3RL0g 2E74D 1HGZA 1LT1A 1HVVA 4RO0A 1GL2A 1KYOE 1SQQD 1NKZB 2Z4EA 2ZJSE 1AFOA 4WWIA 2E76B 4JYBA 2KOGA 1SQQJ 1YIJP 3PTZA 3HUSB 4WB4A 1A02F 2K9JB 1DD3A 2ZT9D 3MD0A 3GMAA 1W2BO 1HF9A 1VQKP 1LT9C 1FOSF 4HKZH 1T2KC 1PPJE 5TJHA 1YTZT 5AVUB 4DT0A 5B66H 1PP9E 4EDFA 3CPWO 2VRSA 4H13B 1KYOD 1FC2C 1N2DC 1AVYA 2B87B 1OIPA 1R5LA 3KYQA 2IX7C 3WUTA 3W68A 2Y9ZA 2YNYA 5AVRB 1PFIA 2SPZA 3BATA 5CCHA 2WSEH 3B71A 2C0XA 3B8EB 5H2FH 3FXEA 4H44D 4TT3H 4EYYQ 3IAOA 1FZFA 1IC2A 1T6AA 1FS0E 3V2PA 1PPJD 3I5CA 1FZGA 1PP9D 4EOTA 2AEFA 2QEXP 1OW6A 1H88A 1K73Q 1GL2C 5GTIH 2PRRA 1L0NG 1PP9J 3L75G 5AW0B 1L4AD 5APVA 5APQA 1NTKE 2GM4A 1NGMB 2YKOA 1YJNP 1BSHA 1LTGC 4DOJA 3HTKB 3SFEC 5APYA 3AE3C 3AE2C 4OVNF 1R5SA 2WSCJ 1HTLC 4GOFA 1NJIQ 1MV8A 2A45G 3L74G 3AEFC 3RGUA 3A0HE 3VMYA 3AE7C 5TISE 1IJDB 4AYCA 1JUNA 1H89A 1UIXA 3A5TA 2M3EA 5AVVB 1NTKD 3I55P 1NU1G 4R4MA 4I1LA 4XFJA 1PGQA 1SP4A 3MTUE 3H1KE 2YKPA 3RL0D 1WT6A 2KNCA 3VP9A 2IBZG 5CCHC 1NTKJ 1N7SD 1KYOI 3S9OA 2WT7B 1CZQA 3CCLP 1QL1A 2UWJE 3PHLA 5APUA 2XDJA 2W90A 1ZN5A 3EFGA 3KHUA 3JSVC 1EDKA 4I2LC 3L70G 1SQBG 4W80A 1S9KD 2D2CC 3QH9A 1SFCD 3L75J 1JTHA 3MGNA 1OZHA 2BCCD 5DJUB 3RK2D 2OYOA 3V2NA 3H1KD 3TYYA 3FXDA 1G1JA 3HE4A 2IPPA 2E74C 2BCCJ 1LT9B 3H1KJ 5APWA 2R5BA 2AXTH 4DJGA 3LW5J 1KZUB 3MIWA 2YXQB 2L5GB 3VN0A 1GK6A 2IFNA 2W27A 3PRJA 1FAVA 2ZT9C 4IFFA 2V7QH 3V6IA 1E79H 4PD4E 1BDDA 3RK3E 3GLMA 3A2AA 3HE5B 2N1TD 2WPRA 3KZIH 4C7RA 1SQBD 1SQXK 2H43A 1CI6A 3G6EP 1K8AQ 3WU2E 1GL2B 3O6QA 1SQBJ 1G2CA 1J2JB 3BCCG 3L35A 3HUSA 4H0LD 2A45H 1SQVE 2M8RA 2O01J 4MN4C 3C1LA 1GTWA 1YJWP 1ZOYC 1AQTA 2NPSD 5GTHH 2ZYGA 3S4RA 2N9YB 5AVSB 2I1KA 3CWBE 2B87A 2ZFCA 3L72E 1NTZE 1AVOA 5EFWB 2HG5D 1MFTA 1NOHA 1JO5A 3T97B 3VMAA 1VQLP 3MUDC 3M06A 1L0LE 2C0WA 3WUVA 1GK4A 3C9IA 1UIIA 3CX5I 2FYUD 2BASA 2I8DA 1LTIC 1EZVI 3GF7A 1E5WA 3CWBD 3MZWB 1MKMA 3L72D 3SFDC 3BCCD 2B89A 2FYUJ 2Y0DA 4I7ZC 1NTZD 2XNDH 2ZVNB 2RMZA 4GOEA 3CWBJ 1J1DC 2OGUA 2D2CB 3L72J 3BCCJ 3TGUD 5KKZC 3RL0C 5B5EE 1NTZJ 2JEEA 2KZJA 3HTKA 1FBMA 4RKUJ 3CD6P 3H1JG 4JBZA 1L0LD 1ZP0C 2LXBA 5AW6B 3TGUJ 3D70A 4YXDC 2E74B 1KILD 1RF1C 3CC4P 3GF3A 1RE3A 5AVYB 1L0LJ 1IO4A 3A7OA 4W7YA 3II6A 3P8CE 2WSFJ 1JMBA 2CK3H 4U3FG 2WTYA 1NTMG 4PD4I 4HJGH 4ZKUA 4N3YB 3RK2C 1SQVK 5M1BA 2IZ1A 1JY2P 4D6TG 5APXA 2ZT9B 1HH0A 1OVRA 3EWKA 3VMXA 1VQMP 2PGDA 1U57A 1ZV8A 3L71G 2HPCA 3GHGA 3AECC 5KLVK 3KXDA 2R44A 4UB8E 1LP1B 2J5UA 5CHXA 1SQPK 3D6YA 5AVXB 2M0BA 1KB9H 3P8CD 2WVRA 5BU8B 4LGDE 3CCEP 5CBNA 1SQQG 3CCJP 2W6AA 4WVZA 3O8ZA 2WPQA 2OTJP 1KFMA 3L37A 2HR3A 1NVOA 2K9YA 1LT9A 4C7NB 2G3AA 3HE4B 2K37A 3TF5A 5B66E 2O1JA 5BU5A 2Q9IA 1YI2P 1JMMA 1X8YA 3CXHH 1RE3C 3V4WA 1G1IA 1JB0J 3G71P 3UIAA 1LTAC 2O01N 2E5TA 2H88C 3WMM0 1YTZI 2NPSC 1KILA 4JF7A 1NHLA 1RF0C 3GHGC 4XA4A 1IZNB 1S5LX 1WMKA 2QM8A 1AJYA 4IL6E 5AVQB 4ZNCA 3USSA 3V2QA 1PPJG 3I56P 1CI6B 4I7ZB 1PP9G 1IFNA 2M5AB 2WQYC 1TU3F 3O6QB 1J1DB 1PGPA 2V4HA 3AEAC 1G2CB 1RE4A 2Y0EA 2N9BA 1FDMA 5KJ7D 5KKZB 4GT1A 3RL0B 1URQD 5AVWB 2XZRA 1GD2E 2CPSA 4WY4D 2Q5UA 1S5LH 5KTBA 3VP8A 5CJ0A 1BCCE 3B5NA 3P7KA 1VL2A 2YO3A 1S4XA 3AE9C 5KAIH 2PP6A 2YMYA 1RF1B 3H1HE 3P8MC 2J58A 1WRGA 2FXMA 5CBOA 1BDCA 3T97A 1OVUA 3GG2A 2JWAA 3RK2B 3AEDC 1FZBA 2AEJA 4GIFA 2OYHC 2WSSH 2LR2A 3SWYA 1KQLA 2JJLA 1LGHB 1OW8A 1NTKG 1KILC 1BCCD 3M91A 4HH2A 2B9BA 1BCCJ 3JCUH 3K5BA 1LJ2A 4KJMA 3QWOC 1PZQA 2PAJA 1PGOA 2Y0CA 1RE4C 1N86A 1KTMA 1MFZA 2BCCG 3H1KG 4NPEA 3NXSA 3B5NC 3NFQA 3U1AA 1VQPP 1JM0A 1SQXE 1NYHA 1Q81Q 1Y8AA 4YXWH 2Z5HA 1NO4A 5KJ7A 1VQ5P 4H0LB 3IR9A 4GDOA 3NTNA 3F89A 3D71A 1JNMA 1X9VA 2NPSB 1USEA 1M90Q 1LP1A 2E5YA 1LNQA 1KD1Q 2HPCB 3GHGB 3E1IA 2E76D 4N6JA 1M1JC 3E7KA 2WZ7A 1SQXD 3CX5E 2WSCH 3G9RA 3EFFK 1EZVE 4Y28J 1U7JA 5E79E 5BVZA 1SQXJ 3N4XA 4C46A 3W67A 2E75C 4C7NA 5GTHE 4I6MC 1IK7A 1VF5D 4IFDK 1BGYE 2A06E 2BEZF 5CCGD 1YJ9P 1R8EA 4YPCA 3CX5D 1KQGB 1L4AA 3H1IE 5AW3B 1EZVD 5KJ7C 1T8ZA 2HLOA 3Q1MA 1URQC 3MUDA 2JKVA 4KT0J 1P84H 2OYHB 4ZKPA 1SQVG 2R3CA 3BVHA 3H32B 1KILB 3V5BA 1FZAA 1BGYD 2A06D 2AEMA 1NAFA 3CC2P 1EXJA 2FYUG 1AA0A 2OTLP 1S3JA 1BGYJ 2O3JA 2M5AA 3H1ID 3U1CA 3CWBG 4N78E 3L72G 1IFIA 5KLIC 2K1AA 2MKVA 1HBWA 1NTZG 1L0NK 3LW5H 1YHQP 3H1IJ 2JR8A 2QJYC 1X79B 1RQVA 1N7SA 4PJ0H 4PD4D 3RK3D 3SSUA 1ZLLA 3U59A 4RJTA 4H44C 3TGUG 5CMZA 1XTGB 1NH4A 4PV1D 1RF1A 1ZRTE 5KLVE 1L0LG 3B5NB 1VQ8P 3HD7D 1SQPE 1SFCA 2P58A 2K3RA 1L4AC 4N78D 1D7MA 2Q7CA 2H8PD 1FJPA 2M3BA 3SWKA 1PV3A 4Y99C 1SQVD 1OWAA 3L36A 1MUUA 3OW2O 2NRGA 4Z1MH 1NU1K 1JY3O 2H7HA 2QJKC 1SQVJ 5KAFH 2O01H 1ZRTD 5KLVD 1N7LA 2A45I 1VQ9P 1W2EA 2KSJA 1M1JB 1LWUC 5KLVJ 1KN7A 1KQSO 2JWDA 1EDJA 3AE5C 2QIWA 1FDIA 1K9MQ 1T2KD 1QVFO 4IFMA 1KORA 1K04A 2E75B 2JDIH 3F5HA 1N7SC 1VPCA 3TNUA 3AE8C 2B88A 2N1TA 2ZXXA 1H0TB 3IFMA 3E1RA 2HYNA 1JY3N 1FOSE 1JOCA 1HJ0A 3M0DA 1SFCC 4DCKA 1QLED 4RESB 2FXOA 1N8RQ 1Q90D 3VOPA 4W7ZA 1URQB 2G8YA 1SLQA 2NPSA 1QGKB 1VF5C 3M9BA 1FZEA 1HGVA 4U7JA 4AQRD 1RF0A 1J1EC 3HD7A 4EI2A 3H1JE 3NMDA 2YO2A 1JY3P 3V4QA 3CMEP 2XV5A 2QJPC 1YBKA 4IOIH 2WPVB 1BE3E 3Q3DA 2FY8A 5KLIB 1BSNA 2Q3IA 5AVZB 3CMAP 1YITP 2Q3EA 2QJYB 2WSFH 1ZXGA 2QVAA 1HWTC 3A0BH 4D6TE 4H44B 2N1TC 2IYPA 1QEXA 2KI7B 2I1JA 1T3UA 4JQ0D 2YXRB 1M7LA 1K05A 2KLVA 3V2RA 4GODA 1X22A 5B5EH 1VQNP 3HRNA 1Q82Q 1GU4A 3M0DC 4H0LC 1BE3D 1L4AB 2FFDC 5CCHD 4L75A 5AW1B 4OGQD 3L73E 1RHZB 1X0TA 2OYHA 2QE7H 4Y99B 1M56D 3RK3C 5H2FE 1BE3J 1KB9I 4R4LA 3H32A 2KIKA 1VQOP 2QJKB 2ZVOB 2KXPB 3TSIA 3JCUE 3HD7C 2RN0A 1BCCG 3RBXA 5GTIE 3GW6A 1RH5B 3PLNA 4BWNA 3S1KA 3H1LE 4UB6H 3H1HG 1LWUB 1ZR4A 2BEQD 2J59M 1EQ7A 3L73D 3CXHI 2XU6A 4UB8H 3M9HA 2IDBA 1N7SB 3L73J 2WSEJ 2FBWC 4JPZB 2C9LY 2RH0A 3OJAB 3CCUP 1OVVA 3M0AA 4GKGA 1IFPA 2R32A 3H1LD 1Q86Q 2KUBA 2FXPA 3CCMP 1QX8A 1LTJA 1Z56A 3MP7B 1SFCB 2HFED 2MJZA 3TK1A 4NPDA 3H1LJ 1PIXA 3R4YA 1RQUA 3M9QA 1NTMK 2ZXEB 4B86A 1AV1A 3CCQP 2O1KA 2QA4P 1VF5B 2P7JA 3PP5A 1N73C 1RY3A 2DW3A 5AW8B 1J1EB 4IL6X 1QL2A 4M3LA 1M1JA 3H1HD 1M57D 3G4SP 2KS1A 1FE6A 2KYVA 3FGAD 3LIDA 1KFNA 1S72P 3CCRP 4KHXA 2QJPB 3H1HJ 3A3YB 3AE6C 2L91A 1SQXG 2POHA 3CCVP 2KLUA 1LTSC 2YKQA 1SQQK 3AEBC 3N7NA 4IL6H 2QM7A 1H0TA 1M8OB 1DD4A 2KSEA
chains in the Genus database with same CATH topology
2HODA 2JEEA 4ZKPA 3HTKA 3TNUB 2R3CA 1FBMA 1DEBA 2N1TB 3BVHA 3H32B 1NKNA 1KILB 3V5BA 3G3ZA 1FZAA 4WBAA 5AW6B 1GW3A 1VDFA 1KILD 1OXZA 3HE5A 1RF1C 1NAFA 1IFMA 1RE3A 5AVYB 1HGZA 1LTJC 1IO4A 3A7OA 3U1CA 4W7YA 1IFDA 2FFDB 5AW9B 1URQA 3II6A 4N78E 3P8CE 1HVVA 1IFIA 2GUVA 1GL2A 4WY4A 2WTYA 1HBWA 4ZKUA 1L0NK 3RK3B 4N3YB 3LW5H 3RK2C 1SQVK 1NKZB 2Z4EA 1JY2P 1X79B 1AFOA 1N7SA 5APXA 4JYBA 3RK3D 1HH0A 1ZLLA 1S9KE 2KOGA 3U59A 5CMZA 2E42A 3HUSB 1XTGB 1NH4A 4WB4A 1A02F 3VMXA 3MD0A 1FZCA 1RF1A 1ZV8A 3HD7B 2HPCA 3R2PA 3GHGA 3B5NB 1JCCA 5KLVK 1IK9A 1LT9C 3HD7D 1FOSF 1FU1A 3VYIA 5CHXA 1T2KC 1SQPK 4DZOA 5AW2B 1SFCA 2KB7P 1L4AC 5AVXB 1YTZT 5AVUB 4N78D 2Q7CA 3P8CD 1FJKA 2H8PD 5BU8B 2VRSA 4LGDE 1ZR2A 1FJPA 2M3BA 1N2DC 4Y99C 1OWAA 1LTTC 3L36A 2W6AA 1MUUA 3KYQA 3O8ZA 2OYIA 2WPQA 1NU1K 2IX7C 1JY3O 1DH3A 1KFMA 3L37A 2H7HA 3SWFA 2YNYA 1GZLA 5AVRB 2KP8A 1PFIA 1GDTA 1LT9A 4C7NB 3BATA 2O01H 5CCHA 2WSEH 2C0XA 1N7LA 2A45I 3HE4B 2O1JA 3B8EB 5BU5A 2Q9IA 1W2EA 2KSJA 3OAKA 1M1JB 1JMMA 1X8YA 1AQ5A 1FZFA 1IC2A 1LWUC 3V2PA 1RE3C 2IFMA 3V4WA 3I5CA 1G1IA 1FZGA 4EOTA 5CJ4A 3UIAA 1H88A 1LTAC 1GL2C 4WY4C 1T2KD 3L4FA 3CL3D 4IFMA 2P1JA 5AW0B 1L4AD 5APVA 3LIEA 1N73B 5APTA 1N7SC 1VPCA 5APQA 2GM4A 3TNUA 2N1TA 3WMM0 1NTKK 1YTZI 2NPSC 2YKOA 1KILA 4JF7A 1NHLA 3IFMA 1RF0C 2WPSA 1FZCC 1LTGC 4DOJA 2HODB 1LWUA 3GHGC 3HTKB 4XA4A 2HYNA 5APYA 1T3JA 1JY3N 1FOSE 1JOCA 2QM8A 4O9BA 5AVQB 1HTLC 1MV8A 3M0DA 2A45G 1SFCC 3KPEA 3V2QA 3EQ2A 3VMYA 1CI6B 2R5DA 1IJDB 2W6BA 4RESB 4AYCA 1JUNA 1IFNA 3VOPA 1H89A 4W7ZA 1URQB 1J1DB 2FYZA 1G2CB 1RE4A 1SLQA 2NPSA 2N9BA 1FDMA 5KJ7D 3A5TA 5AVVB 3M9BA 1FZEA 1HGVA 4AQRD 4GT1A 1RF0A 3RL0B 1URQD 5AVWB 2XZRA 1J1EC 2OYIC 1GD2E 4I1LA 4HYTB 2CPSA 1SP4A 3MTUE 2XNXA 4WY4D 2Q5UA 3HD7A 5KTBA 3VP8A 2YKPA 5CJ0A 3RL0D 1WT6A 3VP9A 3B5NA 3P7KA 5CCHC 3BRTB 3NMDA 2YO3A 2YO2A 2PP6A 1N7SD 3P32A 2YMYA 1RF1B 1JY3P 3V4QA 2CPBA 2WT7B 2XV5A 4JYCA 2C9NY 3P8MC 1CZQA 2E43A 1QL1A 1LTJB 5APUA 2J58A 2XDJA 1WRGA 2FXMA 3KQGA 1ZN5A 3EFGA 4I2LC 1JY2O 1YYCA 5AW5B 3T97A 4W80A 4LLHA 2Q3IA 5AVZB 1S9KD 3RK2B 2GUSA 1SFCD 3VTPC 1FZBA 2WSFH 4GIFA 2OYHC 1JTHA 1HWTC 3MGNA 3SWYA 3BASA 5CCGA 1KQLA 2JJLA 1LGHB 3RK2D 3V2NA 2N1TC 3TYYA 1KILC 3M91A 1G1JA 3HE4A 2I1JA 1T3UA 4HH2A 2OARA 2IPPA 1M7LA 1LT9B 2KLVA 5APWA 3V2RA 2R5BA 3HRNA 1GU4A 3M0DC 1L4AB 1SQBK 2FFDC 5AW4B 5AW7B 5CCHD 4OH8B 4XE5B 2WITA 5AW1B 1KZUB 3MIWA 1CSBA 3CI9A 2L5GB 3VN0A 2OYHA 4Y99B 1HJBA 2P2UA 2PAJA 3RK3C 1LTBC 1GK6A 2IFNA 2W27A 1FAVA 1RE4C 1N86A 3H32A 1JY2N 4IFFA 1HUCA 2P67A 3BRVB 1MFZA 3HUSC 1SVFA 3TSIA 3HD7C 1NWQA 3NXSA 3B5NC 3NFQA 3U1AA 2FFDA 3A2AA 3HE5B 2N1TD 2WPRA 1LWUB 5AVTB 4C7RA 1ZR4A 1SQXK 2H43A 1CI6A 1DX7A 2J59M 2Z5HA 1NO4A 2FKWB 1EQ7A 5KJ7A 3IR9A 1GL2B 2XU6A 3H6PA 4WY4B 1G2CA 1J2JB 3NTNA 3L35A 3M9HA 3HUSA 1CW5A 2A45H 1GL2D 2M8RA 1N7SB 1JNMA 5CCGC 1X9VA 2NPSB 1GTWA 5APSA 1FZCB 2C9LY 3OJAB 1A02J 2WWWA 2HPCB 3GHGB 2NPSD 3E1IA 3M0AA 4GKGA 4N6JA 2WT7A 3KDPB 1M1JC 2R32A 2WZ7A 2FYUK 3CLQA 1LTJA 1GW4A 5AVSB 1Z56A 2I1KA 1SFCB 2HFED 2ZFCA 2MJZA 3TK1A 3B5ND 2WSCH 5BVZA 3M9QA 1NTMK 2ZXEB 1NTZK 2HG5D 1NOHA 4B86A 3N4XA 3OA7A 4C46A 2O1KA 1JO5A 2P7JA 3PP5A 1N73C 1RY3A 4C7NA 2OYIB 5AW8B 1J1EB 4I6MC 3M06A 1QL2A 3VMZA 4IFDK 1JTHB 4M3LA 1M1JA 2C0WA 2XKMA 1L0LK 1GK4A 3C9IA 2Z5IA 4AUWA 2KYVA 4LC1A 3LIDA 2BASA 1KFNA 5CCGD 4KHXA 2LKMA 1LTIC 3A3YB 1E5WA 1L4AA 1MZ9A 2POHA 5AW3B 1JCDA 1LTSC 2YKQA 1GU5A 5KJ7C 1N73A 1T8ZA 2HLOA 1URQC 1SQQK 1J1DC 1XTCC 3MUDA 3N7NA 2QM7A 1IFJA 1H8AA 4EIJA 2OYHB 3RL0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1C A;  2JEE A;  4O9B A;  4ZKP A;  5BU5 A;  2FXM A;  4I1L A;  1NKN A;  3U1A A;  1IC2 A;  5KTB A;  2POH A;  3VP8 A;  1WT6 A;  4ZKU A;  3VP9 A;  4N3Y B;  1X79 B;  3C9I A;  3N7N A;  3HRN A;  5BVZ A;  4GIF A;  3OJA B;  3U59 A;  4N78 D;  3BAT A;  3BAS A;  3P8C D;  3N4X A;  5BU8 B; 
#chains in the Genus database with same CATH topology
 1KYO H;  3TNU B;  1SS1 A;  2N1T B;  1DEB A;  2AXT E;  1NKN A;  1VQ4 P;  2KK7 A;  2JP3 A;  3H25 A;  4WBA A;  3IN6 A;  2W8Z A;  4BRY B;  2ITA A;  4CPG A;  2ZYD A;  1IFM A;  1LTJ C;  4BXL A;  1IFD A;  2FFD B;  2LXC B;  5AW9 B;  1P84 E;  1URQ A;  1U7M A;  1Q7Y Q;  2GUV A;  4WY4 A;  1L0N E;  1EZV G;  3RK3 B;  3L75 E;  4PV1 B;  3KZI E;  1S9K E;  2E42 A;  1FZC A;  3HD7 B;  2BCC E;  3R2P A;  1EXI A;  2IZ0 A;  1JCC A;  2KZI A;  5C39 A;  1IK9 A;  1BGY G;  2A06 G;  1FU1 A;  3VYI A;  2WMM A;  4DZO A;  3L74 E;  5AW2 B;  4OGQ C;  2KB7 P;  4L73 A;  1P84 D;  2FYN C;  1FJK A;  3H1I G;  4PJ0 E;  4ZMD A;  1ZR2 A;  1L0N D;  1VQ6 P;  3PH0 A;  1LTT C;  1Q2N A;  3L75 D;  3CC7 P;  1OW7 A;  3AE4 C;  2V7Q J;  2YIU C;  4H13 D;  1NU1 E;  2OYI A;  1DH3 A;  1L0N J;  3SWF A;  1GZL A;  2Q1K A;  2KP8 A;  1GDT A;  3AEG C;  1ZME C;  2IBZ E;  2QRX A;  1YQ3 C;  1NAY A;  3OAK A;  1AQ5 A;  3L74 D;  2IFM A;  2QSI A;  5CJ4 A;  3L70 E;  1SQB E;  3CCS P;  3L74 J;  4WY4 C;  5KAF E;  3L4F A;  3CL3 D;  2P1J A;  3A0H H;  1NU1 D;  3LIE A;  1N73 B;  5TIS H;  5APT A;  5L8R J;  1L2P A;  3AEE C;  1NTK K;  1USD A;  1OMI A;  2R3S A;  2IBZ D;  3MHV A;  2WPS A;  1FZC C;  1NU1 J;  2HOD B;  1LWU A;  1PL5 A;  5KLV G;  1T3J A;  5K5G B;  2Y9Y A;  4O9B A;  2Q6Q A;  1OFC X;  3ZDM A;  1SQP G;  4HB1 A;  3KPE A;  3EQ2 A;  2PFX A;  2W83 C;  2R5D A;  3L70 D;  3ABV C;  2W6B A;  1EDI A;  3Q2Y A;  2FYZ A;  1JEK A;  3L70 J;  2OYI C;  3CX5 H;  4HYT B;  2K9J A;  2XNX A;  5E79 H;  1P84 I;  3BRT B;  2K88 A;  3P32 A;  2CPB A;  4JYC A;  2C9N Y;  2E43 A;  1LTJ B;  2FYU E;  3KQG A;  4ASV A;  1S2E A;  1JY2 O;  1YYC A;  2P10 A;  5AW5 B;  4LLH A;  3BCC E;  2GUS A;  3VTP C;  1KQF B;  1FDO A;  1W5C E;  1Y9B A;  3BAS A;  5CCG A;  3ITK A;  1YQ4 C;  4A7P A;  1M1K Q;  1KB9 E;  2ZAE B;  1VQ7 P;  3TGU E;  4OWF A;  1SQP D;  2OAR A;  2KS1 B;  1KC8 Q;  4PD4 H;  4OGQ B;  1KIL E;  1SQP J;  1SQB K;  5AW4 B;  2FYN B;  5AW7 B;  1KV4 A;  1EC5 A;  4OH8 B;  4XE5 B;  2WIT A;  3A0B E;  1CSB A;  3CI9 A;  2ZYA A;  1HJB A;  2P2U A;  2IYO A;  1LTB C;  2IBZ I;  3RBZ A;  2YIU B;  3AE1 C;  3CXH E;  2E76 C;  3WU2 H;  2W6J H;  1JY2 N;  1HUC A;  2P67 A;  3BRV B;  4BRY A;  1KB9 D;  3HUS C;  1SVF A;  3JC2 2;  1ZW0 A;  2YMK A;  1NWQ A;  2JO1 A;  2FFD A;  3B4S A;  5AVT B;  1DX7 A;  1BE3 G;  2FKW B;  2QG4 A;  4H13 C;  3H6P A;  4WY4 B;  3FX0 A;  3PJS K;  2AXC A;  1CW5 A;  3TDK A;  3CXH D;  1GL2 D;  4QMA A;  4NPF X;  4ASW A;  5CCG C;  3WUU A;  4UB6 E;  5APS A;  2GA1 A;  1FZC B;  1A02 J;  2WWW A;  1PGJ A;  1S1C X;  2WT7 A;  3KDP B;  2KNC B;  2FYU K;  3CLQ A;  1GW4 A;  1EDL A;  3B5N D;  1S5L E;  4U3F E;  1KMI Z;  1NTM E;  3L73 G;  4K35 A;  1NTZ K;  5KAI E;  3OA7 A;  5DJT B;  3IF4 A;  2H89 C;  1DEE G;  4TLF A;  3Q5S A;  3D6Z A;  1DIP A;  2RKL A;  2OYI B;  1OX3 A;  3H1J D;  1GMJ A;  3L71 E;  1Y47 A;  3VMZ A;  1JTH B;  2XKM A;  1L0L K;  2Z5I A;  1QVG O;  4AUW A;  3H1J J;  4LC1 A;  2NZ2 A;  3H1L G;  2LKM A;  4L76 A;  1MZ9 A;  4U3F D;  1NTM D;  1JCD A;  4L74 A;  1GU5 A;  3FWL A;  1N73 A;  1SQQ E;  4PV1 C;  4K3A A;  1XTC C;  4D6T D;  1IFJ A;  1H8A A;  4EIJ A;  3Q5P A;  4U3F J;  1NTM J;  2HOD A;  2D2C D;  2OQQ A;  2OTK E;  3L71 D;  3Q5R A;  4D6T J;  4YTP C;  3FWN A;  3G3Z A;  3C8V A;  2E75 D;  1GW3 A;  1VDF A;  1OXZ A;  3HE5 A;  3L71 J;  3RL0 g;  2E74 D;  1HGZ A;  1LT1 A;  1HVV A;  4RO0 A;  1GL2 A;  1KYO E;  1SQQ D;  1NKZ B;  2Z4E A;  2ZJS E;  1AFO A;  4WWI A;  2E76 B;  4JYB A;  2KOG A;  1SQQ J;  1YIJ P;  3PTZ A;  3HUS B;  4WB4 A;  1A02 F;  2K9J B;  1DD3 A;  2ZT9 D;  3MD0 A;  3GMA A;  1W2B O;  1HF9 A;  1VQK P;  1LT9 C;  1FOS F;  4HKZ H;  1T2K C;  1PPJ E;  5TJH A;  1YTZ T;  5AVU B;  4DT0 A;  5B66 H;  1PP9 E;  4EDF A;  3CPW O;  2VRS A;  4H13 B;  1KYO D;  1FC2 C;  1N2D C;  1AVY A;  2B87 B;  1OIP A;  1R5L A;  3KYQ A;  2IX7 C;  3WUT A;  3W68 A;  2Y9Z A;  2YNY A;  5AVR B;  1PFI A;  2SPZ A;  3BAT A;  5CCH A;  2WSE H;  3B71 A;  2C0X A;  3B8E B;  5H2F H;  3FXE A;  4H44 D;  4TT3 H;  4EYY Q;  3IAO A;  1FZF A;  1IC2 A;  1T6A A;  1FS0 E;  3V2P A;  1PPJ D;  3I5C A;  1FZG A;  1PP9 D;  4EOT A;  2AEF A;  2QEX P;  1OW6 A;  1H88 A;  1K73 Q;  1GL2 C;  5GTI H;  2PRR A;  1L0N G;  1PP9 J;  3L75 G;  5AW0 B;  1L4A D;  5APV A;  5APQ A;  1NTK E;  2GM4 A;  1NGM B;  2YKO A;  1YJN P;  1BSH A;  1LTG C;  4DOJ A;  3HTK B;  3SFE C;  5APY A;  3AE3 C;  3AE2 C;  4OVN F;  1R5S A;  2WSC J;  1HTL C;  4GOF A;  1NJI Q;  1MV8 A;  2A45 G;  3L74 G;  3AEF C;  3RGU A;  3A0H E;  3VMY A;  3AE7 C;  5TIS E;  1IJD B;  4AYC A;  1JUN A;  1H89 A;  1UIX A;  3A5T A;  2M3E A;  5AVV B;  1NTK D;  3I55 P;  1NU1 G;  4R4M A;  4I1L A;  4XFJ A;  1PGQ A;  1SP4 A;  3MTU E;  3H1K E;  2YKP A;  3RL0 D;  1WT6 A;  2KNC A;  3VP9 A;  2IBZ G;  5CCH C;  1NTK J;  1N7S D;  1KYO I;  3S9O A;  2WT7 B;  1CZQ A;  3CCL P;  1QL1 A;  2UWJ E;  3PHL A;  5APU A;  2XDJ A;  2W90 A;  1ZN5 A;  3EFG A;  3KHU A;  3JSV C;  1EDK A;  4I2L C;  3L70 G;  1SQB G;  4W80 A;  1S9K D;  2D2C C;  3QH9 A;  1SFC D;  3L75 J;  1JTH A;  3MGN A;  1OZH A;  2BCC D;  5DJU B;  3RK2 D;  2OYO A;  3V2N A;  3H1K D;  3TYY A;  3FXD A;  1G1J A;  3HE4 A;  2IPP A;  2E74 C;  2BCC J;  1LT9 B;  3H1K J;  5APW A;  2R5B A;  2AXT H;  4DJG A;  3LW5 J;  1KZU B;  3MIW A;  2YXQ B;  2L5G B;  3VN0 A;  1GK6 A;  2IFN A;  2W27 A;  3PRJ A;  1FAV A;  2ZT9 C;  4IFF A;  2V7Q H;  3V6I A;  1E79 H;  4PD4 E;  1BDD A;  3RK3 E;  3GLM A;  3A2A A;  3HE5 B;  2N1T D;  2WPR A;  3KZI H;  4C7R A;  1SQB D;  1SQX K;  2H43 A;  1CI6 A;  3G6E P;  1K8A Q;  3WU2 E;  1GL2 B;  3O6Q A;  1SQB J;  1G2C A;  1J2J B;  3BCC G;  3L35 A;  3HUS A;  4H0L D;  2A45 H;  1SQV E;  2M8R A;  2O01 J;  4MN4 C;  3C1L A;  1GTW A;  1YJW P;  1ZOY C;  1AQT A;  2NPS D;  5GTH H;  2ZYG A;  3S4R A;  2N9Y B;  5AVS B;  2I1K A;  3CWB E;  2B87 A;  2ZFC A;  3L72 E;  1NTZ E;  1AVO A;  5EFW B;  2HG5 D;  1MFT A;  1NOH A;  1JO5 A;  3T97 B;  3VMA A;  1VQL P;  3MUD C;  3M06 A;  1L0L E;  2C0W A;  3WUV A;  1GK4 A;  3C9I A;  1UII A;  3CX5 I;  2FYU D;  2BAS A;  2I8D A;  1LTI C;  1EZV I;  3GF7 A;  1E5W A;  3CWB D;  3MZW B;  1MKM A;  3L72 D;  3SFD C;  3BCC D;  2B89 A;  2FYU J;  2Y0D A;  4I7Z C;  1NTZ D;  2XND H;  2ZVN B;  2RMZ A;  4GOE A;  3CWB J;  1J1D C;  2OGU A;  2D2C B;  3L72 J;  3BCC J;  3TGU D;  5KKZ C;  3RL0 C;  5B5E E;  1NTZ J;  2JEE A;  2KZJ A;  3HTK A;  1FBM A;  4RKU J;  3CD6 P;  3H1J G;  4JBZ A;  1L0L D;  1ZP0 C;  2LXB A;  5AW6 B;  3TGU J;  3D70 A;  4YXD C;  2E74 B;  1KIL D;  1RF1 C;  3CC4 P;  3GF3 A;  1RE3 A;  5AVY B;  1L0L J;  1IO4 A;  3A7O A;  4W7Y A;  3II6 A;  3P8C E;  2WSF J;  1JMB A;  2CK3 H;  4U3F G;  2WTY A;  1NTM G;  4PD4 I;  4HJG H;  4ZKU A;  4N3Y B;  3RK2 C;  1SQV K;  5M1B A;  2IZ1 A;  1JY2 P;  4D6T G;  5APX A;  2ZT9 B;  1HH0 A;  1OVR A;  3EWK A;  3VMX A;  1VQM P;  2PGD A;  1U57 A;  1ZV8 A;  3L71 G;  2HPC A;  3GHG A;  3AEC C;  5KLV K;  3KXD A;  2R44 A;  4UB8 E;  1LP1 B;  2J5U A;  5CHX A;  1SQP K;  3D6Y A;  5AVX B;  2M0B A;  1KB9 H;  3P8C D;  2WVR A;  5BU8 B;  4LGD E;  3CCE P;  5CBN A;  1SQQ G;  3CCJ P;  2W6A A;  4WVZ A;  3O8Z A;  2WPQ A;  2OTJ P;  1KFM A;  3L37 A;  2HR3 A;  1NVO A;  2K9Y A;  1LT9 A;  4C7N B;  2G3A A;  3HE4 B;  2K37 A;  3TF5 A;  5B66 E;  2O1J A;  5BU5 A;  2Q9I A;  1YI2 P;  1JMM A;  1X8Y A;  3CXH H;  1RE3 C;  3V4W A;  1G1I A;  1JB0 J;  3G71 P;  3UIA A;  1LTA C;  2O01 N;  2E5T A;  2H88 C;  3WMM 0;  1YTZ I;  2NPS C;  1KIL A;  4JF7 A;  1NHL A;  1RF0 C;  3GHG C;  4XA4 A;  1IZN B;  1S5L X;  1WMK A;  2QM8 A;  1AJY A;  4IL6 E;  5AVQ B;  4ZNC A;  3USS A;  3V2Q A;  1PPJ G;  3I56 P;  1CI6 B;  4I7Z B;  1PP9 G;  1IFN A;  2M5A B;  2WQY C;  1TU3 F;  3O6Q B;  1J1D B;  1PGP A;  2V4H A;  3AEA C;  1G2C B;  1RE4 A;  2Y0E A;  2N9B A;  1FDM A;  5KJ7 D;  5KKZ B;  4GT1 A;  3RL0 B;  1URQ D;  5AVW B;  2XZR A;  1GD2 E;  2CPS A;  4WY4 D;  2Q5U A;  1S5L H;  5KTB A;  3VP8 A;  5CJ0 A;  1BCC E;  3B5N A;  3P7K A;  1VL2 A;  2YO3 A;  1S4X A;  3AE9 C;  5KAI H;  2PP6 A;  2YMY A;  1RF1 B;  3H1H E;  3P8M C;  2J58 A;  1WRG A;  2FXM A;  5CBO A;  1BDC A;  3T97 A;  1OVU A;  3GG2 A;  2JWA A;  3RK2 B;  3AED C;  1FZB A;  2AEJ A;  4GIF A;  2OYH C;  2WSS H;  2LR2 A;  3SWY A;  1KQL A;  2JJL A;  1LGH B;  1OW8 A;  1NTK G;  1KIL C;  1BCC D;  3M91 A;  4HH2 A;  2B9B A;  1BCC J;  3JCU H;  3K5B A;  1LJ2 A;  4KJM A;  3QWO C;  1PZQ A;  2PAJ A;  1PGO A;  2Y0C A;  1RE4 C;  1N86 A;  1KTM A;  1MFZ A;  2BCC G;  3H1K G;  4NPE A;  3NXS A;  3B5N C;  3NFQ A;  3U1A A;  1VQP P;  1JM0 A;  1SQX E;  1NYH A;  1Q81 Q;  1Y8A A;  4YXW H;  2Z5H A;  1NO4 A;  5KJ7 A;  1VQ5 P;  4H0L B;  3IR9 A;  4GDO A;  3NTN A;  3F89 A;  3D71 A;  1JNM A;  1X9V A;  2NPS B;  1USE A;  1M90 Q;  1LP1 A;  2E5Y A;  1LNQ A;  1KD1 Q;  2HPC B;  3GHG B;  3E1I A;  2E76 D;  4N6J A;  1M1J C;  3E7K A;  2WZ7 A;  1SQX D;  3CX5 E;  2WSC H;  3G9R A;  3EFF K;  1EZV E;  4Y28 J;  1U7J A;  5E79 E;  5BVZ A;  1SQX J;  3N4X A;  4C46 A;  3W67 A;  2E75 C;  4C7N A;  5GTH E;  4I6M C;  1IK7 A;  1VF5 D;  4IFD K;  1BGY E;  2A06 E;  2BEZ F;  5CCG D;  1YJ9 P;  1R8E A;  4YPC A;  3CX5 D;  1KQG B;  1L4A A;  3H1I E;  5AW3 B;  1EZV D;  5KJ7 C;  1T8Z A;  2HLO A;  3Q1M A;  1URQ C;  3MUD A;  2JKV A;  4KT0 J;  1P84 H;  2OYH B;  4ZKP A;  1SQV G;  2R3C A;  3BVH A;  3H32 B;  1KIL B;  3V5B A;  1FZA A;  1BGY D;  2A06 D;  2AEM A;  1NAF A;  3CC2 P;  1EXJ A;  2FYU G;  1AA0 A;  2OTL P;  1S3J A;  1BGY J;  2O3J A;  2M5A A;  3H1I D;  3U1C A;  3CWB G;  4N78 E;  3L72 G;  1IFI A;  5KLI C;  2K1A A;  2MKV A;  1HBW A;  1NTZ G;  1L0N K;  3LW5 H;  1YHQ P;  3H1I J;  2JR8 A;  2QJY C;  1X79 B;  1RQV A;  1N7S A;  4PJ0 H;  4PD4 D;  3RK3 D;  3SSU A;  1ZLL A;  3U59 A;  4RJT A;  4H44 C;  3TGU G;  5CMZ A;  1XTG B;  1NH4 A;  4PV1 D;  1RF1 A;  1ZRT E;  5KLV E;  1L0L G;  3B5N B;  1VQ8 P;  3HD7 D;  1SQP E;  1SFC A;  2P58 A;  2K3R A;  1L4A C;  4N78 D;  1D7M A;  2Q7C A;  2H8P D;  1FJP A;  2M3B A;  3SWK A;  1PV3 A;  4Y99 C;  1SQV D;  1OWA A;  3L36 A;  1MUU A;  3OW2 O;  2NRG A;  4Z1M H;  1NU1 K;  1JY3 O;  2H7H A;  2QJK C;  1SQV J;  5KAF H;  2O01 H;  1ZRT D;  5KLV D;  1N7L A;  2A45 I;  1VQ9 P;  1W2E A;  2KSJ A;  1M1J B;  1LWU C;  5KLV J;  1KN7 A;  1KQS O;  2JWD A;  1EDJ A;  3AE5 C;  2QIW A;  1FDI A;  1K9M Q;  1T2K D;  1QVF O;  4IFM A;  1KOR A;  1K04 A;  2E75 B;  2JDI H;  3F5H A;  1N7S C;  1VPC A;  3TNU A;  3AE8 C;  2B88 A;  2N1T A;  2ZXX A;  1H0T B;  3IFM A;  3E1R A;  2HYN A;  1JY3 N;  1FOS E;  1JOC A;  1HJ0 A;  3M0D A;  1SFC C;  4DCK A;  1QLE D;  4RES B;  2FXO A;  1N8R Q;  1Q90 D;  3VOP A;  4W7Z A;  1URQ B;  2G8Y A;  1SLQ A;  2NPS A;  1QGK B;  1VF5 C;  3M9B A;  1FZE A;  1HGV A;  4U7J A;  4AQR D;  1RF0 A;  1J1E C;  3HD7 A;  4EI2 A;  3H1J E;  3NMD A;  2YO2 A;  1JY3 P;  3V4Q A;  3CME P;  2XV5 A;  2QJP C;  1YBK A;  4IOI H;  2WPV B;  1BE3 E;  3Q3D A;  2FY8 A;  5KLI B;  1BSN A;  2Q3I A;  5AVZ B;  3CMA P;  1YIT P;  2Q3E A;  2QJY B;  2WSF H;  1ZXG A;  2QVA A;  1HWT C;  3A0B H;  4D6T E;  4H44 B;  2N1T C;  2IYP A;  1QEX A;  2KI7 B;  2I1J A;  1T3U A;  4JQ0 D;  2YXR B;  1M7L A;  1K05 A;  2KLV A;  3V2R A;  4GOD A;  1X22 A;  5B5E H;  1VQN P;  3HRN A;  1Q82 Q;  1GU4 A;  3M0D C;  4H0L C;  1BE3 D;  1L4A B;  2FFD C;  5CCH D;  4L75 A;  5AW1 B;  4OGQ D;  3L73 E;  1RHZ B;  1X0T A;  2OYH A;  2QE7 H;  4Y99 B;  1M56 D;  3RK3 C;  5H2F E;  1BE3 J;  1KB9 I;  4R4L A;  3H32 A;  2KIK A;  1VQO P;  2QJK B;  2ZVO B;  2KXP B;  3TSI A;  3JCU E;  3HD7 C;  2RN0 A;  1BCC G;  3RBX A;  5GTI E;  3GW6 A;  1RH5 B;  3PLN A;  4BWN A;  3S1K A;  3H1L E;  4UB6 H;  3H1H G;  1LWU B;  1ZR4 A;  2BEQ D;  2J59 M;  1EQ7 A;  3L73 D;  3CXH I;  2XU6 A;  4UB8 H;  3M9H A;  2IDB A;  1N7S B;  3L73 J;  2WSE J;  2FBW C;  4JPZ B;  2C9L Y;  2RH0 A;  3OJA B;  3CCU P;  1OVV A;  3M0A A;  4GKG A;  1IFP A;  2R32 A;  3H1L D;  1Q86 Q;  2KUB A;  2FXP A;  3CCM P;  1QX8 A;  1LTJ A;  1Z56 A;  3MP7 B;  1SFC B;  2HFE D;  2MJZ A;  3TK1 A;  4NPD A;  3H1L J;  1PIX A;  3R4Y A;  1RQU A;  3M9Q A;  1NTM K;  2ZXE B;  4B86 A;  1AV1 A;  3CCQ P;  2O1K A;  2QA4 P;  1VF5 B;  2P7J A;  3PP5 A;  1N73 C;  1RY3 A;  2DW3 A;  5AW8 B;  1J1E B;  4IL6 X;  1QL2 A;  4M3L A;  1M1J A;  3H1H D;  1M57 D;  3G4S P;  2KS1 A;  1FE6 A;  2KYV A;  3FGA D;  3LID A;  1KFN A;  1S72 P;  3CCR P;  4KHX A;  2QJP B;  3H1H J;  3A3Y B;  3AE6 C;  2L91 A;  1SQX G;  2POH A;  3CCV P;  2KLU A;  1LTS C;  2YKQ A;  1SQQ K;  3AEB C;  3N7N A;  4IL6 H;  2QM7 A;  1H0T A;  1M8O B;  1DD4 A;  2KSE A; 
#chains in the Genus database with same CATH homology
 2HOD A;  2JEE A;  4ZKP A;  3HTK A;  3TNU B;  2R3C A;  1FBM A;  1DEB A;  2N1T B;  3BVH A;  3H32 B;  1NKN A;  1KIL B;  3V5B A;  3G3Z A;  1FZA A;  4WBA A;  5AW6 B;  1GW3 A;  1VDF A;  1KIL D;  1OXZ A;  3HE5 A;  1RF1 C;  1NAF A;  1IFM A;  1RE3 A;  5AVY B;  1HGZ A;  1LTJ C;  1IO4 A;  3A7O A;  3U1C A;  4W7Y A;  1IFD A;  2FFD B;  5AW9 B;  1URQ A;  3II6 A;  4N78 E;  3P8C E;  1HVV A;  1IFI A;  2GUV A;  1GL2 A;  4WY4 A;  2WTY A;  1HBW A;  4ZKU A;  1L0N K;  3RK3 B;  4N3Y B;  3LW5 H;  3RK2 C;  1SQV K;  1NKZ B;  2Z4E A;  1JY2 P;  1X79 B;  1AFO A;  1N7S A;  5APX A;  4JYB A;  3RK3 D;  1HH0 A;  1ZLL A;  1S9K E;  2KOG A;  3U59 A;  5CMZ A;  2E42 A;  3HUS B;  1XTG B;  1NH4 A;  4WB4 A;  1A02 F;  3VMX A;  3MD0 A;  1FZC A;  1RF1 A;  1ZV8 A;  3HD7 B;  2HPC A;  3R2P A;  3GHG A;  3B5N B;  1JCC A;  5KLV K;  1IK9 A;  1LT9 C;  3HD7 D;  1FOS F;  1FU1 A;  3VYI A;  5CHX A;  1T2K C;  1SQP K;  4DZO A;  5AW2 B;  1SFC A;  2KB7 P;  1L4A C;  5AVX B;  1YTZ T;  5AVU B;  4N78 D;  2Q7C A;  3P8C D;  1FJK A;  2H8P D;  5BU8 B;  2VRS A;  4LGD E;  1ZR2 A;  1FJP A;  2M3B A;  1N2D C;  4Y99 C;  1OWA A;  1LTT C;  3L36 A;  2W6A A;  1MUU A;  3KYQ A;  3O8Z A;  2OYI A;  2WPQ A;  1NU1 K;  2IX7 C;  1JY3 O;  1DH3 A;  1KFM A;  3L37 A;  2H7H A;  3SWF A;  2YNY A;  1GZL A;  5AVR B;  2KP8 A;  1PFI A;  1GDT A;  1LT9 A;  4C7N B;  3BAT A;  2O01 H;  5CCH A;  2WSE H;  2C0X A;  1N7L A;  2A45 I;  3HE4 B;  2O1J A;  3B8E B;  5BU5 A;  2Q9I A;  1W2E A;  2KSJ A;  3OAK A;  1M1J B;  1JMM A;  1X8Y A;  1AQ5 A;  1FZF A;  1IC2 A;  1LWU C;  3V2P A;  1RE3 C;  2IFM A;  3V4W A;  3I5C A;  1G1I A;  1FZG A;  4EOT A;  5CJ4 A;  3UIA A;  1H88 A;  1LTA C;  1GL2 C;  4WY4 C;  1T2K D;  3L4F A;  3CL3 D;  4IFM A;  2P1J A;  5AW0 B;  1L4A D;  5APV A;  3LIE A;  1N73 B;  5APT A;  1N7S C;  1VPC A;  5APQ A;  2GM4 A;  3TNU A;  2N1T A;  3WMM 0;  1NTK K;  1YTZ I;  2NPS C;  2YKO A;  1KIL A;  4JF7 A;  1NHL A;  3IFM A;  1RF0 C;  2WPS A;  1FZC C;  1LTG C;  4DOJ A;  2HOD B;  1LWU A;  3GHG C;  3HTK B;  4XA4 A;  2HYN A;  5APY A;  1T3J A;  1JY3 N;  1FOS E;  1JOC A;  2QM8 A;  4O9B A;  5AVQ B;  1HTL C;  1MV8 A;  3M0D A;  2A45 G;  1SFC C;  3KPE A;  3V2Q A;  3EQ2 A;  3VMY A;  1CI6 B;  2R5D A;  1IJD B;  2W6B A;  4RES B;  4AYC A;  1JUN A;  1IFN A;  3VOP A;  1H89 A;  4W7Z A;  1URQ B;  1J1D B;  2FYZ A;  1G2C B;  1RE4 A;  1SLQ A;  2NPS A;  2N9B A;  1FDM A;  5KJ7 D;  3A5T A;  5AVV B;  3M9B A;  1FZE A;  1HGV A;  4AQR D;  4GT1 A;  1RF0 A;  3RL0 B;  1URQ D;  5AVW B;  2XZR A;  1J1E C;  2OYI C;  1GD2 E;  4I1L A;  4HYT B;  2CPS A;  1SP4 A;  3MTU E;  2XNX A;  4WY4 D;  2Q5U A;  3HD7 A;  5KTB A;  3VP8 A;  2YKP A;  5CJ0 A;  3RL0 D;  1WT6 A;  3VP9 A;  3B5N A;  3P7K A;  5CCH C;  3BRT B;  3NMD A;  2YO3 A;  2YO2 A;  2PP6 A;  1N7S D;  3P32 A;  2YMY A;  1RF1 B;  1JY3 P;  3V4Q A;  2CPB A;  2WT7 B;  2XV5 A;  4JYC A;  2C9N Y;  3P8M C;  1CZQ A;  2E43 A;  1QL1 A;  1LTJ B;  5APU A;  2J58 A;  2XDJ A;  1WRG A;  2FXM A;  3KQG A;  1ZN5 A;  3EFG A;  4I2L C;  1JY2 O;  1YYC A;  5AW5 B;  3T97 A;  4W80 A;  4LLH A;  2Q3I A;  5AVZ B;  1S9K D;  3RK2 B;  2GUS A;  1SFC D;  3VTP C;  1FZB A;  2WSF H;  4GIF A;  2OYH C;  1JTH A;  1HWT C;  3MGN A;  3SWY A;  3BAS A;  5CCG A;  1KQL A;  2JJL A;  1LGH B;  3RK2 D;  3V2N A;  2N1T C;  3TYY A;  1KIL C;  3M91 A;  1G1J A;  3HE4 A;  2I1J A;  1T3U A;  4HH2 A;  2OAR A;  2IPP A;  1M7L A;  1LT9 B;  2KLV A;  5APW A;  3V2R A;  2R5B A;  3HRN A;  1GU4 A;  3M0D C;  1L4A B;  1SQB K;  2FFD C;  5AW4 B;  5AW7 B;  5CCH D;  4OH8 B;  4XE5 B;  2WIT A;  5AW1 B;  1KZU B;  3MIW A;  1CSB A;  3CI9 A;  2L5G B;  3VN0 A;  2OYH A;  4Y99 B;  1HJB A;  2P2U A;  2PAJ A;  3RK3 C;  1LTB C;  1GK6 A;  2IFN A;  2W27 A;  1FAV A;  1RE4 C;  1N86 A;  3H32 A;  1JY2 N;  4IFF A;  1HUC A;  2P67 A;  3BRV B;  1MFZ A;  3HUS C;  1SVF A;  3TSI A;  3HD7 C;  1NWQ A;  3NXS A;  3B5N C;  3NFQ A;  3U1A A;  2FFD A;  3A2A A;  3HE5 B;  2N1T D;  2WPR A;  1LWU B;  5AVT B;  4C7R A;  1ZR4 A;  1SQX K;  2H43 A;  1CI6 A;  1DX7 A;  2J59 M;  2Z5H A;  1NO4 A;  2FKW B;  1EQ7 A;  5KJ7 A;  3IR9 A;  1GL2 B;  2XU6 A;  3H6P A;  4WY4 B;  1G2C A;  1J2J B;  3NTN A;  3L35 A;  3M9H A;  3HUS A;  1CW5 A;  2A45 H;  1GL2 D;  2M8R A;  1N7S B;  1JNM A;  5CCG C;  1X9V A;  2NPS B;  1GTW A;  5APS A;  1FZC B;  2C9L Y;  3OJA B;  1A02 J;  2WWW A;  2HPC B;  3GHG B;  2NPS D;  3E1I A;  3M0A A;  4GKG A;  4N6J A;  2WT7 A;  3KDP B;  1M1J C;  2R32 A;  2WZ7 A;  2FYU K;  3CLQ A;  1LTJ A;  1GW4 A;  5AVS B;  1Z56 A;  2I1K A;  1SFC B;  2HFE D;  2ZFC A;  2MJZ A;  3TK1 A;  3B5N D;  2WSC H;  5BVZ A;  3M9Q A;  1NTM K;  2ZXE B;  1NTZ K;  2HG5 D;  1NOH A;  4B86 A;  3N4X A;  3OA7 A;  4C46 A;  2O1K A;  1JO5 A;  2P7J A;  3PP5 A;  1N73 C;  1RY3 A;  4C7N A;  2OYI B;  5AW8 B;  1J1E B;  4I6M C;  3M06 A;  1QL2 A;  3VMZ A;  4IFD K;  1JTH B;  4M3L A;  1M1J A;  2C0W A;  2XKM A;  1L0L K;  1GK4 A;  3C9I A;  2Z5I A;  4AUW A;  2KYV A;  4LC1 A;  3LID A;  2BAS A;  1KFN A;  5CCG D;  4KHX A;  2LKM A;  1LTI C;  3A3Y B;  1E5W A;  1L4A A;  1MZ9 A;  2POH A;  5AW3 B;  1JCD A;  1LTS C;  2YKQ A;  1GU5 A;  5KJ7 C;  1N73 A;  1T8Z A;  2HLO A;  1URQ C;  1SQQ K;  1J1D C;  1XTC C;  3MUD A;  3N7N A;  2QM7 A;  1IFJ A;  1H8A A;  4EIJ A;  2OYH B;  3RL0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...