3VP8A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
75
structure length
75
Chain Sequence
b'SVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General transcriptional corepressor TUP1
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 35
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp8A00
3VP9A 5BU5A 2JEEA 2POHA 3U59A 4I1LA 5BU8B 3P8CD 5KTBA 4ZKPA 4N3YB 3U1AA 5BVZA 3N7NA 2FXMA 1NKNA 4O9BA 3BASA 1WT6A 1IC2A 4ZKUA 3BATA 3OJAB 4N78D 4GIFA 3N4XA 3C9IA 3U1CA 1X79B 3HRNA 3VP8A
chains in the Genus database with same CATH superfamily
1IFDA 3KDPB 2PAJA 2E43A 2FFDB 5CJ0A 4JBZA 4WVZA 5H2FE 5CBNA 1T6AA 1SFCD 3CPWO 2HPCA 2E76B 2E5YA 3R4YA 2YKOA 4OVNF 1KILD 1GL2B 1QEXA 5BU8B 1NTKJ 3BRTB 2OQQA 1M1KQ 3CX5I 3AE9C 2KNCB 2YKPA 3QWOC 1YQ3C 2WSFJ 3TGUD 3JSVC 1NTZD 3HUSA 2I1JA 2FYUK 3H1HD 3L72E 1RF0C 3CC7P 4PD4D 2WSCJ 4RJTA 5BU5A 2M8RA 1NO4A 3L73E 4HB1A 1SQPD 3SWKA 3JCUH 1HUCA 1WT6A 3GF7A 2ZYAA 4GOEA 1YTZI 3WU2H 1EZVI 1JMBA 3UIAA 1XTGB 1S1CX 2FXOA 2KI7B 1M90Q 2HR3A 2O01H 1DIPA 3CWBE 2N9BA 3TNUA 2E76D 1QVFO 4I2LC 5APTA 2OGUA 5TISE 1H8AA 1KFMA 5B5EH 3HUSC 1KQLA 1GL2D 4WB4A 1PP9J 1X8YA 5KLVJ 1WMKA 3TDKA 3CCRP 4KJMA 1BE3D 3RK3B 1L0NJ 1JCCA 3P8CD 1SQQJ 2QA4P 3CCJP 1RF1C 1KORA 3B5NC 4NPEA 1YTZT 2OTJP 2NPSC 4U7JA 1JY2P 3CWBG 2G3AA 3PH0A 2ZYDA 3L75D 2IFNA 2W6AA 5CCHA 3U59A 3L4FA 4H0LC 5AVYB 2IBZD 2KS1B 1QGKB 5APWA 2YO2A 4H13B 2FYUE 1IFMA 4PJ0H 4L73A 1X79B 3VP8A 2Y9ZA 2XDJA 1LP1A 1GDTA 2R3SA 5DJUB 1SQVD 1KC8Q 2W90A 1YI2P 4EYYQ 3WUTA 2OARA 1URQB 1SQXJ 1L0LG 5CCHC 2WVRA 3IN6A 2DW3A 3V2PA 3CX5H 3L72J 2FXMA 4C7NB 3S1KA 3V5BA 1HGVA 3E1IA 2W8ZA 2N1TB 1JTHB 1GZLA 1YITP 3L73J 2A06D 2B89A 3V6IA 2UWJE 1GW3A 1VQ6P 1RY3A 3Q3DA 5E79E 1FE6A 4GDOA 4L74A 3SSUA 3GHGC 4ZKPA 3FGAD 1VQ8P 3HD7B 2BEQD 2FKWB 1FC2C 1ZP0C 1GL2C 1KB9H 1RE4C 3BATA 3SWFA 2IBZI 1HJ0A 1GK6A 2N9YB 5KKZC 3AEEC 1U7JA 4IFMA 1URQD 3NMDA 3KZIE 2C9LY 4N6JA 4BXLA 3VMAA 1GTWA 2Z5IA 2KUBA 2XV5A 2MKVA 3H1LD 4LGDE 2BCCG 3I55P 2GA1A 2IYOA 1EDLA 3L70G 3AEBC 2N1TD 3F5HA 2Q3IA 1Q82Q 3HE5A 1JY3N 1NU1K 2YKQA 4NPDA 3HD7D 1OVVA 3RL0g 1UIXA 2QIWA 1KTMA 3VP9A 1VDFA 3VMZA 2WSFH 2FYUJ 1LWUA 1FZBA 1GK4A 1RH5B 2Z5HA 1FZCC 4OH8B 1T2KD 1VQNP 2WSSH 2Y0CA 1NAYA 4U3FD 1A02F 2WSCH 1AJYA 3CCEP 1N86A 3C9IA 5KLIC 3O6QA 4WY4A 1LTIC 3ITKA 2KYVA 3MUDC 3M9BA 1LTJC 3FWLA 1AVYA 1SS1A 2JKVA 2B88A 1QX8A 1P84I 3PJSK 5CJ4A 4K3AA 1PGQA 4IL6E 1SQBD 1S5LE 3RK2B 2C0XA 3RBZA 2FYNC 1FS0E 3KYQA 2QG4A 1LTAC 3CLQA 1URQC 4W7YA 1U7MA 1XTCC 3EWKA 1N73B 2HLOA 1SQPK 1NU1E 4D6TE 1Y9BA 4JF7A 1GU4A 1N8RQ 3H1KE 1FOSF 2P58A 2V7QJ 1JO5A 1OVRA 3H1JD 3O8ZA 2G8YA 3EFGA 5C39A 3NTNA 5H2FH 2KZJA 1BCCJ 3I5CA 5B66E 1L4AB 4Y99B 1YJ9P 1USDA 1LT9A 2ZXXA 4GOFA 3RK2D 3VMXA 1VQ4P 1NU1G 4D6TG 4L76A 5CCGA 3L74E 3Q5SA 4LC1A 2O1KA 1QLED 2YO3A 3TF5A 2WPSA 1LTTC 2E74C 2WSEJ 4A7PA 1JUNA 2HPCB 1KILE 2P10A 2PGDA 4I7ZB 4ASWA 3QH9A 1NGMB 4C46A 2HODA 1S9KD 1NTZE 1D7MA 1CW5A 3HRNA 3H1HE 3L74G 3BCCD 2FBWC 3H1ID 1NKZB 1OW8A 4PD4E 1R5LA 5CCGC 3M91A 1L4AD 2KK7A 3CXHI 3Q5PA 2H43A 2XU6A 2QJPB 1Q81Q 3AEDC 1SQPE 3LIDA 3L71D 5TISH 2QJKC 3AEAC 3CX5D 3AE6C 3U1CA 1N7SA 2HG5D 1M1JA 1P84H 1DEEG 2AEJA 2ZAEB 4K35A 3TGUG 1NTZG 1EQ7A 3H1HG 4GT1A 3OA7A 3TNUB 2ZT9B 4B86A 3G71P 1VQ9P 2IZ1A 1OW7A 1FJKA 3CL3D 1HWTC 1SQPG 2QRXA 1NWQA 3T97A 1KB9D 1EZVD 4JYCA 2K3RA 3RL0B 3P8CE 1Q90D 3H1KJ 2YIUB 4ZKUA 2W6JH 3B8EB 1N7SC 4JPZB 2Y0EA 1RF0A 2Z4EA 3RK2C 1DEBA 2I8DA 4KHXA 2M5AB 2PP6A 1RHZB 1NTMD 1CI6A 1U57A 5GTHE 3LIEA 1BE3G 3L74J 1OVUA 1ZRTD 2Q5UA 3H32A 3MHVA 1H0TA 5AVQB 2ZT9D 1VF5C 1L0LK 3N7NA 1SQVE 3SFEC 2WQYC 3L36A 2P67A 3GW6A 3L75G 1YJNP 3RL0D 2Q7CA 5AVVB 4AYCA 2R5BA 2FXPA 3CMAP 2H8PD 3HE4B 2WPRA 1RF1A 1KB9I 3B5NA 2CK3H 2NPSA 1MUUA 3M0AA 2A06E 1SQVG 1SQPJ 3G9RA 1ZMEC 3CXHH 2YMYA 3U1AA 1ZOYC 3KZIH 1JEKA 1ZN5A 4I7ZC 2V7QH 4DJGA 1G2CA 1PP9D 2IPPA 3K5BA 2JO1A 1KILA 2QVAA 2XNXA 4YTPC 1L0ND 2FY8A 1SQQD 5APQA 2WMMA 3Q1MA 2A06G 1ZXGA 3H1LE 1K05A 1YYCA 1PZQA 1JB0J 4LLHA 4CPGA 3AEFC 2WT7A 2KIKA 3V2NA 1L0LE 5APXA 1BGYD 1FU1A 2E42A 4PV1B 2WSEH 2W27A 1Y8AA 1SFCC 1ZV8A 1CSBA 1KQSO 2O01N 2KOGA 4DCKA 1KILC 1K73Q 3AE2C 1NH4A 1H88A 5AW5B 3GHGA 5APVA 3H1LG 5KAFE 3RK3D 1LWUB 1W2EA 1PGJA 1GL2A 1AFOA 1RE4A 4U3FE 1YHQP 3A7OA 2A45I 1JNMA 4NPFX 2KNCA 3D70A 1SQXD 2IYPA 2GUSA 4N3YB 2QJYB 3KQGA 3GLMA 4JQ0D 1IJDB 3L72D 4IL6H 2YMKA 4WY4B 1KYOE 1S5LH 1FJPA 1HTLC 2FFDC 3D71A 5APSA 3L73D 4N78E 5AVXB 4H13D 4PV1D 1E79H 1E5WA 2OYHB 1OXZA 3H6PA 3G6EP 2M0BA 2BCCE 2E76C 5K5GB 3ABVC 4U3FG 3L70E 1AVOA 4ZMDA 3CCQP 1BSNA 4DZOA 3CWBJ 3V2QA 2RMZA 1KZUB 2QSIA 1QVGO 5AW9B 4H44B 1T8ZA 2KZIA 1KQFB 1AQ5A 3CMEP 2NRGA 1PV3A 2D2CB 2KSEA 1J1DB 3WU2E 1FZCA 3G3ZA 1JCDA 1P84D 3CC2P 1IZNB 3A0HH 5EFWB 2BEZF 5B66H 1JY2N 4WY4D 1SQBG 1H89A 1T3UA 3H1LJ 3M9HA 1RQVA 3AE4C 4IL6X 2OYIB 1NJIQ 1S5LX 3MUDA 1LTJA 1NYHA 4YXWH 1L0LJ 2QE7H 4Z1MH 2O1JA 2E75B 3KPEA 1VQOP 3M0DC 3TSIA 3AE5C 1LT9B 1GMJA 1KMIZ 1BSHA 2K9JB 2IX7C 2FYUD 1KV4A 3RK3C 4H44D 4WBAA 4OGQB 3F89A 4TT3H 2WZ7A 3GMAA 2WITA 5KAIH 3H1JG 1FDIA 1GW4A 4PD4H 1URQA 1Z56A 1OIPA 1NTMK 1ZR4A 2IZ0A 2OTLP 2QEXP 3BRVB 2OYOA 1EC5A 5KJ7D 3V4WA 4BRYB 1S9KE 2A45H 3FWNA 1J1EB 2ZJSE 2HODB 1FOSE 4H13C 4PV1C 1QL1A 1M7LA 3H1IE 2N1TA 3H25A 2E75D 3EFFK 4HH2A 3V2RA 1K9MQ 3L71E 4RKUJ 3S4RA 2BCCJ 1NTZK 3CX5E 3HD7A 3L70J 3MIWA 4XFJA 1SVFA 1AV1A 4OGQD 1RQUA 4EI2A 1K8AQ 1M1JB 1X0TA 1DD3A 3LW5J 1KQGB 3CXHD 3H1IG 3HTKB 3B71A 2NZ2A 2KSJA 2N1TC 1A02J 2RH0A 3NXSA 2V4HA 2Y0DA 3L71G 1EZVE 3AE7C 3T97B 2Q3EA 2OYHC 4OWFA 4YXDC 2SPZA 3HD7C 5GTHH 1BCCD 4XA4A 1FDMA 4IFFA 2O3JA 3TK1A 3CC4P 3BASA 3IR9A 1NTME 4QMAA 1IO4A 3FXDA 1T2KC 4UB8E 3CCUP 3CCSP 1FBMA 3VTPC 2M3EA 2C9NY 1JY3O 2B87A 3E1RA 2JJLA 1EZVG 5CHXA 2RKLA 1BDCA 2JEEA 2W6BA 4Y28J 3PTZA 3AE8C 1KD1Q 1NAFA 4EDFA 1H0TB 5AVRB 5AW4B 5KJ7C 1M8OB 1MKMA 1IK7A 3TGUE 2GM4A 1EXIA 2P1JA 3CCLP 4HYTB 4W7ZA 2OYIC 3HUSB 1NTMG 3G4SP 4I6MC 3Q5RA 2Y9YA 1LTGC 2E75C 1KN7A 1SQVK 5DJTB 3H1IJ 2JP3A 1ZW0A 1LGHB 1HH0A 3AE1C 1RF1B 2QM8A 4OGQC 3B5NB 1SQXK 1FZFA 1NKNA 1MFZA 2YXRB 1PGOA 4H0LB 1MV8A 2YNYA 1G1IA 1N73A 1PFIA 2JDIH 1VQLP 1NU1J 4D6TJ 1ZR2A 2AXTE 3RBXA 1BE3E 1IFPA 1DD4A 3L37A 1L2PA 5L8RJ 3H1KD 4UB6E 1Q2NA 3N4XA 3Q2YA 2LKMA 1W2BO 2BASA 2B9BA 3L75E 4RO0A 3M06A 1L4AA 2I1KA 1MFTA 1NVOA 4WWIA 1IK9A 2IBZE 3VN0A 1BGYE 2L5GB 1PP9G 5KAFH 1VPCA 1N73C 1NTMJ 1EDKA 1RE3A 3L74D 4HKZH 1M56D 4L75A 1L0NG 1SQQG 4H0LD 4RESB 1NTKD 1LP1B 1T3JA 2Q6QA 3GHGB 3ZDMA 2E5TA 3RK3E 5M1BA 1KYOH 3SFDC 2IBZG 1BGYG 1L4AC 1SQXE 3P32A 4Y99C 5E79H 3TGUJ 1NTZJ 4O9BA 3H1HJ 5KKZB 5AW7B 1M57D 4M3LA 1VQMP 3MZWB 1VL2A 2ZYGA 3AECC 3C1LA 4ZNCA 1S2EA 1RE3C 5CCHD 3A0BE 3TYYA 1HJBA 3LW5H 1K04A 5AW1B 1S4XA 2M3BA 1VQPP 1FAVA 1SQXG 1SFCA 4R4MA 2KB7P 1PPJD 4GKGA 3FXEA 5KLVD 2PRRA 1LTBC 2RN0A 3L72G 2L91A 2ITAA 2R5DA 2ZFCA 4C7RA 1PGPA 3BVHA 1SQBK 3IFMA 5AVSB 3L73G 1BE3J 1P84E 1OW6A 1IFIA 1FZCB 2QJPC 3MTUE 3D6YA 1OZHA 1YQ4C 5AW8B 2XKMA 3FX0A 2OTKE 1BDDA 1IFNA 5KLIB 1UIIA 1OFCX 3L75J 3CCVP 2M5AA 5GTIE 3HE5B 2XZRA 2FFDA 1LTJB 2IDBA 1BGYJ 1Q86Q 1JM0A 2ZT9C 2R32A 1PIXA 1JY3P 3PP5A 3NFQA 4PD4I 4BWNA 3S9OA 2J59M 1OX3A 3WUVA 1AA0A 2CPSA 3RL0C 3MP7B 1QL2A 1SQVJ 3AE3C 2YIUC 3P7KA 3PHLA 1JOCA 2FYNB 2PFXA 5TJHA 3A5TA 3IF4A 3O6QB 1X9VA 1HGZA 4GODA 3II6A 2HYNA 2QM7A 3L35A 1YIJP 2WPVB 4I1LA 2FYUG 3HE4A 4AQRD 3RGUA 3V4QA 2KXPB 2AEMA 5AVTB 1IC2A 1SQBE 3OAKA 3CWBD 1YJWP 3CD6P 1X22A 1EXJA 3JCUE 3M0DA 1N2DC 1FZEA 4AUWA 3VOPA 5AW2B 3D6ZA 4KT0J 2ZVOB 1MZ9A 3CXHE 2R44A 3CCMP 3B4SA 5B5EE 3W67A 2E74B 1LTSC 3H1JE 2AXCA 1DX7A 3C8VA 2P2UA 3GG2A 4UB8H 4R4LA 1AQTA 2KS1A 1L0LD 1BCCE 2P7JA 1FDOA 4EOTA 2HFED 2R3CA 1LJ2A 5CMZA 2D2CD 1HVVA 3W68A 4YPCA 3PRJA 2K9YA 2POHA 2QJKB 2FYZA 2B87B 1VQ7P 4U3FJ 1FZAA 3R2PA 3GF3A 4PJ0E 2W83C 1BCCG 2KLVA 2E74D 2C0WA 2WWWA 5AVWB 4C7NA 3BCCE 2VRSA 1EDIA 1JTHA 2AEFA 1KYOD 4JYBA 3KXDA 1R5SA 1NTKK 2JR8A 2H89C 3PLNA 2OYHA 1OMIA 4N78D 1VQ5P 4HJGH 2WPQA 3OW2O 2BCCD 5CBOA 1LWUC 5CCGD 1SQBJ 3L70D 1N7SB 5AVZB 2H7HA 2AXTH 1WRGA 3E7KA 2LR2A 3VMYA 3BCCG 1N7LA 2QJYC 2Q1KA 4UB6H 1LT1A 4WY4C 1VQKP 5BVZA 2ZXEB 2LXBA 3VYIA 1KB9E 2O01J 1SP4A 3A2AA 2JWAA 5KJ7A 1VF5B 1ZLLA 2J58A 4IFDK 3H1JJ 2OYIA 3AEGC 3WMM0 1USEA 5KLVK 1JY2O 4ASVA 2K88A 3A0HE 4H44C 3CI9A 1YBKA 1L0NK 1SQQK 3OJAB 5AVUB 1N7SD 1CI6B 4TLFA 4DOJA 2D2CC 3P8MC 1J1DC 2K9JA 1KYOI 1TU3F 2K1AA 1JMMA 1DH3A 5AW6B 1ZRTE 1NOHA 5AW3B 4MN4C 1HBWA 3I56P 4W80A 3IAOA 3H1KG 3H32B 4XE5B 1LNQA 2IFMA 1W5CE 2KLUA 1NTKE 3USSA 1S72P 1Y47A 5AW0B 2YXQB 3A0BH 4BRYA 1VF5D 1EDJA 1NHLA 1R8EA 2Q9IA 1HF9A 3MGNA 3SWYA 2XNDH 1GD2E 3MD0A 4IOIH 3JC22 3BCCJ 1LT9C 2GUVA 3EQ2A 5KAIE 1OWAA 2J5UA 5APUA 2JWDA 2WTYA 2ZVNB 5KTBA 1NTKG 2NPSB 3L71J 1SLQA 3M9QA 4DT0A 2LXCB 4GIFA 1FZGA 2KP8A 1PL5A 1GU5A 1PP9E 1PPJE 1G1JA 1SFCB 5KLVE 1G2CB 3HTKA 1J1EC 1NU1D 3A3YB 4D6TD 1KILB 1IFJA 1L0NE 1SQQE 5APYA 4EIJA 2H88C 1S3JA 1J2JB 5GTIH 1Q7YQ 3WUUA 2A45G 1CZQA 1KFNA 3KHUA 2WT7B 2MJZA 3B5ND 2CPBA 2NPSD 1PPJG 2K37A 5KLVG 1M1JC
chains in the Genus database with same CATH topology
3RK2D 1IFDA 3KDPB 3KPEA 3VMXA 1LTJB 2PAJA 2E43A 3M0DC 3TSIA 1LT9B 5CCGA 2FFDB 2R32A 5CJ0A 1JY3P 4LC1A 3PP5A 2IX7C 2O1KA 3NFQA 3RK3C 2J59M 4WBAA 2YO3A 1SFCD 2HPCA 2WPSA 2CPSA 1LTTC 3RL0C 1QL2A 2WZ7A 2YKOA 1KILD 2WITA 1JUNA 3P7KA 1GL2B 5BU8B 2HPCB 3BRTB 1GW4A 1JOCA 1URQA 1Z56A 2YKPA 1NTMK 3A5TA 4C46A 1X9VA 1ZR4A 3HUSA 2HODA 2I1JA 1S9KD 3BRVB 2FYUK 1HGZA 5KJ7D 3V4WA 1RF0C 1S9KE 2A45H 1J1EB 1CW5A 3HRNA 2HODB 1FOSE 1QL1A 3II6A 2HYNA 2QM7A 1NKZB 3L35A 5BU5A 1M7LA 2M8RA 1NO4A 4I1LA 5CCGC 3M91A 2N1TA 1L4AD 3HE4A 2H43A 2XU6A 4AQRD 3V4QA 3LIDA 1HUCA 1WT6A 4HH2A 3V2RA 5AVTB 1IC2A 1YTZI 3OAKA 3U1CA 3UIAA 1NTZK 1XTGB 1N7SA 3HD7A 2HG5D 3MIWA 1M1JA 1SVFA 2O01H 2N9BA 3TNUA 3M0DA 4I2LC 5APTA 1H8AA 1M1JB 1EQ7A 1KFMA 1N2DC 3HUSC 1FZEA 4GT1A 1KQLA 4AUWA 3OA7A 3TNUB 1GL2D 4WB4A 1X8YA 3VOPA 3HTKB 5AW2B 4B86A 1MZ9A 1FJKA 2KSJA 3CL3D 3RK3B 1HWTC 2N1TC 1JCCA 3P8CD 1A02J 1NWQA 3T97A 3NXSA 4JYCA 3RL0B 3P8CE 1LTSC 2OYHC 1RF1C 1DX7A 4ZKUA 3B5NC 1YTZT 2P2UA 2NPSC 1JY2P 3B8EB 1N7SC 3HD7C 1RF0A 2Z4EA 2IFNA 3RK2C 1DEBA 4KHXA 2W6AA 4XA4A 5CCHA 2PP6A 3U59A 3L4FA 2FFDA 5AVYB 1FDMA 4IFFA 3TK1A 1CI6A 2P7JA 4EOTA 2HFED 3BASA 2R3CA 3IR9A 5APWA 2YO2A 1IO4A 1T2KC 1IFMA 3LIEA 5CMZA 1FBMA 3VTPC 1X79B 3VP8A 2C9NY 1HVVA 1JY3O 2XDJA 2JJLA 5CHXA 2Q5UA 3H32A 2JEEA 2POHA 2W6BA 2FYZA 1GDTA 5AVQB 1L0LK 3N7NA 1NAFA 1FZAA 3R2PA 3L36A 2P67A 5AVRB 5AW4B 5KJ7C 2OARA 1URQB 2KLVA 2GM4A 3RL0D 2Q7CA 2P1JA 2C0WA 4HYTB 4W7ZA 2WWWA 5CCHC 2OYIC 5AVWB 3HUSB 5AVVB 3V2PA 4C7NA 4I6MC 2VRSA 1JTHA 2FXMA 4AYCA 1LTGC 4C7NB 2R5BA 1SQVK 3V5BA 1HGVA 3E1IA 4JYBA 2H8PD 2N1TB 1NTKK 3HE4B 1JTHB 1GZLA 2WPRA 2OYHA 1RF1A 4N78D 3B5NA 1GW3A 2NPSA 1MUUA 3M0AA 2WPQA 1RY3A 1HH0A 1LGHB 1LWUC 1RF1B 2QM8A 3GHGC 5CCGD 3B5NB 4ZKPA 2YMYA 3U1AA 1SQXK 1N7SB 5AVZB 3HD7B 2H7HA 2FKWB 1FZFA 1NKNA 1MFZA 1WRGA 1GL2C 1ZN5A 1RE4C 3VMYA 3BATA 3SWFA 1N7LA 1MV8A 2YNYA 1G1IA 1G2CA 1N73A 1GK6A 2IPPA 1PFIA 4WY4C 1KILA 4IFMA 1URQD 3NMDA 1ZR2A 2C9LY 2XNXA 5BVZA 4N6JA 2ZXEB 3VYIA 5APQA 1GTWA 3L37A 1SP4A 2Z5IA 3A2AA 2XV5A 4LGDE 3N4XA 5KJ7A 2LKMA 1YYCA 1ZLLA 2J58A 2BASA 4IFDK 4LLHA 2N1TD 2OYIA 3M06A 2WT7A 3WMM0 3V2NA 5KLVK 1L4AA 1JY2O 2I1KA 2Q3IA 5APXA 3HE5A 1IK9A 1JY3N 1FU1A 1NU1K 2YKQA 2E42A 2WSEH 3CI9A 3VN0A 2W27A 1L0NK 2L5GB 1SQQK 1SFCC 1ZV8A 3OJAB 5AVUB 1VPCA 1CSBA 1N7SD 1CI6B 3HD7D 4DOJA 3P8MC 1N73C 2KOGA 1J1DC 1KILC 3VP9A 1NH4A 1VDFA 1RE3A 1JMMA 3VMZA 1DH3A 2WSFH 1H88A 5AW5B 5AW6B 1LWUA 1NOHA 5AW3B 1FZBA 1GK4A 1HBWA 3GHGA 2Z5HA 4W80A 5APVA 1FZCC 4RESB 4OH8B 1T2KD 3H32B 4XE5B 3RK3D 1LWUB 2IFMA 1T3JA 1W2EA 3GHGB 1A02F 2WSCH 1GL2A 1AFOA 1RE4A 1N86A 3C9IA 3A7OA 2A45I 5AW0B 1JNMA 2GUSA 4WY4A 3P32A 1L4AC 4N3YB 4Y99C 1LTIC 3KQGA 4O9BA 1NHLA 1IJDB 2KYVA 2Q9IA 3MGNA 3M9BA 5AW7B 3SWYA 4WY4B 3MD0A 1LTJC 1GD2E 4M3LA 1FJPA 1LT9C 1HTLC 2FFDC 2GUVA 3EQ2A 1OWAA 5APSA 1RE3C 5CCHD 4N78E 5AVXB 5APUA 1E5WA 5CJ4A 2WTYA 2OYHB 5KTBA 1OXZA 3H6PA 3TYYA 1HJBA 2NPSB 3LW5H 1SLQA 3M9QA 3RK2B 5AW1B 2M3BA 2C0XA 4DZOA 4GIFA 1FAVA 3KYQA 1FZGA 3V2QA 1SFCA 1KZUB 2KB7P 2KP8A 1LTAC 4GKGA 3CLQA 5AW9B 1GU5A 1T8ZA 1LTBC 1URQC 4W7YA 1AQ5A 1G1JA 1SFCB 1XTCC 1G2CB 2R5DA 3HTKA 1J1EC 3A3YB 1N73B 2HLOA 2ZFCA 1J1DB 1KILB 1IFJA 1SQPK 1FZCA 3G3ZA 1JCDA 4C7RA 5APYA 3BVHA 1SQBK 4EIJA 3IFMA 5AVSB 4JF7A 1GU4A 1IFIA 1FZCB 1JY2N 3MTUE 1J2JB 1FOSF 4WY4D 5AW8B 2XKMA 1JO5A 2A45G 1H89A 1CZQA 1IFNA 1T3UA 1KFNA 3O8ZA 3EFGA 3M9HA 3NTNA 2OYIB 2WT7B 3MUDA 3I5CA 2MJZA 3B5ND 2CPBA 1LTJA 1L4AB 2NPSD 4Y99B 1LT9A 1M1JC 2O1JA 2XZRA 3HE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP9 A;  5BU5 A;  2JEE A;  2POH A;  3U59 A;  4I1L A;  5BU8 B;  3P8C D;  5KTB A;  4ZKP A;  4N3Y B;  3U1A A;  5BVZ A;  3N7N A;  2FXM A;  1NKN A;  4O9B A;  3BAS A;  1WT6 A;  1IC2 A;  4ZKU A;  3BAT A;  3OJA B;  4N78 D;  4GIF A;  3N4X A;  3C9I A;  3U1C A;  1X79 B;  3HRN A;  3VP8 A; 
#chains in the Genus database with same CATH topology
 1IFD A;  3KDP B;  2PAJ A;  2E43 A;  2FFD B;  5CJ0 A;  4JBZ A;  4WVZ A;  5H2F E;  5CBN A;  1T6A A;  1SFC D;  3CPW O;  2HPC A;  2E76 B;  2E5Y A;  3R4Y A;  2YKO A;  4OVN F;  1KIL D;  1GL2 B;  1QEX A;  5BU8 B;  1NTK J;  3BRT B;  2OQQ A;  1M1K Q;  3CX5 I;  3AE9 C;  2KNC B;  2YKP A;  3QWO C;  1YQ3 C;  2WSF J;  3TGU D;  3JSV C;  1NTZ D;  3HUS A;  2I1J A;  2FYU K;  3H1H D;  3L72 E;  1RF0 C;  3CC7 P;  4PD4 D;  2WSC J;  4RJT A;  5BU5 A;  2M8R A;  1NO4 A;  3L73 E;  4HB1 A;  1SQP D;  3SWK A;  3JCU H;  1HUC A;  1WT6 A;  3GF7 A;  2ZYA A;  4GOE A;  1YTZ I;  3WU2 H;  1EZV I;  1JMB A;  3UIA A;  1XTG B;  1S1C X;  2FXO A;  2KI7 B;  1M90 Q;  2HR3 A;  2O01 H;  1DIP A;  3CWB E;  2N9B A;  3TNU A;  2E76 D;  1QVF O;  4I2L C;  5APT A;  2OGU A;  5TIS E;  1H8A A;  1KFM A;  5B5E H;  3HUS C;  1KQL A;  1GL2 D;  4WB4 A;  1PP9 J;  1X8Y A;  5KLV J;  1WMK A;  3TDK A;  3CCR P;  4KJM A;  1BE3 D;  3RK3 B;  1L0N J;  1JCC A;  3P8C D;  1SQQ J;  2QA4 P;  3CCJ P;  1RF1 C;  1KOR A;  3B5N C;  4NPE A;  1YTZ T;  2OTJ P;  2NPS C;  4U7J A;  1JY2 P;  3CWB G;  2G3A A;  3PH0 A;  2ZYD A;  3L75 D;  2IFN A;  2W6A A;  5CCH A;  3U59 A;  3L4F A;  4H0L C;  5AVY B;  2IBZ D;  2KS1 B;  1QGK B;  5APW A;  2YO2 A;  4H13 B;  2FYU E;  1IFM A;  4PJ0 H;  4L73 A;  1X79 B;  3VP8 A;  2Y9Z A;  2XDJ A;  1LP1 A;  1GDT A;  2R3S A;  5DJU B;  1SQV D;  1KC8 Q;  2W90 A;  1YI2 P;  4EYY Q;  3WUT A;  2OAR A;  1URQ B;  1SQX J;  1L0L G;  5CCH C;  2WVR A;  3IN6 A;  2DW3 A;  3V2P A;  3CX5 H;  3L72 J;  2FXM A;  4C7N B;  3S1K A;  3V5B A;  1HGV A;  3E1I A;  2W8Z A;  2N1T B;  1JTH B;  1GZL A;  1YIT P;  3L73 J;  2A06 D;  2B89 A;  3V6I A;  2UWJ E;  1GW3 A;  1VQ6 P;  1RY3 A;  3Q3D A;  5E79 E;  1FE6 A;  4GDO A;  4L74 A;  3SSU A;  3GHG C;  4ZKP A;  3FGA D;  1VQ8 P;  3HD7 B;  2BEQ D;  2FKW B;  1FC2 C;  1ZP0 C;  1GL2 C;  1KB9 H;  1RE4 C;  3BAT A;  3SWF A;  2IBZ I;  1HJ0 A;  1GK6 A;  2N9Y B;  5KKZ C;  3AEE C;  1U7J A;  4IFM A;  1URQ D;  3NMD A;  3KZI E;  2C9L Y;  4N6J A;  4BXL A;  3VMA A;  1GTW A;  2Z5I A;  2KUB A;  2XV5 A;  2MKV A;  3H1L D;  4LGD E;  2BCC G;  3I55 P;  2GA1 A;  2IYO A;  1EDL A;  3L70 G;  3AEB C;  2N1T D;  3F5H A;  2Q3I A;  1Q82 Q;  3HE5 A;  1JY3 N;  1NU1 K;  2YKQ A;  4NPD A;  3HD7 D;  1OVV A;  3RL0 g;  1UIX A;  2QIW A;  1KTM A;  3VP9 A;  1VDF A;  3VMZ A;  2WSF H;  2FYU J;  1LWU A;  1FZB A;  1GK4 A;  1RH5 B;  2Z5H A;  1FZC C;  4OH8 B;  1T2K D;  1VQN P;  2WSS H;  2Y0C A;  1NAY A;  4U3F D;  1A02 F;  2WSC H;  1AJY A;  3CCE P;  1N86 A;  3C9I A;  5KLI C;  3O6Q A;  4WY4 A;  1LTI C;  3ITK A;  2KYV A;  3MUD C;  3M9B A;  1LTJ C;  3FWL A;  1AVY A;  1SS1 A;  2JKV A;  2B88 A;  1QX8 A;  1P84 I;  3PJS K;  5CJ4 A;  4K3A A;  1PGQ A;  4IL6 E;  1SQB D;  1S5L E;  3RK2 B;  2C0X A;  3RBZ A;  2FYN C;  1FS0 E;  3KYQ A;  2QG4 A;  1LTA C;  3CLQ A;  1URQ C;  4W7Y A;  1U7M A;  1XTC C;  3EWK A;  1N73 B;  2HLO A;  1SQP K;  1NU1 E;  4D6T E;  1Y9B A;  4JF7 A;  1GU4 A;  1N8R Q;  3H1K E;  1FOS F;  2P58 A;  2V7Q J;  1JO5 A;  1OVR A;  3H1J D;  3O8Z A;  2G8Y A;  3EFG A;  5C39 A;  3NTN A;  5H2F H;  2KZJ A;  1BCC J;  3I5C A;  5B66 E;  1L4A B;  4Y99 B;  1YJ9 P;  1USD A;  1LT9 A;  2ZXX A;  4GOF A;  3RK2 D;  3VMX A;  1VQ4 P;  1NU1 G;  4D6T G;  4L76 A;  5CCG A;  3L74 E;  3Q5S A;  4LC1 A;  2O1K A;  1QLE D;  2YO3 A;  3TF5 A;  2WPS A;  1LTT C;  2E74 C;  2WSE J;  4A7P A;  1JUN A;  2HPC B;  1KIL E;  2P10 A;  2PGD A;  4I7Z B;  4ASW A;  3QH9 A;  1NGM B;  4C46 A;  2HOD A;  1S9K D;  1NTZ E;  1D7M A;  1CW5 A;  3HRN A;  3H1H E;  3L74 G;  3BCC D;  2FBW C;  3H1I D;  1NKZ B;  1OW8 A;  4PD4 E;  1R5L A;  5CCG C;  3M91 A;  1L4A D;  2KK7 A;  3CXH I;  3Q5P A;  2H43 A;  2XU6 A;  2QJP B;  1Q81 Q;  3AED C;  1SQP E;  3LID A;  3L71 D;  5TIS H;  2QJK C;  3AEA C;  3CX5 D;  3AE6 C;  3U1C A;  1N7S A;  2HG5 D;  1M1J A;  1P84 H;  1DEE G;  2AEJ A;  2ZAE B;  4K35 A;  3TGU G;  1NTZ G;  1EQ7 A;  3H1H G;  4GT1 A;  3OA7 A;  3TNU B;  2ZT9 B;  4B86 A;  3G71 P;  1VQ9 P;  2IZ1 A;  1OW7 A;  1FJK A;  3CL3 D;  1HWT C;  1SQP G;  2QRX A;  1NWQ A;  3T97 A;  1KB9 D;  1EZV D;  4JYC A;  2K3R A;  3RL0 B;  3P8C E;  1Q90 D;  3H1K J;  2YIU B;  4ZKU A;  2W6J H;  3B8E B;  1N7S C;  4JPZ B;  2Y0E A;  1RF0 A;  2Z4E A;  3RK2 C;  1DEB A;  2I8D A;  4KHX A;  2M5A B;  2PP6 A;  1RHZ B;  1NTM D;  1CI6 A;  1U57 A;  5GTH E;  3LIE A;  1BE3 G;  3L74 J;  1OVU A;  1ZRT D;  2Q5U A;  3H32 A;  3MHV A;  1H0T A;  5AVQ B;  2ZT9 D;  1VF5 C;  1L0L K;  3N7N A;  1SQV E;  3SFE C;  2WQY C;  3L36 A;  2P67 A;  3GW6 A;  3L75 G;  1YJN P;  3RL0 D;  2Q7C A;  5AVV B;  4AYC A;  2R5B A;  2FXP A;  3CMA P;  2H8P D;  3HE4 B;  2WPR A;  1RF1 A;  1KB9 I;  3B5N A;  2CK3 H;  2NPS A;  1MUU A;  3M0A A;  2A06 E;  1SQV G;  1SQP J;  3G9R A;  1ZME C;  3CXH H;  2YMY A;  3U1A A;  1ZOY C;  3KZI H;  1JEK A;  1ZN5 A;  4I7Z C;  2V7Q H;  4DJG A;  1G2C A;  1PP9 D;  2IPP A;  3K5B A;  2JO1 A;  1KIL A;  2QVA A;  2XNX A;  4YTP C;  1L0N D;  2FY8 A;  1SQQ D;  5APQ A;  2WMM A;  3Q1M A;  2A06 G;  1ZXG A;  3H1L E;  1K05 A;  1YYC A;  1PZQ A;  1JB0 J;  4LLH A;  4CPG A;  3AEF C;  2WT7 A;  2KIK A;  3V2N A;  1L0L E;  5APX A;  1BGY D;  1FU1 A;  2E42 A;  4PV1 B;  2WSE H;  2W27 A;  1Y8A A;  1SFC C;  1ZV8 A;  1CSB A;  1KQS O;  2O01 N;  2KOG A;  4DCK A;  1KIL C;  1K73 Q;  3AE2 C;  1NH4 A;  1H88 A;  5AW5 B;  3GHG A;  5APV A;  3H1L G;  5KAF E;  3RK3 D;  1LWU B;  1W2E A;  1PGJ A;  1GL2 A;  1AFO A;  1RE4 A;  4U3F E;  1YHQ P;  3A7O A;  2A45 I;  1JNM A;  4NPF X;  2KNC A;  3D70 A;  1SQX D;  2IYP A;  2GUS A;  4N3Y B;  2QJY B;  3KQG A;  3GLM A;  4JQ0 D;  1IJD B;  3L72 D;  4IL6 H;  2YMK A;  4WY4 B;  1KYO E;  1S5L H;  1FJP A;  1HTL C;  2FFD C;  3D71 A;  5APS A;  3L73 D;  4N78 E;  5AVX B;  4H13 D;  4PV1 D;  1E79 H;  1E5W A;  2OYH B;  1OXZ A;  3H6P A;  3G6E P;  2M0B A;  2BCC E;  2E76 C;  5K5G B;  3ABV C;  4U3F G;  3L70 E;  1AVO A;  4ZMD A;  3CCQ P;  1BSN A;  4DZO A;  3CWB J;  3V2Q A;  2RMZ A;  1KZU B;  2QSI A;  1QVG O;  5AW9 B;  4H44 B;  1T8Z A;  2KZI A;  1KQF B;  1AQ5 A;  3CME P;  2NRG A;  1PV3 A;  2D2C B;  2KSE A;  1J1D B;  3WU2 E;  1FZC A;  3G3Z A;  1JCD A;  1P84 D;  3CC2 P;  1IZN B;  3A0H H;  5EFW B;  2BEZ F;  5B66 H;  1JY2 N;  4WY4 D;  1SQB G;  1H89 A;  1T3U A;  3H1L J;  3M9H A;  1RQV A;  3AE4 C;  4IL6 X;  2OYI B;  1NJI Q;  1S5L X;  3MUD A;  1LTJ A;  1NYH A;  4YXW H;  1L0L J;  2QE7 H;  4Z1M H;  2O1J A;  2E75 B;  3KPE A;  1VQO P;  3M0D C;  3TSI A;  3AE5 C;  1LT9 B;  1GMJ A;  1KMI Z;  1BSH A;  2K9J B;  2IX7 C;  2FYU D;  1KV4 A;  3RK3 C;  4H44 D;  4WBA A;  4OGQ B;  3F89 A;  4TT3 H;  2WZ7 A;  3GMA A;  2WIT A;  5KAI H;  3H1J G;  1FDI A;  1GW4 A;  4PD4 H;  1URQ A;  1Z56 A;  1OIP A;  1NTM K;  1ZR4 A;  2IZ0 A;  2OTL P;  2QEX P;  3BRV B;  2OYO A;  1EC5 A;  5KJ7 D;  3V4W A;  4BRY B;  1S9K E;  2A45 H;  3FWN A;  1J1E B;  2ZJS E;  2HOD B;  1FOS E;  4H13 C;  4PV1 C;  1QL1 A;  1M7L A;  3H1I E;  2N1T A;  3H25 A;  2E75 D;  3EFF K;  4HH2 A;  3V2R A;  1K9M Q;  3L71 E;  4RKU J;  3S4R A;  2BCC J;  1NTZ K;  3CX5 E;  3HD7 A;  3L70 J;  3MIW A;  4XFJ A;  1SVF A;  1AV1 A;  4OGQ D;  1RQU A;  4EI2 A;  1K8A Q;  1M1J B;  1X0T A;  1DD3 A;  3LW5 J;  1KQG B;  3CXH D;  3H1I G;  3HTK B;  3B71 A;  2NZ2 A;  2KSJ A;  2N1T C;  1A02 J;  2RH0 A;  3NXS A;  2V4H A;  2Y0D A;  3L71 G;  1EZV E;  3AE7 C;  3T97 B;  2Q3E A;  2OYH C;  4OWF A;  4YXD C;  2SPZ A;  3HD7 C;  5GTH H;  1BCC D;  4XA4 A;  1FDM A;  4IFF A;  2O3J A;  3TK1 A;  3CC4 P;  3BAS A;  3IR9 A;  1NTM E;  4QMA A;  1IO4 A;  3FXD A;  1T2K C;  4UB8 E;  3CCU P;  3CCS P;  1FBM A;  3VTP C;  2M3E A;  2C9N Y;  1JY3 O;  2B87 A;  3E1R A;  2JJL A;  1EZV G;  5CHX A;  2RKL A;  1BDC A;  2JEE A;  2W6B A;  4Y28 J;  3PTZ A;  3AE8 C;  1KD1 Q;  1NAF A;  4EDF A;  1H0T B;  5AVR B;  5AW4 B;  5KJ7 C;  1M8O B;  1MKM A;  1IK7 A;  3TGU E;  2GM4 A;  1EXI A;  2P1J A;  3CCL P;  4HYT B;  4W7Z A;  2OYI C;  3HUS B;  1NTM G;  3G4S P;  4I6M C;  3Q5R A;  2Y9Y A;  1LTG C;  2E75 C;  1KN7 A;  1SQV K;  5DJT B;  3H1I J;  2JP3 A;  1ZW0 A;  1LGH B;  1HH0 A;  3AE1 C;  1RF1 B;  2QM8 A;  4OGQ C;  3B5N B;  1SQX K;  1FZF A;  1NKN A;  1MFZ A;  2YXR B;  1PGO A;  4H0L B;  1MV8 A;  2YNY A;  1G1I A;  1N73 A;  1PFI A;  2JDI H;  1VQL P;  1NU1 J;  4D6T J;  1ZR2 A;  2AXT E;  3RBX A;  1BE3 E;  1IFP A;  1DD4 A;  3L37 A;  1L2P A;  5L8R J;  3H1K D;  4UB6 E;  1Q2N A;  3N4X A;  3Q2Y A;  2LKM A;  1W2B O;  2BAS A;  2B9B A;  3L75 E;  4RO0 A;  3M06 A;  1L4A A;  2I1K A;  1MFT A;  1NVO A;  4WWI A;  1IK9 A;  2IBZ E;  3VN0 A;  1BGY E;  2L5G B;  1PP9 G;  5KAF H;  1VPC A;  1N73 C;  1NTM J;  1EDK A;  1RE3 A;  3L74 D;  4HKZ H;  1M56 D;  4L75 A;  1L0N G;  1SQQ G;  4H0L D;  4RES B;  1NTK D;  1LP1 B;  1T3J A;  2Q6Q A;  3GHG B;  3ZDM A;  2E5T A;  3RK3 E;  5M1B A;  1KYO H;  3SFD C;  2IBZ G;  1BGY G;  1L4A C;  1SQX E;  3P32 A;  4Y99 C;  5E79 H;  3TGU J;  1NTZ J;  4O9B A;  3H1H J;  5KKZ B;  5AW7 B;  1M57 D;  4M3L A;  1VQM P;  3MZW B;  1VL2 A;  2ZYG A;  3AEC C;  3C1L A;  4ZNC A;  1S2E A;  1RE3 C;  5CCH D;  3A0B E;  3TYY A;  1HJB A;  3LW5 H;  1K04 A;  5AW1 B;  1S4X A;  2M3B A;  1VQP P;  1FAV A;  1SQX G;  1SFC A;  4R4M A;  2KB7 P;  1PPJ D;  4GKG A;  3FXE A;  5KLV D;  2PRR A;  1LTB C;  2RN0 A;  3L72 G;  2L91 A;  2ITA A;  2R5D A;  2ZFC A;  4C7R A;  1PGP A;  3BVH A;  1SQB K;  3IFM A;  5AVS B;  3L73 G;  1BE3 J;  1P84 E;  1OW6 A;  1IFI A;  1FZC B;  2QJP C;  3MTU E;  3D6Y A;  1OZH A;  1YQ4 C;  5AW8 B;  2XKM A;  3FX0 A;  2OTK E;  1BDD A;  1IFN A;  5KLI B;  1UII A;  1OFC X;  3L75 J;  3CCV P;  2M5A A;  5GTI E;  3HE5 B;  2XZR A;  2FFD A;  1LTJ B;  2IDB A;  1BGY J;  1Q86 Q;  1JM0 A;  2ZT9 C;  2R32 A;  1PIX A;  1JY3 P;  3PP5 A;  3NFQ A;  4PD4 I;  4BWN A;  3S9O A;  2J59 M;  1OX3 A;  3WUV A;  1AA0 A;  2CPS A;  3RL0 C;  3MP7 B;  1QL2 A;  1SQV J;  3AE3 C;  2YIU C;  3P7K A;  3PHL A;  1JOC A;  2FYN B;  2PFX A;  5TJH A;  3A5T A;  3IF4 A;  3O6Q B;  1X9V A;  1HGZ A;  4GOD A;  3II6 A;  2HYN A;  2QM7 A;  3L35 A;  1YIJ P;  2WPV B;  4I1L A;  2FYU G;  3HE4 A;  4AQR D;  3RGU A;  3V4Q A;  2KXP B;  2AEM A;  5AVT B;  1IC2 A;  1SQB E;  3OAK A;  3CWB D;  1YJW P;  3CD6 P;  1X22 A;  1EXJ A;  3JCU E;  3M0D A;  1N2D C;  1FZE A;  4AUW A;  3VOP A;  5AW2 B;  3D6Z A;  4KT0 J;  2ZVO B;  1MZ9 A;  3CXH E;  2R44 A;  3CCM P;  3B4S A;  5B5E E;  3W67 A;  2E74 B;  1LTS C;  3H1J E;  2AXC A;  1DX7 A;  3C8V A;  2P2U A;  3GG2 A;  4UB8 H;  4R4L A;  1AQT A;  2KS1 A;  1L0L D;  1BCC E;  2P7J A;  1FDO A;  4EOT A;  2HFE D;  2R3C A;  1LJ2 A;  5CMZ A;  2D2C D;  1HVV A;  3W68 A;  4YPC A;  3PRJ A;  2K9Y A;  2POH A;  2QJK B;  2FYZ A;  2B87 B;  1VQ7 P;  4U3F J;  1FZA A;  3R2P A;  3GF3 A;  4PJ0 E;  2W83 C;  1BCC G;  2KLV A;  2E74 D;  2C0W A;  2WWW A;  5AVW B;  4C7N A;  3BCC E;  2VRS A;  1EDI A;  1JTH A;  2AEF A;  1KYO D;  4JYB A;  3KXD A;  1R5S A;  1NTK K;  2JR8 A;  2H89 C;  3PLN A;  2OYH A;  1OMI A;  4N78 D;  1VQ5 P;  4HJG H;  2WPQ A;  3OW2 O;  2BCC D;  5CBO A;  1LWU C;  5CCG D;  1SQB J;  3L70 D;  1N7S B;  5AVZ B;  2H7H A;  2AXT H;  1WRG A;  3E7K A;  2LR2 A;  3VMY A;  3BCC G;  1N7L A;  2QJY C;  2Q1K A;  4UB6 H;  1LT1 A;  4WY4 C;  1VQK P;  5BVZ A;  2ZXE B;  2LXB A;  3VYI A;  1KB9 E;  2O01 J;  1SP4 A;  3A2A A;  2JWA A;  5KJ7 A;  1VF5 B;  1ZLL A;  2J58 A;  4IFD K;  3H1J J;  2OYI A;  3AEG C;  3WMM 0;  1USE A;  5KLV K;  1JY2 O;  4ASV A;  2K88 A;  3A0H E;  4H44 C;  3CI9 A;  1YBK A;  1L0N K;  1SQQ K;  3OJA B;  5AVU B;  1N7S D;  1CI6 B;  4TLF A;  4DOJ A;  2D2C C;  3P8M C;  1J1D C;  2K9J A;  1KYO I;  1TU3 F;  2K1A A;  1JMM A;  1DH3 A;  5AW6 B;  1ZRT E;  1NOH A;  5AW3 B;  4MN4 C;  1HBW A;  3I56 P;  4W80 A;  3IAO A;  3H1K G;  3H32 B;  4XE5 B;  1LNQ A;  2IFM A;  1W5C E;  2KLU A;  1NTK E;  3USS A;  1S72 P;  1Y47 A;  5AW0 B;  2YXQ B;  3A0B H;  4BRY A;  1VF5 D;  1EDJ A;  1NHL A;  1R8E A;  2Q9I A;  1HF9 A;  3MGN A;  3SWY A;  2XND H;  1GD2 E;  3MD0 A;  4IOI H;  3JC2 2;  3BCC J;  1LT9 C;  2GUV A;  3EQ2 A;  5KAI E;  1OWA A;  2J5U A;  5APU A;  2JWD A;  2WTY A;  2ZVN B;  5KTB A;  1NTK G;  2NPS B;  3L71 J;  1SLQ A;  3M9Q A;  4DT0 A;  2LXC B;  4GIF A;  1FZG A;  2KP8 A;  1PL5 A;  1GU5 A;  1PP9 E;  1PPJ E;  1G1J A;  1SFC B;  5KLV E;  1G2C B;  3HTK A;  1J1E C;  1NU1 D;  3A3Y B;  4D6T D;  1KIL B;  1IFJ A;  1L0N E;  1SQQ E;  5APY A;  4EIJ A;  2H88 C;  1S3J A;  1J2J B;  5GTI H;  1Q7Y Q;  3WUU A;  2A45 G;  1CZQ A;  1KFN A;  3KHU A;  2WT7 B;  2MJZ A;  3B5N D;  2CPB A;  2NPS D;  1PPJ G;  2K37 A;  5KLV G;  1M1J C; 
#chains in the Genus database with same CATH homology
 3RK2 D;  1IFD A;  3KDP B;  3KPE A;  3VMX A;  1LTJ B;  2PAJ A;  2E43 A;  3M0D C;  3TSI A;  1LT9 B;  5CCG A;  2FFD B;  2R32 A;  5CJ0 A;  1JY3 P;  4LC1 A;  3PP5 A;  2IX7 C;  2O1K A;  3NFQ A;  3RK3 C;  2J59 M;  4WBA A;  2YO3 A;  1SFC D;  2HPC A;  2WPS A;  2CPS A;  1LTT C;  3RL0 C;  1QL2 A;  2WZ7 A;  2YKO A;  1KIL D;  2WIT A;  1JUN A;  3P7K A;  1GL2 B;  5BU8 B;  2HPC B;  3BRT B;  1GW4 A;  1JOC A;  1URQ A;  1Z56 A;  2YKP A;  1NTM K;  3A5T A;  4C46 A;  1X9V A;  1ZR4 A;  3HUS A;  2HOD A;  2I1J A;  1S9K D;  3BRV B;  2FYU K;  1HGZ A;  5KJ7 D;  3V4W A;  1RF0 C;  1S9K E;  2A45 H;  1J1E B;  1CW5 A;  3HRN A;  2HOD B;  1FOS E;  1QL1 A;  3II6 A;  2HYN A;  2QM7 A;  1NKZ B;  3L35 A;  5BU5 A;  1M7L A;  2M8R A;  1NO4 A;  4I1L A;  5CCG C;  3M91 A;  2N1T A;  1L4A D;  3HE4 A;  2H43 A;  2XU6 A;  4AQR D;  3V4Q A;  3LID A;  1HUC A;  1WT6 A;  4HH2 A;  3V2R A;  5AVT B;  1IC2 A;  1YTZ I;  3OAK A;  3U1C A;  3UIA A;  1NTZ K;  1XTG B;  1N7S A;  3HD7 A;  2HG5 D;  3MIW A;  1M1J A;  1SVF A;  2O01 H;  2N9B A;  3TNU A;  3M0D A;  4I2L C;  5APT A;  1H8A A;  1M1J B;  1EQ7 A;  1KFM A;  1N2D C;  3HUS C;  1FZE A;  4GT1 A;  1KQL A;  4AUW A;  3OA7 A;  3TNU B;  1GL2 D;  4WB4 A;  1X8Y A;  3VOP A;  3HTK B;  5AW2 B;  4B86 A;  1MZ9 A;  1FJK A;  2KSJ A;  3CL3 D;  3RK3 B;  1HWT C;  2N1T C;  1JCC A;  3P8C D;  1A02 J;  1NWQ A;  3T97 A;  3NXS A;  4JYC A;  3RL0 B;  3P8C E;  1LTS C;  2OYH C;  1RF1 C;  1DX7 A;  4ZKU A;  3B5N C;  1YTZ T;  2P2U A;  2NPS C;  1JY2 P;  3B8E B;  1N7S C;  3HD7 C;  1RF0 A;  2Z4E A;  2IFN A;  3RK2 C;  1DEB A;  4KHX A;  2W6A A;  4XA4 A;  5CCH A;  2PP6 A;  3U59 A;  3L4F A;  2FFD A;  5AVY B;  1FDM A;  4IFF A;  3TK1 A;  1CI6 A;  2P7J A;  4EOT A;  2HFE D;  3BAS A;  2R3C A;  3IR9 A;  5APW A;  2YO2 A;  1IO4 A;  1T2K C;  1IFM A;  3LIE A;  5CMZ A;  1FBM A;  3VTP C;  1X79 B;  3VP8 A;  2C9N Y;  1HVV A;  1JY3 O;  2XDJ A;  2JJL A;  5CHX A;  2Q5U A;  3H32 A;  2JEE A;  2POH A;  2W6B A;  2FYZ A;  1GDT A;  5AVQ B;  1L0L K;  3N7N A;  1NAF A;  1FZA A;  3R2P A;  3L36 A;  2P67 A;  5AVR B;  5AW4 B;  5KJ7 C;  2OAR A;  1URQ B;  2KLV A;  2GM4 A;  3RL0 D;  2Q7C A;  2P1J A;  2C0W A;  4HYT B;  4W7Z A;  2WWW A;  5CCH C;  2OYI C;  5AVW B;  3HUS B;  5AVV B;  3V2P A;  4C7N A;  4I6M C;  2VRS A;  1JTH A;  2FXM A;  4AYC A;  1LTG C;  4C7N B;  2R5B A;  1SQV K;  3V5B A;  1HGV A;  3E1I A;  4JYB A;  2H8P D;  2N1T B;  1NTK K;  3HE4 B;  1JTH B;  1GZL A;  2WPR A;  2OYH A;  1RF1 A;  4N78 D;  3B5N A;  1GW3 A;  2NPS A;  1MUU A;  3M0A A;  2WPQ A;  1RY3 A;  1HH0 A;  1LGH B;  1LWU C;  1RF1 B;  2QM8 A;  3GHG C;  5CCG D;  3B5N B;  4ZKP A;  2YMY A;  3U1A A;  1SQX K;  1N7S B;  5AVZ B;  3HD7 B;  2H7H A;  2FKW B;  1FZF A;  1NKN A;  1MFZ A;  1WRG A;  1GL2 C;  1ZN5 A;  1RE4 C;  3VMY A;  3BAT A;  3SWF A;  1N7L A;  1MV8 A;  2YNY A;  1G1I A;  1G2C A;  1N73 A;  1GK6 A;  2IPP A;  1PFI A;  4WY4 C;  1KIL A;  4IFM A;  1URQ D;  3NMD A;  1ZR2 A;  2C9L Y;  2XNX A;  5BVZ A;  4N6J A;  2ZXE B;  3VYI A;  5APQ A;  1GTW A;  3L37 A;  1SP4 A;  2Z5I A;  3A2A A;  2XV5 A;  4LGD E;  3N4X A;  5KJ7 A;  2LKM A;  1YYC A;  1ZLL A;  2J58 A;  2BAS A;  4IFD K;  4LLH A;  2N1T D;  2OYI A;  3M06 A;  2WT7 A;  3WMM 0;  3V2N A;  5KLV K;  1L4A A;  1JY2 O;  2I1K A;  2Q3I A;  5APX A;  3HE5 A;  1IK9 A;  1JY3 N;  1FU1 A;  1NU1 K;  2YKQ A;  2E42 A;  2WSE H;  3CI9 A;  3VN0 A;  2W27 A;  1L0N K;  2L5G B;  1SQQ K;  1SFC C;  1ZV8 A;  3OJA B;  5AVU B;  1VPC A;  1CSB A;  1N7S D;  1CI6 B;  3HD7 D;  4DOJ A;  3P8M C;  1N73 C;  2KOG A;  1J1D C;  1KIL C;  3VP9 A;  1NH4 A;  1VDF A;  1RE3 A;  1JMM A;  3VMZ A;  1DH3 A;  2WSF H;  1H88 A;  5AW5 B;  5AW6 B;  1LWU A;  1NOH A;  5AW3 B;  1FZB A;  1GK4 A;  1HBW A;  3GHG A;  2Z5H A;  4W80 A;  5APV A;  1FZC C;  4RES B;  4OH8 B;  1T2K D;  3H32 B;  4XE5 B;  3RK3 D;  1LWU B;  2IFM A;  1T3J A;  1W2E A;  3GHG B;  1A02 F;  2WSC H;  1GL2 A;  1AFO A;  1RE4 A;  1N86 A;  3C9I A;  3A7O A;  2A45 I;  5AW0 B;  1JNM A;  2GUS A;  4WY4 A;  3P32 A;  1L4A C;  4N3Y B;  4Y99 C;  1LTI C;  3KQG A;  4O9B A;  1NHL A;  1IJD B;  2KYV A;  2Q9I A;  3MGN A;  3M9B A;  5AW7 B;  3SWY A;  4WY4 B;  3MD0 A;  1LTJ C;  1GD2 E;  4M3L A;  1FJP A;  1LT9 C;  1HTL C;  2FFD C;  2GUV A;  3EQ2 A;  1OWA A;  5APS A;  1RE3 C;  5CCH D;  4N78 E;  5AVX B;  5APU A;  1E5W A;  5CJ4 A;  2WTY A;  2OYH B;  5KTB A;  1OXZ A;  3H6P A;  3TYY A;  1HJB A;  2NPS B;  3LW5 H;  1SLQ A;  3M9Q A;  3RK2 B;  5AW1 B;  2M3B A;  2C0X A;  4DZO A;  4GIF A;  1FAV A;  3KYQ A;  1FZG A;  3V2Q A;  1SFC A;  1KZU B;  2KB7 P;  2KP8 A;  1LTA C;  4GKG A;  3CLQ A;  5AW9 B;  1GU5 A;  1T8Z A;  1LTB C;  1URQ C;  4W7Y A;  1AQ5 A;  1G1J A;  1SFC B;  1XTC C;  1G2C B;  2R5D A;  3HTK A;  1J1E C;  3A3Y B;  1N73 B;  2HLO A;  2ZFC A;  1J1D B;  1KIL B;  1IFJ A;  1SQP K;  1FZC A;  3G3Z A;  1JCD A;  4C7R A;  5APY A;  3BVH A;  1SQB K;  4EIJ A;  3IFM A;  5AVS B;  4JF7 A;  1GU4 A;  1IFI A;  1FZC B;  1JY2 N;  3MTU E;  1J2J B;  1FOS F;  4WY4 D;  5AW8 B;  2XKM A;  1JO5 A;  2A45 G;  1H89 A;  1CZQ A;  1IFN A;  1T3U A;  1KFN A;  3O8Z A;  3EFG A;  3M9H A;  3NTN A;  2OYI B;  2WT7 B;  3MUD A;  3I5C A;  2MJZ A;  3B5N D;  2CPB A;  1LTJ A;  1L4A B;  2NPS D;  4Y99 B;  1LT9 A;  1M1J C;  2O1J A;  2XZR A;  3HE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...