3VP8A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
75
structure length
75
Chain Sequence
SVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords General transcriptional corepressor TUP1
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 35
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp8A00
3U1AA 5BVZA 3BASA 3N4XA 3U59A 4I1LA 4N3YB 5KTBA 3OJAB 4N78D 1X79B 3P8CD 3U1CA 5BU5A 2JEEA 2POHA 1NKNA 3C9IA 4O9BA 4ZKUA 4GIFA 3BATA 3HRNA 4ZKPA 1WT6A 2FXMA 3VP8A 1IC2A 5BU8B 3N7NA 3VP9A
chains in the Genus database with same CATH superfamily
3I55P 1GZLA 1FZFA 1W5CE 4GDOA 1LTJC 1YYCA 1LTJB 1DEEG 1PV3A 3AEBC 3CCSP 2M5AA 2IZ1A 5AVWB 1LT9A 5CCGD 3BCCG 5KJ7C 4W7YA 1OVUA 1Z56A 1SQXD 3H1KD 2NPSD 3BRTB 1X0TA 3EWKA 2M3BA 3CLQA 2Y0DA 3KZIE 5AW7B 1NTMD 1CI6B 3NMDA 4R4LA 3TGUD 1QLED 3BRVB 1LP1B 3L73J 2IPPA 1NTME 3RBZA 3MHVA 3PLNA 3TGUE 4HKZH 3TK1A 3OJAB 4AYCA 1PP9D 3MGNA 3O8ZA 1AV1A 2BEZF 5APTA 1SQVE 1P84I 1EDIA 1AQTA 3VMZA 1YHQP 2GA1A 1URQD 2YIUC 4DT0A 1L0LE 1X79B 1LWUC 2WSFJ 1P84D 2PP6A 2V4HA 1GDTA 2W6BA 3L72D 3MUDA 2WSFH 2JP3A 4ZKPA 3L72E 1IK7A 3HE4B 2D2CD 1M1JB 1YBKA 3WMM0 1S9KE 2PAJA 1ZRTD 1PL5A 1FBMA 3H1HD 1DEBA 3I56P 2QRXA 1ZRTE 3G6EP 2MKVA 3H1HE 1KC8Q 1SQVG 3B5NA 5KAFE 3OA7A 1AVYA 1S5LX 1L4AA 1RE3C 2A45I 1RE4A 1L0LG 3AE4C 3AE5C 2ZT9B 4L75A 2E76B 3RL0C 1MKMA 3L74E 3P8CE 3RL0B 1FDIA 1CW5A 3V4WA 1IFNA 2BCCG 4C7NA 3USSA 5CCHD 4PD4E 3MIWA 1K05A 3V4QA 4L74A 2FYUD 1RQUA 2ZAEB 2AEFA 5AW8B 2FYUE 1L0NE 2H89C 4JQ0D 1FDOA 1X9VA 1PPJG 4CPGA 1SQQK 3L36A 1M57D 1NTZJ 1X8YA 1MV8A 1LGHB 3WUTA 3L74G 2H8PD 2A45G 1NKZB 3CC7P 2RN0A 5APQA 1H0TB 4D6TJ 3N4XA 2WPSA 3ITKA 1JUNA 2FY8A 2FYUG 1KFMA 1L0NG 2KNCA 1SVFA 3OAKA 1QL1A 1SQXK 4K35A 5AVUB 5H2FH 3BATA 2QSIA 3AE8C 1KFNA 1IC2A 2JKVA 4UB8H 4ZMDA 1ZMEC 1NTMK 2M8RA 2YNYA 1HJBA 1HVVA 1AVOA 2E74D 1GL2D 2N1TC 4BRYB 4OGQC 3CC4P 4RESB 1H89A 2Z4EA 3P8MC 2N1TB 3RK2D 1IJDB 1N7SD 3WU2E 2W83C 2IFNA 2QM8A 1BGYD 1W2BO 2W90A 3RL0g 1VF5D 2QVAA 3GG2A 2ZYAA 2H43A 1M90Q 1K9MQ 3H1IE 5GTIE 3L70J 1VQMP 1JY2O 5DJUB 2Q6QA 3T97B 1OW6A 3K5BA 1URQA 4W80A 3GHGC 3RK3D 1Y47A 2YKQA 1YTZT 3CX5H 3HUSC 4EIJA 2NPSB 1YJWP 3HD7C 5E79H 3AEDC 2K88A 2JO1A 4H13D 2OARA 4B86A 3CC2P 4OVNF 1DIPA 3H1IG 1VQ6P 1SQPD 5B5EH 4YTPC 2XV5A 1LTGC 1FZEA 2YO2A 1KYOH 1SQBD 3KDPB 3KXDA 5KLIB 3GLMA 4IL6E 4GKGA 1VQNP 2XDJA 3C9IA 2ZYGA 1KV4A 5GTHH 3FWNA 4OWFA 3CWBE 1HUCA 3L71E 1ZXGA 2LKMA 1T2KD 2FYUK 1URQB 1GW4A 5CJ0A 1KD1Q 1RHZB 2FKWB 3G3ZA 1DD3A 1KB9H 2KLUA 2OQQA 3VYIA 2HODB 1EDKA 2OYHA 3MTUE 1OMIA 3MP7B 3GMAA 2QM7A 2J59M 2YKPA 4C46A 2UWJE 1ZW0A 3CXHE 2D2CC 4JYCA 2W8ZA 1QX8A 2NRGA 1L2PA 2D2CB 2RMZA 1RF0C 1IO4A 3D6YA 1NU1G 2YXQB 3CWBG 3L71G 3H6PA 4DZOA 3SSUA 1LTIC 3JCUH 1U7JA 5B66H 1IFMA 1SQQJ 4Y99B 2E42A 1JMBA 2OTJP 3II6A 4LC1A 3A0BE 5CBNA 5CCHC 4H0LD 2JWDA 1KYOD 3AECC 2YMYA 2IFMA 3H1JE 3SFDC 2Q9IA 1PIXA 4N78D 2Y9ZA 3B5ND 5L8RJ 1NTKD 2E75D 1E5WA 3JC22 1FDMA 1L4AD 2P2UA 1SQXJ 2XNXA 3H1KJ 1JOCA 1OFCX 3L4FA 2WTYA 3CCMP 1NWQA 4RJTA 1GL2A 1GK4A 3U59A 1NHLA 5EFWB 1NTMJ 1OW7A 3FXEA 2ZVOB 1QEXA 1K04A 2RH0A 3MZWB 3TGUJ 3V6IA 3O6QB 2WSCJ 2QJPC 3AEGC 3H1JG 2WSCH 2R44A 1N73A 1PGPA 1EDJA 5AW2B 3VOPA 1OW8A 3NFQA 3TNUA 3VN0A 1KQGB 3AE9C 3HTKA 3M91A 3LW5J 1T3JA 2GUSA 3BCCD 3GF7A 5TJHA 3S1KA 4IFFA 3LW5H 1HJ0A 2I1KA 1NAYA 1OWAA 3VMYA 3L72J 4KHXA 1SQPK 2E74B 4Z1MH 1GL2B 2OTKE 3G4SP 2QA4P 3RK2C 3D6ZA 5KLVE 1SQBK 1BE3D 3RK2B 1N7SB 5CBOA 1G2CA 1BE3E 3H1HJ 4WVZA 5AVQB 2HYNA 1VF5B 3IN6A 1JY2P 3A5TA 5KAFH 2M3EA 1N73B 2WWWA 3WUVA 4IFDK 2G8YA 2PGDA 4YXDC 1VQPP 1FOSF 2OYIA 2GUVA 1HH0A 1YQ4C 1YI2P 2IDBA 4JBZA 4PV1D 1QVGO 2W6AA 1Q86Q 3RK3C 2WSEH 2WITA 3RK3B 2R5BA 2IX7C 5KLVG 2K37A 1UIIA 2N9BA 2Q3EA 1NGMB 5CMZA 5AVRB 2A45H 1BE3G 3SWFA 2H7HA 1LWUA 2FFDB 1J1DC 1QGKB 4H13C 2IBZE 2FYUJ 1J1DB 4H13B 1GMJA 1BSNA 1VQKP 3V2PA 1YJNP 1HWTC 1Q81Q 3AEFC 2OGUA 3TDKA 3CD6P 4U3FE 4KJMA 1SQVD 1FU1A 3CI9A 4ASVA 3CCVP 2OYOA 1MFTA 2M5AB 1BSHA 1L0LD 1LT9C 1LT9B 4DCKA 2QEXP 1S2EA 5BU5A 1RF1A 2E5TA 1T2KC 4O9BA 1PFIA 2IBZG 4JPZB 2BCCD 1S9KD 4LLHA 2O1JA 2R32A 1M1JC 2QJYB 2BCCE 4U3FG 1NTKK 2K3RA 2N9YB 2WT7A 5AVVB 1YJ9P 1EZVI 2KZJA 1JEKA 1VQ9P 1HTLC 1PPJD 1OZHA 1EZVD 1VQ7P 1PPJE 1USDA 1IZNB 1EZVE 4PD4I 2ZT9C 3A3YB 2E76C 3L74D 3P8CD 1KILD 3V5BA 3F5HA 1ZLLA 4PD4D 3Q1MA 1KILE 3SWYA 1K8AQ 2XZRA 4WY4A 1FZBA 1BGYJ 2WVRA 3MUDC 1N8RQ 3P32A 1AQ5A 1L0ND 4L73A 1ZR2A 3H1IJ 3L75E 2HG5D 3CPWO 4H0LC 3D71A 4H0LB 3AE1C 5GTIH 4C7RA 1EZVG 2KI7B 3B5NC 2E75C 3B5NB 1L4AC 2LXBA 1GW3A 2E75B 3JSVC 1L4AB 1YIJP 1IFIA 1JY3O 1OVRA 1OVVA 2B87A 3F89A 5APSA 3CCJP 1PGQA 3OW2O 3W67A 3L75G 2O01J 4C7NB 2HFED 2JEEA 1SQPJ 2O01H 1ZR4A 1SQBJ 3E7KA 3R2PA 1T6AA 4IL6H 2BASA 4HB1A 2KK7A 1EC5A 4YXWH 1EQ7A 1JNMA 2IYPA 4Y28J 3GHGA 5AVTB 3S4RA 5TISE 3PRJA 3IF4A 3E1RA 3Q5PA 3HUSA 3HD7A 3VMXA 3QWOC 2Y0CA 1SQVK 2KS1A 2AEMA 3H1ID 1DX7A 1L0LK 2IZ0A 5AW3B 2Q5UA 1FJPA 2KNCB 2P58A 4L76A 2G3AA 2MJZA 1S5LE 2H88C 2R3SA 3A2AA 3AE3C 1M8OB 2FXOA 5APXA 2A06E 1KQLA 1ZP0C 5CCGC 1FZCA 3FWLA 3TYYA 4PV1C 3M0AA 2NPSC 2IYOA 1VQ8P 4PV1B 2NZ2A 1R8EA 3H1LD 4I2LC 1NH4A 5KJ7D 1KZUB 3Q3DA 1S4XA 3B71A 3A0BH 5AVSB 3H1LE 4UB6H 3M0DC 4U7JA 5KAIH 1GTWA 1NTZE 1IFDA 5CHXA 5AVZB 2JDIH 3Q2YA 5BU8B 2A06G 2C9NY 5KLIC 4ZNCA 4AUWA 1NU1D 1DD4A 1FOSE 1NTKJ 1PGJA 1RF0A 1VL2A 2KSEA 2WZ7A 3L37A 1GD2E 1NU1E 3CWBD 3L71D 2WPVB 3I5CA 1JY3N 1KILA 2ZXXA 1URQC 3H1LG 5H2FE 3CXHI 1FZCB 1L0NK 2ZXEB 1NTZG 1ZN5A 3AEEC 3VTPC 3CXHD 1WT6A 2HR3A 4GOFA 3R4YA 2FBWC 2ITAA 3H32A 2HPCA 3BVHA 2P7JA 3Q5SA 3E1IA 1VPCA 4JYBA 4BXLA 1GU5A 1USEA 3BCCJ 2RKLA 5APWA 3AE6C 2KZIA 4Y99C 1NYHA 5KTBA 2XKMA 4PJ0E 1KILB 3FGAD 1G1JA 3B8EB 1BE3J 2WMMA 3L70E 2YXRB 3H1JD 2FYNB 3A7OA 2OYHC 1IK9A 3M9HA 3QH9A 2OYHB 2PFXA 1KTMA 5APYA 1LTSC 4IOIH 3AE7C 1E79H 2AXTE 2ZVNB 3VP8A 1SFCA 1EXIA 1J1EB 1JY3P 3U1AA 4H44D 3LIDA 1JTHA 1W2EA 1BCCE 3L70G 2KUBA 3KZIH 2K9JA 2KYVA 2SPZA 3C8VA 4TLFA 4WB4A 1LTBC 4WY4D 3W68A 1VDFA 4OH8B 3UIAA 2GM4A 1SQVJ 1FZGA 1KMIZ 2POHA 2VRSA 2P67A 1LTJA 3RGUA 2KOGA 5KKZC 4DOJA 2CPSA 3A0HE 1BCCG 1KQFB 1L0LJ 5KKZB 1Q82Q 1S1CX 5KJ7A 2E74C 1GL2C 5KLVD 3PH0A 2BCCJ 1LT1A 1N7SC 1JTHB 3HRNA 4QMAA 1FE6A 1CI6A 1NU1K 4KT0J 3JCUE 3LIEA 4OGQD 1LP1A 1QL2A 1VF5C 2Q7CA 2FYZA 4A7PA 3CL3D 1SQQE 2WPQA 4YPCA 1N73C 2ZJSE 4DJGA 3D70A 3TNUB 1KN7A 2W27A 1XTCC 2WSEJ 1LJ2A 2B88A 4NPEA 3HTKB 4MN4C 1UIXA 3PP5A 3L74J 2IBZI 3KQGA 4HJGH 3C1LA 4WBAA 2YO3A 2IBZD 4PD4H 2FFDC 3L75J 3IAOA 3BASA 4NPDA 3HD7D 1A02J 1SQQG 1L0NJ 1SQXE 3H1KE 2M0BA 4U3FD 1K73Q 3HE4A 4XA4A 1M1JA 2O1KA 1QVFO 1G2CB 2ZYDA 1IFPA 1NKNA 4AQRD 1NOHA 1KQSO 1FS0E 1R5LA 3CCLP 2KLVA 1EDLA 1LNQA 1OIPA 2OYIC 4XE5B 1RE3A 2OYIB 4RKUJ 1JO5A 2K9YA 1PP9E 1M7LA 1SQXG 3H1KG 3GW6A 2QIWA 2QJYC 3EFGA 2L5GB 2YIUB 1CZQA 1NTMG 1LWUB 4W7ZA 3TGUG 3NXSA 2HLOA 1P84E 2J58A 5AW1B 1Q7YQ 1JCCA 1R5SA 4I1LA 1PP9G 1H88A 1DH3A 5TISH 4JF7A 2JR8A 1N2DC 3WU2H 1IFJA 3CCRP 4HYTB 2I8DA 1RF1C 1M1KQ 2CPBA 3AEAC 2P1JA 3FX0A 5AW6B 1RF1B 1OXZA 2QG4A 3L75D 4N3YB 1YTZI 1H0TA 1HGZA 3GF3A 3L72G 1YQ3C 1Q90D 2P10A 1N86A 4GIFA 4HH2A 1BDCA 4K3AA 1S5LH 3L73D 3CMEP 2W6JH 2XNDH 2WT7B 5KLVK 2Y0EA 3H1HG 4BWNA 3L73E 5DJTB 1S72P 2ZFCA 3V2QA 2C0XA 4GT1A 1SS1A 1RE4C 2Z5IA 1U57A 4H44C 1JM0A 3H1LJ 3KHUA 5AVYB 5APVA 4H44B 4IL6X 4BRYA 1PGOA 2N1TA 1FAVA 1NAFA 3WUUA 4WY4C 1NVOA 4WY4B 1X22A 1Y8AA 2K1AA 1EXJA 3KPEA 1MFZA 5CJ4A 1VQ5P 3L73G 3S9OA 1NU1J 3VMAA 2AXCA 3MD0A 3IFMA 3CWBJ 3L71J 3CCUP 1AA0A 3T97A 3G9RA 1SFCD 2V7QJ 1U7MA 5M1BA 5CCGA 3IR9A 1Q2NA 2V7QH 2NPSA 4M3LA 1ZV8A 2C9LY 1GK6A 2KXPB 2B87B 3CXHH 3M0DA 4OGQB 4N6JA 1YITP 2A06D 1BGYE 2KIKA 1MUUA 1S3JA 1T3UA 3TSIA 3HE5A 2R3CA 4PJ0H 1PZQA 4LGDE 1NTZD 3ZDMA 3PJSK 2L91A 3GHGB 3H1JJ 1LTAC 3RK3E 2HODA 3HUSB 2QJKC 1RQVA 3HD7B 2QJKB 2E43A 2KS1B 1BGYG 2XU6A 2YKOA 4D6TD 3EQ2A 1ZOYC 1H8AA 1HF9A 2JJLA 2AXTH 2BEQD 4D6TE 4ASWA 3G71P 1BCCJ 3EFFK 5AW5B 1SQPE 1FZCC 5C39A 1SQBE 1WMKA 4UB8E 3HE5B 1N7LA 3P7KA 2B9BA 3CMAP 5CCHA 3M06A 4D6TG 2PRRA 4EI2A 4R4MA 4EOTA 3M9QA 4IFMA 2E5YA 1GU4A 1JB0J 3A0HH 1SQPG 1FJKA 4WWIA 2WPRA 1SP4A 1SQBG 3N7NA 3L35A 3VP9A 1A02F 3B4SA 1Y9BA 2WQYC 1JCDA 3CX5I 1KILC 5KLVJ 3RBXA 3L70D 1FZAA 2DW3A 2Q1KA 1TU3F 4TT3H 1VQ4P 2ZT9D 3SWKA 2E76D 3CX5D 1M56D 2FXMA 1MZ9A 2FYNC 2KSJA 3RL0D 3CX5E 3M9BA 3O6QA 2O01N 4I7ZC 5E79E 4I7ZB 5AW0B 3Q5RA 1JMMA 5AW9B 4UB6E 3TF5A 1NO4A 1VQOP 1KYOI 3ABVC 1OX3A 5KAIE 1CSBA 3H32B 2HPCB 1SLQA 1J1EC 2Q3IA 1BCCD 5B5EE 5BVZA 1RY3A 2AEJA 1JY2N 1T8ZA 1G1IA 1KYOE 4EDFA 3H25A 4N78E 3PHLA 5AW4B 1KB9I 2B89A 4I6MC 4GOEA 1RH5B 1NTKE 1BDDA 5GTHE 4NPFX 4U3FJ 2R5DA 1KB9D 3SFEC 3CCQP 4RO0A 1N7SA 1NJIQ 2Y9YA 1VQLP 1D7MA 2LR2A 1KB9E 3V2NA 3U1CA 2FXPA 2JWAA 4ZKUA 1WRGA 3AE2C 5K5GB 2Z5HA 3CCEP 2QJPB 2I1JA 4EYYQ 1HBWA 2OTLP 1NTZK 5AVXB 1LTTC 1XTGB 1PP9J 5APUA 1HGVA 2O3JA 2WSSH 1SFCC 1KORA 2C0WA 1NTKG 1SFCB 2KP8A 2QE7H 3FXDA 3KYQA 2K9JB 2J5UA 2N1TD 3PTZA 1J2JB 3BCCE 1AJYA 5B66E 1SQQD 2YMKA 2FFDA 3NTNA 2CK3H 1AFOA 1P84H 1FC2C 3V2RA 4GODA 2LXCB 4XFJA 2KB7P
chains in the Genus database with same CATH topology
1GZLA 1RF1C 2CPBA 4Y99B 1FZFA 2E42A 2P1JA 2MJZA 3II6A 3A2AA 1LTJC 5AW6B 1RF1B 1YYCA 1OXZA 4N3YB 1YTZI 4LC1A 5APXA 1LTJB 1HGZA 1KQLA 5AVWB 5CCGC 1FZCA 3TYYA 5CCHC 1LT9A 3M0AA 1N86A 2NPSC 5CCGD 4GIFA 4HH2A 5KJ7C 4W7YA 1Z56A 4I2LC 1NH4A 2NPSD 3BRTB 2YMYA 5KJ7D 2IFMA 1KZUB 2WT7B 5KLVK 2M3BA 5AVSB 3CLQA 3M0DC 2Q9IA 4N78D 2ZFCA 3V2QA 2C0XA 4GT1A 1GTWA 3B5ND 5AW7B 1RE4C 1IFDA 2Z5IA 1CI6B 3NMDA 1E5WA 1FDMA 1L4AD 2P2UA 3BRVB 2XNXA 3L4FA 1JOCA 5CHXA 5APVA 5AVYB 5AVZB 2WTYA 1NWQA 2IPPA 5BU8B 1GL2A 1GK4A 3U59A 1NHLA 2C9NY 2N1TA 3TK1A 4AUWA 3OJAB 1FAVA 1NAFA 1FOSE 4WY4C 1RF0A 4AYCA 3MGNA 2WZ7A 3L37A 1GD2E 4WY4B 3O8ZA 3I5CA 1JY3N 1KILA 3KPEA 1URQC 5APTA 1MFZA 5CJ4A 2WSCH 1N73A 1FZCB 1L0NK 3VMZA 1URQD 2ZXEB 5AW2B 3VOPA 3NFQA 3MD0A 1ZN5A 3IFMA 3TNUA 1X79B 1LWUC 3VTPC 3VN0A 1GDTA 2PP6A 3HTKA 2W6BA 3MUDA 3M91A 2WSFH 3T97A 1SFCD 4ZKPA 1WT6A 1T3JA 2GUSA 5CCGA 3IR9A 3HE4B 4IFFA 1M1JB 3LW5H 2NPSA 4M3LA 2PAJA 3H32A 3WMM0 1S9KE 1ZV8A 3BVHA 2HPCA 2P7JA 2I1KA 1FBMA 1DEBA 2C9LY 1OWAA 3VMYA 4KHXA 3E1IA 1SQPK 1GK6A 1VPCA 4JYBA 1GU5A 1GL2B 3RK2C 3B5NA 3M0DA 1SQBK 3OA7A 5APWA 3RK2B 1N7SB 4N6JA 1L4AA 1G2CA 1RE3C 4Y99C 2A45I 1RE4A 5AVQB 2HYNA 5KTBA 2XKMA 1KILB 1G1JA 1JY2P 3B8EB 1MUUA 3A5TA 3RL0C 3P8CE 1T3UA 3RL0B 2WWWA 3TSIA 1N73B 4IFDK 1CW5A 3V4WA 1IFNA 4C7NA 1FOSF 2OYIA 2GUVA 1HH0A 3HE5A 5CCHD 3A7OA 2R3CA 2OYHC 3MIWA 1IK9A 3M9HA 2W6AA 3V4QA 2OYHB 3RK3C 5APYA 2WSEH 1LTSC 2WITA 4LGDE 3RK3B 2R5BA 2IX7C 2N9BA 5CMZA 5AVRB 5AW8B 2A45H 3GHGB 1LTAC 1X9VA 3SWFA 2HODA 2H7HA 3HUSB 1LWUA 3VP8A 1SQQK 2FFDB 1SFCA 3HD7B 1J1DC 1JY3P 1J1EB 3U1AA 3L36A 3LIDA 2E43A 2XU6A 1J1DB 1X8YA 1JTHA 2YKOA 1W2EA 1MV8A 1LGHB 3V2PA 3EQ2A 1HWTC 1H8AA 2KYVA 2H8PD 2JJLA 2A45G 4WB4A 1NKZB 1LTBC 4WY4D 1FU1A 3CI9A 5AW5B 5APQA 1FZCC 1VDFA 3N4XA 2WPSA 1JUNA 4OH8B 1LT9C 1KFMA 3UIAA 1LT9B 2GM4A 1SVFA 3OAKA 3HE5B 5BU5A 1QL1A 1RF1A 1FZGA 2POHA 2VRSA 2P67A 1T2KC 1SQXK 4O9BA 1LTJA 1PFIA 2KOGA 1N7LA 5AVUB 3BATA 1KFNA 2CPSA 3P7KA 4DOJA 1IC2A 1S9KD 4LLHA 2O1JA 2R32A 1M1JC 5CCHA 3M06A 1NTMK 2M8RA 1NTKK 5KJ7A 2YNYA 4EOTA 1GL2C 1HJBA 2WT7A 1HVVA 3M9QA 5AVVB 4IFMA 1GU4A 1GL2D 2N1TC 1N7SC 1JTHB 3HRNA 4RESB 1H89A 1HTLC 2Z4EA 1FJKA 3P8MC 2N1TB 2WPRA 1SP4A 3RK2D 3N7NA 3L35A 3VP9A 1IJDB 1CI6A 1N7SD 1NU1K 1A02F 3LIEA 2IFNA 2QM8A 1JCDA 1QL2A 1KILC 2Q7CA 2FYZA 1FZAA 3A3YB 3P8CD 3CL3D 2WPQA 1KILD 3V5BA 1N73C 1ZLLA 2H43A 3SWYA 2FXMA 1MZ9A 3RL0D 2KSJA 2XZRA 4WY4A 1FZBA 3TNUB 3M9BA 2W27A 1XTCC 3HTKB 3PP5A 1JY2O 5AW0B 3P32A 1AQ5A 1JMMA 5AW9B 1NO4A 1URQA 1ZR2A 4W80A 2HG5D 3GHGC 3KQGA 3RK3D 2YKQA 1CSBA 1YTZT 3HUSC 4WBAA 2YO3A 4EIJA 2NPSB 2FFDC 3H32B 3HD7C 2HPCB 1SLQA 1J1EC 2Q3IA 4C7RA 5BVZA 1RY3A 3BASA 3HD7D 1JY2N 1A02J 1T8ZA 1G1IA 3B5NC 2OARA 3B5NB 3HE4A 4XA4A 1L4AC 1GW3A 1M1JA 2O1KA 4N78E 4B86A 1L4AB 1G2CB 5AW4B 1NKNA 4I6MC 1IFIA 1JY3O 4AQRD 2XV5A 1LTGC 5APSA 1NOHA 1FZEA 2YO2A 3KDPB 2R5DA 2KLVA 1N7SA 2OYIC 4XE5B 1RE3A 4GKGA 3V2NA 4C7NB 2HFED 3U1CA 2OYIB 2JEEA 2XDJA 2O01H 1JO5A 3C9IA 4ZKUA 1WRGA 1ZR4A 2Z5HA 1HUCA 2I1JA 1M7LA 3R2PA 1HBWA 2LKMA 1T2KD 2FYUK 1URQB 1GW4A 1NTZK 5CJ0A 5AVXB 3EFGA 1LTTC 2FKWB 3G3ZA 2BASA 1XTGB 5APUA 2L5GB 3VYIA 1HGVA 1SFCC 1CZQA 2HODB 2OYHA 3MTUE 1LWUB 2C0WA 4W7ZA 1SFCB 2QM7A 2J59M 2YKPA 3NXSA 4C46A 2HLOA 2KP8A 1EQ7A 1JNMA 2J58A 4JYCA 5AW1B 3KYQA 3GHGA 5AVTB 1RF0C 1IO4A 2N1TD 1J2JB 1JCCA 3HUSA 4I1LA 2FFDA 3HD7A 3VMXA 1SQVK 3NTNA 1AFOA 1H88A 3H6PA 1DH3A 3V2RA 4DZOA 1LTIC 1DX7A 4JF7A 1L0LK 1N2DC 1IFJA 5AW3B 2KB7P 4HYTB 2Q5UA 1FJPA 1IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U1A A;  5BVZ A;  3BAS A;  3N4X A;  3U59 A;  4I1L A;  4N3Y B;  5KTB A;  3OJA B;  4N78 D;  1X79 B;  3P8C D;  3U1C A;  5BU5 A;  2JEE A;  2POH A;  1NKN A;  3C9I A;  4O9B A;  4ZKU A;  4GIF A;  3BAT A;  3HRN A;  4ZKP A;  1WT6 A;  2FXM A;  3VP8 A;  1IC2 A;  5BU8 B;  3N7N A;  3VP9 A; 
#chains in the Genus database with same CATH topology
 3I55 P;  1GZL A;  1FZF A;  1W5C E;  4GDO A;  1LTJ C;  1YYC A;  1LTJ B;  1DEE G;  1PV3 A;  3AEB C;  3CCS P;  2M5A A;  2IZ1 A;  5AVW B;  1LT9 A;  5CCG D;  3BCC G;  5KJ7 C;  4W7Y A;  1OVU A;  1Z56 A;  1SQX D;  3H1K D;  2NPS D;  3BRT B;  1X0T A;  3EWK A;  2M3B A;  3CLQ A;  2Y0D A;  3KZI E;  5AW7 B;  1NTM D;  1CI6 B;  3NMD A;  4R4L A;  3TGU D;  1QLE D;  3BRV B;  1LP1 B;  3L73 J;  2IPP A;  1NTM E;  3RBZ A;  3MHV A;  3PLN A;  3TGU E;  4HKZ H;  3TK1 A;  3OJA B;  4AYC A;  1PP9 D;  3MGN A;  3O8Z A;  1AV1 A;  2BEZ F;  5APT A;  1SQV E;  1P84 I;  1EDI A;  1AQT A;  3VMZ A;  1YHQ P;  2GA1 A;  1URQ D;  2YIU C;  4DT0 A;  1L0L E;  1X79 B;  1LWU C;  2WSF J;  1P84 D;  2PP6 A;  2V4H A;  1GDT A;  2W6B A;  3L72 D;  3MUD A;  2WSF H;  2JP3 A;  4ZKP A;  3L72 E;  1IK7 A;  3HE4 B;  2D2C D;  1M1J B;  1YBK A;  3WMM 0;  1S9K E;  2PAJ A;  1ZRT D;  1PL5 A;  1FBM A;  3H1H D;  1DEB A;  3I56 P;  2QRX A;  1ZRT E;  3G6E P;  2MKV A;  3H1H E;  1KC8 Q;  1SQV G;  3B5N A;  5KAF E;  3OA7 A;  1AVY A;  1S5L X;  1L4A A;  1RE3 C;  2A45 I;  1RE4 A;  1L0L G;  3AE4 C;  3AE5 C;  2ZT9 B;  4L75 A;  2E76 B;  3RL0 C;  1MKM A;  3L74 E;  3P8C E;  3RL0 B;  1FDI A;  1CW5 A;  3V4W A;  1IFN A;  2BCC G;  4C7N A;  3USS A;  5CCH D;  4PD4 E;  3MIW A;  1K05 A;  3V4Q A;  4L74 A;  2FYU D;  1RQU A;  2ZAE B;  2AEF A;  5AW8 B;  2FYU E;  1L0N E;  2H89 C;  4JQ0 D;  1FDO A;  1X9V A;  1PPJ G;  4CPG A;  1SQQ K;  3L36 A;  1M57 D;  1NTZ J;  1X8Y A;  1MV8 A;  1LGH B;  3WUT A;  3L74 G;  2H8P D;  2A45 G;  1NKZ B;  3CC7 P;  2RN0 A;  5APQ A;  1H0T B;  4D6T J;  3N4X A;  2WPS A;  3ITK A;  1JUN A;  2FY8 A;  2FYU G;  1KFM A;  1L0N G;  2KNC A;  1SVF A;  3OAK A;  1QL1 A;  1SQX K;  4K35 A;  5AVU B;  5H2F H;  3BAT A;  2QSI A;  3AE8 C;  1KFN A;  1IC2 A;  2JKV A;  4UB8 H;  4ZMD A;  1ZME C;  1NTM K;  2M8R A;  2YNY A;  1HJB A;  1HVV A;  1AVO A;  2E74 D;  1GL2 D;  2N1T C;  4BRY B;  4OGQ C;  3CC4 P;  4RES B;  1H89 A;  2Z4E A;  3P8M C;  2N1T B;  3RK2 D;  1IJD B;  1N7S D;  3WU2 E;  2W83 C;  2IFN A;  2QM8 A;  1BGY D;  1W2B O;  2W90 A;  3RL0 g;  1VF5 D;  2QVA A;  3GG2 A;  2ZYA A;  2H43 A;  1M90 Q;  1K9M Q;  3H1I E;  5GTI E;  3L70 J;  1VQM P;  1JY2 O;  5DJU B;  2Q6Q A;  3T97 B;  1OW6 A;  3K5B A;  1URQ A;  4W80 A;  3GHG C;  3RK3 D;  1Y47 A;  2YKQ A;  1YTZ T;  3CX5 H;  3HUS C;  4EIJ A;  2NPS B;  1YJW P;  3HD7 C;  5E79 H;  3AED C;  2K88 A;  2JO1 A;  4H13 D;  2OAR A;  4B86 A;  3CC2 P;  4OVN F;  1DIP A;  3H1I G;  1VQ6 P;  1SQP D;  5B5E H;  4YTP C;  2XV5 A;  1LTG C;  1FZE A;  2YO2 A;  1KYO H;  1SQB D;  3KDP B;  3KXD A;  5KLI B;  3GLM A;  4IL6 E;  4GKG A;  1VQN P;  2XDJ A;  3C9I A;  2ZYG A;  1KV4 A;  5GTH H;  3FWN A;  4OWF A;  3CWB E;  1HUC A;  3L71 E;  1ZXG A;  2LKM A;  1T2K D;  2FYU K;  1URQ B;  1GW4 A;  5CJ0 A;  1KD1 Q;  1RHZ B;  2FKW B;  3G3Z A;  1DD3 A;  1KB9 H;  2KLU A;  2OQQ A;  3VYI A;  2HOD B;  1EDK A;  2OYH A;  3MTU E;  1OMI A;  3MP7 B;  3GMA A;  2QM7 A;  2J59 M;  2YKP A;  4C46 A;  2UWJ E;  1ZW0 A;  3CXH E;  2D2C C;  4JYC A;  2W8Z A;  1QX8 A;  2NRG A;  1L2P A;  2D2C B;  2RMZ A;  1RF0 C;  1IO4 A;  3D6Y A;  1NU1 G;  2YXQ B;  3CWB G;  3L71 G;  3H6P A;  4DZO A;  3SSU A;  1LTI C;  3JCU H;  1U7J A;  5B66 H;  1IFM A;  1SQQ J;  4Y99 B;  2E42 A;  1JMB A;  2OTJ P;  3II6 A;  4LC1 A;  3A0B E;  5CBN A;  5CCH C;  4H0L D;  2JWD A;  1KYO D;  3AEC C;  2YMY A;  2IFM A;  3H1J E;  3SFD C;  2Q9I A;  1PIX A;  4N78 D;  2Y9Z A;  3B5N D;  5L8R J;  1NTK D;  2E75 D;  1E5W A;  3JC2 2;  1FDM A;  1L4A D;  2P2U A;  1SQX J;  2XNX A;  3H1K J;  1JOC A;  1OFC X;  3L4F A;  2WTY A;  3CCM P;  1NWQ A;  4RJT A;  1GL2 A;  1GK4 A;  3U59 A;  1NHL A;  5EFW B;  1NTM J;  1OW7 A;  3FXE A;  2ZVO B;  1QEX A;  1K04 A;  2RH0 A;  3MZW B;  3TGU J;  3V6I A;  3O6Q B;  2WSC J;  2QJP C;  3AEG C;  3H1J G;  2WSC H;  2R44 A;  1N73 A;  1PGP A;  1EDJ A;  5AW2 B;  3VOP A;  1OW8 A;  3NFQ A;  3TNU A;  3VN0 A;  1KQG B;  3AE9 C;  3HTK A;  3M91 A;  3LW5 J;  1T3J A;  2GUS A;  3BCC D;  3GF7 A;  5TJH A;  3S1K A;  4IFF A;  3LW5 H;  1HJ0 A;  2I1K A;  1NAY A;  1OWA A;  3VMY A;  3L72 J;  4KHX A;  1SQP K;  2E74 B;  4Z1M H;  1GL2 B;  2OTK E;  3G4S P;  2QA4 P;  3RK2 C;  3D6Z A;  5KLV E;  1SQB K;  1BE3 D;  3RK2 B;  1N7S B;  5CBO A;  1G2C A;  1BE3 E;  3H1H J;  4WVZ A;  5AVQ B;  2HYN A;  1VF5 B;  3IN6 A;  1JY2 P;  3A5T A;  5KAF H;  2M3E A;  1N73 B;  2WWW A;  3WUV A;  4IFD K;  2G8Y A;  2PGD A;  4YXD C;  1VQP P;  1FOS F;  2OYI A;  2GUV A;  1HH0 A;  1YQ4 C;  1YI2 P;  2IDB A;  4JBZ A;  4PV1 D;  1QVG O;  2W6A A;  1Q86 Q;  3RK3 C;  2WSE H;  2WIT A;  3RK3 B;  2R5B A;  2IX7 C;  5KLV G;  2K37 A;  1UII A;  2N9B A;  2Q3E A;  1NGM B;  5CMZ A;  5AVR B;  2A45 H;  1BE3 G;  3SWF A;  2H7H A;  1LWU A;  2FFD B;  1J1D C;  1QGK B;  4H13 C;  2IBZ E;  2FYU J;  1J1D B;  4H13 B;  1GMJ A;  1BSN A;  1VQK P;  3V2P A;  1YJN P;  1HWT C;  1Q81 Q;  3AEF C;  2OGU A;  3TDK A;  3CD6 P;  4U3F E;  4KJM A;  1SQV D;  1FU1 A;  3CI9 A;  4ASV A;  3CCV P;  2OYO A;  1MFT A;  2M5A B;  1BSH A;  1L0L D;  1LT9 C;  1LT9 B;  4DCK A;  2QEX P;  1S2E A;  5BU5 A;  1RF1 A;  2E5T A;  1T2K C;  4O9B A;  1PFI A;  2IBZ G;  4JPZ B;  2BCC D;  1S9K D;  4LLH A;  2O1J A;  2R32 A;  1M1J C;  2QJY B;  2BCC E;  4U3F G;  1NTK K;  2K3R A;  2N9Y B;  2WT7 A;  5AVV B;  1YJ9 P;  1EZV I;  2KZJ A;  1JEK A;  1VQ9 P;  1HTL C;  1PPJ D;  1OZH A;  1EZV D;  1VQ7 P;  1PPJ E;  1USD A;  1IZN B;  1EZV E;  4PD4 I;  2ZT9 C;  3A3Y B;  2E76 C;  3L74 D;  3P8C D;  1KIL D;  3V5B A;  3F5H A;  1ZLL A;  4PD4 D;  3Q1M A;  1KIL E;  3SWY A;  1K8A Q;  2XZR A;  4WY4 A;  1FZB A;  1BGY J;  2WVR A;  3MUD C;  1N8R Q;  3P32 A;  1AQ5 A;  1L0N D;  4L73 A;  1ZR2 A;  3H1I J;  3L75 E;  2HG5 D;  3CPW O;  4H0L C;  3D71 A;  4H0L B;  3AE1 C;  5GTI H;  4C7R A;  1EZV G;  2KI7 B;  3B5N C;  2E75 C;  3B5N B;  1L4A C;  2LXB A;  1GW3 A;  2E75 B;  3JSV C;  1L4A B;  1YIJ P;  1IFI A;  1JY3 O;  1OVR A;  1OVV A;  2B87 A;  3F89 A;  5APS A;  3CCJ P;  1PGQ A;  3OW2 O;  3W67 A;  3L75 G;  2O01 J;  4C7N B;  2HFE D;  2JEE A;  1SQP J;  2O01 H;  1ZR4 A;  1SQB J;  3E7K A;  3R2P A;  1T6A A;  4IL6 H;  2BAS A;  4HB1 A;  2KK7 A;  1EC5 A;  4YXW H;  1EQ7 A;  1JNM A;  2IYP A;  4Y28 J;  3GHG A;  5AVT B;  3S4R A;  5TIS E;  3PRJ A;  3IF4 A;  3E1R A;  3Q5P A;  3HUS A;  3HD7 A;  3VMX A;  3QWO C;  2Y0C A;  1SQV K;  2KS1 A;  2AEM A;  3H1I D;  1DX7 A;  1L0L K;  2IZ0 A;  5AW3 B;  2Q5U A;  1FJP A;  2KNC B;  2P58 A;  4L76 A;  2G3A A;  2MJZ A;  1S5L E;  2H88 C;  2R3S A;  3A2A A;  3AE3 C;  1M8O B;  2FXO A;  5APX A;  2A06 E;  1KQL A;  1ZP0 C;  5CCG C;  1FZC A;  3FWL A;  3TYY A;  4PV1 C;  3M0A A;  2NPS C;  2IYO A;  1VQ8 P;  4PV1 B;  2NZ2 A;  1R8E A;  3H1L D;  4I2L C;  1NH4 A;  5KJ7 D;  1KZU B;  3Q3D A;  1S4X A;  3B71 A;  3A0B H;  5AVS B;  3H1L E;  4UB6 H;  3M0D C;  4U7J A;  5KAI H;  1GTW A;  1NTZ E;  1IFD A;  5CHX A;  5AVZ B;  2JDI H;  3Q2Y A;  5BU8 B;  2A06 G;  2C9N Y;  5KLI C;  4ZNC A;  4AUW A;  1NU1 D;  1DD4 A;  1FOS E;  1NTK J;  1PGJ A;  1RF0 A;  1VL2 A;  2KSE A;  2WZ7 A;  3L37 A;  1GD2 E;  1NU1 E;  3CWB D;  3L71 D;  2WPV B;  3I5C A;  1JY3 N;  1KIL A;  2ZXX A;  1URQ C;  3H1L G;  5H2F E;  3CXH I;  1FZC B;  1L0N K;  2ZXE B;  1NTZ G;  1ZN5 A;  3AEE C;  3VTP C;  3CXH D;  1WT6 A;  2HR3 A;  4GOF A;  3R4Y A;  2FBW C;  2ITA A;  3H32 A;  2HPC A;  3BVH A;  2P7J A;  3Q5S A;  3E1I A;  1VPC A;  4JYB A;  4BXL A;  1GU5 A;  1USE A;  3BCC J;  2RKL A;  5APW A;  3AE6 C;  2KZI A;  4Y99 C;  1NYH A;  5KTB A;  2XKM A;  4PJ0 E;  1KIL B;  3FGA D;  1G1J A;  3B8E B;  1BE3 J;  2WMM A;  3L70 E;  2YXR B;  3H1J D;  2FYN B;  3A7O A;  2OYH C;  1IK9 A;  3M9H A;  3QH9 A;  2OYH B;  2PFX A;  1KTM A;  5APY A;  1LTS C;  4IOI H;  3AE7 C;  1E79 H;  2AXT E;  2ZVN B;  3VP8 A;  1SFC A;  1EXI A;  1J1E B;  1JY3 P;  3U1A A;  4H44 D;  3LID A;  1JTH A;  1W2E A;  1BCC E;  3L70 G;  2KUB A;  3KZI H;  2K9J A;  2KYV A;  2SPZ A;  3C8V A;  4TLF A;  4WB4 A;  1LTB C;  4WY4 D;  3W68 A;  1VDF A;  4OH8 B;  3UIA A;  2GM4 A;  1SQV J;  1FZG A;  1KMI Z;  2POH A;  2VRS A;  2P67 A;  1LTJ A;  3RGU A;  2KOG A;  5KKZ C;  4DOJ A;  2CPS A;  3A0H E;  1BCC G;  1KQF B;  1L0L J;  5KKZ B;  1Q82 Q;  1S1C X;  5KJ7 A;  2E74 C;  1GL2 C;  5KLV D;  3PH0 A;  2BCC J;  1LT1 A;  1N7S C;  1JTH B;  3HRN A;  4QMA A;  1FE6 A;  1CI6 A;  1NU1 K;  4KT0 J;  3JCU E;  3LIE A;  4OGQ D;  1LP1 A;  1QL2 A;  1VF5 C;  2Q7C A;  2FYZ A;  4A7P A;  3CL3 D;  1SQQ E;  2WPQ A;  4YPC A;  1N73 C;  2ZJS E;  4DJG A;  3D70 A;  3TNU B;  1KN7 A;  2W27 A;  1XTC C;  2WSE J;  1LJ2 A;  2B88 A;  4NPE A;  3HTK B;  4MN4 C;  1UIX A;  3PP5 A;  3L74 J;  2IBZ I;  3KQG A;  4HJG H;  3C1L A;  4WBA A;  2YO3 A;  2IBZ D;  4PD4 H;  2FFD C;  3L75 J;  3IAO A;  3BAS A;  4NPD A;  3HD7 D;  1A02 J;  1SQQ G;  1L0N J;  1SQX E;  3H1K E;  2M0B A;  4U3F D;  1K73 Q;  3HE4 A;  4XA4 A;  1M1J A;  2O1K A;  1QVF O;  1G2C B;  2ZYD A;  1IFP A;  1NKN A;  4AQR D;  1NOH A;  1KQS O;  1FS0 E;  1R5L A;  3CCL P;  2KLV A;  1EDL A;  1LNQ A;  1OIP A;  2OYI C;  4XE5 B;  1RE3 A;  2OYI B;  4RKU J;  1JO5 A;  2K9Y A;  1PP9 E;  1M7L A;  1SQX G;  3H1K G;  3GW6 A;  2QIW A;  2QJY C;  3EFG A;  2L5G B;  2YIU B;  1CZQ A;  1NTM G;  1LWU B;  4W7Z A;  3TGU G;  3NXS A;  2HLO A;  1P84 E;  2J58 A;  5AW1 B;  1Q7Y Q;  1JCC A;  1R5S A;  4I1L A;  1PP9 G;  1H88 A;  1DH3 A;  5TIS H;  4JF7 A;  2JR8 A;  1N2D C;  3WU2 H;  1IFJ A;  3CCR P;  4HYT B;  2I8D A;  1RF1 C;  1M1K Q;  2CPB A;  3AEA C;  2P1J A;  3FX0 A;  5AW6 B;  1RF1 B;  1OXZ A;  2QG4 A;  3L75 D;  4N3Y B;  1YTZ I;  1H0T A;  1HGZ A;  3GF3 A;  3L72 G;  1YQ3 C;  1Q90 D;  2P10 A;  1N86 A;  4GIF A;  4HH2 A;  1BDC A;  4K3A A;  1S5L H;  3L73 D;  3CME P;  2W6J H;  2XND H;  2WT7 B;  5KLV K;  2Y0E A;  3H1H G;  4BWN A;  3L73 E;  5DJT B;  1S72 P;  2ZFC A;  3V2Q A;  2C0X A;  4GT1 A;  1SS1 A;  1RE4 C;  2Z5I A;  1U57 A;  4H44 C;  1JM0 A;  3H1L J;  3KHU A;  5AVY B;  5APV A;  4H44 B;  4IL6 X;  4BRY A;  1PGO A;  2N1T A;  1FAV A;  1NAF A;  3WUU A;  4WY4 C;  1NVO A;  4WY4 B;  1X22 A;  1Y8A A;  2K1A A;  1EXJ A;  3KPE A;  1MFZ A;  5CJ4 A;  1VQ5 P;  3L73 G;  3S9O A;  1NU1 J;  3VMA A;  2AXC A;  3MD0 A;  3IFM A;  3CWB J;  3L71 J;  3CCU P;  1AA0 A;  3T97 A;  3G9R A;  1SFC D;  2V7Q J;  1U7M A;  5M1B A;  5CCG A;  3IR9 A;  1Q2N A;  2V7Q H;  2NPS A;  4M3L A;  1ZV8 A;  2C9L Y;  1GK6 A;  2KXP B;  2B87 B;  3CXH H;  3M0D A;  4OGQ B;  4N6J A;  1YIT P;  2A06 D;  1BGY E;  2KIK A;  1MUU A;  1S3J A;  1T3U A;  3TSI A;  3HE5 A;  2R3C A;  4PJ0 H;  1PZQ A;  4LGD E;  1NTZ D;  3ZDM A;  3PJS K;  2L91 A;  3GHG B;  3H1J J;  1LTA C;  3RK3 E;  2HOD A;  3HUS B;  2QJK C;  1RQV A;  3HD7 B;  2QJK B;  2E43 A;  2KS1 B;  1BGY G;  2XU6 A;  2YKO A;  4D6T D;  3EQ2 A;  1ZOY C;  1H8A A;  1HF9 A;  2JJL A;  2AXT H;  2BEQ D;  4D6T E;  4ASW A;  3G71 P;  1BCC J;  3EFF K;  5AW5 B;  1SQP E;  1FZC C;  5C39 A;  1SQB E;  1WMK A;  4UB8 E;  3HE5 B;  1N7L A;  3P7K A;  2B9B A;  3CMA P;  5CCH A;  3M06 A;  4D6T G;  2PRR A;  4EI2 A;  4R4M A;  4EOT A;  3M9Q A;  4IFM A;  2E5Y A;  1GU4 A;  1JB0 J;  3A0H H;  1SQP G;  1FJK A;  4WWI A;  2WPR A;  1SP4 A;  1SQB G;  3N7N A;  3L35 A;  3VP9 A;  1A02 F;  3B4S A;  1Y9B A;  2WQY C;  1JCD A;  3CX5 I;  1KIL C;  5KLV J;  3RBX A;  3L70 D;  1FZA A;  2DW3 A;  2Q1K A;  1TU3 F;  4TT3 H;  1VQ4 P;  2ZT9 D;  3SWK A;  2E76 D;  3CX5 D;  1M56 D;  2FXM A;  1MZ9 A;  2FYN C;  2KSJ A;  3RL0 D;  3CX5 E;  3M9B A;  3O6Q A;  2O01 N;  4I7Z C;  5E79 E;  4I7Z B;  5AW0 B;  3Q5R A;  1JMM A;  5AW9 B;  4UB6 E;  3TF5 A;  1NO4 A;  1VQO P;  1KYO I;  3ABV C;  1OX3 A;  5KAI E;  1CSB A;  3H32 B;  2HPC B;  1SLQ A;  1J1E C;  2Q3I A;  1BCC D;  5B5E E;  5BVZ A;  1RY3 A;  2AEJ A;  1JY2 N;  1T8Z A;  1G1I A;  1KYO E;  4EDF A;  3H25 A;  4N78 E;  3PHL A;  5AW4 B;  1KB9 I;  2B89 A;  4I6M C;  4GOE A;  1RH5 B;  1NTK E;  1BDD A;  5GTH E;  4NPF X;  4U3F J;  2R5D A;  1KB9 D;  3SFE C;  3CCQ P;  4RO0 A;  1N7S A;  1NJI Q;  2Y9Y A;  1VQL P;  1D7M A;  2LR2 A;  1KB9 E;  3V2N A;  3U1C A;  2FXP A;  2JWA A;  4ZKU A;  1WRG A;  3AE2 C;  5K5G B;  2Z5H A;  3CCE P;  2QJP B;  2I1J A;  4EYY Q;  1HBW A;  2OTL P;  1NTZ K;  5AVX B;  1LTT C;  1XTG B;  1PP9 J;  5APU A;  1HGV A;  2O3J A;  2WSS H;  1SFC C;  1KOR A;  2C0W A;  1NTK G;  1SFC B;  2KP8 A;  2QE7 H;  3FXD A;  3KYQ A;  2K9J B;  2J5U A;  2N1T D;  3PTZ A;  1J2J B;  3BCC E;  1AJY A;  5B66 E;  1SQQ D;  2YMK A;  2FFD A;  3NTN A;  2CK3 H;  1AFO A;  1P84 H;  1FC2 C;  3V2R A;  4GOD A;  2LXC B;  4XFJ A;  2KB7 P; 
#chains in the Genus database with same CATH homology
 1GZL A;  1RF1 C;  2CPB A;  4Y99 B;  1FZF A;  2E42 A;  2P1J A;  2MJZ A;  3II6 A;  3A2A A;  1LTJ C;  5AW6 B;  1RF1 B;  1YYC A;  1OXZ A;  4N3Y B;  1YTZ I;  4LC1 A;  5APX A;  1LTJ B;  1HGZ A;  1KQL A;  5AVW B;  5CCG C;  1FZC A;  3TYY A;  5CCH C;  1LT9 A;  3M0A A;  1N86 A;  2NPS C;  5CCG D;  4GIF A;  4HH2 A;  5KJ7 C;  4W7Y A;  1Z56 A;  4I2L C;  1NH4 A;  2NPS D;  3BRT B;  2YMY A;  5KJ7 D;  2IFM A;  1KZU B;  2WT7 B;  5KLV K;  2M3B A;  5AVS B;  3CLQ A;  3M0D C;  2Q9I A;  4N78 D;  2ZFC A;  3V2Q A;  2C0X A;  4GT1 A;  1GTW A;  3B5N D;  5AW7 B;  1RE4 C;  1IFD A;  2Z5I A;  1CI6 B;  3NMD A;  1E5W A;  1FDM A;  1L4A D;  2P2U A;  3BRV B;  2XNX A;  3L4F A;  1JOC A;  5CHX A;  5APV A;  5AVY B;  5AVZ B;  2WTY A;  1NWQ A;  2IPP A;  5BU8 B;  1GL2 A;  1GK4 A;  3U59 A;  1NHL A;  2C9N Y;  2N1T A;  3TK1 A;  4AUW A;  3OJA B;  1FAV A;  1NAF A;  1FOS E;  4WY4 C;  1RF0 A;  4AYC A;  3MGN A;  2WZ7 A;  3L37 A;  1GD2 E;  4WY4 B;  3O8Z A;  3I5C A;  1JY3 N;  1KIL A;  3KPE A;  1URQ C;  5APT A;  1MFZ A;  5CJ4 A;  2WSC H;  1N73 A;  1FZC B;  1L0N K;  3VMZ A;  1URQ D;  2ZXE B;  5AW2 B;  3VOP A;  3NFQ A;  3MD0 A;  1ZN5 A;  3IFM A;  3TNU A;  1X79 B;  1LWU C;  3VTP C;  3VN0 A;  1GDT A;  2PP6 A;  3HTK A;  2W6B A;  3MUD A;  3M91 A;  2WSF H;  3T97 A;  1SFC D;  4ZKP A;  1WT6 A;  1T3J A;  2GUS A;  5CCG A;  3IR9 A;  3HE4 B;  4IFF A;  1M1J B;  3LW5 H;  2NPS A;  4M3L A;  2PAJ A;  3H32 A;  3WMM 0;  1S9K E;  1ZV8 A;  3BVH A;  2HPC A;  2P7J A;  2I1K A;  1FBM A;  1DEB A;  2C9L Y;  1OWA A;  3VMY A;  4KHX A;  3E1I A;  1SQP K;  1GK6 A;  1VPC A;  4JYB A;  1GU5 A;  1GL2 B;  3RK2 C;  3B5N A;  3M0D A;  1SQB K;  3OA7 A;  5APW A;  3RK2 B;  1N7S B;  4N6J A;  1L4A A;  1G2C A;  1RE3 C;  4Y99 C;  2A45 I;  1RE4 A;  5AVQ B;  2HYN A;  5KTB A;  2XKM A;  1KIL B;  1G1J A;  1JY2 P;  3B8E B;  1MUU A;  3A5T A;  3RL0 C;  3P8C E;  1T3U A;  3RL0 B;  2WWW A;  3TSI A;  1N73 B;  4IFD K;  1CW5 A;  3V4W A;  1IFN A;  4C7N A;  1FOS F;  2OYI A;  2GUV A;  1HH0 A;  3HE5 A;  5CCH D;  3A7O A;  2R3C A;  2OYH C;  3MIW A;  1IK9 A;  3M9H A;  2W6A A;  3V4Q A;  2OYH B;  3RK3 C;  5APY A;  2WSE H;  1LTS C;  2WIT A;  4LGD E;  3RK3 B;  2R5B A;  2IX7 C;  2N9B A;  5CMZ A;  5AVR B;  5AW8 B;  2A45 H;  3GHG B;  1LTA C;  1X9V A;  3SWF A;  2HOD A;  2H7H A;  3HUS B;  1LWU A;  3VP8 A;  1SQQ K;  2FFD B;  1SFC A;  3HD7 B;  1J1D C;  1JY3 P;  1J1E B;  3U1A A;  3L36 A;  3LID A;  2E43 A;  2XU6 A;  1J1D B;  1X8Y A;  1JTH A;  2YKO A;  1W2E A;  1MV8 A;  1LGH B;  3V2P A;  3EQ2 A;  1HWT C;  1H8A A;  2KYV A;  2H8P D;  2JJL A;  2A45 G;  4WB4 A;  1NKZ B;  1LTB C;  4WY4 D;  1FU1 A;  3CI9 A;  5AW5 B;  5APQ A;  1FZC C;  1VDF A;  3N4X A;  2WPS A;  1JUN A;  4OH8 B;  1LT9 C;  1KFM A;  3UIA A;  1LT9 B;  2GM4 A;  1SVF A;  3OAK A;  3HE5 B;  5BU5 A;  1QL1 A;  1RF1 A;  1FZG A;  2POH A;  2VRS A;  2P67 A;  1T2K C;  1SQX K;  4O9B A;  1LTJ A;  1PFI A;  2KOG A;  1N7L A;  5AVU B;  3BAT A;  1KFN A;  2CPS A;  3P7K A;  4DOJ A;  1IC2 A;  1S9K D;  4LLH A;  2O1J A;  2R32 A;  1M1J C;  5CCH A;  3M06 A;  1NTM K;  2M8R A;  1NTK K;  5KJ7 A;  2YNY A;  4EOT A;  1GL2 C;  1HJB A;  2WT7 A;  1HVV A;  3M9Q A;  5AVV B;  4IFM A;  1GU4 A;  1GL2 D;  2N1T C;  1N7S C;  1JTH B;  3HRN A;  4RES B;  1H89 A;  1HTL C;  2Z4E A;  1FJK A;  3P8M C;  2N1T B;  2WPR A;  1SP4 A;  3RK2 D;  3N7N A;  3L35 A;  3VP9 A;  1IJD B;  1CI6 A;  1N7S D;  1NU1 K;  1A02 F;  3LIE A;  2IFN A;  2QM8 A;  1JCD A;  1QL2 A;  1KIL C;  2Q7C A;  2FYZ A;  1FZA A;  3A3Y B;  3P8C D;  3CL3 D;  2WPQ A;  1KIL D;  3V5B A;  1N73 C;  1ZLL A;  2H43 A;  3SWY A;  2FXM A;  1MZ9 A;  3RL0 D;  2KSJ A;  2XZR A;  4WY4 A;  1FZB A;  3TNU B;  3M9B A;  2W27 A;  1XTC C;  3HTK B;  3PP5 A;  1JY2 O;  5AW0 B;  3P32 A;  1AQ5 A;  1JMM A;  5AW9 B;  1NO4 A;  1URQ A;  1ZR2 A;  4W80 A;  2HG5 D;  3GHG C;  3KQG A;  3RK3 D;  2YKQ A;  1CSB A;  1YTZ T;  3HUS C;  4WBA A;  2YO3 A;  4EIJ A;  2NPS B;  2FFD C;  3H32 B;  3HD7 C;  2HPC B;  1SLQ A;  1J1E C;  2Q3I A;  4C7R A;  5BVZ A;  1RY3 A;  3BAS A;  3HD7 D;  1JY2 N;  1A02 J;  1T8Z A;  1G1I A;  3B5N C;  2OAR A;  3B5N B;  3HE4 A;  4XA4 A;  1L4A C;  1GW3 A;  1M1J A;  2O1K A;  4N78 E;  4B86 A;  1L4A B;  1G2C B;  5AW4 B;  1NKN A;  4I6M C;  1IFI A;  1JY3 O;  4AQR D;  2XV5 A;  1LTG C;  5APS A;  1NOH A;  1FZE A;  2YO2 A;  3KDP B;  2R5D A;  2KLV A;  1N7S A;  2OYI C;  4XE5 B;  1RE3 A;  4GKG A;  3V2N A;  4C7N B;  2HFE D;  3U1C A;  2OYI B;  2JEE A;  2XDJ A;  2O01 H;  1JO5 A;  3C9I A;  4ZKU A;  1WRG A;  1ZR4 A;  2Z5H A;  1HUC A;  2I1J A;  1M7L A;  3R2P A;  1HBW A;  2LKM A;  1T2K D;  2FYU K;  1URQ B;  1GW4 A;  1NTZ K;  5CJ0 A;  5AVX B;  3EFG A;  1LTT C;  2FKW B;  3G3Z A;  2BAS A;  1XTG B;  5APU A;  2L5G B;  3VYI A;  1HGV A;  1SFC C;  1CZQ A;  2HOD B;  2OYH A;  3MTU E;  1LWU B;  2C0W A;  4W7Z A;  1SFC B;  2QM7 A;  2J59 M;  2YKP A;  3NXS A;  4C46 A;  2HLO A;  2KP8 A;  1EQ7 A;  1JNM A;  2J58 A;  4JYC A;  5AW1 B;  3KYQ A;  3GHG A;  5AVT B;  1RF0 C;  1IO4 A;  2N1T D;  1J2J B;  1JCC A;  3HUS A;  4I1L A;  2FFD A;  3HD7 A;  3VMX A;  1SQV K;  3NTN A;  1AFO A;  1H88 A;  3H6P A;  1DH3 A;  3V2R A;  4DZO A;  1LTI C;  1DX7 A;  4JF7 A;  1L0L K;  1N2D C;  1IFJ A;  5AW3 B;  2KB7 P;  4HYT B;  2Q5U A;  1FJP A;  1IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...