3VP8A

Crystal structure of the n-terminal domain of the yeast general corepressor tup1p
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
75
structure length
75
Chain Sequence
SVSNTQNKLNELLDAIRQEFLQVSQEANTYRLQNQKDYDFKMNQQLAEMQQIRNTVYELELTHRKMKDAYEEEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of the yeast general corepressor Tup1p and its functional implications
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords General transcriptional corepressor TUP1
total genus 35
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08581 Tup_N Tup N-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.340 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3vp8A00
3VP8A 4O9BA 3U1AA 3OJAB 5BU8B 1X79B 3BATA 3BASA 1WT6A 5BVZA 2FXMA 4N3YB 1IC2A 3U1CA 3VP9A 2POHA 2JEEA 3P8CD 4ZKPA 5BU5A 3N4XA 4N78D 4GIFA 4I1LA 3HRNA 1NKNA 5KTBA 3N7NA 3U59A 4ZKUA 3C9IA
chains in the Genus database with same CATH superfamily
1KILC 2JJLA 1N73C 2QM7A 2Y9YA 5AW9B 2KLUA 3KQGA 2UWJE 3CI9A 4UB8H 1USEA 1L0NE 3E1IA 2XNXA 2BEZF 1L0NJ 1KILA 5KKZC 5AW8B 5KAFH 3IF4A 4WY4D 2WT7B 1S3JA 3VN0A 1NH4A 3CMEP 2KS1B 3H1JD 3H1IE 3CC7P 1K8AQ 3G4SP 2O01H 3VMXA 1YITP 2HODA 1NTMG 2HPCB 5APWA 2Y9ZA 2FFDB 4GOFA 3B8EB 1OVRA 3L71E 3V4WA 1YJ9P 3H1IG 2ZJSE 2RN0A 1FDOA 3OA7A 5DJTB 1EQ7A 3PP5A 4YXDC 1Q7YQ 3VYIA 3WUVA 2O01N 1DX7A 3MUDC 2BCCG 3JCUH 2IZ0A 2W8ZA 4JF7A 4PD4E 2KP8A 2KZIA 3RL0D 2WSFJ 1L0NK 4OGQC 4C46A 1N86A 2WMMA 3B5NC 3D70A 1SQVD 1X22A 4QMAA 1KZUB 4I7ZB 2WITA 3FXDA 3BATA 1URQC 1PZQA 3KDPB 2ZT9D 4U7JA 2K1AA 5TISE 1FS0E 2YKOA 3CWBJ 2WPRA 1BE3G 3FX0A 1JNMA 1L0LG 5KLVG 1CI6B 1Q82Q 2KXPB 4RKUJ 1PGJA 1URQA 3CWBD 5E79H 4U3FJ 1SQVK 1BE3E 1VQNP 2NPSB 3RL0C 1M56D 4IOIH 3H32A 2W27A 3N4XA 2KLVA 4N6JA 4PV1D 4C7NB 3CCQP 2CK3H 2QIWA 5AW7B 3L74J 2JDIH 2M5AA 3AECC 5AVUB 1EZVG 1MKMA 1Q90D 2BCCJ 3A0BH 1EDIA 5KJ7A 5EFWB 3CC2P 2BCCD 3C8VA 3WUTA 2OTJP 1NU1J 1X0TA 5APVA 3T97B 1R5SA 2FYZA 1GMJA 1KB9D 1SFCD 1XTGB 2H8PD 1NTMD 1SQQD 2KOGA 3V2RA 1FZFA 3EFFK 2ZVNB 4PJ0E 1Z56A 2OTKE 3D6YA 1SQQJ 2I1KA 2NPSD 2HG5D 1M7LA 1IJDB 4H0LD 3RK2B 2OYHB 2E75C 1RE4A 3CXHD 5CCGD 1OWAA 1EDLA 1RQUA 5AVYB 2WSSH 3L73E 3BCCE 1LTAC 3AE8C 1SQQK 3CL3D 3CCRP 2R5BA 2WQYC 5GTIH 3Q5SA 3GLMA 2E74C 3OAKA 4GOEA 3VMYA 1SFCB 3A7OA 4BRYA 1Q2NA 1SS1A 4GIFA 1AA0A 1M1JB 1N7SA 1NTZE 3HD7A 3P7KA 2I8DA 3EFGA 1LJ2A 2B89A 2ZYAA 3H1HJ 4D6TE 2QA4P 1FZCB 1EXIA 2IBZG 5AVXB 3U59A 1N7SD 1UIIA 4OGQD 2OYOA 3H1HD 4H0LB 3WU2E 1SLQA 2K37A 2MJZA 3H1KD 3HD7C 1EC5A 1LT1A 2GA1A 1N2DC 1SQQG 1S9KD 1SQBK 1YYCA 1W2EA 1NTMK 2Y0DA 1HJ0A 2AEFA 1IZNB 2K9JA 2YXQB 1IC2A 1FE6A 4UB8E 2FYNC 2WTYA 1NYHA 5AVQB 4C7RA 5CCGA 3AEDC 1PFIA 4LC1A 4WY4B 2OYIB 1N7SC 1OVVA 1P84I 4AQRD 1MV8A 4I7ZC 4L75A 3SFEC 3D71A 1GD2E 2AXTE 2M5AB 1URQB 2IFNA 4PV1C 1L0NG 4NPEA 4OGQB 3TK1A 5AVSB 1JUNA 2GM4A 1GU5A 3C1LA 3QH9A 1NGMB 1HJBA 5AVZB 1GK4A 1S5LH 2YMKA 5CHXA 3RBXA 3P32A 2WSCH 1NWQA 1BE3D 1VDFA 1QGKB 1L4AA 2M0BA 4R4LA 1NO4A 1LNQA 4EI2A 1KB9H 4GDOA 4JQ0D 4ZKUA 1HUCA 1JM0A 1JY3P 4IL6E 2YO2A 2AXCA 1SQVG 1RHZB 1JCDA 3CCJP 3CD6P 4IL6H 3S9OA 1FZAA 2C9LY 1VL2A 4UB6H 3NMDA 2E75D 1K05A 1SQVE 1URQD 2QM8A 3PLNA 4LGDE 1RQVA 3TYYA 1NU1G 3VP9A 4EIJA 3CX5H 3U1AA 3PRJA 4PD4D 3M06A 1S5LE 1D7MA 4K35A 1FOSE 2B87A 1DIPA 1PP9J 2KI7B 3AE3C 4JYCA 3RBZA 1NHLA 2HODB 2W6JH 3H1KG 1KORA 2JP3A 5E79E 3L37A 1KQGB 3EWKA 2KSEA 3TGUJ 4BWNA 1NTMJ 1QVGO 2HR3A 3GHGB 5KAIE 2P7JA 1LTSC 3A0HH 2RH0A 3H1LJ 1L0LE 2KSJA 3AEAC 3L71D 3GG2A 3RK2C 1NKNA 3TGUD 1T2KD 2C9NY 1IFIA 4JBZA 3H1JE 1VQ8P 1YI2P 3MIWA 2XZRA 3TDKA 2WT7A 2E42A 1A02F 1DEBA 5B66E 1CI6A 5AVWB 2WZ7A 3OJAB 4HB1A 1H89A 1PPJE 2GUVA 3HE4A 1KQSO 4H13B 2KB7P 3WU2H 2FYUG 4AUWA 2PFXA 2OTLP 1GL2C 1PPJG 3H6PA 4IFMA 2QSIA 1LT9B 3SWYA 1KYOH 3W68A 3ZDMA 4H0LC 3V2NA 1N8RQ 1NAYA 3UIAA 4XA4A 1L2PA 4N78E 2V7QH 1AFOA 1LTGC 1G1IA 2FBWC 1GK6A 1T6AA 1S1CX 3P8CD 5M1BA 2P67A 5BU5A 1JEKA 1S5LX 1HGVA 2YKQA 4HJGH 1VQKP 1TU3F 1GW4A 3V4QA 3G9RA 1BDDA 1AVYA 2OQQA 2QJPC 4L73A 3BVHA 1JY3N 1GL2D 1RY3A 5APYA 2QEXP 4IFDK 2NRGA 2SPZA 4WY4C 5GTHE 5KTBA 1HH0A 1KILE 2OYIC 1A02J 1KN7A 1FC2C 1SQPE 3KHUA 2KS1A 1CW5A 1OFCX 4IL6X 1K04A 2FKWB 1NKZB 3CXHI 2A06E 1SQBE 3GMAA 2FYUJ 3HUSC 2G8YA 3IN6A 3M9BA 3NTNA 3SWFA 1RF1C 1E5WA 1GU4A 3BASA 1L0LJ 2W6AA 1EXJA 3L73G 2A06G 1ZN5A 2XNDH 3CX5D 1FOSF 1KB9I 1VF5B 3KZIE 4NPFX 2LXBA 1AVOA 2IBZE 3IR9A 5CJ4A 2E43A 1L0LD 1Q86Q 1JY2O 4NPDA 5AVRB 2E76C 2POHA 5KKZB 1J1EC 3V6IA 4ZMDA 2P1JA 1FBMA 1FZGA 3V2PA 1P84H 3B5ND 2NZ2A 2D2CB 3LIDA 3AE4C 1LP1B 3FXEA 4W7YA 1NAFA 1LTBC 1VF5C 2ZT9B 3L70D 1S2EA 3W67A 1HF9A 1BCCJ 1BGYJ 1XTCC 3MZWB 1T3JA 1GDTA 1BGYE 1BCCE 1LP1A 1KQLA 2KNCA 2L5GB 3H1IJ 2XKMA 4H13C 5CMZA 5BU8B 1M1KQ 1X79B 4R4MA 3AEFC 1J1DC 4WBAA 1LWUB 1DEEG 1VQ5P 1SQVJ 1LTJC 5AW0B 1WT6A 1KD1Q 1KYOD 2FXMA 3B5NB 3H1LD 3JSVC 2XU6A 3L72D 3SSUA 2HYNA 3A0HE 2WPSA 4HKZH 3E1RA 1JMBA 2YIUB 1KC8Q 3BCCJ 2N1TD 2E74D 1PGOA 2QJPB 1GTWA 2E5YA 2FXPA 3VMZA 4DCKA 1W5CE 4JYBA 1VQMP 4U3FD 1JTHB 2CPSA 1QLED 1SVFA 2H43A 3V2QA 1FZCC 1VQ4P 2NPSC 3AE5C 1JY2P 2QRXA 1RE4C 3H1JJ 3RK2D 2QJKB 1T2KC 4TLFA 1ZRTD 2WSEH 5KAFE 3PH0A 1H88A 2ITAA 2O1JA 4WWIA 1ZOYC 2WSCJ 3B71A 1H0TA 1FDIA 1SFCC 2ZXEB 1ZRTE 3PJSK 3CC4P 2E76B 1NTKE 2N1TA 2P10A 2E74B 5B66H 1KB9E 1M57D 1SQXD 4K3AA 2ZYDA 1EZVD 3LW5H 1GW3A 4D6TD 2E5TA 2BCCE 1IFDA 1AV1A 2L91A 1H0TB 2Q1KA 3ABVC 1VQ7P 3KXDA 1W2BO 5CCHA 3G3ZA 3Q3DA 3HUSB 3O6QA 5APUA 1QL2A 3Q5PA 1KYOI 5KAIH 5APTA 1FJPA 2W6BA 4A7PA 4BRYB 2Z4EA 1LTTC 2WSEJ 1FZBA 4U3FG 5CJ0A 5H2FE 4PD4I 3CCEP 2J58A 1PGQA 1SQXK 2FYUD 4WVZA 1RF1B 3L73D 4TT3H 1IFPA 3M0DA 4GKGA 4W7ZA 2P58A 2E76D 3BRVB 3H1LG 4Y28J 4DJGA 3QWOC 5AW4B 1QVFO 1FAVA 2WWWA 3CCLP 1VQ6P 4IFFA 4BXLA 1ZXGA 2B9BA 3GHGA 3RL0B 1WMKA 1SQXE 1NTME 1Y8AA 2R44A 3B5NA 3L4FA 2M3BA 1NTKD 1MUUA 3PHLA 1PV3A 1NVOA 2IZ1A 1SQXG 1X8YA 4RJTA 1PP9G 2YIUC 1FJKA 2C0XA 1NU1D 3HE5B 2N9YB 5H2FH 3RL0g 3TF5A 3A2AA 3L70J 4HH2A 2FYNB 3L75D 2FFDC 1PP9E 1SQBG 3FWNA 3HTKB 1RH5B 5GTHH 1K9MQ 2HPCA 4RESB 1MFTA 1ZP0C 2IX7C 2IYOA 3O8ZA 4OH8B 1J1DB 2V7QJ 4C7NA 4PV1B 1YQ3C 1ZR2A 1LGHB 1ZW0A 4H44C 3RK3D 1G2CB 4GODA 2WPVB 5CCGC 2O01J 1S72P 2E75B 1KFMA 5CBOA 1J2JB 3BCCG 4YXWH 1AJYA 3ITKA 3CWBG 1GL2A 2GUSA 1BDCA 1IO4A 3VP8A 1JY2N 1L0ND 1OXZA 3KYQA 2Q5UA 1QX8A 1QL1A 1RF1A 5CCHC 1KV4A 2XDJA 1CZQA 3OW2O 1IK7A 4D6TG 3RK3E 3MHVA 4XFJA 2A45I 2B88A 1LTJA 3A0BE 3K5BA 2QJKC 5APQA 1HBWA 2VRSA 4ZNCA 1RE3C 2PRRA 1ZV8A 4W80A 2JWAA 3M9HA 3L36A 3TSIA 4ASVA 3L75E 2B87B 5B5EE 1N73B 3I5CA 2Q6QA 4GT1A 4N78D 2N1TB 1U7JA 1RF0A 3F5HA 1NU1K 3M9QA 1VQLP 1LT9A 3RGUA 4DT0A 5KJ7C 3A5TA 2OYHC 2PP6A 3CCMP 1FZCA 4D6TJ 3G6EP 3H1HG 4YPCA 2Q7CA 2I1JA 1OX3A 1YTZI 2K9YA 4KHXA 4O9BA 1Q81Q 4EYYQ 3CX5E 4I2LC 1OW7A 3CLQA 1T8ZA 2FXOA 2LXCB 1YBKA 2Q3EA 3L74E 3USSA 1IFJA 5KLIC 3CCSP 1FDMA 2K3RA 4PD4H 2JKVA 1G1JA 1T3UA 3JCUE 5AW2B 1IFMA 2A06D 2AEMA 4N3YB 5BVZA 2YXRB 1NTZG 3JC22 1R8EA 1GL2B 3AE1C 1SQPD 2QJYB 3L72G 3H25A 3CCUP 1LT9C 2OYHA 2WPQA 4RO0A 3CXHH 1USDA 2Z5HA 5K5GB 2MKVA 3LIEA 5CBNA 5AVVB 3H1KJ 2DW3A 1HGZA 3RK3C 2BEQD 2KUBA 1JOCA 1NTKJ 3GF7A 3P8CE 5AW1B 1KQFB 4I1LA 2WVRA 3T97A 3M0DC 1VQPP 1L4AD 1PP9D 1N73A 1J1EB 2O1KA 4EOTA 3NFQA 3AE2C 4Y99C 1NTZK 3G71P 1VQ9P 1KFNA 3E7KA 1PL5A 1M1JC 1EZVI 1NTKK 3H32B 1S9KE 2A45G 2BASA 3D6ZA 3TNUA 3L71J 1OW8A 3WMM0 2Y0CA 4H44D 2QG4A 1NTZJ 1JB0J 1M1JA 2D2CD 1PPJD 1M8OB 3PTZA 2J59M 2H7HA 5KLVD 1NTZD 4Y99B 3F89A 1JO5A 2N1TC 4U3FE 1BE3J 1RF0C 1FZEA 5KLVJ 3GW6A 1Y47A 3MP7B 3LW5J 3HUSA 1DD4A 1L4AB 3O6QB 4L76A 4LLHA 3TGUE 2KK7A 3Q2YA 1BSNA 2Z5IA 1G2CA 1OMIA 2FYUE 3H1LE 2HLOA 3AEGC 3Q5RA 3TGUG 1HTLC 3L71G 1SQPK 2FY8A 1SP4A 3HTKA 5C39A 1IK9A 1NU1E 5GTIE 1YQ4C 2M3EA 2R3SA 1OIPA 2KZJA 3HD7D 4KT0J 3RK3B 2IFMA 2RKLA 5KLIB 3C9IA 3CX5I 4I6MC 1HWTC 3V5BA 2JWDA 3H1KE 1AQTA 1ZR4A 1BCCD 1BGYD 1EDJA 1FU1A 2Y0EA 2LKMA 1VQOP 2QJYC 3A3YB 3AE6C 3M0AA 5AVTB 2C0WA 2P2UA 4AYCA 1Y9BA 5L8RJ 1MZ9A 5CCHD 3U1CA 1N7SB 5APSA 1LTIC 1LTJB 1WRGA 1SQPG 3GF3A 3I56P 2IYPA 2H89C 3FWLA 2N9BA 3HE4B 4L74A 1U7MA 3BRTB 3H1JG 2NPSA 4CPGA 3CMAP 3CPWO 1OVUA 4ASWA 4ZKPA 1NJIQ 3HD7B 2JR8A 1AQ5A 2PGDA 1R5LA 1RE3A 1SFCA 3AEBC 1GZLA 3CWBE 4JPZB 3CXHE 1PIXA 1N7LA 4UB6E 1S4XA 2YMYA 2OARA 3P8MC 3VTPC 4EDFA 5KJ7D 2QE7H 5KLVE 1JMMA 1X9VA 1L0LK 1QEXA 1EZVE 2K88A 3TNUB 3Q1MA 1SQBD 2KNCB 1SQPJ 1YTZT 3L75G 1YJNP 5TJHA 4XE5B 3MD0A 1KYOE 2JO1A 2J5UA 1LWUA 1SQBJ 2D2CC 3AE9C 4WB4A 5TISH 2PAJA 1IFNA 3R2PA 2FFDA 2H88C 1VF5D 2YO3A 3I55P 3MGNA 1DD3A 1CSBA 1L4AC 2XV5A 3L70G 3S1KA 3VOPA 4OVNF 4DZOA 3H1HE 5AW5B 2W83C 3HE5A 4YTPC 4HYTB 1PGPA 2G3AA 2R32A 3M91A 3L70E 1U57A 2W90A 2OGUA 1YJWP 3GHGC 3EQ2A 3L74G 2V4HA 2YKPA 3VMAA 1VPCA 1EDKA 2IBZI 1YIJP 2AEJA 3AE7C 1M90Q 5B5EH 2ZYGA 1H8AA 4KJMA 3IFMA 2R3CA 2LR2A 3AEEC 1KILB 4MN4C 3L72J 3L72E 3II6A 3L73J 2M8RA 4M3LA 3BCCD 3N7NA 2HFED 1DH3A 5AW3B 3S4RA 2R5DA 3KPEA 1OZHA 3L74D 3SFDC 2ZXXA 1MFZA 5DJUB 1K73Q 3MTUE 3CCVP 1KMIZ 1UIXA 3FGAD 1JY3O 2WSFH 1E79H 3IAOA 2Q3IA 1SQQE 1OW6A 2ZT9C 4H44B 3MUDA 2RMZA 1HVVA 2ZAEB 1P84E 2JEEA 4WY4A 2OYIA 1YHQP 3WUUA 1BSHA 1KILD 4H13D 1BCCG 1BGYG 2QVAA 3R4YA 5APXA 2KYVA 2K9JB 2KIKA 3H1ID 2FYUK 1NTKG 1JCCA 3L35A 1LWUC 1SQXJ 3L75J 3SWKA 3KZIH 1KTMA 1NOHA 3B4SA 2YNYA 4DOJA 1P84D 2CPBA 5AW6B 3HRNA 3NXSA 2IDBA 2AXTH 4B86A 1ZLLA 4PJ0H 2IPPA 2A45H 2O3JA 2ZVOB 2IBZD 4Z1MH 2Q9IA 1ZMEC 5KLVK 2ZFCA 4OWFA 1JTHA
chains in the Genus database with same CATH topology
1KILC 2JJLA 1N73C 2QM7A 5AW9B 3KQGA 3CI9A 3E1IA 2XNXA 1KILA 5AW8B 4WY4D 2WT7B 3VN0A 1NH4A 2O01H 3VMXA 2HODA 2HPCB 5APWA 3B8EB 3V4WA 3OA7A 1EQ7A 3PP5A 3VYIA 1DX7A 4JF7A 2KP8A 3RL0D 4C46A 1L0NK 1N86A 3B5NC 1KZUB 2WITA 3BATA 1URQC 3KDPB 2YKOA 2WPRA 1JNMA 1CI6B 1URQA 1SQVK 2NPSB 3RL0C 3H32A 2W27A 3N4XA 2KLVA 4N6JA 4C7NB 5AW7B 5AVUB 5KJ7A 5APVA 2FYZA 1SFCD 1XTGB 2H8PD 3V2RA 2KOGA 1Z56A 2I1KA 2NPSD 2HG5D 1M7LA 1IJDB 3RK2B 2OYHB 1RE4A 5CCGD 1OWAA 5AVYB 1LTAC 1SQQK 3CL3D 2R5BA 3OAKA 3VMYA 1SFCB 3A7OA 4GIFA 1M1JB 3HD7A 1N7SA 4M3LA 3P7KA 1FZFA 3EFGA 1FZCB 5AVXB 3U59A 1N7SD 1SLQA 2MJZA 3HD7C 1N2DC 1S9KD 1SQBK 1YYCA 1W2EA 1NTMK 1IC2A 2WTYA 4C7RA 5AVQB 5CCGA 1PFIA 4LC1A 4WY4B 2OYIB 1N7SC 4AQRD 1MV8A 1GD2E 3TK1A 1URQB 2IFNA 1JUNA 5AVSB 2GM4A 1GU5A 1HJBA 5AVZB 1GK4A 1NWQA 5CHXA 3P32A 2WSCH 1VDFA 1L4AA 1NO4A 4ZKUA 1HUCA 1JY3P 2YO2A 1JCDA 1FZAA 2C9LY 3NMDA 4LGDE 1URQD 4EIJA 2QM8A 3TYYA 1AQ5A 3VP9A 1FOSE 3M06A 4JYCA 1NHLA 2HODB 3L37A 3GHGB 2P7JA 1LTSC 5KLVK 2KSJA 3RK2C 2C9NY 1T2KD 1NKNA 1IFIA 3MIWA 2XZRA 2WT7A 2E42A 1A02F 1DEBA 1CI6A 5AVWB 2WZ7A 3OJAB 1H89A 2GUVA 3HE4A 2KB7P 4AUWA 1GL2C 3H6PA 4IFMA 1LT9B 3SWYA 3V2NA 3UIAA 4XA4A 4N78E 1AFOA 1LTGC 1G1IA 1GK6A 3P8CD 2P67A 5BU5A 1HGVA 2YKQA 1GW4A 3V4QA 3BVHA 1JY3N 1GL2D 1RY3A 5APYA 4IFDK 4WY4C 2OYIC 5KTBA 1HH0A 1A02J 1CW5A 3U1AA 2FKWB 1NKZB 3SWFA 3NTNA 1RF1C 3HUSC 3M9BA 1E5WA 3BASA 2W6AA 1FOSF 1ZN5A 2E43A 3IR9A 5CJ4A 1JY2O 5AVRB 2POHA 1J1EC 2P1JA 1FBMA 1FZGA 3V2PA 3B5ND 3LIDA 4W7YA 1NAFA 1LTBC 1XTCC 1GDTA 1T3JA 2L5GB 1KQLA 2XKMA 5CMZA 5BU8B 1X79B 1J1DC 4WBAA 1LWUB 5AW0B 1LTJC 1WT6A 2FXMA 3B5NB 2XU6A 2HYNA 2WPSA 2N1TD 1GTWA 3VMZA 4JYBA 1JTHB 2CPSA 1SVFA 2H43A 3V2QA 1FZCC 2NPSC 1JY2P 1RE4C 3RK2D 1T2KC 2WSEH 1H88A 2O1JA 1SFCC 2ZXEB 2N1TA 3LW5H 1GW3A 1IFDA 5CCHA 3G3ZA 3HUSB 5APUA 1QL2A 5APTA 1FJPA 2W6BA 2Z4EA 1LTTC 1FZBA 5CJ0A 2J58A 1SQXK 1RF1B 3M0DA 4GKGA 4W7ZA 3BRVB 5AW4B 1FAVA 2WWWA 4IFFA 3GHGA 3RL0B 3L4FA 3B5NA 2M3BA 1MUUA 1X8YA 1FJKA 2C0XA 3HE5B 3A2AA 4HH2A 2FFDC 3HTKB 2HPCA 4RESB 2IX7C 3O8ZA 4OH8B 1J1DB 4C7NA 1ZR2A 1LGHB 3RK3D 1G2CB 5CCGC 1KFMA 1J2JB 1GL2A 2GUSA 1IO4A 3VP8A 1JY2N 1OXZA 3KYQA 2Q5UA 1QL1A 1RF1A 5CCHC 2XDJA 1CZQA 2A45I 1LTJA 5APQA 1HBWA 2VRSA 1RE3C 1ZV8A 4W80A 3M9HA 3TSIA 3L36A 1N73B 3I5CA 4N78D 4GT1A 2N1TB 1RF0A 1NU1K 3M9QA 1LT9A 3A5TA 5KJ7C 2OYHC 2PP6A 1FZCA 2Q7CA 2I1JA 1YTZI 4KHXA 4O9BA 4I2LC 3CLQA 1T8ZA 1FDMA 1IFJA 1G1JA 1T3UA 5AW2B 5BVZA 1IFMA 4N3YB 1GL2B 1LT9C 2OYHA 2WPQA 2Z5HA 3LIEA 5AVVB 1HGZA 3RK3C 1JOCA 3P8CE 5AW1B 1N73A 4I1LA 3T97A 3M0DC 1L4AD 1J1EB 2O1KA 4EOTA 3NFQA 4Y99C 1NTZK 1KFNA 1M1JC 1NTKK 3H32B 1S9KE 2A45G 2BASA 3TNUA 3WMM0 1M1JA 2J59M 2H7HA 4Y99B 1JO5A 2N1TC 1RF0C 1FZEA 4LLHA 3HUSA 1L4AB 2Z5IA 1G2CA 2HLOA 1HTLC 1SQPK 1SP4A 3HTKA 1IK9A 3RK3B 3HD7D 1HWTC 2IFMA 3C9IA 4I6MC 3V5BA 1ZR4A 1FU1A 2LKMA 3A3YB 3M0AA 5AVTB 2C0WA 2P2UA 4AYCA 5CCHD 1MZ9A 3U1CA 1N7SB 5APSA 1LTIC 1LTJB 1WRGA 2N9BA 3HE4B 3BRTB 2NPSA 4ZKPA 3HD7B 1RE3A 1SFCA 1GZLA 1N7LA 2YMYA 3VTPC 2OARA 3P8MC 5KJ7D 1JMMA 1X9VA 1L0LK 1GU4A 3TNUB 1YTZT 4XE5B 3MD0A 1LWUA 2FFDA 4WB4A 2PAJA 1IFNA 3R2PA 2YO3A 3MGNA 1CSBA 1L4AC 2XV5A 3VOPA 4DZOA 5AW5B 3HE5A 4HYTB 2R32A 3M91A 3GHGC 3EQ2A 2YKPA 1VPCA 1H8AA 3IFMA 2R3CA 1KILB 3II6A 2M8RA 3N7NA 2HFED 1DH3A 5AW3B 2R5DA 3KPEA 1MFZA 3MTUE 1JY3O 2WSFH 2Q3IA 3MUDA 1HVVA 4WY4A 2JEEA 2OYIA 1KILD 5APXA 2KYVA 3L35A 2FFDB 2FYUK 1JCCA 1LWUC 1NOHA 2YNYA 4DOJA 2CPBA 5AW6B 3HRNA 3NXSA 4B86A 1ZLLA 2IPPA 2A45H 2Q9IA 2ZFCA 1JTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VP8 A;  4O9B A;  3U1A A;  3OJA B;  5BU8 B;  1X79 B;  3BAT A;  3BAS A;  1WT6 A;  5BVZ A;  2FXM A;  4N3Y B;  1IC2 A;  3U1C A;  3VP9 A;  2POH A;  2JEE A;  3P8C D;  4ZKP A;  5BU5 A;  3N4X A;  4N78 D;  4GIF A;  4I1L A;  3HRN A;  1NKN A;  5KTB A;  3N7N A;  3U59 A;  4ZKU A;  3C9I A; 
#chains in the Genus database with same CATH topology
 1KIL C;  2JJL A;  1N73 C;  2QM7 A;  2Y9Y A;  5AW9 B;  2KLU A;  3KQG A;  2UWJ E;  3CI9 A;  4UB8 H;  1USE A;  1L0N E;  3E1I A;  2XNX A;  2BEZ F;  1L0N J;  1KIL A;  5KKZ C;  5AW8 B;  5KAF H;  3IF4 A;  4WY4 D;  2WT7 B;  1S3J A;  3VN0 A;  1NH4 A;  3CME P;  2KS1 B;  3H1J D;  3H1I E;  3CC7 P;  1K8A Q;  3G4S P;  2O01 H;  3VMX A;  1YIT P;  2HOD A;  1NTM G;  2HPC B;  5APW A;  2Y9Z A;  2FFD B;  4GOF A;  3B8E B;  1OVR A;  3L71 E;  3V4W A;  1YJ9 P;  3H1I G;  2ZJS E;  2RN0 A;  1FDO A;  3OA7 A;  5DJT B;  1EQ7 A;  3PP5 A;  4YXD C;  1Q7Y Q;  3VYI A;  3WUV A;  2O01 N;  1DX7 A;  3MUD C;  2BCC G;  3JCU H;  2IZ0 A;  2W8Z A;  4JF7 A;  4PD4 E;  2KP8 A;  2KZI A;  3RL0 D;  2WSF J;  1L0N K;  4OGQ C;  4C46 A;  1N86 A;  2WMM A;  3B5N C;  3D70 A;  1SQV D;  1X22 A;  4QMA A;  1KZU B;  4I7Z B;  2WIT A;  3FXD A;  3BAT A;  1URQ C;  1PZQ A;  3KDP B;  2ZT9 D;  4U7J A;  2K1A A;  5TIS E;  1FS0 E;  2YKO A;  3CWB J;  2WPR A;  1BE3 G;  3FX0 A;  1JNM A;  1L0L G;  5KLV G;  1CI6 B;  1Q82 Q;  2KXP B;  4RKU J;  1PGJ A;  1URQ A;  3CWB D;  5E79 H;  4U3F J;  1SQV K;  1BE3 E;  1VQN P;  2NPS B;  3RL0 C;  1M56 D;  4IOI H;  3H32 A;  2W27 A;  3N4X A;  2KLV A;  4N6J A;  4PV1 D;  4C7N B;  3CCQ P;  2CK3 H;  2QIW A;  5AW7 B;  3L74 J;  2JDI H;  2M5A A;  3AEC C;  5AVU B;  1EZV G;  1MKM A;  1Q90 D;  2BCC J;  3A0B H;  1EDI A;  5KJ7 A;  5EFW B;  3CC2 P;  2BCC D;  3C8V A;  3WUT A;  2OTJ P;  1NU1 J;  1X0T A;  5APV A;  3T97 B;  1R5S A;  2FYZ A;  1GMJ A;  1KB9 D;  1SFC D;  1XTG B;  2H8P D;  1NTM D;  1SQQ D;  2KOG A;  3V2R A;  1FZF A;  3EFF K;  2ZVN B;  4PJ0 E;  1Z56 A;  2OTK E;  3D6Y A;  1SQQ J;  2I1K A;  2NPS D;  2HG5 D;  1M7L A;  1IJD B;  4H0L D;  3RK2 B;  2OYH B;  2E75 C;  1RE4 A;  3CXH D;  5CCG D;  1OWA A;  1EDL A;  1RQU A;  5AVY B;  2WSS H;  3L73 E;  3BCC E;  1LTA C;  3AE8 C;  1SQQ K;  3CL3 D;  3CCR P;  2R5B A;  2WQY C;  5GTI H;  3Q5S A;  3GLM A;  2E74 C;  3OAK A;  4GOE A;  3VMY A;  1SFC B;  3A7O A;  4BRY A;  1Q2N A;  1SS1 A;  4GIF A;  1AA0 A;  1M1J B;  1N7S A;  1NTZ E;  3HD7 A;  3P7K A;  2I8D A;  3EFG A;  1LJ2 A;  2B89 A;  2ZYA A;  3H1H J;  4D6T E;  2QA4 P;  1FZC B;  1EXI A;  2IBZ G;  5AVX B;  3U59 A;  1N7S D;  1UII A;  4OGQ D;  2OYO A;  3H1H D;  4H0L B;  3WU2 E;  1SLQ A;  2K37 A;  2MJZ A;  3H1K D;  3HD7 C;  1EC5 A;  1LT1 A;  2GA1 A;  1N2D C;  1SQQ G;  1S9K D;  1SQB K;  1YYC A;  1W2E A;  1NTM K;  2Y0D A;  1HJ0 A;  2AEF A;  1IZN B;  2K9J A;  2YXQ B;  1IC2 A;  1FE6 A;  4UB8 E;  2FYN C;  2WTY A;  1NYH A;  5AVQ B;  4C7R A;  5CCG A;  3AED C;  1PFI A;  4LC1 A;  4WY4 B;  2OYI B;  1N7S C;  1OVV A;  1P84 I;  4AQR D;  1MV8 A;  4I7Z C;  4L75 A;  3SFE C;  3D71 A;  1GD2 E;  2AXT E;  2M5A B;  1URQ B;  2IFN A;  4PV1 C;  1L0N G;  4NPE A;  4OGQ B;  3TK1 A;  5AVS B;  1JUN A;  2GM4 A;  1GU5 A;  3C1L A;  3QH9 A;  1NGM B;  1HJB A;  5AVZ B;  1GK4 A;  1S5L H;  2YMK A;  5CHX A;  3RBX A;  3P32 A;  2WSC H;  1NWQ A;  1BE3 D;  1VDF A;  1QGK B;  1L4A A;  2M0B A;  4R4L A;  1NO4 A;  1LNQ A;  4EI2 A;  1KB9 H;  4GDO A;  4JQ0 D;  4ZKU A;  1HUC A;  1JM0 A;  1JY3 P;  4IL6 E;  2YO2 A;  2AXC A;  1SQV G;  1RHZ B;  1JCD A;  3CCJ P;  3CD6 P;  4IL6 H;  3S9O A;  1FZA A;  2C9L Y;  1VL2 A;  4UB6 H;  3NMD A;  2E75 D;  1K05 A;  1SQV E;  1URQ D;  2QM8 A;  3PLN A;  4LGD E;  1RQV A;  3TYY A;  1NU1 G;  3VP9 A;  4EIJ A;  3CX5 H;  3U1A A;  3PRJ A;  4PD4 D;  3M06 A;  1S5L E;  1D7M A;  4K35 A;  1FOS E;  2B87 A;  1DIP A;  1PP9 J;  2KI7 B;  3AE3 C;  4JYC A;  3RBZ A;  1NHL A;  2HOD B;  2W6J H;  3H1K G;  1KOR A;  2JP3 A;  5E79 E;  3L37 A;  1KQG B;  3EWK A;  2KSE A;  3TGU J;  4BWN A;  1NTM J;  1QVG O;  2HR3 A;  3GHG B;  5KAI E;  2P7J A;  1LTS C;  3A0H H;  2RH0 A;  3H1L J;  1L0L E;  2KSJ A;  3AEA C;  3L71 D;  3GG2 A;  3RK2 C;  1NKN A;  3TGU D;  1T2K D;  2C9N Y;  1IFI A;  4JBZ A;  3H1J E;  1VQ8 P;  1YI2 P;  3MIW A;  2XZR A;  3TDK A;  2WT7 A;  2E42 A;  1A02 F;  1DEB A;  5B66 E;  1CI6 A;  5AVW B;  2WZ7 A;  3OJA B;  4HB1 A;  1H89 A;  1PPJ E;  2GUV A;  3HE4 A;  1KQS O;  4H13 B;  2KB7 P;  3WU2 H;  2FYU G;  4AUW A;  2PFX A;  2OTL P;  1GL2 C;  1PPJ G;  3H6P A;  4IFM A;  2QSI A;  1LT9 B;  3SWY A;  1KYO H;  3W68 A;  3ZDM A;  4H0L C;  3V2N A;  1N8R Q;  1NAY A;  3UIA A;  4XA4 A;  1L2P A;  4N78 E;  2V7Q H;  1AFO A;  1LTG C;  1G1I A;  2FBW C;  1GK6 A;  1T6A A;  1S1C X;  3P8C D;  5M1B A;  2P67 A;  5BU5 A;  1JEK A;  1S5L X;  1HGV A;  2YKQ A;  4HJG H;  1VQK P;  1TU3 F;  1GW4 A;  3V4Q A;  3G9R A;  1BDD A;  1AVY A;  2OQQ A;  2QJP C;  4L73 A;  3BVH A;  1JY3 N;  1GL2 D;  1RY3 A;  5APY A;  2QEX P;  4IFD K;  2NRG A;  2SPZ A;  4WY4 C;  5GTH E;  5KTB A;  1HH0 A;  1KIL E;  2OYI C;  1A02 J;  1KN7 A;  1FC2 C;  1SQP E;  3KHU A;  2KS1 A;  1CW5 A;  1OFC X;  4IL6 X;  1K04 A;  2FKW B;  1NKZ B;  3CXH I;  2A06 E;  1SQB E;  3GMA A;  2FYU J;  3HUS C;  2G8Y A;  3IN6 A;  3M9B A;  3NTN A;  3SWF A;  1RF1 C;  1E5W A;  1GU4 A;  3BAS A;  1L0L J;  2W6A A;  1EXJ A;  3L73 G;  2A06 G;  1ZN5 A;  2XND H;  3CX5 D;  1FOS F;  1KB9 I;  1VF5 B;  3KZI E;  4NPF X;  2LXB A;  1AVO A;  2IBZ E;  3IR9 A;  5CJ4 A;  2E43 A;  1L0L D;  1Q86 Q;  1JY2 O;  4NPD A;  5AVR B;  2E76 C;  2POH A;  5KKZ B;  1J1E C;  3V6I A;  4ZMD A;  2P1J A;  1FBM A;  1FZG A;  3V2P A;  1P84 H;  3B5N D;  2NZ2 A;  2D2C B;  3LID A;  3AE4 C;  1LP1 B;  3FXE A;  4W7Y A;  1NAF A;  1LTB C;  1VF5 C;  2ZT9 B;  3L70 D;  1S2E A;  3W67 A;  1HF9 A;  1BCC J;  1BGY J;  1XTC C;  3MZW B;  1T3J A;  1GDT A;  1BGY E;  1BCC E;  1LP1 A;  1KQL A;  2KNC A;  2L5G B;  3H1I J;  2XKM A;  4H13 C;  5CMZ A;  5BU8 B;  1M1K Q;  1X79 B;  4R4M A;  3AEF C;  1J1D C;  4WBA A;  1LWU B;  1DEE G;  1VQ5 P;  1SQV J;  1LTJ C;  5AW0 B;  1WT6 A;  1KD1 Q;  1KYO D;  2FXM A;  3B5N B;  3H1L D;  3JSV C;  2XU6 A;  3L72 D;  3SSU A;  2HYN A;  3A0H E;  2WPS A;  4HKZ H;  3E1R A;  1JMB A;  2YIU B;  1KC8 Q;  3BCC J;  2N1T D;  2E74 D;  1PGO A;  2QJP B;  1GTW A;  2E5Y A;  2FXP A;  3VMZ A;  4DCK A;  1W5C E;  4JYB A;  1VQM P;  4U3F D;  1JTH B;  2CPS A;  1QLE D;  1SVF A;  2H43 A;  3V2Q A;  1FZC C;  1VQ4 P;  2NPS C;  3AE5 C;  1JY2 P;  2QRX A;  1RE4 C;  3H1J J;  3RK2 D;  2QJK B;  1T2K C;  4TLF A;  1ZRT D;  2WSE H;  5KAF E;  3PH0 A;  1H88 A;  2ITA A;  2O1J A;  4WWI A;  1ZOY C;  2WSC J;  3B71 A;  1H0T A;  1FDI A;  1SFC C;  2ZXE B;  1ZRT E;  3PJS K;  3CC4 P;  2E76 B;  1NTK E;  2N1T A;  2P10 A;  2E74 B;  5B66 H;  1KB9 E;  1M57 D;  1SQX D;  4K3A A;  2ZYD A;  1EZV D;  3LW5 H;  1GW3 A;  4D6T D;  2E5T A;  2BCC E;  1IFD A;  1AV1 A;  2L91 A;  1H0T B;  2Q1K A;  3ABV C;  1VQ7 P;  3KXD A;  1W2B O;  5CCH A;  3G3Z A;  3Q3D A;  3HUS B;  3O6Q A;  5APU A;  1QL2 A;  3Q5P A;  1KYO I;  5KAI H;  5APT A;  1FJP A;  2W6B A;  4A7P A;  4BRY B;  2Z4E A;  1LTT C;  2WSE J;  1FZB A;  4U3F G;  5CJ0 A;  5H2F E;  4PD4 I;  3CCE P;  2J58 A;  1PGQ A;  1SQX K;  2FYU D;  4WVZ A;  1RF1 B;  3L73 D;  4TT3 H;  1IFP A;  3M0D A;  4GKG A;  4W7Z A;  2P58 A;  2E76 D;  3BRV B;  3H1L G;  4Y28 J;  4DJG A;  3QWO C;  5AW4 B;  1QVF O;  1FAV A;  2WWW A;  3CCL P;  1VQ6 P;  4IFF A;  4BXL A;  1ZXG A;  2B9B A;  3GHG A;  3RL0 B;  1WMK A;  1SQX E;  1NTM E;  1Y8A A;  2R44 A;  3B5N A;  3L4F A;  2M3B A;  1NTK D;  1MUU A;  3PHL A;  1PV3 A;  1NVO A;  2IZ1 A;  1SQX G;  1X8Y A;  4RJT A;  1PP9 G;  2YIU C;  1FJK A;  2C0X A;  1NU1 D;  3HE5 B;  2N9Y B;  5H2F H;  3RL0 g;  3TF5 A;  3A2A A;  3L70 J;  4HH2 A;  2FYN B;  3L75 D;  2FFD C;  1PP9 E;  1SQB G;  3FWN A;  3HTK B;  1RH5 B;  5GTH H;  1K9M Q;  2HPC A;  4RES B;  1MFT A;  1ZP0 C;  2IX7 C;  2IYO A;  3O8Z A;  4OH8 B;  1J1D B;  2V7Q J;  4C7N A;  4PV1 B;  1YQ3 C;  1ZR2 A;  1LGH B;  1ZW0 A;  4H44 C;  3RK3 D;  1G2C B;  4GOD A;  2WPV B;  5CCG C;  2O01 J;  1S72 P;  2E75 B;  1KFM A;  5CBO A;  1J2J B;  3BCC G;  4YXW H;  1AJY A;  3ITK A;  3CWB G;  1GL2 A;  2GUS A;  1BDC A;  1IO4 A;  3VP8 A;  1JY2 N;  1L0N D;  1OXZ A;  3KYQ A;  2Q5U A;  1QX8 A;  1QL1 A;  1RF1 A;  5CCH C;  1KV4 A;  2XDJ A;  1CZQ A;  3OW2 O;  1IK7 A;  4D6T G;  3RK3 E;  3MHV A;  4XFJ A;  2A45 I;  2B88 A;  1LTJ A;  3A0B E;  3K5B A;  2QJK C;  5APQ A;  1HBW A;  2VRS A;  4ZNC A;  1RE3 C;  2PRR A;  1ZV8 A;  4W80 A;  2JWA A;  3M9H A;  3L36 A;  3TSI A;  4ASV A;  3L75 E;  2B87 B;  5B5E E;  1N73 B;  3I5C A;  2Q6Q A;  4GT1 A;  4N78 D;  2N1T B;  1U7J A;  1RF0 A;  3F5H A;  1NU1 K;  3M9Q A;  1VQL P;  1LT9 A;  3RGU A;  4DT0 A;  5KJ7 C;  3A5T A;  2OYH C;  2PP6 A;  3CCM P;  1FZC A;  4D6T J;  3G6E P;  3H1H G;  4YPC A;  2Q7C A;  2I1J A;  1OX3 A;  1YTZ I;  2K9Y A;  4KHX A;  4O9B A;  1Q81 Q;  4EYY Q;  3CX5 E;  4I2L C;  1OW7 A;  3CLQ A;  1T8Z A;  2FXO A;  2LXC B;  1YBK A;  2Q3E A;  3L74 E;  3USS A;  1IFJ A;  5KLI C;  3CCS P;  1FDM A;  2K3R A;  4PD4 H;  2JKV A;  1G1J A;  1T3U A;  3JCU E;  5AW2 B;  1IFM A;  2A06 D;  2AEM A;  4N3Y B;  5BVZ A;  2YXR B;  1NTZ G;  3JC2 2;  1R8E A;  1GL2 B;  3AE1 C;  1SQP D;  2QJY B;  3L72 G;  3H25 A;  3CCU P;  1LT9 C;  2OYH A;  2WPQ A;  4RO0 A;  3CXH H;  1USD A;  2Z5H A;  5K5G B;  2MKV A;  3LIE A;  5CBN A;  5AVV B;  3H1K J;  2DW3 A;  1HGZ A;  3RK3 C;  2BEQ D;  2KUB A;  1JOC A;  1NTK J;  3GF7 A;  3P8C E;  5AW1 B;  1KQF B;  4I1L A;  2WVR A;  3T97 A;  3M0D C;  1VQP P;  1L4A D;  1PP9 D;  1N73 A;  1J1E B;  2O1K A;  4EOT A;  3NFQ A;  3AE2 C;  4Y99 C;  1NTZ K;  3G71 P;  1VQ9 P;  1KFN A;  3E7K A;  1PL5 A;  1M1J C;  1EZV I;  1NTK K;  3H32 B;  1S9K E;  2A45 G;  2BAS A;  3D6Z A;  3TNU A;  3L71 J;  1OW8 A;  3WMM 0;  2Y0C A;  4H44 D;  2QG4 A;  1NTZ J;  1JB0 J;  1M1J A;  2D2C D;  1PPJ D;  1M8O B;  3PTZ A;  2J59 M;  2H7H A;  5KLV D;  1NTZ D;  4Y99 B;  3F89 A;  1JO5 A;  2N1T C;  4U3F E;  1BE3 J;  1RF0 C;  1FZE A;  5KLV J;  3GW6 A;  1Y47 A;  3MP7 B;  3LW5 J;  3HUS A;  1DD4 A;  1L4A B;  3O6Q B;  4L76 A;  4LLH A;  3TGU E;  2KK7 A;  3Q2Y A;  1BSN A;  2Z5I A;  1G2C A;  1OMI A;  2FYU E;  3H1L E;  2HLO A;  3AEG C;  3Q5R A;  3TGU G;  1HTL C;  3L71 G;  1SQP K;  2FY8 A;  1SP4 A;  3HTK A;  5C39 A;  1IK9 A;  1NU1 E;  5GTI E;  1YQ4 C;  2M3E A;  2R3S A;  1OIP A;  2KZJ A;  3HD7 D;  4KT0 J;  3RK3 B;  2IFM A;  2RKL A;  5KLI B;  3C9I A;  3CX5 I;  4I6M C;  1HWT C;  3V5B A;  2JWD A;  3H1K E;  1AQT A;  1ZR4 A;  1BCC D;  1BGY D;  1EDJ A;  1FU1 A;  2Y0E A;  2LKM A;  1VQO P;  2QJY C;  3A3Y B;  3AE6 C;  3M0A A;  5AVT B;  2C0W A;  2P2U A;  4AYC A;  1Y9B A;  5L8R J;  1MZ9 A;  5CCH D;  3U1C A;  1N7S B;  5APS A;  1LTI C;  1LTJ B;  1WRG A;  1SQP G;  3GF3 A;  3I56 P;  2IYP A;  2H89 C;  3FWL A;  2N9B A;  3HE4 B;  4L74 A;  1U7M A;  3BRT B;  3H1J G;  2NPS A;  4CPG A;  3CMA P;  3CPW O;  1OVU A;  4ASW A;  4ZKP A;  1NJI Q;  3HD7 B;  2JR8 A;  1AQ5 A;  2PGD A;  1R5L A;  1RE3 A;  1SFC A;  3AEB C;  1GZL A;  3CWB E;  4JPZ B;  3CXH E;  1PIX A;  1N7L A;  4UB6 E;  1S4X A;  2YMY A;  2OAR A;  3P8M C;  3VTP C;  4EDF A;  5KJ7 D;  2QE7 H;  5KLV E;  1JMM A;  1X9V A;  1L0L K;  1QEX A;  1EZV E;  2K88 A;  3TNU B;  3Q1M A;  1SQB D;  2KNC B;  1SQP J;  1YTZ T;  3L75 G;  1YJN P;  5TJH A;  4XE5 B;  3MD0 A;  1KYO E;  2JO1 A;  2J5U A;  1LWU A;  1SQB J;  2D2C C;  3AE9 C;  4WB4 A;  5TIS H;  2PAJ A;  1IFN A;  3R2P A;  2FFD A;  2H88 C;  1VF5 D;  2YO3 A;  3I55 P;  3MGN A;  1DD3 A;  1CSB A;  1L4A C;  2XV5 A;  3L70 G;  3S1K A;  3VOP A;  4OVN F;  4DZO A;  3H1H E;  5AW5 B;  2W83 C;  3HE5 A;  4YTP C;  4HYT B;  1PGP A;  2G3A A;  2R32 A;  3M91 A;  3L70 E;  1U57 A;  2W90 A;  2OGU A;  1YJW P;  3GHG C;  3EQ2 A;  3L74 G;  2V4H A;  2YKP A;  3VMA A;  1VPC A;  1EDK A;  2IBZ I;  1YIJ P;  2AEJ A;  3AE7 C;  1M90 Q;  5B5E H;  2ZYG A;  1H8A A;  4KJM A;  3IFM A;  2R3C A;  2LR2 A;  3AEE C;  1KIL B;  4MN4 C;  3L72 J;  3L72 E;  3II6 A;  3L73 J;  2M8R A;  4M3L A;  3BCC D;  3N7N A;  2HFE D;  1DH3 A;  5AW3 B;  3S4R A;  2R5D A;  3KPE A;  1OZH A;  3L74 D;  3SFD C;  2ZXX A;  1MFZ A;  5DJU B;  1K73 Q;  3MTU E;  3CCV P;  1KMI Z;  1UIX A;  3FGA D;  1JY3 O;  2WSF H;  1E79 H;  3IAO A;  2Q3I A;  1SQQ E;  1OW6 A;  2ZT9 C;  4H44 B;  3MUD A;  2RMZ A;  1HVV A;  2ZAE B;  1P84 E;  2JEE A;  4WY4 A;  2OYI A;  1YHQ P;  3WUU A;  1BSH A;  1KIL D;  4H13 D;  1BCC G;  1BGY G;  2QVA A;  3R4Y A;  5APX A;  2KYV A;  2K9J B;  2KIK A;  3H1I D;  2FYU K;  1NTK G;  1JCC A;  3L35 A;  1LWU C;  1SQX J;  3L75 J;  3SWK A;  3KZI H;  1KTM A;  1NOH A;  3B4S A;  2YNY A;  4DOJ A;  1P84 D;  2CPB A;  5AW6 B;  3HRN A;  3NXS A;  2IDB A;  2AXT H;  4B86 A;  1ZLL A;  4PJ0 H;  2IPP A;  2A45 H;  2O3J A;  2ZVO B;  2IBZ D;  4Z1M H;  2Q9I A;  1ZME C;  5KLV K;  2ZFC A;  4OWF A;  1JTH A; 
#chains in the Genus database with same CATH homology
 1KIL C;  2JJL A;  1N73 C;  2QM7 A;  5AW9 B;  3KQG A;  3CI9 A;  3E1I A;  2XNX A;  1KIL A;  5AW8 B;  4WY4 D;  2WT7 B;  3VN0 A;  1NH4 A;  2O01 H;  3VMX A;  2HOD A;  2HPC B;  5APW A;  3B8E B;  3V4W A;  3OA7 A;  1EQ7 A;  3PP5 A;  3VYI A;  1DX7 A;  4JF7 A;  2KP8 A;  3RL0 D;  4C46 A;  1L0N K;  1N86 A;  3B5N C;  1KZU B;  2WIT A;  3BAT A;  1URQ C;  3KDP B;  2YKO A;  2WPR A;  1JNM A;  1CI6 B;  1URQ A;  1SQV K;  2NPS B;  3RL0 C;  3H32 A;  2W27 A;  3N4X A;  2KLV A;  4N6J A;  4C7N B;  5AW7 B;  5AVU B;  5KJ7 A;  5APV A;  2FYZ A;  1SFC D;  1XTG B;  2H8P D;  3V2R A;  2KOG A;  1Z56 A;  2I1K A;  2NPS D;  2HG5 D;  1M7L A;  1IJD B;  3RK2 B;  2OYH B;  1RE4 A;  5CCG D;  1OWA A;  5AVY B;  1LTA C;  1SQQ K;  3CL3 D;  2R5B A;  3OAK A;  3VMY A;  1SFC B;  3A7O A;  4GIF A;  1M1J B;  3HD7 A;  1N7S A;  4M3L A;  3P7K A;  1FZF A;  3EFG A;  1FZC B;  5AVX B;  3U59 A;  1N7S D;  1SLQ A;  2MJZ A;  3HD7 C;  1N2D C;  1S9K D;  1SQB K;  1YYC A;  1W2E A;  1NTM K;  1IC2 A;  2WTY A;  4C7R A;  5AVQ B;  5CCG A;  1PFI A;  4LC1 A;  4WY4 B;  2OYI B;  1N7S C;  4AQR D;  1MV8 A;  1GD2 E;  3TK1 A;  1URQ B;  2IFN A;  1JUN A;  5AVS B;  2GM4 A;  1GU5 A;  1HJB A;  5AVZ B;  1GK4 A;  1NWQ A;  5CHX A;  3P32 A;  2WSC H;  1VDF A;  1L4A A;  1NO4 A;  4ZKU A;  1HUC A;  1JY3 P;  2YO2 A;  1JCD A;  1FZA A;  2C9L Y;  3NMD A;  4LGD E;  1URQ D;  4EIJ A;  2QM8 A;  3TYY A;  1AQ5 A;  3VP9 A;  1FOS E;  3M06 A;  4JYC A;  1NHL A;  2HOD B;  3L37 A;  3GHG B;  2P7J A;  1LTS C;  5KLV K;  2KSJ A;  3RK2 C;  2C9N Y;  1T2K D;  1NKN A;  1IFI A;  3MIW A;  2XZR A;  2WT7 A;  2E42 A;  1A02 F;  1DEB A;  1CI6 A;  5AVW B;  2WZ7 A;  3OJA B;  1H89 A;  2GUV A;  3HE4 A;  2KB7 P;  4AUW A;  1GL2 C;  3H6P A;  4IFM A;  1LT9 B;  3SWY A;  3V2N A;  3UIA A;  4XA4 A;  4N78 E;  1AFO A;  1LTG C;  1G1I A;  1GK6 A;  3P8C D;  2P67 A;  5BU5 A;  1HGV A;  2YKQ A;  1GW4 A;  3V4Q A;  3BVH A;  1JY3 N;  1GL2 D;  1RY3 A;  5APY A;  4IFD K;  4WY4 C;  2OYI C;  5KTB A;  1HH0 A;  1A02 J;  1CW5 A;  3U1A A;  2FKW B;  1NKZ B;  3SWF A;  3NTN A;  1RF1 C;  3HUS C;  3M9B A;  1E5W A;  3BAS A;  2W6A A;  1FOS F;  1ZN5 A;  2E43 A;  3IR9 A;  5CJ4 A;  1JY2 O;  5AVR B;  2POH A;  1J1E C;  2P1J A;  1FBM A;  1FZG A;  3V2P A;  3B5N D;  3LID A;  4W7Y A;  1NAF A;  1LTB C;  1XTC C;  1GDT A;  1T3J A;  2L5G B;  1KQL A;  2XKM A;  5CMZ A;  5BU8 B;  1X79 B;  1J1D C;  4WBA A;  1LWU B;  5AW0 B;  1LTJ C;  1WT6 A;  2FXM A;  3B5N B;  2XU6 A;  2HYN A;  2WPS A;  2N1T D;  1GTW A;  3VMZ A;  4JYB A;  1JTH B;  2CPS A;  1SVF A;  2H43 A;  3V2Q A;  1FZC C;  2NPS C;  1JY2 P;  1RE4 C;  3RK2 D;  1T2K C;  2WSE H;  1H88 A;  2O1J A;  1SFC C;  2ZXE B;  2N1T A;  3LW5 H;  1GW3 A;  1IFD A;  5CCH A;  3G3Z A;  3HUS B;  5APU A;  1QL2 A;  5APT A;  1FJP A;  2W6B A;  2Z4E A;  1LTT C;  1FZB A;  5CJ0 A;  2J58 A;  1SQX K;  1RF1 B;  3M0D A;  4GKG A;  4W7Z A;  3BRV B;  5AW4 B;  1FAV A;  2WWW A;  4IFF A;  3GHG A;  3RL0 B;  3L4F A;  3B5N A;  2M3B A;  1MUU A;  1X8Y A;  1FJK A;  2C0X A;  3HE5 B;  3A2A A;  4HH2 A;  2FFD C;  3HTK B;  2HPC A;  4RES B;  2IX7 C;  3O8Z A;  4OH8 B;  1J1D B;  4C7N A;  1ZR2 A;  1LGH B;  3RK3 D;  1G2C B;  5CCG C;  1KFM A;  1J2J B;  1GL2 A;  2GUS A;  1IO4 A;  3VP8 A;  1JY2 N;  1OXZ A;  3KYQ A;  2Q5U A;  1QL1 A;  1RF1 A;  5CCH C;  2XDJ A;  1CZQ A;  2A45 I;  1LTJ A;  5APQ A;  1HBW A;  2VRS A;  1RE3 C;  1ZV8 A;  4W80 A;  3M9H A;  3TSI A;  3L36 A;  1N73 B;  3I5C A;  4N78 D;  4GT1 A;  2N1T B;  1RF0 A;  1NU1 K;  3M9Q A;  1LT9 A;  3A5T A;  5KJ7 C;  2OYH C;  2PP6 A;  1FZC A;  2Q7C A;  2I1J A;  1YTZ I;  4KHX A;  4O9B A;  4I2L C;  3CLQ A;  1T8Z A;  1FDM A;  1IFJ A;  1G1J A;  1T3U A;  5AW2 B;  5BVZ A;  1IFM A;  4N3Y B;  1GL2 B;  1LT9 C;  2OYH A;  2WPQ A;  2Z5H A;  3LIE A;  5AVV B;  1HGZ A;  3RK3 C;  1JOC A;  3P8C E;  5AW1 B;  1N73 A;  4I1L A;  3T97 A;  3M0D C;  1L4A D;  1J1E B;  2O1K A;  4EOT A;  3NFQ A;  4Y99 C;  1NTZ K;  1KFN A;  1M1J C;  1NTK K;  3H32 B;  1S9K E;  2A45 G;  2BAS A;  3TNU A;  3WMM 0;  1M1J A;  2J59 M;  2H7H A;  4Y99 B;  1JO5 A;  2N1T C;  1RF0 C;  1FZE A;  4LLH A;  3HUS A;  1L4A B;  2Z5I A;  1G2C A;  2HLO A;  1HTL C;  1SQP K;  1SP4 A;  3HTK A;  1IK9 A;  3RK3 B;  3HD7 D;  1HWT C;  2IFM A;  3C9I A;  4I6M C;  3V5B A;  1ZR4 A;  1FU1 A;  2LKM A;  3A3Y B;  3M0A A;  5AVT B;  2C0W A;  2P2U A;  4AYC A;  5CCH D;  1MZ9 A;  3U1C A;  1N7S B;  5APS A;  1LTI C;  1LTJ B;  1WRG A;  2N9B A;  3HE4 B;  3BRT B;  2NPS A;  4ZKP A;  3HD7 B;  1RE3 A;  1SFC A;  1GZL A;  1N7L A;  2YMY A;  3VTP C;  2OAR A;  3P8M C;  5KJ7 D;  1JMM A;  1X9V A;  1L0L K;  1GU4 A;  3TNU B;  1YTZ T;  4XE5 B;  3MD0 A;  1LWU A;  2FFD A;  4WB4 A;  2PAJ A;  1IFN A;  3R2P A;  2YO3 A;  3MGN A;  1CSB A;  1L4A C;  2XV5 A;  3VOP A;  4DZO A;  5AW5 B;  3HE5 A;  4HYT B;  2R32 A;  3M91 A;  3GHG C;  3EQ2 A;  2YKP A;  1VPC A;  1H8A A;  3IFM A;  2R3C A;  1KIL B;  3II6 A;  2M8R A;  3N7N A;  2HFE D;  1DH3 A;  5AW3 B;  2R5D A;  3KPE A;  1MFZ A;  3MTU E;  1JY3 O;  2WSF H;  2Q3I A;  3MUD A;  1HVV A;  4WY4 A;  2JEE A;  2OYI A;  1KIL D;  5APX A;  2KYV A;  3L35 A;  2FFD B;  2FYU K;  1JCC A;  1LWU C;  1NOH A;  2YNY A;  4DOJ A;  2CPB A;  5AW6 B;  3HRN A;  3NXS A;  4B86 A;  1ZLL A;  2IPP A;  2A45 H;  2Q9I A;  2ZFC A;  1JTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...