3VPBA

Argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
b'MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetylornithine deacetylase
molecule tags Ligase
source organism Sulfolobus tokodaii
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
pubmed doi rcsb
total genus 92
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpbA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpbA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpbA01
5BPHA 2DWCA 2V58A 1DV2A 1M0TA 4FE2A 2R7NA 4O84A 3LP8A 1KBLA 2R85A 4O7LA 3R5XA 4GGMX 4FFOA 4WD3A 3K3PA 2CNUA 2W6NA 2CNVA 1OBGA 2YZGA 4WBNF 2GLTA 1I7LA 1Z2NX 4MV1A 4I4TF 5K2MA 2V59A 2P0AA 4IZOA 4MV9A 1B6SA 1GSAA 4RZQA 4XZ3B 1Z2PX 5CB4F 5JVLA 4MV3A 3RFCA 1M0WA 5CAEB 1E4EA 3KAJA 3VPCA 2R86A 2ZDGA 2GQRA 4O7SA 1EUDB 3TQTA 2R82A 3JZFA 1CS0A 3GLKA 3KAKA 4ME6A 4HNUA 3MWEA 1UC9A 2XCLA 3V4ZA 2GQSA 5HBRB 1KJJA 1BXRA 3VPBA 5IYZF 4C5CA 4TV9F 3R5FA 2C00A 3N6RA 3VA7A 1Z2OX 4O86A 5JQWA 4O7WA 4C5AA 1DV1A 1KJQA 5LOVF 3RV3A 4ZOLF 2FPGB 1M6VA 1GSOA 4EA9A 4O2AF 1KJ9A 3ETHA 4M98A 1DIKA 1W96A 1BNCA 4C5BA 2CNQA 1CQJB 2W6PA 2VPQA 4IHJF 2ZDQA 2W6OA 3R9RA 4HR7A 1ULZA 1IOWA 1EZ1A 5BPFA 2CQYA 5BMVF 4XX0B 4O81A 2YW2A 2YZMA 5H80A 2R7MA 1VBHA 2Z02A 4ZHQF 2YRXA 3BSSA 4NYEA 5J2TF 4QSHA 3LWBA 2NPOA 3U55A 3TIGA 3UFXB 4IWYA 2NU8B 3ORQA 4O82A 2DIKA 5CA1F 5C8YF 3U9SA 3HO8A 1C30A 5I47A 3MWDA 4O7TA 2VR1A 4O7YA 2GPWA 1E4EB 1EHIA 2I87A 4YJ3F 4TV8F 3WO0A 3VMMA 3JZIA 3AW8A 4O83A 4MV7A 4EABA 2ZDHA 4I50F 4FFPA 3RUPA 5J2UF 4YAJB 2FPIB 1EYZA 4M9UA 4O7VA 5JH7F 3G8DA 1IOVA 1KUTA 5D8DA 1JDBB 2QK4A 2R7LA 3ORRA 5KX5F 3MJFA 1KC7A 3VPDA 1W93A 4O4IF 4EAAA 3Q2OA 3V4SA 4Y8VB 1B6RA 2HGSA 4DLKA 2VQDA 4FU0A 1C3OA 4MV6A 4EGQA 4O7RA 3DF7A 2W6MA 3U9TA 5C1PA 3TW6A 5KKNB 4O7NA 4M99A 3VOTA 2X0SA 5LXTF 2Z04A 2QF7A 3BG5A 1GGOA 3KREA 4YJ2F 2PVPA 1WR2A 1PK8A 5JQGF 4O7ZA 1T36A 4MV8A 2VHEA 3R5HA 3QFFA 1OBDA 5DMXA 5LYJF 3WNZA 2FB9A 3TINA 3BFPA 2W71A 2PBZA 2YZNA 2W6ZA 3BSWA 2R6FA 3U54A 1PX2A 5JVDF 2V5AA 1JDEA 4MV4A 4O4JF 2HJWA 4MA5A 1GSHA 2PN1A 5FNVF 3RV4A 5C1OA 4O4LF 5CA0F 5EZYF 4EA7A 3KALA 2YYAA 2YL2A 4XYLB 2NU9B 3WO1A 4IWXA 3K5IA 3GIDA 4YBZB 4EGJA 2DLNA 2FP4B 2YS7A 4E4TA 3E5NA 4TUYF 3BSYA 3NUAA 4YB8B 1I7NA 4HNVA 1KEEA 2NU7B 3OUUA 2YRWA 2OLSA 3K5HA 4EA8A 2FPPB 3JRWA 3I12A 4EG0A 1VKZA 1JKJB 2I80A 3N8DA 3Q1KA 4FFNA 3SE7A 2W6QA 2YZLA 3TIIA 2R84A 4IIJF 2R7KA 1A48A 1KJIA 3OUZA 2R87A 2GPSA 4MA0A 2IP4A 2DZDA 3G8CA 4O2BF 4MAMA 2CZGA 3JRXA 4FFMA 2NU6B 1SCUB 4I55F 1EUCB 2WYOA 4XYMB 1VBGA 2NUAB 2YS6A 4ZI7F 2YWVA 5LA6F 4J6EA 4FGRA 1CQIB 1KJ8A 2XD4A 4ZQIA 4FFRA 3R23A 4M9CA 5LP6F 5HV6A 2I8CA 5GONF 4HQ6A 2J9GA 1CE8A 4L1KA 3HB9A 3HBLA 1JLLB 3AX6A 1AUVA 4DIMA 2W70A 1UC8A 4YAKB 1A9XA 4FFLA 1AUXA 3ETJA 2SCUB 4O4HF 4HNTA 1GLVA
chains in the Genus database with same CATH superfamily
2ZUVA 3IHWA 3BQMB 2DAAA 1D07A 3BAAA 4AYWA 3OPYB 3FIJA 2ZE8A 1RQRA 4O84A 1JR4A 4RHFA 1G55A 1QNLA 2W2KB 3PDIA 2VPIA 5T8KA 1Y98A 1R4ZA 3RYFA 3STVA 4C14A 2XBLA 1XTKA 1DIGA 1T4CA 4MUEA 2Q3JA 3GFSA 2ZSIA 1CVLA 3PC2A 4OSOA 4URWR 4WRRA 3VJLA 4DQUA 1XLVA 3ZCXA 4PCUA 2HR1A 4IDEA 3BGDA 1Y5MA 3K70C 4ML3A 2F4VB 1X7WB 5J2TB 1QF7A 1RFLA 1IN6A 3O2SB 3D4NA 4KU4A 1ZGAA 2XQKA 4CMJA 2VF8A 2PSEA 2V54A 2A1UA 3AK4A 4WESA 1YCFA 3ZDZB 2D00A 3V32A 3ITKA 3K2QA 2WKRA 3LZDA 2A92A 4XH9B 1JUDA 4DLYA 3QZ7A 1F6WA 3TPFA 1R74A 1XVIA 1SURA 1ZNQO 1MAWA 2WVHA 3IHKA 3WLOA 5IF9A 3IQGX 3BTSA 4TTRA 4PANA 1FP6A 1XRPA 1U8TA 1DEKA 1DPFA 4DR4H 2JI7A 3VPFA 3N7TA 4JFAA 1UEIA 4W1SA 1O6FA 4IH9A 5DCYA 4EHIA 3C3DA 1QG4A 1Z2AA 5E2BA 3DZHA 3C87A 4QJIA 4MV1A 3FMVA 5TQ2B 3TSZA 5FLMG 1AKQA 1ADCA 2DUNA 5CDYA 3IL2A 1FXUA 5DOZA 1FRVA 4DV6B 2PUWA 5DQIA 1CUZA 1Y34E 2N1MA 2C78A 4ZFNA 3VDMA 4YASA 3I1FA 1EE1A 3ND8A 5LA6A 3SR3A 5LKAA 2Z1MA 5GIPE 1TWAA 1L7PA 3GHYA 4GC5A 1JQAA 1GQOA 5IX8A 1MRNA 2XKAA 3H9EO 4PAQA 1YJ5A 4MULA 1N36H 2IYQA 1OFIA 3R4VA 1J56A 4PYQA 3GLQA 1RRMA 2X76A 2PWBA 4MRPA 4ZQBA 5L1IA 4HQOA 1ZK4A 4ED7A 6GPBA 5BQFA 5I5EA 2HA3A 1II0A 4U2GA 4DR2B 3I62A 5JYBA 2BHTA 3KX2A 1QGYA 3QE4A 2JLSA 5K8CA 1CNEA 1D2NA 3ZWNA 1ZW1A 5AW4A 1F3LA 1V5EA 3GNLA 4BFZA 1E0SA 3FTNA 4OHRA 3A4VA 1TJYA 2CHFA 3I34X 3OT1B 4O3MA 1ADBA 1NW4A 3CO0S 4YP5A 4P8RA 2FI1A 4HYQA 4QAQA 4PXSA 1ULTA 3GGGA 1YRBA 3ADDA 1E92A 2L0XA 4ZRNA 4J7XA 4N3AA 1UQRA 2BFBB 4QG3A 3D3KA 5CVTA 3IB3A 1WOMA 2HHLA 1QORA 4M0JA 2DU8A 2HPZA 4TWAA 4E5KA 5B3JC 5ICMA 1ZONA 3V4ZA 3GTPA 1O58A 2DT5A 2W90A 4FN5A 5M3BA 5TF4A 3R9WA 4IOLA 3HXPA 1NR5A 2ATXA 3RKUA 1KDRA 1Q7TA 1A7AA 3GCDA 5BSEA 4DG5A 1XA4A 4JB0A 3MS7A 1FBTA 4Z1MA 2PGDA 4HFRA 1IG0A 2GK7A 2AJBA 4G63A 4NCBA 2M1XA 1D4AA 2ODAA 3HJAA 1O94A 4EY3A 4R31A 1A2KC 4TWRA 4KV7A 5ALVA 2GXUA 5IN5A 1V1JA 3R7SA 3M6IA 3N2GB 4CJXA 4C5AA 2TRSB 1ORRA 1ZLXA 5AI5A 3IBSA 1QIIA 4Z3DA 3LQQA 1CRWG 5B3JA 2CW7A 5TRTA 1NNUA 3F46A 3D2BA 1NMXA 1GYPA 2G06A 2VDWA 3PUKA 2AG0A 4TMXA 1RZRA 5FLXA 1M2VB 4RSGA 2R1TB 1ZQ9A 2Q3DA 3JQEA 1CKMA 1KNQA 2HGZA 1GSOA 1IN7A 1GGNA 3KUKA 3H3XA 3MTGA 3KTAA 1FP1D 1QRRA 3PA8A 5FBQB 3RVRA 3VU3A 4B35A 4QGSA 5KTKA 1MX5A 3FOWA 3C3EA 1R0YA 3K2IA 3EF0A 2X5XA 5JXWA 4BMCA 1XEAA 7YASA 3GEMA 2J0VA 3L79A 5G4KA 1FTQA 2XCPA 5KYUA 2EGGA 1BNCA 5CVCA 5BW5A 2UZ4A 4YRJA 5KFGA 3JYNA 3EVCA 1CQJB 2H5IA 3OT1A 2PX6A 4G5YA 5IFKA 3AY7A 4MVXA 3TW7A 4OBXA 2IHJA 3TRKA 3OLVA 2DQYA 1JKFA 3KQOA 5H3CA 1C7QA 3KYJB 3WB1A 3FI0A 3AJDA 5L7TA 3DMTA 3OIWA 4IJ5A 3MRSA 4NK5A 3LXUX 2X0NA 3K1ZA 4BAGA 4E5YA 3OCZA 5KYWA 1XRNA 3KSMA 1JEYA 4AXBA 3H5WA 2WJVA 3BD9A 2V45A 1JHDA 5BMVF 2JEGA 5CVUA 1G60A 1BH6A 4FS1A 4U7TB 1WR8A 4FNOA 1XCOA 2C3MA 5B1EA 4LWOA 4JUZA 2WB2A 3RT7A 1H94A 5H80A 5ILQA 5KU7A 3G0GA 2EBHX 3E9MA 3EBOA 4R8UB 4JT8A 4Q16A 1PGOA 2BR3A 1G3IA 2WSIA 4KUGA 3OLWA 4L9WA 1EVYA 2QAGB 1GUFA 1IXYA 2Y0PA 3DOFA 2ALJA 4J0QA 1YJXA 1WQ3A 4C4RA 2DUJA 1HXHA 5LYJA 4ARIA 1XZCA 1XU4A 5BRAA 3E8SA 2W11A 2ZRMA 2G8LA 3G9QA 3GROA 3LUAA 3FTCA 1B8OA 2QXYA 1B43A 1LK5A 1NBAA 1Q0UA 2NPOA 2OK8A 3N87A 3NEAA 3NUGA 5CIQA 5F1YA 3RKSA 4NMXB 3S2YA 5KQGA 5FBZA 4IR1A 2EYUA 4GUAA 2W8KA 1HMYA 2QAGA 2FEAA 1X2BA 4IFBA 3ZWDA 1UFOA 4FJ2A 4GDFA 4I1SA 4TM8A 4LECA 2BMFA 1HV8A 2HSEA 4MRAA 1U28A 2BZSA 3EGVA 4DV3H 4DLPA 3NGMA 2ZWAA 5IG2A 4O7YA 3KSZO 1E5TA 1R12A 2NUBA 4CV1A 2XKBA 4Q1BA 5IANA 4N7RA 1FX1A 1PVVA 2I54A 2NSDA 2OZLB 2C5LA 3KZMA 1CX9B 4XCVA 5AKEA 2XHZA 1CR0A 3ETNA 1E3QA 3GJ8A 5EVCA 1WXFA 3JV7A 3W1GA 3TEJA 5JNRA 3URKA 4YN3A 1L5MA 3TDNA 5TPZD 1W0JA 2IY8A 4DV0H 1ZHHA 2Q1WA 1QJ4A 3A9SA 4FGWA 1GZDA 4TRJA 4G8CA 3P0RA 3A3KA 2JLZA 3KKMA 1X3SA 1OWLA 4RZ3A 5IVKA 1LA2A 2APJA 2Z09A 3NETA 3ZV3A 4ZCIA 2YMPA 3HA3A 3QXJA 5EZYA 1HNXH 3HY6A 2GN6A 3ZHQA 4C7MA 5KS2A 3VU9A 1XU7A 1R6TA 3X1ZA 1HT1E 3A1DA 3EGWA 1GOTA 3Q12A 2VVTA 1E1MA 2JIZD 1QB7A 2OCDA 4MO2A 4PZLA 2J3LA 2WAAA 4FXPA 4BQPA 5KWSA 3S28A 1NHGA 1YS1X 4IL5A 2AOUB 2BKAA 1XYGA 1Q0ZA 4U1RA 1AF4A 5BV2P 2NTYC 4V1CI 2Q7DA 2X4DA 1YZVA 2JF0A 2MTBA 2OG1A 2R4QA 4DL5A 1YRAA 1GV1A 2ANCA 2PKXA 1P75A 1R6XA 3ORRA 1EJBA 1N9GA 2OORA 4RU1A 5LSAA 1E7QA 5IAAA 3MPUA 3WQSB 4QARA 5I4BA 1E1RA 1SCKA 2L82A 3O1IC 1REQB 4FBTA 3D8UA 1ZRSA 4F0JA 4Y67A 5EUQB 4TYWA 3JR7A 3TNLA 2AEJA 1RWXA 4HI0E 4BE4A 1HEYA 5L3SA 5JW6A 2ZSFA 2QX9A 1DP4A 4JXKA 4IG9A 1TFUA 3CX8A 1Q0RA 3WWZA 2BGUA 2XYRA 1H6CA 4QATA 1JQLB 4YRMA 5F76A 1J7KA 4QZVA 1PFVA 5KYXB 3KOUA 4UM7A 4HSEA 1WD5A 1OI7A 1IHOA 1D4ZA 1A0OA 1PU2A 2HK7A 2ZRKA 3IIEA 2G5TA 3KDSE 3EVEA 3SMVA 5JFOA 1RI2A 2CWDA 4R5HA 3WDSA 2C3OA 3I5UA 5AUNB 2WTAA 3VI3B 3SLGA 1CR6A 2IMWP 1J2EA 1ATIA 1P39A 3V1LA 3ZW7A 4DC0A 3DMTC 2ZUEA 5JJKA 1I3LA 1JR3A 2C5HA 1R9MA 5CU7A 1K5GA 1JMKC 3GLGB 4EWLA 2E48A 1PZGA 3OPXA 1GZ3A 4MWCA 1CE8B 2WPNA 3TSYA 1WCMG 1PF7E 2HSWA 5J9FA 1A7UA 1FJ2A 4W1QA 4LBYA 4JCCA 2RI6A 2VHEA 1VG8A 2QLMA 3UMBA 5A02A 1GA6A 1RWBA 2W58A 1OREA 2HZ7A 1GCAA 2JLBA 3H8WA 4GKVA 5DMXA 2GEBA 3CRMA 2YVQA 1KBZA 3KDPA 2VYND 1Q0TA 2DLCX 5L6MB 4IUCS 2O52A 1UXJA 3JQDA 2GQ0A 1Y0BA 4TYYA 4OD0A 3PW0A 1N5RA 4ESHA 5JBQA 4WOPA 4EYHB 2O0MA 3FDXA 1ZAYA 1RHJA 3BL6A 1KJWA 2CNBA 4AXXA 2YNMA 4CNBA 4Q66C 1Z82A 3HJRA 2AGQA 4RPCA 1PT7A 1RAIA 5BV1A 4R68A 3GA7A 2RB5A 4KDEA 4NWIA 1JDEA 1ZESA 2J59A 1KSFX 1JA1A 5DG7A 1NV9A 3ZDXB 1FRQA 4QKQA 2VPWA 2KSWA 4E7OA 3QLTA 4I1IA 1CJVC 3B9RA 2QRPA 4CLRA 4UEKA 1J2JA 3GLVA 2PUHA 4J7UA 1J07A 2OTCA 2OYRA 1B0PA 3BMNA 3M6VA 4MDHA 2F1RA 1WRVA 2D1QA 2YFHA 1VPTA 3MUEA 4IV5A 4J9PA 1KFKB 2PVSA 3V4OA 4EJSB 1P0QA 1CRZA 3WRVA 3UO8B 3ONDA 3NAQA 5I60A 3PQCA 5EJFA 2IP2A 3DVLA 3HWRA 4JY7A 2WP8J 1EFLA 1Z13A 2KW5A 4RJTA 1H93A 2MU1A 2WIKA 4RX1A 4LRWA 2TMYA 3D2AA 4KUEA 4FNAA 1RLOA 4KX3A 2NU9B 2GAAA 4K6GA 4MQFB 5E95A 4JBXA 4CKXA 4GEGA 3VYSB 1X39A 2GAIA 1EK0A 3CZ4A 1LNZA 1U4OA 4FCVA 4LPSA 5ALFA 3G0BA 4B87A 2G9UA 1GTJ1 5E9QA 2ASJA 3F6EX 3OE1A 4JEMA 2XNDA 4Q37A 4CMIA 4B31A 5ISMA 1R1DA 3I2JA 4FFVA 4GLLA 5EN4A 1KVQA 3E1KA 1ZUNA 3BRSA 1XTZA 3SFVA 2EDCA 3U4IA 3FN4A 4GX1A 1FFCA 1XZLA 3GWZA 2WIBA 4IWNA 3S2SA 3JQGB 2WSLA 2YV3A 4AP9A 3PK0A 1HOXA 1UBJS 1AK2A 2YMQA 2ODBA 3U7QA 1Y1QA 1L7OA 2V3CC 4HNVA 1KEEA 1PR9A 2VAPA 2CMGA 2PU5A 3OPNA 4GL4A 4WKNA 5A05A 1P2BA 3AY0A 4ZXFA 1P3JA 1P2VA 2QRHA 3FCSB 1GAQA 3RS3A 4K2HA 2FPPB 2COKA 1HEIA 4GOXA 3RC1A 2H8GA 4ZAFA 4YQEA 2L19A 2YCHA 2EP8A 2GKSA 3H05A 4FS3A 3RNLA 2VDVE 1LRLA 1NW3A 1RHQA 2H4HA 3KZXA 2FCRA 3PYMA 5DXAA 4B3FX 1O3YA 2GZ1A 1OBCA 4FE3A 4FYWA 5SV2A 1XPRA 4YVFA 3UAYA 5A9SB 3ROXA 3AY3A 3HFJA 1CNFA 3A4LA 4NNOA 4Q4LA 2CVFA 2W6QA 2OOSA 2UUCH 2R84A 3L18A 1LPSA 4XX1A 4MW0A 1Z12A 3GIPA 5SYNA 3V7NA 3W5UA 4BNNA 4D82A 1JA0A 3KEGA 3KUXA 5A2GA 2V1XA 3KZNA 4LTDA 3ASVA 4ZOQI 3N41B 1B3BA 1E1KA 1FW6A 3MHTA 4RGBA 4X7MA 1IN4A 3D1LA 5DBHX 3TH5A 4CGZA 1NQTA 1EU1A 5J4HA 5IS2A 4GZ3A 1M54A 2H52A 4QQRA 1RABA 1C30B 2CZGA 1L6RA 1ZXXA 3ZQKA 3B3JA 4OI1A 3S40A 1AJEA 1JIHA 1OWMA 3NBQA 1IL0A 3FWYA 3VR0A 2DWQA 3OZAA 1IVSA 5KT4A 2W9CB 3B53X 2QN9A 3IS3A 4MGHA 3V80A 1FFEA 4F97A 3NKLA 2JI4A 4RLHA 1X87A 2YS6A 1OC4A 4LZJA 4OJKA 5KNBD 1OLOA 3E2PA 4QQNA 1JE1A 1VBKA 2ZPTX 2PUVA 5E6RB 3SS8A 1CY0A 5C8YA 3AIIA 2A5FA 4XPIB 2E87A 4RZ2A 1FMCA 1WOYA 1L2ZA 4Y6QA 1UPCA 3MIZA 4HVCA 2I4TA 1LCIA 3ABIA 1VDZA 5E1DA 1DBWA 1Z4JA 5KYXA 3S7TA 2DFVA 1II9A 1RP7A 2LWIA 1OPXA 2FP3A 2RKOA 2X5NA 4GM1A 4RKQA 2GYYA 1YOBA 3ZKWA 2HMWA 4MRSA 4PSDA 1L4NA 2VPXA 3KUDA 5TT0A 2W7OA 5ABPA 2ZWVA 1W8DA 5AVVA 3CVZA 4PTZA 4RVDA 3KD3A 2OKGA 4C0HA 2AXEA 5IK2D 2OHXA 2WAQE 1DC4A 4YMIA 4AF6A 3KL2A 1BDJA 5WRFA 2CZCA 4EUKA 1KYZA 1M2KA 3T1VA 3AVVA 4TZTA 5DHRA 3W8NA 3EG9A 3KSRA 4FNGA 2CLSA 3G5TA 2W2LD 5J4KA 4D0RA 2HDHA 1J2YA 5G1PA 3K0HA 3FGPA 2E89A 2ANBA 3DZKA 3NIWA 1H2YA 1SC1A 2HUPA 1KQGA 1T2NA 3LQ4A 2DUMA 3K0KA 5JMWA 4F60A 1R0SA 3FB1A 3Q8LA 2E37A 2E5LH 3EPGA 4GRIA 2A9QA 1X8LA 5KYYA 5IHPA 4ZIRA 3GLUA 3OTOH 4TM7A 3ZE1B 2H17A 2GBCA 2QPLA 3N2NA 1IN5A 2WU4A 5AKGA 5FT9A 1T4CB 4CM4A 4Z4QA 2O57A 2PKQO 2OCIA 2D7CA 3DJFA 4A3IG 4E30A 2W93A 4N8EA 4CIWA 1ZMRA 5E1BA 3TBKA 4UTNA 1Z25A 3A0RB 3LOQA 4NYJR 5KIAA 1IY9A 5K51A 4KV9A 4H6XA 3S24A 1QQ7A 3EJWA 3DQZA 4AN0A 3QUBA 4F71A 3A05A 3EPHA 1PEAA 4FMDB 1D2GA 5L3QA 5D7BA 5T6BA 2DHRA 2X8WA 2ZIXB 3ZZNA 1L5HB 5JAMA 1A04A 1STOA 4J29A 5ALWA 3T7SA 4QTYA 5EWMA 4BVKA 2VFAA 3GXOA 2W42A 1KYIA 3IAS6 3A0UA 4KODA 4JXJA 1VA4A 4R3NA 4LYGA 5I9NA 1RWWA 1EBUA 2R00C 3G23A 3G6VA 1K2VN 2GF0A 1Z33A 2PGLA 2YZKA 2A30A 4HNAA 4HTFB 4M1SA 2ZM5A 3CX6A 4UD6A 4QXQA 1TWCA 5ED4A 1NOIA 4IDOA 2I91A 2GN9A 1HY3A 3DKRA 3OIGA 2MYPA 2Q45A 3PUZA 4BVLA 2XLCA 4FHCA 3T5MA 1YKGA 5TQ2A 3URMA 4DLXA 3DPIA 5IBQA 2LVBA 5C4GB 5CIYA 1ZYUA 2J9XB 3ZJYA 3LXMA 1JR3E 5JRJA 2PJUA 3H11A 4QSMA 1A8SA 5G0SA 5LYJB 2VIIA 1R0RE 1PFKA 5FBHA 2X9GA 4F4DA 3AL3A 3DOJA 1Y9AA 2RDIA 5JUMA 3RTBA 4DV4B 1X77A 3ZNQA 3SHFA 4QG7A 4HDQB 1QPGA 5EG5A 4ER7A 4FYHA 1AQIA 1KZGB 1W88A 4BJ5A 5K6AA 1CUYA 5KG2A 3T5PA 4N6NA 2IYLD 3MWDB 5FBRB 4H3KB 3RK1A 5BSFA 1N9KA 1E2PA 4GL2A 1O4VA 1QV6A 1X7WA 4KNVA 1TL7C 1ABFA 1OFTA 4XQ9A 4U2EA 5FLXW 1FLVA 4PE5B 4B3MB 4MDEA 2GQRA 1SVMA 2QRNA 5EQDA 4DVJA 2QMUA 4XM2A 2P2LA 3FYUA 3IEXA 3RARA 1UMDB 2BFDA 3ZS9A 5BVHB 1T91A 3QW4B 4B6PA 3MRXA 3PJFA 4IUYA 2QV0A 4OV6B 1T6YA 2ZTMA 3D8HA 3DCYA 1RAGA 2CMKA 3N3AC 4MKIA 1RRGA 1MR3F 3GLKA 5FLKA 1L5LA 4BNUA 4CKWB 1R4MB 2IU6A 1XHEA 3OQ6A 4GYKA 3I3SR 4P7FA 2XWBF 1UC9A 1DT5A 1QHEA 4ABTA 1TEZA 2VP9A 2XXAB 4M89A 2H4WA 2ZBQA 5KYUB 5AKKA 4EJ0A 5GTDA 3D8TA 4I99A 2J3MA 2XRFA 4PRKA 3DHVA 3GFOA 1NVTA 1MKYA 4WK4B 2RBGA 4IRMA 1ZGHA 4AZSA 3R5FA 4Z0TA 5TEVA 3SZGA 4Z4IA 1RW4A 3Q1LA 2GH1A 4L75A 4WBXC 1F6BA 3UH1A 2C00A 1E9VA 5JECA 4LF4B 4OREX 2IF2A 2XE6A 3GRCA 4RPGA 1ODFA 5JO9A 4GIBA 3RVMA 4X65H 1XZNA 3V3TA 2QZJA 2WT9A 3PA6A 4FW8A 4FVTA 1RD4A 5HF9A 1DI0A 1PSZA 2RH5A 3IOBA 3K0SA 4JDUA 4I81A 4F4ZA 3ONVA 2AZ4A 2FYTA 2XMDA 3NLLA 4BCCA 2VPPA 1V8DA 3O7MA 4FQ5A 4G8BA 2QTFA 4FFBB 2FMTA 2QR2A 5LBUA 4HUQA 3CUUA 4X1IB 1GG8A 1P72A 1T6NA 4AJJA 1GTL1 2GEFA 3PNLA 4INOA 3W0LB 5JSZB 1K3UB 1Z38A 4FOTA 1NONA 3U1BA 1QMPA 4ZT5A 2F3QA 3QVLA 4B4WA 1R4NA 4HSGA 4KO2S 4MUHA 1VBNA 3EQZA 4NKRA 1KOFA 3NTLA 5ALDA 4ZCRA 5LFAA 5GJBA 1I9GA 4HDMA 5G41A 2W8ZA 3ILHA 1G64A 3SMQA 1JHVA 1BMQA 4C0LA 1BCSB 3RSZA 4I1UA 4W5HA 2PUEA 4KAFA 3PZRA 2XUZA 1Y3DE 2O3TA 3ZY4A 2UXDH 2PLNA 2QTBA 4AIIA 3W04A 1FW8A 1LPNA 3G1WA 2OXEA 2CLKB 1BJKA 1P9WA 1TQ8A 1WXDA 1BXGB 1ZCZA 1ZU4A 1F9AA 2R96A 4UHDA 5AHWA 5LZ9A 3QF4B 5LLDA 4OQLA 2JGLA 1H85A 4NOJA 4RTJA 1TQDA 1S3IA 3DXZA 4MVJP 5EUBA 4RS3A 1BU5A 3TZHA 3WGLA 1KFJB 5KT5A 2VH5R 3QK7A 2MSKA 2YIDA 1MC8A 1KXZA 1XSEA 2X1LA 4MS1A 3RU2A 5K0EA 3IDAA 1PL8A 2V7UA 4KLAA 4NCAA 2TSYB 1QQ5A 2R1VB 3RVKA 3SZOA 3GYBA 3HM9A 1Y9DA 1NRIA 1WW8A 2JJ8A 3AZOA 1KDZA 1FJGH 5KHAA 5IYDG 4CR7A 1W5TA 2DF8A 4D8WA 1JDZA 5I5UA 3IQFA 1NVDA 4ZHQF 1KRHA 2A9OA 1FPMA 3CH6A 5FJIA 1SUWA 1GYQA 3WKAA 2GJKA 3HM2A 1X1DA 2ZYVX 3QWIA 5FPOA 1JMVA 3N59A 1IQUA 1T9HA 1FLAA 3RVLA 3MGKA 1O4WA 2ONCA 1YJBA 3WKBA 1M6YA 3KSAC 3A1UA 2X3YA 4IDBA 4MXDA 3R9XA 2N42A 4BEJA 3QU2A 1GG5A 4EYIB 1TU0A 2V7WA 3KP1A 4RVUA 2E0IA 3HG7A 1YH3A 1TM7E 1BVHA 1EA7A 4NTZA 3WIEA 2XJ4A 2A9PA 2VAVA 1QX3A 1VZ3A 5DWQA 1QZ3A 2C04A 2WF9A 4RDIA 1DIHA 5J5VA 5TVKA 3TEMA 2PUAA 1SH7A 3HWX1 1IZ9A 2ZB2A 2VR1A 3LUDA 1VBMA 3BFXA 3P2JA 1IYDA 4E4YA 4M1TA 3NFRA 5B12A 2QU8A 3LO5A 2QJRA 3WB9A 1IBMB 1VJGA 2I34A 3OZFA 5IXSA 3UWPA 2J0SA 2J85A 1NWCA 4OP3A 3IP8A 3IA7A 3KWJA 5CG1A 4ENVA 4OI0A 3HDJA 2I4OA 3QH4A 2ZATA 4PPNA 2ID4A 1QGED 5KQPA 4H0NA 1BXRB 5C35A 1HNZB 2PUCA 1NR7A 3L7BA 3ICEA 3L06A 4RHCA 1C8LA 3P9NA 4NV3A 1TA9A 5F12A 5THQA 3VC2A 4B7AA 5JS2A 2ID7A 5AVKA 1UK9A 1XKLA 4D44A 3DZIA 5F9MA 4EG5A 2WKPA 4QULA 1FCJA 2JHAA 1RZ3A 4IRXA 2VXOA 1EYZA 4K9DA 2BQUA 2RHRA 2JD0A 4L95C 2ASDA 1Q12A 1VM6A 2HC9A 1U90A 2UUOA 5C9ZA 5KQLA 2B1IA 2PYZA 3LE8A 2A0UA 4KBYA 4WLOA 1MQ8B 4KLZA 3SZ3A 1GKIA 4AJ9A 4D42A 4A27A 3AJRA 2C5GA 2RE8A 2D0PB 3FKIG 5BWBA 2GD6A 2VZEA 1SYXB 1XEXA 3GDEA 1M3SA 4DVGA 1B14A 2YU9A 2OCKA 2G82A 2BHSA 5FOQA 3VTKA 4B6JA 2HD4A 1RYFA 3ULKA 4I46A 1FYVA 1DAPA 3LVBA 5C18A 1EE9A 4Y2TA 3FNBA 1CF2O 3KQKA 3PJRA 1KAGA 3IV6A 3BCUA 3KQLA 1TTTA 1YRHA 4PFSA 2XI4A 3AL2A 1IM5A 1XCMA 3CKLA 1W7AA 2HJRA 4UCOA 2PS3A 3CG0A 3GNQA 2BFWA 1RWPA 3B2EA 1K8RA 3ED5A 4N03A 4PCAA 3AKEA 2YJ6A 3PFWO 2BSQA 2WTFA 1AY0A 1G8JA 1PVDA 1TCUA 4G85A 3TQIA 3E18A 1L4HA 3D6TB 1JGTA 1ZJYA 5LLTA 1UOQA 1Y1PA 2QN8A 4ESEA 4PS0A 1YB1A 5F77A 3WL7A 2C4TA 3TAUA 1GL3A 2BLNA 4PLTA 4CFZA 3MC1A 4TQSA 4AWAA 4YRKA 4QLOA 4L0CA 1GTG1 4FHZA 4RA6A 1FQWA 2VJOA 4HGZA 4O29A 4WNYA 4NZZA 5AIAA 4ZA2A 1ECLA 5EMLA 3FJ1A 1KO1A 4B3XA 3H17A 1V7CA 3NHRA 1T5HX 2FJPA 2QA5A 3LBYA 3PHIA 4YR9A 3BEDA 4P22A 2WUEA 3L05A 4LJ9A 5IAOA 4AB1A 4E14A 1XCLA 3TGPA 4J1SA 5I9BA 2JIDA 1XC7A 3IPYA 1UBSB 4TZ6A 4D4IA 3UAGA 3R20A 3UV6A 4BECA 1LVHA 2FETA 2Q8NA 4GLJA 4LZAA 4RHUA 5K6TA 2QZSA 3RAXA 2ZJTA 1Q0HA 5JSHA 2PGAA 4E12A 1E9EA 5C8XA 2EIXA 1QS0B 1QYVA 3HCPA 4N82A 4YYEA 4EY7A 5TJHA 2QNRA 3EZYA 3NDJA 5ITWA 5EPOA 1R0XA 1JQJC 3LRPA 4EFBA 2P6RA 5BQPA 1SBCA 2GEKA 4PZ7A 1UPBA 3BJIC 3O8LA 2PD6A 1JT2A 4MVJE 2C4NA 4PPGA 5CK4A 2IVFA 5AMXA 3PPVA 4E03A 2C54A 4PZPA 3WXMA 2XGOA 4RK5A 3DM9B 4UAVA 2YYYA 4U6QA 4N48A 3FZEA 1UANA 1GTVA 2FPXA 2QMHA 3BSWA 1MOQA 3CZCA 4IF4A 3R3VA 2RJNA 1P1KA 5DFAA 2X58A 4DIOA 3AFOA 5JJ5A 5KOHA 1U1FA 3V6JA 1CKNA 1D0VA 3KR2A 2JEYA 3OPYI 2A84A 3E5RA 4PG4A 2JEZA 1BGWA 3K4HA 4NYIQ 4WCVA 3L1VA 1MIOA 3NP9A 5EIAA 3RT1A 2MCFA 1EFVB 4G4SO 2QE7D 4JJFA 3W9BA 5D3ZA 5KT3A 2XLBA 1TRHA 3OJLA 1GL9B 1NQWA 1XAIA 2NAPA 2W8BA 3EVAA 4RJIA 3F1KA 1B0ZA 4WECA 4E5MA 3D7LA 2Y27A 5L3QB 1PS9A 4NV0A 4EY8A 5CEFA 2OLJA 1USKA 1I32A 2CVZA 5JNLA 1XEWY 3SXJA 1HT0A 1NV8A 3MWKA 4D4LA 3QPUA 1A4RA 1WQ1R 4G1CA 4W8HA 4HZUB 4TLLB 3FUWA 2BFFB 4LYJA 4LK2A 3CFYA 4WFIA 4PTYA 2DT8A 2WM8A 4L85A 2QRUA 1OVMA 4GZ6A 3O8CA 2RGBA 5KTOA 2GD1O 4L27A 1YQDA 4TKVA 4RQBA 2VDQB 4W1PA 5M34A 2YINC 3C43A 3RUIA 2D5CA 2AI2A 1IXZA 1UBGA 4EJSC 1XNQB 4H16A 2V7EA 1XYYA 2P9TA 3EGIA 5AHXA 1NN0A 3SC2B 1OXUA 4G4GA 4GGOA 2WSSA 4RA9B 4PC2A 5JEEA 5IYBG 1UL1X 4DR4B 1YDEA 5DNCA 4J1TA 3SYTA 2HMYB 4C04A 1PHRA 1CS0B 1J06A 4GKJH 2XZTA 4FEAA 4BKMA 3DBVO 3NNNA 3HP1A 1KBQA 1ENZA 1U5BA 3WX0A 4IIYA 3ZWYA 2ODTX 1HDGO 3HHEA 3NIDB 4V3CA 1SB9A 1EXNA 1P7YA 3VZPA 1NUTA 5EE1A 3I12A 4PDBA 2AN1A 2HU2A 2NVWA 5F1KA 5THKA 4C7OB 1MG5A 3ZGOA 1BVRA 4M0PA 2AUMA 4CEJB 4RMHA 1ZM9A 5KTPA 4UPDA 4ZZ0A 1E3DA 3SE7A 2MINA 4AY5A 4G84A 5JYCA 3UV7A 2AG1A 3V8MA 3VAZA 3ONNA 4BATA 5L9XA 5B6PA 2K2QB 4K5QA 1XXLA 1QGDA 3ML1A 2DBQA 3OUZA 4B3RH 1WB4A 1R5BA 3GAZA 4OU5A 4CL8A 1XF1A 2NTVA 4R7ZA 5AVXA 1IN8A 1GQYA 2VHZA 3JYHA 4OXQA 1A9TA 2IBTA 3QYPA 2GSDA 1XMOB 1HDIA 1PTJC 1QHNA 2GM9A 3SR0A 2NVUA 5HKAA 1XCJA 4D57A 1DAAA 4OUKX 2P6MA 3NV9A 4FLFA 4H1UA 1ZK3A 2VCHA 4BNFA 4D92A 1TIBA 1IPFA 4UBIA 5F2KA 1MD9A 3LVQE 3ZYCA 2D1RA 1ZITA 4JLVA 4K9NA 3BD8A 3MD0A 4CFSA 4KNWA 2FQQA 2XE4A 4HOYA 2ENUA 1AVTA 4AO8A 2OQRA 3KVYA 5CAEA 2HDOA 3QSGA 4G2NA 1WW2A 2EFCB 1M8FA 4FGLA 3GBVA 4F8JA 1QONA 2HSZA 4ZO4A 2B4KA 3ZGYA 5CA1A 1R7RA 1LZKA 2WPDD 2PSFA 1AA9A 3BWXA 4KPGA 4BLUA 4XIYA 5FNZA 5L8VA 4LE2A 2CD7A 2OUIA 4DV5H 3AEUB 4ENUA 1CBUA 4KWTA 2BFCB 1TMOA 4Z0HO 2CFTA 1P7PA 2VP4A 4H77A 4F1WA 1LW7A 2HU8A 2J67A 2VP3A 1MFZA 1C4WA 4H1VA 1X1BA 1BS2A 4ZT6A 1DG3A 1C9JA 1IBSA 4G07A 1Y63A 4J9VA 4M3NA 2IIPA 5HHTA 4HAIA 1ECPA 3BWCA 1H3FA 3UXHA 1EUQA 2QI9C 4U9HS 1YULA 2DX7A 3Q8RB 3K9NA 4R7RA 4YRCA 1USIA 1C4XA 4FT4A 4LE1A 4LVOA 4F6CA 3DVSX 1RMYA 4OQZA 3HA7A 4BMYA 5MGNA 1MV8A 1X13A 1ZC3A 2R65A 1PI3A 3LPAA 3PHJA 3C1AA 5JXIA 1U28C 3UFXA 4C9BA 2G36A 1N5IA 1XJWA 1Y8AA 2BE9A 2JKZA 2AIRA 2DE0X 2QNBA 3ANLA 1TIPA 2DWOA 3P9XA 4HFJA 4PWZA 3CEAA 5FL7A 4ZVKA 1DKMA 3FUVA 2KS6A 2OL4A 2X0RA 5BSVA 4RTOA 4Q82A 4EG7A 3J7AC 4ER3A 4DXHA 3SHTA 1N5MA 5TJ9A 1R64A 2DWCA 3IUJA 1Y4ZA 3AW9A 3DAGA 3NYIA 1GADO 3KT3A 4X1KA 4OSEA 1L1EA 3P9IA 5CH3A 4DM4A 3BZUA 2OXCA 3BHMA 4RTQA 3HT5A 4GMFA 2XNSA 4N5IX 3NDIA 1M7BA 3C3MA 3STXA 1U63A 3KDAA 1MW9X 3QFHA 2AG6A 5H7XA 4DNOA 4IJVA 3A2LA 5AXDA 4ZO6A 3FFWA 2BFAA 3ADPA 4FFOA 3TAHA 3UJCA 2ODPA 1CS4C 3UJ8A 4QOIA 5HKOA 2Q5EA 3K3PA 1GO2A 5F9LA 3AI2A 1U0BB 1U9IC 1JG1A 3LWDA 1T6BY 3GD7A 3UHFA 3CGWA 4D6YA 2EG9A 5U4XA 1HR0B 3M4IA 1HFEL 1PTKA 2J8ZA 3PCRB 5FBWB 4C4SA 4BV2A 2J6SA 3DH0A 3SXUB 3WWOA 3CR7A 4OQPA 4R2MA 1L5WA 2B35A 4V0RA 5EERA 3TQHA 4D3YA 1L5YA 1ULBA 3DKIA 3QOFA 1U0FA 1MOSA 2REQA 2IUYA 2QJOA 3P2EA 3QVKA 2E5LB 4DY4A 2EERA 1D7OA 4DTCA 1T2AA 1GYFA 1ZCJA 2V5VA 1E8MA 2EQ5A 1GGVA 4JI2H 4M1EA 4QICA 5A5GA 1VDMA 2J4DA 3GQVA 1MIOB 5J1TB 2VNHA 3N1UA 3PSAA 3C45A 2BY4A 4I9GA 3GP5A 1R5NA 3FYTA 1H8EA 4WZBB 4ETSA 5IUKC 1JQDA 1XCPA 2NPIA 4E6EA 4KFUA 3KYCA 4P33A 3TOCA 1Z0JA 1C4OA 3QYJA 2J30A 3QE2A 2HWUA 4Q9IA 4CIDA 1F17A 4L50A 5GMOA 1PG0A 1K92A 2D2VA 2NQ2C 1G6OA 3QUSA 1ZM3A 3OQIB 3T3PB 3WE7A 4C20A 1SG9A 2VDOB 1FDOA 2X8LA 1EKVA 4S04A 4RHXA 1OIVA 4EFDA 1ZG3A 3B60A 5DHAA 10MHA 4U39A 4BGDA 3M2PA 3GLHE 4GXQA 4JI6H 5C8YB 3MF4A 5KEIA 1EVLA 1N5LA 1T3LA 4E32A 5HM8A 4HS4A 5BMOA 3U7JA 3DTTA 2JNWA 1DX9A 1GPYA 2GCIA 3CRQA 3LJKA 1U7PA 5AKXA 5DYWA 4JI6B 4B6SA 1XTRA 4F2PA 4J07A 3WISA 4AJLA 1E3MA 3AC0A 2G4VA 3DWGA 1S9HA 1UMDA 3CE9A 4QWCA 4HDNA 2WIFA 4S3MA 2W5UA 1Q3TA 3BGSA 3JARA 4MQ6A 5EJMA 1Z4NA 4CHIA 3SX0A 2HNAA 2D0DA 3U81A 3Q9UA 4QJBA 4MX8A 4M88A 3ILSA 4OI4A 1L7AA 1FYXA 5C4IA 1W59A 3ZW8A 1UBCA 4JP2A 2YHIB 1HRKA 5DHPA 3V33A 4A6DA 4EG6A 2ROQA 3QEAZ 3L82B 1L4GA 2HADA 3TL3A 3M6MD 4PQFA 4X71A 1CG6A 3ER8A 3WB2A 3NKFA 4F7WA 3NHWA 1S2DA 4BY9E 1JTVA 2Q2WA 4J16A 4MCAA 1HQDA 3DTYA 3NHJA 1F7VA 3EGDA 4CCYB 2R6HA 1VFNA 2V6FA 4P1ZA 821PA 5AI0A 3E03A 4F3TA 3TZ6A 4JGBA 3U62A 2H48A 1Q7EA 3K2EA 3NTVA 2EX0A 4MP6A 1LDBA 4UDOA 5FA6A 3REQA 1E5VA 1TTQB 4DW8A 3DXXA 1EFCA 5DEIA 3U0VA 4EW2A 5ILOA 1WV1A 1QTQA 2R8IA 1H5UA 4DCOA 3BK7A 5AO9A 2AKAB 3P9QA 3BXPA 3GRZA 4P93A 2OCXA 4UUPA 2IUUA 4BVAA 1VLJA 3PR4A 3OM0A 1IBCA 4B3IA 1QCYA 1C7IA 2IA5A 3DC7A 4AT1A 1T4MA 4TTIA 5HZMA 2Q5JA 4GOKA 3W77A 1NHWA 2FX3A 2XTNA 3QPVA 4C0QC 5JEDA 3H6HA 3TLZA 3ITEA 1TA8A 2ZIXA 1Z5ZA 2VPQA 1YC2A 2VXYA 4DLBA 3AF1A 4NH4A 5D87A 2FTKE 3MB8A 4Q6BA 1TVKA 3G5AA 4B8WA 3OJXA 4K9SA 2N1BA 1V51A 3RFFA 2R8JA 1TC1A 1YR1A 4BX8A 3FGZA 3OJWA 4DFDA 3QX3A 1WDKA 4BZQA 2FCAA 1TJPB 1I2ZA 4KIJA 3AETB 3GDHA 4ZOLB 5GVSA 1X7GA 4RPIA 2RGWA 3ETDA 1SVOA 1UM9A 8ATCA 3FVWA 1HR0H 2IEDA 5ELLA 5LBTA 3QYFA 3UGTA 4I8IA 2A4MA 4K7JA 3WOVA 3VSDA 3N2ZB 3ORHA 3KETA 4Q45A 4REMA 4FGKA 4M0MA 1UKEA 4TLCA 1ZH0A 3BDVA 2P30A 3MBOA 1RJDA 1U99A 4M22A 4B40A 1A95A 1DC3A 3MQ4A 2YVLA 3L4JA 1JB9A 5YASA 2E4WA 1T9BA 3BGWA 2EV9A 3Q9LA 3QUAA 4MR7A 2F9MA 1D9XA 5BN5B 3TNYA 1QKJA 4J1QA 5I8WA 5JMOA 2W0SA 4BP1A 3OOEA 2O7RA 3ORSA 2C4UA 2CUKA 1GUBA 4O0LA 3KE8A 3OF5A 5TNXA 4IAJA 1TM3E 2R66A 3KHUA 4GVPA 3WXBA 4B2PA 5IVHA 8GPBA 1FYDA 4KJZA 3KYDA 3FF4A 6AT1A 4AU1A 3GGDA 3PGLA 2FMUA 2GBLC 4TL8A 3SSMA 3KTMA 3SZMA 5A7GA 3Q9NA 2O8DA 3ORQA 1A1SA 1GUYA 3LT2A 4EX7A 2ACEA 2FR8C 4B32A 1SNYA 5DTEA 1G4UR 4TOIA 1PD0A 1LQUA 3G1UA 4Y6LA 1Z7EA 4G0XA 2OB2A 3INTA 3LUFA 3PQ2A 3Q7EA 3RUEA 3T4PA 1MHTA 2W2QA 1YB6A 3S5UA 1BE0A 1SXJE 3BL8A 4F3RA 4O7TA 1I2AA 2EZTA 1NF8A 2A0WA 4WIAA 1XRLA 4Y6OA 4Y9RA 3WLLA 3FHTA 1GIAA 5B3AA 3UYYA 4DLVA 1JP7A 3NBXX 3Q3GE 3ZV6A 4YJ3F 3F49S 4TV8F 4QJ5A 3NT2A 5AVOA 5LD2C 1KDPA 4BFVA 2JFHA 1N33H 4JQOA 2E9SA 4QGAA 1NE2A 3U48A 3CLSD 4C0BA 4ZEMA 1FU8A 4ZQEA 1CEQA 2CFOA 4S1NA 3K09A 1K7SN 1X7YB 5B1IA 2R6CA 3HYSA 4FFPA 3UT5B 1LUAA 1KVRA 4IJWA 2F3RA 2QVCA 4D46A 5A4KA 2MSDB 3IERA 4ALJA 4HVLA 2DERA 3NHAA 1IC6A 3EVBA 2C1EA 1KDYA 1B73A 3T34A 3KTOA 3WVNA 3H5IA 4O7VA 4Q44A 2BHNA 5DYYA 3DFMA 3N76A 1J9ZA 2C77A 2CXSA 1NG9A 4ZVOA 4LYYA 3VR2D 2JS7A 1AXRA 1SBZA 1ZEJA 3WL4A 2EKDA 4RF2A 5JH7A 4CRWB 2MSNA 4NYIR 4Y0AA 3HJFA 4LHSA 1P73A 1N0IA 2HFJA 4E3ZA 1ESNA 3RYHA 4FX2A 1MQSA 2C7VA 5EA2A 5AJUA 4HN4B 5F21A 3T5HA 1WV0A 2XUPA 1EFRD 3NWPA 4HB4A 4BZWA 4JIMA 4DCMA 3LHFA 2VYVA 3MJ4A 5I8ZA 3EW7A 1NULA 3H2YA 2OUKA 3ZE6A 2EJUA 1F0NA 4DM7A 2ZKLA 4JV2A 2HGSA 3HU2A 5C5CA 1C9MA 4C3VA 1C3OA 5KHOC 5BR1A 2Y1LA 4ZICA 3KQSA 2G25A 1N0HA 4ND4A 3VYWA 4QWBA 2M6RA 3WLFA 4Z3KA 1X7XA 1BGXT 2ZBEA 2V5UA 3DF7A 2YY6A 3U9TA 5C1PA 3H4TA 2PMFA 4AD8A 2KJQA 3VOTA 1D2HA 4DLLA 2DTEA 1J0XO 4HWRA 2WG0A 3HCDA 4EJ6A 3E3OA 4YV2A 3REGA 3FPLA 4P3PA 3KV3O 2BISA 3OG9A 3QVVA 3T3MB 5IEJA 1KMCA 3TRJA 5K6AC 2DPJA 1B0UA 3BWVA 2H2AA 4JLUA 4LXGA 5BMVB 2PZBA 1KTIA 2FUCA 4GQIA 4KWEA 4Q0MA 5KOIA 3LIPA 1I94B 5ALXA 4BCBA 2WIGA 1FFGA 1WUJS 5LMNH 3FWNA 4NENB 2HWKA 2Q6TA 3HUTA 4O3OA 4BMOB 5IM4F 1KQOA 1S3GA 2WTMA 2GHRA 2RHJA 1RKQA 1T36A 4HPXB 1FS4A 1DG1G 1TZBA 2NN3C 3G1TA 3OWOA 1E3TA 1T3SA 2O7NA 4DMFA 1FS6A 1C2TA 3GXBA 4X1OA 2XDYA 1KH1A 2UZ1A 2JGDA 4O2BB 2VRBA 4CLDA 1YMUA 2QT1A 4POAA 4RNCA 3EDRA 1JFLA 4UKDA 1IEWA 2BMDA 3NO4A 3B2QA 2VOJA 4GSKA 5CDTA 1Y4SA 4LY0A 3ZK7A 1VXRA 2ZOSA 1UKCA 4CM7A 3ZU5A 3WP1B 2AU0A 5DSXA 4HQRA 2ABWA 1QOZA 4HWGA 4W5OA 3OY2A 2BAGA 3MJSA 4Q34A 1YDWA 4DBZA 4DV7B 2QUJA 4FJ0A 4ZO9A 4C0XA 5KQMA 3M2TA 2ZJAA 4S12A 1G8AA 3OQPA 1U0SY 3GJTA 3L8GA 2AQKA 5FWAA 1UKVY 2CF5A 3AU8A 2Y2VA 5AW9A 3ROTA 1A4UA 3QKSB 2HJ9A 4OQDA 2VYVD 1GZ7A 5AVTA 2R8YA 3ZNNA 3PTZA 1N2CE 3AP1A 2M6LA 2TMKA 4ILEA 5BW4A 4O4JF 2B7LA 2SNIE 5KFFA 3TMKA 1MN6A 2ZIEA 1NPTO 3F9IA 3Q7TA 4FDAA 5HF5A 3R8XA 3UWSA 1LNSA 5A3SA 2HJWA 1D1SA 2VNJA 4BNDA 4US2R 1EP3B 2XE8A 1Y4DE 5BURA 1RLIA 1G2OA 2PXHA 4ZKEA 3TDMA 1MC4A 4XSGA 8LDHA 5IM4A 1TZ2A 2HO4A 2OV6A 4RHTA 3ZVKA 4MWDA 1V3UA 2V6BA 4NJMB 2AUTA 5BV0A 4CBVA 3EQ8A 4LWQA 4CEHB 8OHMA 3Q98A 5EWMB 3CISA 1ZGGA 5I6DA 2QYTA 2QMZA 4DJ5X 2WU0A 3N5KA 3K0CC 1T4GA 4OM7A 4OXRA 4MKFA 4QNMA 4QJ4A 2NVOA 3T15A 1QK3A 3LX8A 2X86A 4GC9A 4HVTA 3WMRA 2PTHA 4F11A 3L02A 3PUJA 5DNDA 3SP1A 1U6JA 3ILXA 3K1YA 3RYFB 6REQA 4QU0A 2A8YA 3KEQA 5JSYA 3WGVA 2WJYA 3P26A 1N2IA 4FKBA 5ALNA 4BFCA 3BPSA 4CM4B 1CUDA 3EJ6A 4K87A 4BO0A 2IV7A 5JT1A 4L5JA 2ZUBA 2ZG6A 1HLFA 1GCUA 3QJGA 1DBSA 4PC7A 5L4SA 1VGVA 5DM2A 2WFZA 3ROEA 3RQIA 4LFBB 4X64H 1GNVA 3JAMW 2X5KO 2Z56A 1J8MF 3WL6A 4O8CA 5ITVA 3LGAA 2H4YA 4Y7DA 1N6OA 5G0UA 2ZR9A 3QLJA 4LEIA 1APBA 4GEKA 3DCNA 3D3WB 5CBPA 3OX3A 4PO9A 3HH8A 3RS5A 4CODB 5LQJA 1E61A 4PINA 3OPQA 3O0DA 4UEOA 1WHTA 3FTQA 1VCOA 3OU7A 4E88A 4G0YA 3SR4A 5CNMA 1KDVA 5DN6A 3TKAA 1PFGA 3KHRA 13PKA 5HUJA 4PFKA 1HURA 4UVHA 1QU3A 2GAFA 2ENWA 1E79D 2WAOA 3C3CA 4HH4A 1DCKA 4OG2A 4URYR 3E3MA 4IIJF 1X86B 1UK8A 1NY6A 1O9GA 4IM7A 4EPYA 1R10A 3AY6A 1NNEA 1XZIA 5FAKA 3P52A 2NWQA 3DLTA 4YDSA 3MJHA 3ZI7A 3ZIUA 4HXYA 4K0RA 3WBFA 1EFPB 3NW9A 3PGJA 3WWHA 2OV4A 1YRQA 4O2BF 2E4AA 3IP6A 4Z99A 4XDGA 1R6UA 3LIIA 4IZ6A 1VKJA 4N5DA 4WXEA 2I29A 5E8JA 1X1EA 3VX4A 3ZZTA 1GZ4A 2XCSB 2XTZA 1O8BA 1SCUB 2O14A 3EMKA 4Q3NA 1L1QA 1YZ3A 3UW1A 4Z0NA 1K7FB 3K9QO 2EGUA 1S89A 3CPSA 4C3OB 2WWXA 1WUHS 4KL8S 3H65A 4CIVA 1A9XB 2E82A 3DMHA 2YXNA 4OB6A 5A3QA 4UUBA 4HK4A 4QEZA 3B5EA 3T0GA 5KFIA 5JALA 2G83A 5KT2A 1VLQA 1H0RA 4BRZA 1LX7A 2EFYA 3FUUA 5AKIA 1YHZA 4YFVA 3M9MB 3FKQA 2JFOA 1SOVA 4JLSA 1P91A 2RAVA 2E5FA 4ITUA 3TECE 5AD1A 2CBXA 1DBVO 4JOSA 1HC7A 4DNQA 1QGUB 4DB4A 1TUGA 3WQBA 4FMPA 4M7EA 4YRDA 3KT0A 4R2KA 5U4QA 3SHOA 3VU1A 4G41A 3MWEB 3QKIA 3BXGA 2J9GA 2VTEA 4K9OA 4Q24A 4UAUA 5E4TA 2WE6A 4DRXA 1TYCA 3MCTA 4L1KA 4EOGA 3RAEC 1IN1A 2C9MA 1T3HA 4BNDB 2FQXA 2C92A 1IIBA 4CIXA 5A9SA 1GKUB 2FX2A 4UATA 3K9BA 3GVIA 1P4RA 1RQNA 1E98A 5CEJA 1GGKA 3T5LA 1OT5A 1JKXA 1XGKA 2C9DA 2A9JA 2CYBA 2WAMA 3CLRD 3IKVA 3KYDB 2F43B 5ETJA 3AKCA 1MNQA 3STWA 1MAHA 5IDYA 4LFBH 1MORA 3KIPA 3W2GA 1UDCA 4Y2XA 4AZ3A 4UCRA 1WKVA 1OX4B 1NG1A 2REQB 3IODA 4TL7A 4FDLA 1G6HA 4O4IB 1FU4A 2EP7A 1E4OA 3TTUA 5C5IA 2FEWB 4P3XA 4W5QA 3NC4A 3E9CA 1U7TA 3FH0A 5D5HA 2XADA 3MR5A 4NATA 2ZXFA 4HF7A 2Q6LA 3WIUA 1Y8ZA 4E1VA 1UAGA 5KG6A 1SVNA 1BMFA 2JEOA 2YQ5A 3DXYA 3SJ7A 5K99A 1N8KA 1TYEB 4B3CA 2NXWA 1E89A 1CUJA 1KL7A 2BFOA 3BH7A 1YQUA 1BA2A 4HAYA 1WEKA 3TW8B 1PJBA 4ZYXA 5DMHA 2WU1A 2X4IA 4QBFA 4XVCA 1I5OA 4TQ9A 4UJ5A 3OZCA 1T6XA 1T9GR 2UU9B 5THXA 1MPTA 2CWWA 2H5EA 1XQWA 2XC9A 3U4QB 1OAOC 2FHPA 5EIXA 4C01A 2WV9A 1F14A 2VP5A 1CQJA 2YWGA 2CNVA 4PG8A 4EQ6B 3SKVA 1DJNA 4NENA 4ROTA 1K0UA 1PJAA 3L0IB 2JGFA 3ZDEA 3USCS 4M1QA 4CF4A 3NHMA 2VJQA 2BUBA 4DIUA 1FQJA 4NJEB 2X2FA 4JXUA 3D4OA 3IR6A 4F12A 2XZLA 1RYDA 4CKYA 3A6EA 2NW6A 3ENQA 1ADYA 3ZCRA 1DL5A 3MINA 5BOSA 1EXWA 2PJRA 3L6BA 4ALIA 1MX9A 4M0UA 3TGLA 4R81A 5IVIA 3UXYA 1K66A 4U8HA 4JJIA 3LQRA 3RCBA 4A82A 5I9IA 3OAAA 2CEAA 1Z5OA 4J9KA 1DC5A 2EATA 1A97A 2O1SA 3UHOA 2E6KA 1W73A 4B7ZA 1NYTA 1EFTA 3PO3G 2IE0A 2VJMB 3KR1A 4RZQA 3CWQA 3ZE2B 3LK6A 1LLDA 1MJNA 3EGDB 1RQ7A 2IOYA 3JQPA 4JQZA 1KZ1A 2JA1A 2PXCA 4ZD6A 6ADHA 1E5LA 2CHUA 1FYWA 4U7PB 3ZGXA 3G7SA 3NEPX 3ZQ4A 2V7QD 4MV3A 3JZDA 5A03A 2Q50A 1XUOA 3L4EA 1JI0A 1L3CA 1UJCA 4JU8A 1E4GT 2IW1A 5K0JA 3H3VH 5EHXA 4NZNA 1C3EA 1XVUA 1SXJC 2FMKA 3HNPA 3VV3A 4CLOB 1V5GA 2WWRA 4TTPA 4LHWA 1QLJA 4JBYA 4BYMA 3DZBA 4QQFA 4PN7A 3EPJA 4YRGA 7GPBA 3OM9A 2R8HA 2UXDB 3JATB 4OYLA 4S1WA 5DGIA 3PRHA 4Q3EA 1IVYA 5EP4A 4CC6A 1A9SA 2JAPA 1YGPA 4MQMA 4W6ZA 4Q01A 4QYSA 2NYAA 2Q1SA 2XQVA 4ZU6X 2FPWA 4G0PA 2XCLA 3AF3A 4GGPA 2DXIA 4REQA 1MH1A 4EHKA 4ZZ1A 2CSUA 5A5DA 5FEMA 2PH5A 5F7ZA 3CUYA 3VPBA 4J03A 4RW0A 1AA6A 3FKIA 1SD2A 3UBMA 2I1WA 3D3QA 1E58A 1UIMA 2A2ZA 2V7VA 3W2FA 2QUBA 1XNJA 1DQYA 4QGBA 2B9EA 3LTNC 2Z3ZA 4I66A 1J00A 4KVAA 5TMDA 3TTXA 3ZD9A 4OLAA 1H1DA 4DLTA 4DADA 2H2FA 3OFND 1PRYA 3C8MA 3DWEX 3FRJA 4ECEA 3M5WA 2GK4A 2XF8A 4B3JA 1IULA 1R0BA 4RH0A 1X15A 4W9NA 1ZOPA 1RHKA 5KC9A 3MJEA 4BXOA 5JI3E 5KI6A 5KSWB 2FWAA 3D8RA 3N7UA 3CPJB 2Y0CA 1FS5A 5LA6B 3DFFA 5K3OA 3O4HA 1TO1E 4DUZB 2IPNA 1TU3A 1RM0A 2C2YA 3AR3A 3GFBA 2PLWA 1XFAA 1SMKA 4XQGA 4F9FA 2ASEA 3QLUC 2JEFA 4X97A 1XXHE 2JI6A 4GHWA 4UUQA 2VUIB 5KAMA 1FLNA 2AG8A 3WIOA 1AXEA 2XUGA 3OTQA 3PFCA 4B2IA 4H6WA 4IHJB 3G49A 4Q9LA 4BKRA 4Z8XA 1DO8A 1L9KA 1DIKA 1ESZA 5EMNA 4CG2A 2F8TA 4F92B 1LI7A 4DEVA 3E15A 4JYZA 3EDQA 1YCDA 4JJEA 1U7OA 1VP3A 2H4XA 4PG7A 4KREA 3C5EA 4HZIA 4KXMA 5AFSA 1NI4A 2ZXEA 3RYTC 5C32A 3RT9A 3MUNA 4QDZA 5DIZA 3VTZA 2XBMA 4Q4HA 1SO8A 4YWHA 1J5XA 2X8JB 3PQFA 4ZI7A 2IUTA 2CXUA 2RGVA 1ECFA 3HACA 2Q2UA 3T3EA 1MFPA 1RRKA 4FBGA 5BVGB 3T5AA 4YK7A 4CLHA 2V65A 5BWVA 3MTQA 2WF5A 4LBWA 4D0NA 4EF4A 5JZBA 1EZ1A 5KFSA 1NF3A 1YVRA 3WGOA 4HDKA 4EB8A 5JH7B 4DL3A 4CQMD 2XW6A 2ZBFA 1Y37A 2XWSA 2H51A 2JHFA 3Q0IA 2I6QA 4WN9A 5AVWA 5EJ7A 5K8TA 2DPGA 4NX2A 3VR6D 2OCAA 1NJFA 5A0FA 3NPMA 4BV3A 3WBKA 4BU1A 2GZDA 2YWJA 3AG5A 3RF2A 2H1IA 4LSXA 4L4UA 3B9BA 2JFNA 3GRKA 4IGEA 4TSFD 1S8FA 4X9XA 1SQGA 3JD0A 3WGHA 1DFHA 2QMOA 1ZL2A 2X6RA 4M7RA 4KVGA 3VOSA 3UXMA 4BNIA 2PLAA 2GFHA 2YV5A 4UEWA 1SAYA 3F78A 3TE6A 4NYEA 1ZSVA 2ZYWX 3PQ3A 1E9AA 2QGZA 3L77A 2GJSA 5IULC 2FUKA 2CUZA 4YCBA 4C08A 4Q05A 4YPOA 3UFXB 2R6AA 3I2KA 4FDVA 5ALOA 3F4KA 2VPZA 3BUSA 4D9BA 3QU9A 4JUCA 2VDJA 1EUYA 3OU6A 4YIHA 3A25A 3QV1A 3L6CA 5JAHA 5EOVA 2A58A 1ID1A 2BT4A 1E2DA 1CZHA 1G8KA 4MGYR 3SZRA 3TQQA 1H2ZA 1UUFA 1MNAA 4CMDA 5I7FA 2HDKA 4IHAA 3QEOA 1N0UA 5EDWA 3L93A 2PUJA 3AHHA 1ECGA 2EEZA 3OZTA 1EAMA 1SKQA 1R9GA 2AX4A 5DB4A 3UKDA 3ZQJA 4DDVA 5AW1A 2VDUE 1TRKA 3NPAA 1JBKA 3SBDA 1YHNA 3S2ZA 4LJSA 2J9ZB 1R6BX 2JVKA 1Y3CE 2QZPA 3A27A 3FWHA 4G0OA 1ISPA 1YCGA 3SZUA 2ZJ5A 3TZCA 3C98A 1N6KA 4J75A 3IESA 3OTOB 3MHPA 3MOIA 1MJFA 3JZIA 3UWDA 3AW8A 1KJNA 1JWLA 4HAOA 3BQ2A 5K8IA 3BWEA 2ZDHA 5IC6A 2ZUWA 4MJLA 5IM5A 1KO8A 4FK8A 5KKAA 3O4FA 4CMGA 4G5FA 1C81A 4U7FA 5JAPA 2FK1A 4XGKA 1YI8A 1FMFA 4XYBA 2DBVO 2NGRA 5EFZA 1HUQA 4CTMA 3WNDA 1KC1A 2IEGA 5JAIA 2P4SA 4KI7A 2GJAA 1KYQA 3EFEA 1YBHA 5BNIA 3TWOA 3TDKA 3DL2A 2GJ8A 3UUWA 1NF9A 2JA6A 3GMSA 2HPAA 1LLQA 3ZC3A 3KJHA 1NVFA 1G3QA 1X7YA 4X3PA 2F1OA 4TLAA 5IWAH 5EWGA 4UCXA 4D8XA 3TY9A 4YC7A 4Z4CA 3LYLA 5CB4A 2Q0SA 1BD3A 1ISJA 2WHYA 4RPLA 1Z63A 2QK4A 1XKTA 3JD1A 5A5FA 1ESMA 3ZDAA 3V4LA 3UOWA 4QUKA 1S2OA 2AFVA 2DKOA 3DDOA 2VLBA 2R7LA 1F12A 2H0QA 4XLTA 2QN6A 3CPEA 1Z4MA 1G5PA 2B37A 2WIDA 1W93A 2MR6A 2I3DA 4DWOA 1Q19A 4JCOA 3WLKX 1AMUA 1U1CA 1Y6JA 4BO6A 4YRNA 3UB2A 1XVLA 1T8WA 2Y0EA 1AGRA 4BJ1A 1DADA 4UCWA 5KFYA 5IPFA 1TUEA 1X9HA 3DF9A 3ZXSA 4BVGA 1M1NB 4LRXA 3C7AA 4S1TA 4M99A 3DT9A 4REOA 2A5JA 3CCCA 1P6XA 4D98A 1TCCA 2FKAA 4QBGB 1R8QA 1R9JA 3WK6A 5AW6A 2IK8A 2NVXA 3E82A 3T38A 1NYLA 1OYYA 1J24A 2QD2A 4HGYA 2EBFX 2QTVB 4BMPB 5JCZA 1W44A 1Y3AA 4WXYB 3W7AA 4DJTA 2VBGA 3PQ5A 4P3YA 1GGOA 2AOTB 3GMIA 1M5UA 2DR0A 2PH1A 3LT4A 4GM4A 3NBKA 2XMRA 4AN1A 2E4VA 2PK3A 4BMZA 1UM8A 1W9MA 2PVPA 2CFRA 1WR2A 3JQ9A 3JCZA 4MJ7A 5FNVA 4X64B 3MWFA 3LP5A 4GPAA 3IJRA 4FP9A 3VTAA 4Q02A 3CZPA 1NP3A 1V7ZA 2UYQA 4I2NA 2WYUA 3EZLA 3H20A 2PMZA 4WBSA 2VUMA 1Q7BA 3IMKA 1QAQA 3LV8A 3QX9A 3FYDA 1PWZA 4M2LA 1Z47A 2OO5A 3EWIA 3DBIA 4AK9A 5IYZB 4AJEA 1ZHFA 1LJ8A 4HH3C 3VGJA 3L01A 4E5SA 1WUTA 2CHEA 4J0EA 4LQLA 4YJGA 2G4CA 3LCJA 1ZMOA 2HQSA 3VZRA 4A3SA 2V0CA 2C82A 3CWCA 1VSTA 3GEIA 1RWNA 4H1HA 1SOMA 2R6JA 3T5DA 3KYHC 2Y1GA 1MX3A 2VJCA 4RXUA 1FDIA 4Q9AA 3FDZA 3C1TA 5IASA 2Z4TA 4FW9A 2NO7A 5E1MA 3FMOB 1E2KA 5T3UA 1ONPA 4DUZH 1Q7CA 3VVCA 4B4KA 3QNMA 5FH9A 4YV1A 3DHNA 4PG6A 2WC1A 3EEBA 3K9HA 4AC9A 3KB2A 3OFKA 2CDNA 2RGGA 4WXHA 2G7MC 2PTGA 4QYXA 2PX2A 4Z9AA 2PS9A 3VAAA 3TIFA 4QDTA 2ZAGA 1R37A 1SXGA 4QRIA 1RRCA 1RJ9B 3U56A 1B23P 2CE7A 1SHLA 3E6AA 3OOSA 2HPHA 4BNLA 5TF0A 4HN2A 2PGIA 3FNGA 1Y7TA 4LF5H 4EKGA 5JYEA 2VT3A 1H6AA 5CVEA 1DBIA 2YQ4A 5DGCA 4EUSA 1DOHA 3WHLA 4TVSA 4XI9A 3DTNA 4RULA 1VRWA 3TE7A 3OMXA 4DTIA 5KFAA 2IYTA 4O1MA 2WBLC 3C24A 4RYDA 4YQYA 1OTXA 2R1VA 2AC4A 4L6IA 3IT3A 3KXPA 1YJ8A 5E6SB 4MR7B 4LPKA 4MP3A 3WLSA 1T8TA 1VE5A 4K40A 1FUIA 5KQRA 4AY6A 2O6LA 4FBMA 1A8QA 1VC2A 1E9CA 2F3SA 3LQFA 4MAFA 4PX9A 3L4BA 1B8VA 3ZCVA 2V7BA 2MHCA 2GN8A 3O26A 1TW2A 3FFTA 3SC4A 4DCVA 5BN1A 5LPNA 2AMFA 1Z08A 4EKEA 2PO7A 1H2RS 3AINA 4MICA 3L7IA 4EM6A 1PDWA 2BCGY 2FZ4A 3T1HH 1G1MA 3A14A 4JASB 4L5IA 2YS7A 5I01A 5LMCA 1KMQA 2OB1A 2PNJA 1XQ1A 4XIGS 3FMPB 3HLTA 3LHDA 4MHOA 3S1AB 2VO1A 4HQNA 3HY4A 4EG8A 1ZICA 1SRQA 2GZMA 2J9RA 5BNZA 5C5DA 1A2OA 1BCSA 4U63A 1I2CA 1X7HA 4HQ0A 3WV5A 1FRNA 1OGYA 1Z6YA 3MCZA 1P1BA 4B0PA 1YHYA 3KSDO 3V2GA 2XCAA 1EE2A 1F51E 2G5GX 2YVKA 4MKGA 2YHBA 3RKRA 1OY1A 2I7VA 3T7EA 1PT9A 3VPGA 3NHFA 1VL2A 4X94A 4P84A 5HJ5A 3ZTYA 2I80A 2ZT7A 4R51A 4GBED 3ZE8A 1RYYA 1X2EA 2MINB 1GPJA 2NVBA 1IOLA 3F74A 3Q8SB 1V9CA 3BTUA 3FBGA 4PPFA 5H4HA 3WFIA 1OIWA 1VRCA 2VAWA 2RFLA 3KWMA 1NW7A 3KOMA 1UT5A 4NHEA 4XTCS 3F71A 2XNHA 4IXNA 1RWOA 1X94A 2Y0BA 3FNQA 4E5PA 1DMRA 1AB5A 2Z43A 3DBLA 3KXIA 3MT9A 2ZRCA 4CCYA 1O5IA 3KELA 4ZGWA 1FUKA 2OHHA 2PFKA 3WJ1A 2OH2A 2HVRA 1IHPA 1OFHA 3TLBA 2VH1A 3CLTD 3KZCA 3OBIA 4UREA 1AXGA 3HXQA 1JFTA 4FFMA 3LGSA 4IOMA 1XD2A 4NG5A 2ZAMA 4NYMR 4C0SA 2Q9CA 3F3YA 4IMPA 4IYJA 3C0KA 5BNTA 4PC6A 2P75A 3L1UA 4M6WB 2PSSA 2RGNA 2WD9A 3A9RA 1DXHA 3C1OA 4BN5A 5BSTA 4YRLA 5J1SB 2C2OA 5HIKA 4D0SA 2IE8A 7MDHA 1PGPA 4QQ8A 1DAMA 4GBJA 2PO5A 1GAJA 2IIQA 2COIA 1CF9A 1ETHA 1NPDA 1T24A 2CHVA 3GFFA 2YIVX 4FZJA 1E7MA 4RCVA 3ZE9A 4FE4A 1TJ4A 2YVAA 3JSAA 3R3WA 2FHSA 3BAZA 3IE2A 2QD1A 4ZHQA 1PKXA 5JNUA 5JCOA 4QYMA 2PPVA 2XITA 2XBUA 3O8QB 5KFBA 1QHSA 1J2RA 2WWWA 3DFIA 2PL1A 4RO0A 4WCFC 1RBMA 1T25A 3E4DA 3AX6A 1SUCA 2WLTA 3HBFA 2FSSA 3ER9A 3DGEC 3OQIA 4KACA 4OXIA 2P9QA 3KSUA 4W82A 2ECQA 3OQMA 4F3NA 2C35B 3RK0A 4ZYYA 2WILA 1NT4A 2CC2A 2W70A 2GEJA 2O50A 2QP9X 2RHDA 3HKEB 2X5RA 3HKDB 3K20A 4KQ1A 5EIHA 3SIRA 4BWSC 1KI6A 1YIDA 1XAJA 3PFNA 1WVGA 3QBTA 1A9ZA 3NUQA 4L07A 4MRMA 3IAXA 3ETJA 4WZBA 4HTFA 2WVAA 1K6IA 3EXEB 5LWHA 2AC7A 1XMOH 1Z28A 3PT5A 4M36A 4MQEA 1FSSA 4LXTA 4EFKA 2GBPA 3VFDA 4YTEA 1JILA 4NBUA 2OQVA 4XB6B 3MVEA 2WQ6A 3RVQA 1KOGA 1AHHA 1NFQA 2WD8A 2QMEA 5B36A 2DFKB 5IDVA 2Q9UA 3LD9A 4W5JA 2AD5A 2X5OA 3UYKA 4NECA 3QVTA 1UPAA 3OFJA 4RIFA 3F7NA 1GDTA 4LNUB 5EKUA 3SQOA 1JV2B 3WAKA 4AWXA 2P9CA 4JI8H 1GRNA 1ML3A 1V47A 1Z5VA 5KKCA 2BCJQ 3BD7A 4D9IA 4XQ0A 3AHIA 1LDGA 3UFBA 1RQPA 4WD3A 1P1HA 2JA2A 2KE5A 3CG4A 2F55A 4CUJA 2BFNA 4G1EB 1XWWA 3PR1A 4OQ4A 3KVVA 1NDUA 3HDHA 2AXNA 1NMYA 4U7GA 5LMUH 1FY2A 2WD7B 4WBNF 3DMPA 3ES9A 4LHYA 4UTZA 4WK2B 3WG9A 3CUSA 5EJIA 3OOWA 5HVNA 1AMNA 1BS9A 3DBHB 4LYAA 4TS3A 3AESA 4IDCA 4KSCA 3NHZA 1VHJA 1JPVA 2GLTA 3VNVA 1S4QA 4DBVO 4N39A 3FMAA 1F0PA 1G42A 3F6RA 1NNLA 1ZZGA 4XWOA 1UXHA 3AVOA 1C4KA 1E2FA 1XNQH 1HPLA 3WGYA 1EM8B 1DNPA 1QWOA 5EL0A 1IJKA 2P65A 1DO2A 3ESCA 4L72A 4JP8A 2WM9B 3QFSA 3TXXA 1L5VA 1YUNA 2FW7A 4DLUA 2C1ZA 2QLJA 4MWTA 4UHCA 3GGCA 1CRLA 5ESWA 2CV0A 4X7BA 3F6SA 2O8EB 5LQSA 3T5JA 1RC0A 3HS3A 3HYCA 2CVPA 2B30A 1OV4A 3WLEA 1GD1O 2Y1OA 2IYZA 2O20A 2Q2QA 5E6UB 3H5RA 1PT6A 4PQYA 1HI9A 3I6BA 9ATCA 1UFRA 4CQNA 1SZCA 3CVYA 5E6UA 3GVPA 3H97A 3AIOA 3L8DA 4LOKA 1CZRA 2DG2A 1FMJA 3PC8A 3R6GA 4NOLA 4WCDA 4ZN6A 5IC4A 4I5GA 2L69A 5KFOA 2P68A 5DYGA 3D59A 3JWPA 4JBHA 4BJ3A 5C51B 5CFMA 2VQFH 3Q87B 4NAVA 2OSVA 3HCNA 2OAP1 3CNEA 3BIWA 1IYEA 3DE6X 4OY3A 1OLSA 3VPCA 3UICA 4XDHA 2W7PA 1UBLS 2ZCVA 4XUCA 5JRDS 5D3MB 2MSEB 3AFHA 1PBTA 3RSCA 4JNCA 2ZJ4A 2J5BA 5MHTA 3EMDA 3W2TA 2IXDA 3GZ4A 4YRFA 3PQDA 4JWKA 1EGAA 1U1GA 1ZVQA 1H42A 1HSZA 2FW9A 5HCUA 1NLFA 3L4SO 4QELA 1H4SA 3LUKA 4WJKB 2XECA 3I04A 3C3KA 4NZ9A 3SNKA 4BNHA 4YH1A 2JJ2D 3L4KA 3C5VA 4LYEA 1BXRA 1XQYA 5KFZA 1TLLA 5IYZF 1YTLA 2IH5A 1TAUA 3BF7A 4KGVA 3QPWA 1FYFA 3B52X 4D26A 3DW1X 4YGYA 2VQ6A 4HDSA 1KY3A 1YJAA 2QLFA 5A3VA 2H2HA 1VIMA 1JSCA 1KFCB 1E6KA 2C03A 2QTNA 1MABA 3I45A 3UAZA 2HQRA 4K3VA 4S24A 3BK1A 4OK3A 1RZUA 2MJLA 4IX9A 4TN5A 2W6JA 4AG5A 4UARA 2CYCA 2QAIA 4YBRA 2L17A 4ZTBA 4JI1B 1BOOA 1QRDA 3UB3A 2ZBDA 2XGPA 1L7DA 1RVDA 1KPHA 2Q4BA 3EXFA 5DBEX 3R7DA 5JNSA 5HFJA 2NVUB 5KYKA 4IDFA 1T3NA 1Y1WA 3C8DA 4IGFA 2A9KA 1JHPA 5TMBA 1RWVA 1VG0B 3B85A 1KJQA 2AXPA 3BJYA 1XK7A 4L8YA 2QVZX 3FHOA 4F4CA 1CZOA 2WSBA 1NI3A 3GT3A 3V42A 1Y5LA 2DGDA 2OY0A 4GPBA 5HOEA 1FFYA 2QWXA 1AX9A 1WQ4A 1GN9A 3D6FA 2I76A 1NU8A 3NH6A 3IC5A 3PUXA 4C76A 3P9KA 4DA0A 5KREA 1CU1A 2NG1A 2PX4A 4ARBA 4G5QA 5CHEA 5G0VA 1Z0DA 4EI9A 1V9LA 4CQJA 4N0QA 3OTWA 4NCNA 1MXHA 3D7KA 3E2MA 3M6WA 4Q15A 5BYJA 3ZCTA 2F48A 1MRSA 1AGNA 3E9NA 2JZNA 4NY1A 3X3HA 1XRRA 3D31A 4KK3A 1L2TA 2ZZNA 3JQGA 4H3HB 4V3BA 3H2SA 3H75A 1N0WA 3NYQA 2HXGA 2O59A 4BO2A 3E2IA 5T41A 2BYTA 1JKIA 2AF4C 2W6OA 3HOXG 1VE6A 4WBNB 1FDUA 1DOAA 4DNXA 1NN1A 1NPYA 1YQWA 5BO5A 5DWVA 4OGLA 1K9VF 3EZ9A 1TVMA 3RSLA 5CVDA 5LWQA 3KLPX 2FUNB 2OBNA 4K6OA 4HADA 5DI9A 4Q3OA 5KFHA 2HBZA 2Y1XA 4C1BA 1J25A 4DDMA 1KYTA 1RHUA 2FOIA 1UOEA 4MQFA 1QG6A 2PZGA 2B4RO 4DDKA 3JQBA 3RAFC 4ACAA 1YK0A 2IHBA 1J20A 2OWEA 3CNBA 4BKUA 5J2UA 3TTSA 1QYWA 4ZJZA 2FRXA 1T0IA 2VZLA 1E1QD 3IH5A 1K97A 1M7GA 1Q21A 3NI2A 1K3FA 2PPLA 4OGWA 4YAOA 5A4AA 4FWIB 5KFRA 2QM7A 3EAQA 3EUAA 5JYDA 5AKLA 2FZKA 1OU4A 1NF2A 4ATNA 1CJTC 1FRFS 1OAAA 1UMBA 3K9LA 3AERB 4JLAA 4HZUA 2HF7A 3PNMA 3ZE7A 2QX4A 3AOEC 3LNCA 4Y1FA 5J4LA 5KDOA 1WXHA 5JV5A 4MW7A 1XD2B 2WZBA 4HMPA 4L73A 2UZ3A 4XFKA 5IT4A 1CZLA 1NI4B 3F5DA 1RNLA 2BMVA 5KSOA 3U55A 1FK8A 4JLDA 1D1QA 2XOKA 5HJ7A 2D7JA 3BZBA 3IAUA 1RDFA 2CK3D 1T2CA 1UJ5A 4G25A 4ZARA 3RRNA 5IKEA 3EUFA 3MCAA 3ORFA 1Y9ZA 2BLLA 4IHJA 3N7AA 1EFVA 1UAYA 3VNAA 5C8YF 1TYAE 5K9ZA 1P19A 3AWIA 1P0FA 3RADC 4FSXA 4LF7B 5FUWA 1VJDA 1PNTA 2BGNA 1V6CA 2C2ZA 2QRMA 3HRKA 5EXEA 3KD2A 3TLEA 3NGLA 5AKZA 3NGXA 1ISFA 1WHTB 1XTSA 1JNXX 3F67A 2I03A 5EWJA 3G2NA 1WBDA 4YMLA 1JKMA 1CDZA 2ZRDA 2I1VB 4RD3A 1J0BA 1CCWA 2KBFA 3KKEA 1ELOA 2ZYDA 4Q4AB 4GOND 3GPLA 3RWMB 2DHEA 1WY5A 1Z0UA 1UMCB 4CUKA 1A9YA 1EGMB 1MF7A 2EG5A 3PDUA 4O83A 2D59A 2HF8A 3HEBA 3M4NA 4X3CA 4DBLE 4E5NA 1SULA 3ANMA 3FOEC 3MRTA 2PZFA 3AVYA 1LRJA 3ZWOA 1QLHA 2QDXA 5CB4B 3WLRA 6NULA 3QNWA 1DKNA 2NO9A 2V3VA 1Z74A 4PZYA 1QPZA 3G82C 3PICA 4AAYA 4OF4A 5B6IA 4CKWA 3WGIA 4E31A 2JLVA 2BZGA 1RK6A 5B1HA 3KPVA 2A33A 4D8VA 5F3WB 2GXSA 4UNRA 1YFLA 1VPVA 3ZD6A 1KNXA 2QOEA 1QR6A 3PLAE 4IZHA 2W2NA 4BX9A 1TZJA 2Y77A 3NDPA 1SBTA 4GBMA 5HW0A 1G3MA 3G8DA 5INTA 3HBJA 3GJXC 1P6QA 5K3DA 4DA9A 1SXJB 4TV8B 4F6RB 2OFOA 3DBRA 2VDMB 5AQEA 3LF1A 4IIUA 1HTBA 4ZEXA 4ARUA 4F84A 2JA5A 5EJEA 1J1IA 2AN5A 3PXAA 1CDOA 1S10A 1W4RA 3PENA 3V2UA 2M9MA 1WNFA 5JDIC 2FRDA 3MJFA 4U8GA 1Z3CA 2MOKA 1JJIA 3CYFA 1UJ4A 2A5YB 3SKYA 2YQZA 4PAOA 3W5DA 1T2FA 3EYWA 3N5CA 1KORA 4WHMA 5H02A 3RNOA 4E70A 2CBZA 4FU0A 4UCUA 4GM0A 2ATLA 5EGSA 1L7NA 2VRCA 3L0DA 2FSUA 4CMCA 4D02A 1O7JA 2KLBA 4KQXA 1F60A 2XQIA 5ERXA 1TJ3A 5GVRA 1SUFA 4ZTUB 3WLHA 1AQ6A 4JC4A 2MDTA 2UVRA 3IBFA 1QIEA 1I9CA 1T15A 2JI9A 3KR0A 3L1HA 4LZLA 4O2LA 5C3EG 3I37X 3NWJA 3R5TA 5D3KA 4RH3A 3N8HA 4XB2A 3D43A 1N6RA 1DLJA 4J0GA 2OORC 4F4IA 3T1NA 3L6DA 3OE4A 3BMXA 2P91A 3AVTA 1ISMA 2XIGA 2EZ8A 2Q6IA 4A73A 1AK1A 1IDOA 2ZSKA 1N34H 1T8UA 3IP7A 1G8PA 3JRNA 5ULLA 4C3UA 2QSYA 4WGFA 4X3OA 5LMZA 4F5EA 3ZS8A 5JQGF 5JROA 3FYCA 1VMIA 3U7FB 1KI4A 2NOAA 3L8ZA 2MMCA 1PT5A 2C2EA 4BO4A 4MDFA 2H7CA 3WKDA 4LRQA 4C7JA 1F2VA 2NU9A 1LQTA 1T4BA 1NVGA 2QN7A 5JPDA 4V0OA 5B7NA 3DT6A 3QZUA 2WICA 4UCVA 4LK3A 1BDHA 5FXMA 3U19A 2UAGA 4XPZA 4OB8A 1G18A 1A82A 1B2RA 2EL7A 2YN4A 3WBBA 2YWDA 4IZIA 4DC1A 1COZA 3ICCA 3N0VA 3R6LA 4HNGA 4XKJA 5BN4B 1H3NA 1Y1RA 3O03A 4XSVA 1NJ8A 4OU4A 2VTBA 2PBZA 3R6WA 4LF8B 5F51A 1U2GC 2FXIA 3R3HA 4Q4HB 5ALEA 2JFBA 1LFAA 2RK3A 5I9LA 1IBLB 2PRSA 3UJAA 1SUIA 1GR0A 1WSWA 2IS4A 2JIQA 1K88A 5AR1A 5C37A 4WLUA 1IBRA 4DQDA 4FSDA 4OAQA 5ECYA 1E3WA 2BZ0A 1UJ6A 5HUHA 1PEKE 4ARZB 2AKEA 2DRIA 1IOZA 3FY4A 5FOUA 1ZVMA 4B9EA 1DCFA 1DX6A 3S29A 5KG1A 4DSZA 4FIZA 3L0PA 4MTCA 5D1PA 3ZDRA 5T7BA 1DT3A 1L7XA 1QANA 3DEFA 4NYMQ 3FE2A 4P4NA 2ORIA 2BEVB 1Y6QA 2R8PA 3G7UA 4FMBB 3SBEA 1PX0A 1S02A 4G23A 1PZXA 1U7XA 5DNWA 3I39X 3REFA 2IY9A 1YBFA 2DQKA 1L6IA 1OPRA 3CJQA 5AW5A 4DR7H 2H18A 2VKQA 3H2GA 3QELB 4JMPA 4XUGB 5IH7A 1G8SA 3I4NG 4PZUA 2GLXA 4QDKA 4D9CA 2AK2A 3LUHA 4R16A 3FCCA 4DYVA 1VA5A 2PS1A 1Y1VA 2ZUUA 3VZDA 4WW0A 4B85A 4DLWA 2JLAA 1BVYF 1HO3A 3PVSA 2P3SA 1USUA 4XYLB 4N0MA 2ZAYA 4RE5A 3VR5H 3ZXIA 3IA2A 4IUBS 1B1CA 2WYVA 4BC0A 3U26A 5MN4A 3HUDA 1CVRA 4MMXB 1K98A 4OXYA 4QOEA 5IUNC 3MMPA 4KXNA 3CUWA 4HYEA 3VV2A 4NMWA 5IT5A 3ER6A 1ZR4A 4KLCA 3QIVA 3U4HA 3P5SA 1XI2A 2FDXA 1TKBA 2EKQA 1SK8A 3H0CA 1JNYA 1N3YA 4D43A 2O2EA 1YVPA 1Q83A 2W9CA 1CUBA 1DGSA 1R4AA 1HYQA 3TY8A 1F38A 1GKYA 1A71A 1BTOA 2FPOA 3IVCA 1GQRA 3FDJA 1U4SA 2ERCA 3S68A 3SEAA<