3VPBA

Argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
molecule keywords Putative acetylornithine deacetylase
total genus 92
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpbA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpbA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpbA01
5IYZF 4WBNF 3R5XA 3Q2OA 4O81A 1GLVA 2R82A 4MV6A 3ETJA 4M9UA 3AW8A 4ZI7F 4IWXA 2YZGA 5EZYF 1Z2OX 4I50F 4MA0A 4IWYA 1JDBB 4FFNA 1IOWA 4FFRA 3RV3A 3K3PA 4O4IF 1A9XA 5FNVF 3N8DA 3U9TA 4YJ3F 2YRWA 2R7NA 5C1OA 1GSHA 3VA7A 2W6OA 4EA7A 2NU7B 3LWBA 3WO0A 4IZOA 5LOVF 3MWDA 1WR2A 2FPPB 2GQSA 4FE2A 1JLLB 4YAJB 2W6ZA 2ZDHA 4XYLB 4FFMA 2FP4B 5C8YF 1M0TA 4O7VA 1W93A 1CQIB 4E4TA 2CNUA 3WO1A 1KJ8A 2W6PA 4ZOLF 4O4HF 4TV8F 4MA5A 4O7WA 2I80A 3KAJA 3RFCA 2YW2A 3JRXA 3R23A 4TV9F 4I55F 1AUVA 1OBGA 4YJ2F 2Z02A 4XX0B 2FPIB 1M6VA 2DWCA 4O7RA 3TW6A 4L1KA 3SE7A 1ULZA 2QF7A 4EA9A 4EGQA 1W96A 5JH7F 1EZ1A 2GPSA 3Q1KA 1JDEA 1KJ9A 5JQGF 3G8CA 3OUZA 2XCLA 4M98A 2ZDQA 4MV4A 1BXRA 4IHJF 3MJFA 4O82A 5JVLA 2NPOA 3R9RA 4EG0A 3ORQA 2YL2A 1KJQA 5JVDF 1AUXA 1VKZA 5D8DA 3G8DA 1B6SA 2NU6B 3VMMA 4C5CA 1JKJB 4DLKA 3R5FA 4DIMA 2R7MA 2DIKA 2DZDA 2GPWA 2CQYA 3HO8A 2R87A 4Y8VB 2DLNA 5HBRB 4ZQIA 4O7NA 1EUCB 2GQRA 5JQWA 5KX5F 1A48A 4O83A 5LXTF 2PBZA 2V59A 3HBLA 1KJIA 3N6RA 4MAMA 5I47A 1PX2A 3JZFA 5LYJF 4MV9A 2R85A 4YBZB 2X0SA 5J2TF 3VOTA 2YYAA 1Z2NX 2YZNA 4EABA 2YWVA 2YS7A 4MV3A 3TIGA 2FPGB 1CQJB 2XD4A 4O4JF 2NUAB 4NYEA 2J9GA 2VHEA 1VBHA 3DF7A 2YZMA 4O7TA 2HJWA 4XYMB 3WNZA 5CA1F 3BSWA 2CNVA 5BPHA 5CA0F 4GGMX 3V4SA 4C5BA 3TINA 3U9SA 2W71A 3U54A 4YAKB 1T36A 1I7LA 4I4TF 3OUUA 4C5AA 2OLSA 3NUAA 4O2BF 3AX6A 1C3OA 1E4EA 3R5HA 2W6QA 3U55A 2V5AA 4O86A 5BMVF 2NU9B 3I12A 4IIJF 1M0WA 1KC7A 3ETHA 1EHIA 4YB8B 4O2AF 4HQ6A 3BG5A 2YS6A 4O7SA 2R6FA 2IP4A 2HGSA 2QK4A 3QFFA 1C30A 4O7ZA 4EAAA 3K5IA 2VPQA 3KREA 4MV7A 4MV8A 5C1PA 4TUYF 3BFPA 5J2UF 4QSHA 3RUPA 4HR7A 4ZHQF 1KUTA 1GSOA 4HNVA 2R84A 1UC9A 1B6RA 3UFXB 4EGJA 4M99A 5LP6F 3HB9A 1VBGA 5K2MA 2R7KA 1OBDA 5DMXA 3RV4A 2R86A 5LA6F 4HNUA 2YRXA 4O84A 1E4EB 3K5HA 4HNTA 2NU8B 3KAKA 4FFOA 3V4ZA 3KALA 2V58A 4MV1A 5H80A 1KEEA 1DV2A 4FGRA 1PK8A 1BNCA 4EA8A 4M9CA 2GLTA 2W6MA 2PN1A 2ZDGA 5KKNB 5CB4F 1UC8A 4WD3A 2YZLA 1KJJA 2CNQA 5BPFA 1SCUB 3MWEA 1IOVA 3TQTA 3GLKA 3JRWA 3VPCA 1GSAA 1GGOA 2I87A 2WYOA 1DV1A 2VQDA 3BSYA 4O4LF 2PVPA 4J6EA 2C00A 2VR1A 1CE8A 2R7LA 1CS0A 3BSSA 4ME6A 2FB9A 1DIKA 3GIDA 3TIIA 2P0AA 4FFPA 4O7LA 3E5NA 3ORRA 4RZQA 2W70A 3VPDA 1Z2PX 2CZGA 3VPBA 1I7NA 3LP8A 1EYZA 4FU0A 2SCUB 4FFLA 5GONF 2W6NA 1KBLA 4O7YA 4XZ3B 3JZIA 2Z04A 5HV6A 1EUDB 2I8CA 5CAEB
chains in the Genus database with same CATH superfamily
3FFBA 3CPEA 3QFRA 3VDMA 3VJLA 5IYZF 1QHHB 5C4GB 1I2AA 1UCFA 1EX1A 2NW6A 3KZXA 2IU0A 3DO8A 1FXSA 3DWIA 3KPVA 1GNTA 2JFFA 4WBNF 1TO2E 2Q6VA 4MRSA 4UU1A 3TOXA 2WTNA 4TVIA 5HVNA 1ZVMA 3I0NA 2ZI9A 3E2MA 4XM0A 4U7CA 5CVVA 4DQ0A 1PWYE 1VTKA 2HLDD 1C8LA 3ZH9B 4EUFA 4TMWA 5H83A 1LV8A 2IYEA 1KZ4A 3M8KA 4MIKA 1WLYA 5KSOA 2R82A 2YWEA 1AK9A 1A9YA 1J90A 1US8A 3D9QX 3QX9A 2OLEA 4D9GA 5BV0A 2VXBA 3L7BA 3OE7A 3OSZA 4AVYA 3KQLA 2XVAA 5ESRA 2HI0A 2POQX 4ZRMA 2PBLA 2VNSA 3SCZA 3LYAA 2WUVA 4F9TA 3MS7A 1M2JA 3VI4B 3M6FA 1DAEA 2D5LA 4XW2A 2JZOA 4E6NA 3M9OB 1DJLA 3OD1A 4YAEA 1ITZA 4W1QA 4UJ3A 3IB6A 3TJRA 3ILSA 3D2LA 1XVTA 2ZJBA 2BEVA 3X44A 4IAJA 5TT0A 2HHLA 3THXA 4YR3A 1ULHA 1Z73A 4DTIA 2IXFA 4IKEA 1I30A 1QFSA 2NIPA 4PX2A 5EXXA 3G9XA 4EHHA 4EYOA 1WCIB 4XIJA 2D1RA 2E55A 4RNNA 2BI8A 3CLHA 1FX0A 3GCZA 4MS3B 4TS1A 4UAJA 4X1YA 3UJBA 4EJSC 1UKEA 5JANA 4BXOB 4G1BA 4MGEA 3RYIA 5LUBA 4INPA 1SR8A 1XZNA 3MT9A 2UU9B 1V8ZA 1OFUA 3LX5A 3TCKA 2ICAA 3EWIA 5C7YA 3E4CA 4QOIA 1L7OA 3ER8A 5ECYA 4JWTA 1XZBA 3S40A 2QN1A 4AY5A 5JCXA 2P9YA 3KTDA 3ZCXA 1X7HA 1ZEJA 4GC7A 4PE5B 1J4AA 3DEHA 3EDQA 4V0KA 3RF6A 3LLVA 1YR8A 1QYIA 2B92A 2HSWA 1N9ZA 2ZJYA 4EB6A 1WVIA 3LD9A 1YKGA 2GN4A 3IRUA 4ED6A 1MFZA 5K6RA 3PTLA 1XLTA 2QJWA 1FVFA 1M2FA 4HCJA 1BDHA 3W4KA 1XRQA 1ZDMA 2BR0A 1RCTE 2FA9A 1JLLB 3PR5B 1X2BA 2O2HA 2QUZA 3N05A 5KYYA 4JXXA 4ZAGA 3KQPA 4ZJYA 3LCVB 1E89A 2HTEA 5C8YF 4NLLA 1F9EA 1R0CA 5I51A 4RGYA 3OWHA 3LVRE 1GJRA 4QGFA 3STTA 1XPRA 1G4HA 2BMAA 3D8NA 3MRXA 4Z9YA 1I33A 4KMSA 2FOIA 4D9NA 2DQYA 5LA6B 2BGIA 4DQDA 1JG4A 4Q7JB 2ISSD 2QTTA 4B84A 4QXOA 1JFTA 5FR9A 2WKRA 3ILVA 2PL5A 1SC3A 1XYYA 1F0PA 2R1VB 1UBEA 3DDZX 1NF9A 3DUFB 3GRFA 3W2TA 2VOJA 5ALPA 2NVUA 2FN4A 4M4SA 1BU8A 2I3GA 4QQKA 4UDNA 4ECYA 5FQNA 3SSNA 4OAPA 1MW8X 2UVUA 5KT4A 5CD9A 1O5IA 4I4LA 1VGVA 3A6FA 3CMCO 4RACA 3WWJA 1XDBA 2YVAA 1OFIA 3KYBA 3EVGA 4LG1A 3DF9A 1EK1A 5B2EA 1EFDN 1U7ZA 3V9PA 1P77A 5K4HA 4U00A 1RI5A 3K8YA 2ZR8A 1CDDA 4ZV7A 3LRXA 3P2JA 4BV9A 1G1AA 4RB1A 2WPNA 4GL2A 1MUUA 3M4XA 2PUTA 2MYPA 4HZUA 4LCJA 4YRJA 4WXPA 4K2AA 2H63A 2WKPA 5FJJA 4MR7B 5HDBB 3DM5A 1CC1S 2C2WA 3C5HA 1WZNA 4ISCA 5KPDA 4ZOEA 3TEKA 5KFIA 4L08A 1TTQB 1XRJA 5ICSA 1IU9A 2HNAA 2FVYA 3TZCA 3AHCA 3BIXA 3PB3A 3L0BA 4N4AA 3FOAA 4MI6A 3V6LA 4Y18A 5LMUB 4EH1A 1Y8ZA 3FWKA 3L4SO 4RLQA 5DCUA 3WY9A 1R0SA 3UGJA 2WTBA 5EZ5A 4EVQA 5JVLA 3H11B 3RS3A 1UPXA 1EIZA 1PFWA 3OG9A 1UBKS 2WMNB 4B5KA 2JFPA 3ORQA 1NAHA 1ACLA 1TF5A 1LZKA 2CLEB 2I4LA 1SC4A 1ESMA 1I01A 1UM8A 2R1TA 1KNQA 4LK2A 1M2NA 3FB4A 2RG1A 2AR9A 2ZZMA 2WYWA 3EA4A 4M83A 1O6CA 3VNRA 5JZVA 1BMFA 2GAFA 1HR0B 2FWAA 2J3KA 1OIWA 2V5VA 1FYEA 1X7WB 2BIFA 2X1VA 2ZBRA 3R3XA 1HFEL 4JT4A 7GPBA 1BXKA 2JVKA 3THYA 1G6Q1 1GYQA 1UWKA 1VHJA 3WAKA 4BMYA 1KBZA 4KXYA 1Y3FE 1XRLA 1WSBA 1EAYA 2IQ5A 2Y9MB 4C1NA 4EG7A 2DIKA 2FE3A 2DZDA 4IXDA 4PHGA 2CQYA 1PS8A 1N6HA 1VMAA 1WL8A 4Y1FA 4QFCA 1EVQA 3ZLBA 3GDGA 1CKNB 4DIBA 3PZRA 1AMUA 2UZAA 1DINA 5E9AA 1T3HA 4JJKA 1E64A 4FVTA 3A1FA 1KQ3A 1WW2A 2Q2OA 2ZJAA 1XEWX 1CYDA 4LBYA 4II3A 4MP3A 5G2OA 1E5VA 2XRYA 4FFBA 3E5HA 3P9IA 4H6XA 4RW0A 3QM1A 4XWOA 1COWA 2ZB8A 3JZAA 1N7HA 4J0IA 4FGSA 4LHZA 3JZFA 3KLPX 1Q16A 4EKYA 4JI2H 4UVDA 4Z0TA 4R1PA 3DMNA 4QOFA 2VSFA 4D9MA 4N9QA 2C82A 3FSEA 3I05A 3LFUA 4R2XA 3RVNA 1DEXA 3C0KA 1Y3CE 5J2TF 3O4IA 1QFMA 1P44A 4RUCA 1W29A 2D4AA 3HYRA 4MI3A 4Q9HA 1A9PA 1D1QA 5AT1A 5IAEA 1N3YA 1O03A 1PDOA 3PXBA 3T4PA 1Z2NX 5H1YA 3K70D 2JEJA 5E38A 4AS1A 2NSHA 2R4QA 4XFDA 4DLXA 1T3GA 2ZYWX 1QJCA 2XMSA 1W4BA 4J3JA 1GFWA 5JJCA 3ZD9A 4ENTA 1FFBA 3D3WB 1M1XB 1ORIA 2X8WA 3AWIA 2RHCA 2OCIA 1R00A 3HABA 2V8OA 3PGA1 3QEOA 3UFXA 3B8HA 1JU3A 3MK31 3PC8C 4K5QA 3TYXA 3VV2A 4AUEA 3SXJA 1MENA 1K7XB 3IBYA 3JWGA 4KTVE 4DT1B 1F3LA 1P45A 4QPJC 3DMHA 3EFEA 2EQ5A 3ND7A 5AJTA 3QVGB 3U1VA 4C4RA 4ZICA 5LD2C 4JI0B 1Z6PA 3IH5A 4F97A 4NX2A 2WWFA 4ARZA 1BROA 1HQKA 1QV7A 3C2QA 3JSAA 1ISIA 1HFKA 1JIHA 3HNRA 2WSYB 4OQDA 1A9SA 5HIJA 5KI6A 4WK4B 1RYFA 3HU5A 3UWSA 1W4RA 1YS6A 1YJ8A 3DOHA 1JQ5A 2G71A 4DNQA 1UBHS 3OEHA 4IV0A 5HQ3A 4MVJM 4MCHA 3OJXA 1EKFA 2YJ5A 5DXJA 3C74A 1DBRA 1ZI8A 1ZW1A 5ENZA 2QRJA 1IH8A 2WK1A 4OG2A 3LBIA 2JK1A 3U54A 1TVCA 5KWEA 1W0KA 4LV6A 5FOWA 5JTTA 5BSWA 3D8TA 4YRTA 3PLRA 1NMEA 5CHYA 1UFOA 4TSFA 1JFSA 1IYDA 2O4CA 4TL9A 3DJFA 4ZTZB 5FTJA 4JLJA 1W581 5BYAA 1JZSA 1TA4A 1THMA 2BLLA 5BNWA 3R4VA 1SOMA 3R7WA 3R7AA 3RG8A 3BQMB 1GGHA 2QAGA 2X5OA 4WBNA 4IICA 4TT3A 2C84A 1MEEA 1T10A 3HXQA 1GCAA 1MFPA 5IS2A 3VNAA 4FT4A 1U8TA 4PZZA 1UKVY 2VBFA 3R3VA 3VC7A 1DIOB 1JXMA 1WHTA 4ENWA 2PXXA 1WO8A 3T6KA 1QGDA 1QHGA 4Q45A 1VJ5A 2PZAA 4NXNB 1RJFA 3FPJA 4QDOA 2B37A 4X94A 1SKYE 1N0VC 1U1DA 3O0TA 3ADPA 2ZGVA 3DZJA 1NQVA 2H1OA 1G20E 4BJ5A 4HQ6A 5IK2D 4KXWA 3RR5A 2GDZA 3TIXB 3VNBA 2C83A 2DQZA 3IUQA 5FLYA 1HLPA 1PT5A 3DZ8A 4ZREA 1BIFA 2DPJA 1L2TA 4H08A 4OJYA 2IEYA 3MTDA 2A5LA 2ZRDA 4B6JA 3W5VA 1O4WA 4DF3A 3WQBA 2WIDA 1KS9A 2EJVA 2XITA 4OY3A 4D42A 5CM9C 5ALMA 4F4FA 1F2TA 4ZYWA 5KNDH 3UAVA 2ES4A 3VQTA 5J63A 4EHAA 3Q5GA 2XCPA 3E9ZA 2ZJ1A 5GVSA 1Y1LA 1P19A 1GFIA 1N2CE 4C3UA 5JSQA 4TKUB 1VS0A 4J9KA 3U7QB 1PJ2A 5C1PA 3B2EA 3JAKA 4P54A 2OHVA 4Q1VA 4EF5A 3GLHB 4LGCA 5TR9A 3U62A 3P7MA 3I1YA 2KYRA 3P20A 3EDRA 4AJHA 1TU3A 2IYQA 4WSOA 3S55A 3ZE9A 4P36A 4TV9A 4L02A 1CZLA 1ZAUA 4OVKA 3ISVA 5JCZA 3A9RA 4PN7A 3IDAA 1F2VA 5MDHA 4GR5A 3PDUA 1QC5A 4YAFA 4B4WA 2GILA 4ZHQB 3KHKA 1W4AA 1NVEA 4LZZA 2X3UA 4FFWA 2C95A 5KYXB 1XK7A 1Z5NA 5AK6A 1UFVA 3A28A 1UMDA 3U7IA 1V39A 4APMA 1CG6A 5AH0A 5KQLA 1RRCA 4YP1A 1ATIA 1PLJA 1ES9A 2VBIA 2P5UA 5I4BA 2SKDA 1AZLA 4PC6A 4YPFA 3U4AA 4BMCA 1SD1A 1JIVA 3AP1A 4M99A 5C8YA 1L5NA 1KPHA 4JEHA 5CR9A 1G2PA 4UTNA 2I29A 1V51A 4FBUA 4HYKA 1JILA 1XEFA 4XTRA 3RCBA 3QV1A 1I7SB 3I5AA 4W5RA 3PRKE 1IYEA 2Q6IA 3OEYA 2A0XA 4FYPA 3GR6A 3TRFA 1K9SA 4TXMA 3FAKA 1WPRA 1B42A 1G4UR 1N2HA 5IWAB 1VPEA 5JATA 5JAZA 3BUSA 4DV1H 1IN6A 2CCGA 3SJ7A 1SRRA 3F49S 5A71A 3LLCA 3GFFA 2IUTA 1C1DB 4AKHA 2ZBQA 4QG7A 3NC1C 2GKOA 1VMIA 1UQUA 3OOWA 1JSXA 1PL7A 3EOZA 4E46A 4DMRA 3F46A 3IQFA 3PIIA 1S2LA 4OATA 3QE9Y 4JMLA 1P31A 3M4ZA 1RQXA 3HQ4O 2A5FA 4B8WA 1C8VB 4X85A 1JECA 1R8JA 1U99A 2IOHA 2RFLA 4U5XA 2G08A 1CY7A 1PRYA 4HKTA 5I7WA 4LJ7A 1M6YA 2R60A 1ZBDA 1XMXA 3N5CA 1XD9A 3NHLA 4JLPA 1NJGA 2Q1TA 3V1UA 1ORDA 2P68A 3OF2A 1QSGA 4I14A 1T4DA 5JXGA 4RK5A 1BX1A 4R2HA 2PVSA 5WRFA 1JQ3A 1Z9BA 4B6SA 3PIDA 1K92A 2WF5A 4KN5A 5AI4A 4Z4FA 1PN3A 2P41A 1GT6A 4HY3A 5CGQB 4MW2A 4E09A 4F92B 2PN1A 3DAHA 5F5LA 5BSKA 4OQZA 2VRNA 3LUCA 3RAPR 4FCVA 1KXZA 5IP7G 1E6CA 1ZSYA 2OGSA 1UC8A 4FNMA 4ND3A 4R0VA 4DWWA 2AG8A 3ERCA 2YCHA 4YYZA 2YZLA 1HV8A 1KJJA 2FE1A 4XARA 2DM6A 1G2QA 4DLBA 2GN2A 2JIMA 1LX7A 2ZSAA 3B1WA 3B6IA 4RSGA 1N5MA 5TPZA 1JEYA 1QP7A 4UPDA 2C9BA 3BXZA 4HWTA 4Y98A 4H27A 5EUMA 3ZHCA 4BVBA 4F6LA 4RFSB 1HA3A 2AC4A 1U8FO 3EVNA 2FK7A 5TY0A 3VPFA 4C06A 2PT7A 3EB9A 1T5TA 4J9PA 1GGEA 1NASA 4Z53A 5KOYA 1UOEA 5DQGA 1LLCA 3IAS1 4C4XA 1ADFA 4D96A 2BEWB 2C9DA 3BSYA 1NBEA 3BIFA 2PG3A 4KLZA 4DCNA 5KVCA 1XP5A 4OQYA 5KPJA 2VDPB 2HRZA 3K73O 4TMFA 3N3AC 5B36A 1H2RS 2BFEA 2Z2XA 3ECSA 3KB8A 5C35A 3RYTC 3AEKA 4HQKA 3ROKA 1QK4A 3TF5A 4YRFA 4BY1G 3L4JA 2EU8A 3V3TA 4B44A 3GEBA 3UWMA 3MT8A 1TU0A 1S97A 4H3VA 2BISA 4RSHA 3R20A 5BSGA 5KNCA 1X1RA 4WECA 4WTOA 5TMEA 4FINA 3WQSB 1ZN9A 4UZEA 3IKTA 4RAQA 4X8OA 1GT91 6ADHA 3HMKA 3QPCA 2VQEH 3OLYA 1NIPA 1I0ZA 3N0VA 4WZAA 2W22A 2CN1A 1A3CA 1UMCA 4O5OA 2B0JA 4XA8A 3FZNA 3D2BA 3RRZA 2WIBA 1TYEB 4OHOA 2AR7A 2OSBA 2FN3A 3FLEA 4P4LA 4YXWD 1KZ7B 4ECTA 3Q8KA 1CNMA 1D0VA 1DTEA 2W2TA 3HVHA 4ZKEA 3ZS9A 2O2SA 4YRLA 3FFXA 2AS0A 2V5UA 3SQMA 4DXAA 3UXHA 3KWFA 1YAJA 4NQRA 3J7AC 4PZEA 3Q3EA 3QYAA 1K7FB 1WX1A 2DFVA 1GEGA 2FWNA 2QTHA 3E3AA 3F71A 4NTZA 1UFRA 4BRZA 4JSRA 4FX5A 3DH0A 3JX9A 3RNLA 4Z49A 1QIJA 5CDSA 3GGPA 5JRZA 3I61A 3QEMB 1XZMA 1Z45A 3F5FA 3H4IA 5KYTA 5IT9A 3PUVA 1QB7A 3E61A 4I9NA 1C9DB 4MQLA 1S1MA 3PZBA 1IULA 3Q15C 3VO9A 4U2CA 1NM5C 3QW4B 1SN7A 3O1HB 2FW6A 2AEEA 3BJMA 4CM3A 1SB8A 3FPAA 3O8LA 1YMUA 5FWDA 1TYCA 4E5YA 3F74A 3FPFA 3KV3O 4FGKA 2Q5IA 3DDCA 5JYCA 1CEXA 5KS8A 1R3DA 4WE3A 5KINB 2Y1FA 3KWMA 1GGKA 2X8AA 3JQFC 3AI7A 1FMLA 2IQIA 3DP7A 3VDXA 2CSXA 1CETA 3EXHB 4W1PA 3H0CA 3IDOA 1CKOA 5HJ2A 3ZBPA 2ZKIA 4GC6A 2P6MA 3VC1A 1KKLA 3H3JA 3NIFB 3SVTA 4DRXA 2PWYA 4L4UA 5ALZA 3MWYW 5IULC 4HN4B 2ZI4A 4F3NA 2OZLB 3ZWYA 5F9NA 5CX1B 5EZYF 1ZHOA 2CBGA 1AUQA 1G8KA 3FZQA 2Q3BA 5AHRA 5LCXA 4WK2B 4EJ0A 5M34A 4N48A 4X44A 3CEHA 4G8BA 3GILA 1V11B 3R3JA 2ZVJA 2WTFA 3KFLA 3BA6A 3QOXA 4OB7A 1EE9A 2B4AA 4AIRA 1X1TA 5TEWA 4F4XA 1OBHA 1Q0QA 2OR3A 3O0DA 4UE3S 4RJ2A 3TQSA 4KPEC 3AVXA 4UCSA 2E0IA 5DNEA 3PUZA 4J9RA 1ZQ1A 4LV5B 3A6EA 3O4FA 2I9PA 4EQ5A 1JXAA 1Z35A 2C4MA 5H4HA 4F4CA 5EEGA 4KPFC 2HSGA 4URZR 8OHMA 2OCBA 3E82A 5EXEA 4O63O 5CFQA 1YI1A 2QV7A 3N41B 4WGFA 3QVMA 2XE4A 4X84A 4JI0H 2VKTA 1BA2A 2DHDA 2ZIAA 2C4KA 1W0JD 1W35A 3IAS6 2XIGA 1NUTA 4OJMX 4CM7A 3ENNA 3L1HA 4MQFB 5D1OA 5KFFA 3MJSA 3GUCA 1Q7EA 2AQ8A 3QUTA 4FC7A 1WMDA 3FJYA 3K2IA 1SXHA 4DQKA 3FZGA 1UAAA 3WGGA 3AVPA 4DQNA 4XEUA 4BO2A 1RWNA 4H35A 3OFSA 5E8JA 3MINA 2V9ZA 3OE4A 2WKWA 1XDUA 3FFTA 4AYXA 2IXEA 2DULA 4KXXA 2XVYA 1SUPA 1Q19A 4PHCA 4Q7KA 3C7CB 1VSTA 3C3WA 1GO2A 4RJIA 1DPGA 3QUQA 2Q5FA 5LXTB 3GTGA 1CJSA 3NDJA 3HT5A 1UKCA 4MR9B 4ZOQI 5MN6A 2YXLA 1XAIA 4RZRA 1NXQA 1MOZA 5DK4A 4XYLB 1V26A 2HU2A 3L5KA 4R84A 1ADYA 3PEUA 3R7NA 4PYJA 3GTLA 1BKYA 2FN7A 4ZO4A 5B57C 5JBNA 3TSWA 2QIOA 3TMKA 1RKUA 1R5JA 4WX2B 4KNVA 1JTFA 3Q3IA 2D7DA 1ZHQA 2WJJA 3MB5A 4W5TA 4TV8F 4WZBA 4RIEA 3TLAA 1K4YA 2WMDA 4A3LG 1TUEA 4GLFA 4BDSA 4R1SA 1U11A 2PJZA 1LZLA 1D2AA 2X9NA 4YRDA 2D2XA 3VISA 1NXSA 2FMXA 4TV9F 1JUDA 2ZRNA 4YN3A 4I1YA 4YONB 2CHVA 1E20A 2K7FA 3P9XA 2WKSA 1YQWA 1OBGA 1NIJA 5F9MA 3KYCB 2NAFA 3OFNA 1OV6A 4CLEA 3KAPA 3D5QA 4Z4GA 4ZU1X 1K6MA 4C2MA 5IDYA 5K3FB 2YY6A 5T67A 3FF4A 4Z3OA 2VHXA 4O7RA 1ZC4A 1NYQA 5IDQA 4D41A 1CZRA 1G9TA 2Q62A 3TG8A 2UVPB 1ZX1A 2WI8A 1I4LD 4RE6A 2C1ZA 3EHEA 1ULZA 1XPUA 5AR1A 4EGQA 1QJ4A 3PL5A 1W96A 2CXXA 1KERA 1K27A 3RC1A 3DTFA 5SV2A 3CSUA 4I08A 1U3UA 4O2AB 4CMIA 4YAIA 1V9PA 2GJSA 1WQ3A 4MYUA 2O59A 2NUBA 3TL3A 2P75A 3VNUA 1K7CA 3FCUB 4C0LA 5GWXA 3VO1A 4ZMSA 4H15A 3OUZA 2H92A 2IOFK 1QVVA 2OQVA 2PH7A 1E77A 2EWMA 1EGMB 3ZW8A 3JD0A 1OA1A 1SY7A 1ZD8A 1FU4A 2NGRA 3DO6A 3U3XA 4JI1H 3F67A 2HXGA 2NPOA 2PA3A 4U2FA 3UUFA 4AX4A 4MRRA 1FZQA 4QSMA 4XWTA 5LN1A 1FJGB 3FTNA 5BQFA 3QZUA 3ROPA 4GGOA 3V1TC 1L7NA 3FM9A 3UBTA 4YMUA 2PVCA 3N28A 4B7AA 2WAQE 1RM3A 2AXEA 3A2LA 5D6OA 5KQMA 4HFNA 2KHZA 1DFGA 1GPBA 2WKQA 2IODA 1DAAA 3HN6A 1B6SA 2OECA 3KRTA 4RK4A 5CNIA 5BVGB 1I2ZA 5UKDA 3F7TA 1E1NA 2NUPA 5K9ZA 3F73A 3HC7A 4K6HA 3IXLA 4Y2GA 2FDXA 2CMFA 2QLBA 3BHJA 2O1XA 2VTBA 1KPIA 1KMHA 4DIMA 1QOZA 3PCTA 1SOAA 4HPXB 3H9EO 1JIIA 1Z2EA 2VYCA 3BD9A 2AGQA 5C5JA 1LF5A 3TD9A 3U5TA 1WUTA 4MEAA 4PSCA 4XCVA 1VSUA 2P5TB 1BAPA 3HEAA 5DYNA 1Y8QB 1U3DA 2ALJA 3MQ2A 2QVBA 1FQKA 3WSVA 3PT9A 1ANKA 1J5XA 2BDUA 2JFVA 5E25A 1YO6A 1UXIA 2WPDA 1J9GA 1TKRA 3AP3A 2QD1A 3QUAA 4HL6A 5KX5F 4LVCA 3AESB 1VQ1A 2HA4A 1JU9A 2Z8XA 3AV0B 3HGQA 4FLEA 3RW9A 3W77A 2WDZA 2HB6A 3FWNA 3PPVA 2FU5C 4IIYA 4K05A 4B6OA 2RGCA 2ABWA 3EBLA 2BM1A 4HTFB 4EF4A 4DS3A 4BATA 3IESA 1I6UA 2CLFB 5L40A 2ON6A 2ZE6A 5B6JA 4M9SA 1XRPA 3PQ3A 1FNDA 1YI0A 2XQGA 5FLXW 3LC2O 2X0EA 2JGDB 3KETA 1ZMRA 2EJUA 3G0DA 1H23A 4QFMA 1DC6A 2ZJOA 4UVIA 4TLBA 2BKEA 2W8ZA 5JE8A 4LY9A 1PLLA 1K9VF 1X15A 1SULA 1VM6A 2RIPA 3LQSA 1MEJA 5C0OE 1OC2A 3OZWA 3GTMA 3PF8A 4PBTA 4URWR 3ST7A 3UN1A 2ZXFA 3FIUA 3TNLA 3IOCA 3S4YA 2IHUA 2EEZA 4WNYA 4KSCA 1R0LA 3UENA 5IBPA 3RSCA 4DXDA 3P52A 1Z22A 3V8MA 4UCWA 5ICMA 4O4JF 3FCOA 2DTEA 4GO1A 1T5LA 3PHIA 4OL0A 1P6UA 3AVUA 3C1TA 4C4YA 3NV7A 3CBGA 2JBAA 2J9GA 2P65A 5EWEA 3GA0A 4FOLA 3RR2A 2JCGA 2WEKA 3HB1A 3QY0A 4YWHA 1OI7A 4YCDA 3B1ZA 3SZRA 4CQLB 4NK5A 5LLSA 1PGPA 1YVUA 4FI3F 4FMBB 3MOGA 4E5UA 1H0RA 4NF2A 4OQNA 3CN9A 5K8TA 1SKQA 3DONA 3EXFB 4EAAA 1C3XA 2CNVA 1OTXA 1E1CB 4LOKA 4P2GA 2ORWA 1YQXA 2L19A 3D02A 3HLKA 3KL4A 4GGMX 1RWKA 3RS9A 4ZGGA 2RDIA 1I1HA 1WKCA 2FV8A 4EEZA 2O2XA 2R6R1 3KR1A 1ZM3A 2XGJA 3HB4X 4INZA 4B46A 2B3TA 1I4EB 4JQOA 1XLVA 2P4UA 3R7DA 4AI6A 2J4DA 5EJ9A 2GFHA 2JI7A 5ILGA 3A37A 5DLPA 3DR5A 3L7LA 3AERB 1QH1B 4DMLA 2IBKA 2AYZA 3GJ3A 3ZZ1A 4FZ3A 1RDFA 1NVWQ 5K0SA 3FNFA 3WRWA 1X9GA 5IANA 1KJZA 1FX1A 3URMA 4P0PB 3WDMA 4TQGA 3NBYC 2G0NA 5NLLA 1KHHA 2PGDA 2XHEA 1E6MA 1D8TA 3EIWA 3KQQA 2JFUA 1GNLA 1UKAA 4U3JA 3SLRA 3W6NA 4R9VA 2I71A 2IZ6A 1DAPA 3WL5A 3Q8LA 4RYDA 2XAAA 3NHKA 4LWPA 3ZK8A 2J41A 3P9YA 2AOXA 1QS0B 3QVLA 1AN9A 2JIQA 1M0WA 1RBQA 2DFKB 3ICOA 1RZRA 3NUZA 3GROA 1GKKA 5JZMA 5D1OB 3PA6A 3RK1A 5TMPA 5D3MB 2X1MA 4ED8A 1NPDA 1H8HD 1SVOA 3ZVNA 4AURA 3H9UA 3MGCA 2W2NA 4YDHB 3STWA 2D0OB 3UMGA 3UVEA 1PJAA 4NMWA 5IARA 1I7PA 3B6JA 4OTZA 3AR6A 2JH3A 1RBMA 3S3TA 4WACA 3DVAB 3I3SR 4OB6A 5TQ2A 2UAGA 3I5YA 1P73A 1A8QA 1Q7BA 1Z28A 4NESA 4WKCA 2YNMA 5JXHA 3U2QA 1AA9A 1PTJA 2BGUA 1C30A 1DC8A 1KK2A 2VOEA 1M5UA 4RD2A 1DAKA 1XJWA 4BKRA 2O2YA 4FLMA 4Q3CA 4EY4A 1QTNA 3LLUA 4UNRA 4Y1RA 1A95A 1IHPA 4RPJA 4LF9H 1SA0B 1ZK4A 2XB9A 3CNQS 2BM0A 1TJ3A 1U65A 4RL6A 2V54A 1LJUA 2WB1A 3AIIA 3FYDA 4QO7A 2GPAA 4J4BA 5FPTA 5CW2A 4AWAA 4DQXA 3DBLA 1GKUB 1N5RA 1HSZA 2OWDA 2IT1A 1GQSA 2VJYA 1E2KA 4ZAZA 1XA4A 2AE2A 1E2MA 2ACEA 2EFEB 3DE2X 3PKZA 3MRSA 4RDIA 3FGZA 4AN0A 4ZI2A 4NSNA 2YHIA 1C2TA 3MAGA 1KQNA 1O97D 2LGJA 3T1QA 2QLJA 1BKSB 5KFKA 4G0WA 4OBWA 3SC4A 3TPFA 1SBYA 3NCHA 3BMNB 4W5WA 4JVMA 3GNLA 4B48A 3CS3A 4JKIA 1E58A 4OQLA 3SBEA 1GARA 1XZAA 4PQYA 2J6TA 2FZVA 3HA3A 4ETIA 3Q5DA 4LECA 3KYCA 3BFJA 3PPIA 4OI2A 3SLKA 4W6ZA 4R51A 2PKRA 4ZO6A 1ZRMA 1H65A 3DV0B 4QWAA 3ZUGA 2IK8A 3UJPA 4Q47A 3ZEAA 3I8XA 2QORA 5DN6D 2IF2A 4HTFA 3NVKI 2YR0A 2N1MA 4XJTA 5DM60 5D7BA 3DMRA 1F7VA 1TRHA 3ZV3A 3UXMA 2BD0A 4ARUA 5HMMA 2HMUA 3FVVA 2HDOA 3UNXA 1YZHA 4L76A 5F12A 2DHCA 3PGVA 5K0GA 5JAIA 1KF0A 4RTRA 4KR0A 4RE5A 4EA6A 3GEGA 4MO9A 1UBSB 1ZVJA 2F1KA 4J0FA 5JC1A 5JPDA 4XASA 5E1OA 5LQRA 4CGYA 4O4HA 4JI7H 1RAAA 1SXJA 4HN9A 4M22A 5BSRA 1UXOA 3VTFA 1RLMA 1E2FA 1ZUNB 3I4CA 3MTQA 4KO2S 1T1RA 1SFRA 1VHTA 5I7FA 1IYZA 1I24A 2P7IA 2Z5GA 4RA6A 5A3RA 2J6CA 5EGSA 1JKXA 3DB2A 5KX5B 4OXIA 3KM0A 4MVJE 1MC5A 1QMGA 4LTNA 2Y1GA 5HEKA 1VFPA 1JI3A 3AIMA 3CWQA 3L0OA 5IHXA 1YVPA 1MORA 4RUAA 2AJCA 2W8BB 4JP1A 4MYDA 4CI0B 1XEWY 2X0FA 1IUKA 3DTVD 3GD7A 4LY3A 1PT6A 1P2BA 4CKEA 3GNSA 3HO6A 5GGYA 3MCWA 5H3LA 4RX1A 4B8ZA 4F6RA 4IVQA 5BOSA 1DBPA 3LH5A 2GCOA 5JECA 4DR4H 1DKLA 1MN6A 1D2GA 1K0FA 3HS3A 4R98A 4OHYA 1VBMA 2P78A 4Q6WA 4ZCSA 2F1IA 1XMJA 4DUGD 1S3SA 4ZQGA 4ZEXA 3G8BA 5SZJA 3I6QA 2ZU6A 3JQ7A 3PT5A 5HS6A 2J6SA 4MVJP 3TTXA 4ZIRA 2EGHA 5LD2B 3NAQA 1IN7A 4PPNA 4C4TA 4ECWA 3UHJA 3I92A 4RKYA 1SQFA 2F90A 3WWCA 5FTWA 5JW6A 4PO1A 3LC0A 1ODKA 3IQXA 3M5WA 1KKUA 1JSCA 1J2UA 4LQCA 4QOGA 2IELA 2BWJA 1YNOA 4ALNA 1N3IA 2ZQ5A 1CEQA 2VSXA 3CLSC 4UU8A 4C2UA 1T4CA 2JBHA 2Q3DA 3QG5A 5I9TA 4CFZA 4CEHA 4GNKA 1ESNA 1U4OA 3F4LA 2BP7A 5IC4A 2PE5A 2LRHA 1V1MA 2J0UA 5JZOA 4URFA 5FI1B 1FYXA 2WYOA 1H8ED 1NOKA 2HUPA 3FCCA 4LSMA 4U2BA 4BKPA 1F5NA 2J9XB 3NI2A 4CG1A 5FUQA 3SKYA 1KDOA 3SFVA 1VCMA 5KDOA 2EX4A 3PYLA 1QV9A 4YS6A 3CCFA 3CJRA 3GHYA 4QARA 4JXZA 4GWGA 4HUTA 3V2HA 3ZIAA 1K8QA 1P2GA 1DIGA 2A2ZA 3CLUD 4KQKA 3UH1A 2OHXA 3P0RA 2FLPA 3BQ0A 1P7VA 1T34A 2BEKA 1QYWA 1FNBA 3UW3A 4XWKA 1RRVA 4K6NA 1G17A 1X1EA 4KHPB 4UXIA 3HH8A 4E15A 3E9CA 4U6NA 4DR7H 2RH5A 4KSYA 2YVKA 3EY4A 3QU2A 4IMRA 5AM4A 5K09A 4RAZA 1BWSA 5MGBA 4IIBA 3O8QB 3SWWA 1LSSA 5AP9A 5U4XA 2GH1A 1U28C 1EP3B 1NP3A 2OT3B 3DMTC 1CUHA 4AS3A 4ODIA 2J3IA 2Y6UA 3C3AA 3EEFA 3PKJA 3KKNA 3QI2A 4HGZA 4Y9UA 3SHOA 2HR1A 4YUZA 3N43B 1JSRA 2ZB4A 3BWEA 3OWOA 4LZJA 3C1UA 1E0DA 3FPSA 4MH0R 4CMBA 3DEYX 3SXPA 3I04A 3FWYA 5H59A 4JI3B 3T99A 1I80A 1XNQH 3TSZA 4AF8A 3W8RA 4H7HA 2OCPA 2B98A 2PKQP 2ZIXA 1G60A 1X9NA 4X90A 3ZQKA 2ZYTX 3FYUC 5C44G 2BKVA 2YOGA 3K1ZA 3ZLJA 1DC4A 5CDFA 1YVRA 1E98A 2FSPA 4X0EA 1P1KA 2G9NA 2G4CA 2J9FB 2WV9A 1PW7A 1NG1A 2BE7A 4ON9A 1FMJA 4R81A 5ELLA 3S7TA 4C7KA 3LPDA 4CC6A 3HB0A 1V45E 2BVNA 3JZIA 1H1LB 1Q0ZA 2JPDA 1OSNA 2FR0A 2PSJA 2R48A 4CQMA 5JOQA 4JJ8A 2YZ2A 1SEIA 3VZCA 1HETA 1LDGA 1M6EX 1RLTA 3C6XA 5CAEB 3D31A 1QFJA 3HYCA 4KODA 1VE9A 1C0IA 1PTKA 5THQA 1L5QA 3RD5A 2QJRA 4E70A 2IS4A 2IZ0A 1N0IA 1LPAB 5FI5A 4B74A 1WV0A 5I6DA 5JCJD 4MHSA 2V3WA 3KHHA 3IQZA 4RCYA 4D9HA 5KNCD 4BCDA 1V7QA 1NSFA 1Q0HA 3F7NA 5JVDB 5KSPA 1PD0A 4C0QC 5E6SB 4F91B 1LVHA 1ZJ6A 4R9NA 3EZNA 3UHOA 4D80A 2JHGA 1R9GA 2ZJ2A 3W8NA 1GG5A 4HWKA 1OHHD 3TGWA 3GFQA 1UP4A 5IVKA 3KOXA 1IJKA 2XZPA 4MI1A 4AXBA 1OAOA 2UXBB 5DLDA 1XU7A 1N2CA 1Z4IA 2ZWVA 1Z06A 1QPGA 2F59A 2JGRA 5CVUA 2JGFA 5FA8A 4Y1RB 4C3VA 3N8IA 3C98A 1KTAA 4NYMR 4YMSA 4AF6A 4OJNA 4MPJA 3EZ7A 1I4TD 2VHUA 2R2AA 3AM5A 2VN8A 3IT1A 3GLUA 1CUVA 2HCBA 4L8FA 5K05A 1BS9A 1S3FA 3OQIB 4YIHA 1F2TB 1VI6A 1Y3IA 4Q3EA 3RS5A 1MQ9A 2AW3A 1VJ1A 3M70A 3U13A 1EIWA 3ZKAA 2OP1A 3V32A 3E81A 1W4LA 4PFKA 4B2PA 2GERA 4RQUA 2C2ZA 4HUQA 2FJPA 1YL6A 3H1FA 4G36A 4ED9A 2YWCA 4QQRA 1EB8A 3F6RA 1IY8A 3KXPA 3SXUB 4BX8A 5C81A 2GEKA 3BXGA 4G5GA 2JGKA 2R44A 4ZO7A 2PAFA 5EP2A 2IS2A 1UOPA 4R2KA 1GFSA 2CWDA 1AGNA 2OLJA 1HPLA 2RC5A 3EFOB 3IVXA 4CTKA 4EEXA 5IMSA 3W6ZA 4GBJA 1ABBA 3D64A 3S1AB 4TYNA 2GZDA 2ZPAA 2BDTA 3DFIA 3VA7A 1PVVA 3HCDA 4YJ3B 1GZSA 1G2WA 2EYUA 1W5TA 2VJMB 4DB2A 5KJCA 4KIUA 1RCFA 1CRQA 1DKOA 4R7ZA 1P5ZB 1SQ5A 2A9QA 4OQEA 3DAPA 4GEGA 5C2JB 3OMWA 3AY3A 1TXGA 3W8FA 1AO3A 3QYFA 5DIZA 2EL9A 2W5UA 4RHCA 2B8EA 4RMJA 3COVA 4MICA 3QHQA 4G37A 3JQEA 4UQOA 3C48A 2Y6VA 1DRJA 5LVAA 3KWJA 3LKDA 1L4MA 1YKFA 1ARZA 2QPLA 3FPCA 4RPHA 4F9GA 2JAQA 5BNZA 1L8OA 1A9ZA 3BFVA 3MT7A 1C14A 5CB0A 3CN7A 1YQEA 5AW2A 4K28A 4M37A 2PLRA 2K5UA 4BO6A 2FK2A 1D8AA 3EYYA 3K71B 1WS6A 2R1ZA 1RPZA 1LPMA 4GKJH 5JJIA 2TS1A 3EF3A 1OJLA 3W3ZB 4MPDA 2DBYA 1OIVA 1QBGA 2RGNA 1BD4A 2I5PO 3CRVA 3WKDA 1Z4NA 4KQHA 4BLVA 2Y05A 3GZNB 4RK1A 3SYNA 3UOGA 1XFAA 2XTZA 4HLDA 4CCSA 1PZFA 2YXBA 1JFVA 1YHZA 2E4YA 1HEYA 3SIWA 3ASUA 3E22A 3OVMA 1KMQA 3BTUA 2IXDA 4WXYB 4XSVA 3U49A 2QRUA 3R6GA 5IYBG 1R12A 5K3EA 3FWZA 2PGOA 1E4FT 3QLUC 3WLPA 1X70A 4RB3C 1R6AA 2GUWA 5FLMG 2ODAA 4MW5A 3WWIA 2C4WA 4IKOA 5E0KB 1TQ8A 4YJ2F 4DWVA 2Z57A 1KZYC 3ZYZA 1M34B 4MRVA 2C2KA 1HURA 1IL0A 2BJHA 2P0YA 3EGXB 3N0TA 2Q0HA 1AX9A 2XIQA 3BPSA 4BNUA 1Z62A 1FX0B 4LY6A 4X1YB 1M6VA 5L1JA 2IDJA 1DZIA 4K6GA 4NFYA 4TRNA 1YHNA 3OCWA 4UFOA 4WN9B 5CDTA 4PPGA 1ZNWA 2WIJA 4OAOA 2C9ZA 1GPH1 4KDEA 4DJDC 1U7WA 3A11A 3FSJX 4NFHA 4HRYA 2Q2UA 4H1VA 3F5MA 3AZPA 3HR4A 4KX3A 1ZN8A 3SI7A 1QZTA 1TYDE 1QWSA 4DR2H 1TNDA 1HQYE 1TF7A 4R7GA 1GN9A 3IELA 4BLPA 4J1TC 4UEQA 4Y2SA 2Q1XA 5JU6A 2GBIA 1XYGA 3GJRA 4Z8XA 1W73A 2M6SA 2QN7A 2XGGA 3IP5A 2BONA 4I50B 3NBXX 3S6JA 1E1MA 1KC3A 3EPHA 2GCPA 2P9JA 1R7RA 4CF5A 1EKVA 1PE0A 3VR6D 4ZVRA 3IG0A 1DDIA 2VNHA 5KTNA 1DAIA 5LDHA 4DZRA 3HJHA 5JVDF 2UZ1B 4X20B 1DX4A 1OZ0A 2NQTA 3B1VA 2CDRA 4G24A 4TYMA 3ZXYA 4E6EA 4DB4A 1UK9A 1Y1KE 2QTNA 1JNXX 2YX1A 5KG0A 4G84A 4R9UC 4D2IA 4WESB 1XJCA 4PFSA 4O4HB 4ZGWA 5B58C 1FVOA 4XX1A 3RS0A 1YZGA 4QNMA 4B3RH 1BHQ1 1ZHSA 2XTJA 4B6RA 2WAOA 4FZ5A 1S7GA 3A6ZA 3A4IA 3TO5A 3UT6A 3EPRA 2HG8A 2JW5A 1E5LA 1FK8A 1L7VC 1QH9A 1Z7GA 1OGIA 3L9WA 3L8MA 3MLBA 3NP7A 4YAKA 3GBPA 5EWMB 2PDAA 1AJEA 1XJ5A 4Z1OA 3C41J 5AVTA 5CB4A 3J7TA 4RGBA 3SC3A 2BFAA 5JADA 4XR9A 2FJUA 1K8RA 3H2IA 4ZT6A 3HXLA 1HLFA 5EYPA 4CDMA 2EJCA 1WDLA 5BQ3A 3B20A 3GBVA 4TRRA 5JQWA 1J49A 1G21A 4NBTA 3P4YA 1A48A 2G5CA 2JIBA 3RU2A 5BOSB 1UPCA 2YMPA 4IUYA 2OY0A 5AI8A 3QX7A 4Y6LA 1CNEA 4ZPJA 2YJNA 2HXYA 4YP3A 1EWTA 4RB0A 1FLAA 1E61A 1GYRA 3B3AA 4GXTA 4BC1A 2EIYA 4HB3A 1V4VA 5KDDA 5IF9A 3AR4A 4MUIA 4AJ9A 5LYJF 2PKCA 5JDCC 2HFKA 4P22A 4Y1GA 3D81A 1N1MA 4UE6A 3QLUA 3N2IA 4GMHA 5ECDA 1ZD9A 4V03A 2IEBA 3AUFA 2Q6TA 5EJAA 1ZMOA 5JY6A 2GPYA 5HRUA 2HY7A 2A1UA 5LDDC 4KLAA 1KA9H 1SZJG 2ZW9A 4Z9AA 5CAEA 1WKBA 1V16B 4NU8X 3NKFA 2P2NA 4GKAA 2HMAA 3UK7A 4EABA 4EW6A 1Z4PX 3ICCA 2FRDA 2IS1A 3OLCX 1Q2XA 2E4WA 3LGSA 4JUDX 1MXHA 2W2MA 3TZBA 4RVFA 5EUBA 4A3MG 2DR2A 2FG7C 4D81A 4E2FA 2FX2A 2CNNA 2BMDA 4BNDA 1HT1E 3KTAB 3CT4A 4K81B 2PFKA 4GX0A 4ZD6A 1RLOA 4R3UC 4W1SA 3USES 1O8CA 1ZMTA 4I5EA 1XIVA 2I2WA 3WAGA 2YMLA 3GJ7A 2L0XA 3ONEA 3DBIA 2GZ3A 3TNJA 1DL5A 5HQTA 1HGXA 2RJ3A 3MT0A 4POOA 4A6DA 2VK2A 5KOHA 1XXLA 3ETEA 3TRJA 3WQQA 1QX4A 2WAXA 4YR2A 3HFJA 4OMCA 2CYBA 1ZH4A 1CJCA 4DJAA 5GADl 1BGXT 1KZ9A 1M74A 3SVZA 1YBMA 2B1QA 1WY7A 5EIBD 4QGAA 1S01A 4ZAFA 1GP2A 4RHXA 2QXYA 1BMQA 2FEWB 3KE8A 3LC7O 2MMCA 5IX8A 5BWBA 3BRSA 1LV7A 4HH1A 4XZ3A 3CZ4A 3RC2A 1VA5A 4ESOA 4RIGA 3VVMA 2O5RA 4DSAA 1AS0A 1QAMA 2X7XA 5G0TA 2I91A 4IIHA 3O26A 2AH5A 3OQJA 4B3JA 4KR3A 4EY6A 1I2MA 1SMKA 1TPYA 2XGMA 3DZKA 3EVCA 2GFQA 2FXIA 3FOBA 5L1KA 3QMWA 1GPUA 4MEJA 2C35B 1XTBA 5CM8B 5HE9A 4DG8A 8ADHA 3L0CA 5J9FA 3HCWA 3OBBA 3ZZNA 3BH7A 3FGPA 4MO2A 1KARA 4JMPA 1NE7A 2JGJA 4W5HA 5EJ4A 5IYZA 2QXTA 3SHWA 3RB8A 4DMKA 3R3WA 3QIVA 5HKAA 2XA9A 3KSAC 3ESCA 3I6MA 4IJVA 3FXAA 1OI4A 4XWGA 1KORA 5T8KC 3OZXA 3ZHYA 4CETA 4TVKA 3PC8A 2ERYA 1BW9A 3T3DA 1T9CA 2HVRA 1KYQA 5JMWA 1SJ9A 1WQ1R 4FR2A 4FMCB 2WWWA 2YZ7A 4FSDA 1AZSC 1EVJA 2AN1A 3VZDA 3O3OB 4YMGA 3PN1A 1HQCA 3ENKA 3O2SB 5HF5A 2C2XA 5I7AA 2NP6A 3TS1A 4EY3A 1FYVA 4DLZA 1WDTA 2PUAA 5B6PA 2PUWA 3I4NG 2GO1A 4ZJUA 2IXAA 2PSHA 2YS6A 3QQPA 4KWHA 2ZM6H 2LKDA 1ZJWA 2BSQA 3HR7A 1AY0A 2Q5CA 3QTTA 1SOWA 2X4GA 3INTA 2G04A 4NG4A 1KZHA 1EHYA 3DW1X 4JLMA 4X7MA 4ZRNA 4FKZA 5IZCA 1M2HA 2D4HA 2NZVG 3AR7A 3WLQA 4CQJA 1SCJA 1E9VA 4RPGA 3RJMA 5JI2E 4NZ9A 4J0EA 2X0IA 3D54D 2GD0A 4GC5A 2B21A 2DJ5A 2G9VA 1IMOA 2DFLA 2MR6A 1WU8A 5CT8A 5JNRA 4CKEB 4BL5A 1H4QA 4IVPA 4G1CA 5SICE 2YHBA 2Y1EA 5AK3A 4QU5A 1HNXB 5KFSA 3BB4A 3PW2A 2XWBF 3WGKA 4JCCA 4DQLA 1X7DA 2QP9X 4HC4A 5DVZA 1KYYA 3Q2IA 5BNFA 1O8BA 1KDVA 1FP6A 3SY8A 1ILEA 3RLIA 1O75A 4DV7H 4XCXA 4HMOA 1L7XA 4K8OA 5KNBH 4KRGA 4N8DA 2DF8A 3ZWNA 4OI0A 3HBMA 4ITRC 2QN6A 4MWZA 2QU7A 4GMDA 2C8KA 2OFXA 4G0YA 1GN8A 4DR2B 3A31A 2A5JA 1ZUIA 1DCKA 3DQQA 4DLUA 2K4MA 1NQUA 5FD6A 3FI0A 3RRFA 2F3QA 1SXQA 2IU4A 3QXSA 4QO8A 1O7JA 2B83A 4NU6A 3AT1A 4OUKX 4YP6A 4HDMA 1HO3A 3VVCA 4PAOA 3R9WA 2ET6A 5B37A 3LG2A 4A3JG 3OIFA 5LP6F 1LDBA 3JAMA 4MOWA 4WZ6A 2BMWA 5CDFE 3OOEA 2NO0A 3S28A 4W5NA 4OO3A 4ERXA 1T8YA 1L7RA 2ZS9A 1U2EA 3OZGA 4PRYA 1JBEA 5FBKA 2HMVA 5BWUA 1ZCFA 3JTEA 3FJOA 2JGAA 1T9AA 5DI9A 2GNPA 2P1RA 1XTVA 1MB2A 1H0SA 3G2OA 2JGLA 1WXFA 4UEWA 2IYVA 5LB2A 4E3WA 4RJJA 3K6KA 1FOEB 4ERNA 1U90A 1PU2A 3H6GA 5C5DA 3FOCA 4NENA 4EF6A 3RS4A 4TYQA 4EYSA 4GQAA 3V00A 3WMXA 2EW8A 1XZLA 4TTJA 4Q3BA 4DN6A 2DU8A 4C7VA 4N5HX 2Q7DA 4Y1EA 1AXGA 4X65H 1QO0D 4TS4A 2HRRA 2UXCH 1GVHA 3FDIA 3UMSA 3V4ZA 1F6BA 3IUMA 1Y1WA 5I9IA 4CMCA 1D9XA 4Q9AA 1ZXBA 5FV4A 3ZXSA 3PEFA 3E22B 4I1IA 5DV9A 1NBMA 1BX3A 5EMHA 3LQQA 2ENUA 4YQZA 2FUCA 1KK3A 3UJ3X 4ZYVA 3I9V1 1UEIA 2RBEA 4KFCA 4RMGA 1NQTA 3C5EA 1PJTA 1F60A 5KHAA 4PCLA 1RYEA 3OZFA 1NA5A 4KEAA 4R7RA 3NYQA 1MDBA 3C6YA 4JQSA 5FULA 1RXCA 5TQ2B 3T5MA 2IYPA 3I6ZA 2Y0CA 1ZFNA 3ZCPA 1E2QA 3BULA 3CRNA 4Q9LA 3OQHA 3ZDQA 5CR5A 3JQDA 4FUTA 4OXYA 5JQGA 1POWA 2QE6A 4YR7A 2R62A 4K87A 3IERA 3IQHX 4JT8A 2JA7A 5AVXA 5EFOA 5KX5A 3MWEA 5K3SA 3N76A 4A2BA 4COOA 4BFCA 3B6EA 2PR2A 2VI5A 3EQ7A 4LVUA 2LUOA 1OFGA 2QZ9A 3C87A 3GRPA 3Q0EA 2K2QB 3HOVG 3N2ZB 5DCYA 4LSXA 2AD1A 4JJEA 1JH9A 3K0FA 4HDMB 1I8TA 1T35A 1UKBA 5KC8A 4DREA 3L7AA 3IRVA 2H1CA 3JYLA 2VDLB 3L3BA 4B3TB 4L27A 4M1ZA 1PGQA 2MSWA 1JVNA 2O2CA 2Y1CA 4G25A 4TT3D 3DE5X 3H04A 1E2HA 1WD7A 1D1SA 2QYTA 3OC6A 3UJ6A 1NV9A 3U19A 4GH5A 3D3JA 3L84A 3SF8B 1H22A 2M2IA 1F0NA 4TMKA 4EVRA 5F21A 3B3QA 2OK7A 1ZGGA 2M1ZA 3A70A 3H8SA 1EFRD 4FFPA 4JV0A 1QHSA 2QYHA 4BMSA 4BQIA 1GA6A 1HLGA 8ABPA 2ACVA 5KYKA 3MJVA 2FKNA 3H4BA 1K7YA 4PZAA 3OJFA 3EZLA 3E7XA 4W6QA 2O54A 1HNXH 2P6UA 1NN3A 1W6UA 2PLAA 3K20A 2DAPA 3THRA 4ENVA 2I9KA 2YY5A 3ZWCA 4V2IA 4B4VA 3SYLA 5DM2A 3TG2A 5AM3A 1PR6A 4TL8A 4XVUA 4WLFA 5CA0A 4CHGA 5LYJA 4FU0A 1VG8A 3BC1A 3K2BA 3R3UA 2WAQA 1CQZA 3GVCA 3Q6MA 2BCGY 4FMCF 1XF9A 5HIMA 1HWYA 1UEJA 3CSSA 3JVIA 4FDMA 2ASEA 1FF9A 1QH1A 1K97A 1XROA 1T1GA 3KSUA 1IZ8A 1B15A 3OCZA 4PG5A 4I4TA 4N7BA 5SY9A 3MHTA 3WGJA 5BWWA 4ARVA 3O90A 1IIRA 1DJNA 3QZ7A 1BZYA 4M1WA 5CDUA 3ICPA 4C14A 1PWZA 3IEPA 1AQ6A 5ALWA 5BOVA 3VC2A 1I2DA 1Z08A 4ABYA 4EK9A 5BN3B 5ITZA 1NDQA 1WUJS 3F1LA 4E07A 3Q7SA 4ZI3A 1L5FA 1SU4A 2B2CA 3IVRA 1WNFA 3LS2A 4C0JA 4C0AC 3K0CC 3PGJA 4JI3H 4L07A 4FJ1A 1BW9B 3RC3A 3ZXIA 4IQ0A 1O89A 1RS0A 2DECA 4DE5A 1P3DA 1QGZA 4TPKA 4AJ2A 4CR8A 3HKCA 4I8XA 2WU4A 3DPUA 4GP7A 2OLKA 5KG1A 4GYYA 3K8ZA 3WB9A 3ZDXB 4D6XA 3HU1A 3DYBA 1IIBA 2JRCA 3DBHB 4QVKA 4DJTA 4GKBA 5EOYA 1MIOB 2AXNA 1RXUA 4D6PA 4XYLA 5IVHA 2H0AA 2IUSA 2HK7A 1J07A 4L9WA 4E5KA 3UB2A 4I0WB 2HK6A 1W1UA 1G55A 4G4GA 4V1CI 2HC9A 5EIFA 2WNSA 3WGMA 3GH3A 3EULA 4Y6SA 3Q7PA 3G2QA 1HNWB 2PKYX 1A50B 2OZPA 4DW8A 1QO7A 4H60A 1I5RA 5ANRB 3ONDA 1FFYA 3LVQE 4BVHA 4OHUA 3QBVA 3CLTD 1Y1SA 1HI9A 1QUEA 2B8TA 1XL0A 2WLSA 3TRDA 3U3OA 3QEKA 2Z9BA 2VIIA 4B76A 2IS6A 4RH0A 4DR6H 2ID7A 2CVQA 3ZCRA 5EIHA 2R11A 3N39C 5DHRA 3ZHBA 3U37A 2NG1A 4BZPA 4UTXA 5ITWA 1LDNA 3GX1A 4NY1A 4OHWA 4XWAA 5GVRA 2RGAA 2J4FA 2PL1A 2R8EA 2I4TA 1RQLA 4HOYA 4LJAA 4IHAA 4CIBA 1D2NA 4G67A 2AZ4A 3K5WA 4AZSA 3FOWA 4LE0A 2OQ2A 1WBDA 5FYQA 1Y6JA 4C2AA 1SUSA 4GFDA 5J40A 4PZUA 2F48A 1QVAA 4FWBA 4KQWA 4L5AA 5HPYB 1U0OC 4QVIA 2X5KO 3PEWA 4DFDA 4LOJA 3X1DA 1WR2A 3M49A 2MYNA 4EFKA 2OO7A 4GOLD 4ZC8A 1W49A 2Y0PA 2I8LA 1A3GA 2FPPB 3T94A 1TCAA 3T5TA 4B85A 1QCDA 2I55A 2C98A 2FEKA 4MB2A 4W9RA 3DQZA 1UBJS 1KU6A 1XR3A 2WF7A 3LP5A 3VU9B 4B17A 2XC9A 2GX6A 1VI2A 4AQ7A 4YMIA 2R7ZG 1AKNA 1MKYA 5E4FA 3ZDEA 4YMVA 1YA4A 1WABA 1NNSA 4DCGA 3KZNA 3EYAA 3JQBA 4EPWA 1RM0A 2EXXA 4E4TA 1UIRA 2OZEA 2OGZA 2Q9CA 5LDGA 4CU2A 3KQNA 1EBBA 4GS5A 3AFOA 1RT9A 5JC8A 2H08A 3KXLA 1SKMA 3TUZC 2PM8A 2JRLA 3H99A 2E1RA 1DO2A 3FHCB 1O6BA 1OJ7A 4O59O 3RTAA 4N8EA 4YR0A 5TS3A 4ONEA 4O4HF 3WKBA 4LXUA 5BUSA 3K9QO 4OB8A 1Z4MA 5CVEA 1U9CA 3VPGA 3GLGA 4TX1A 1N9GA 4PG7A 2XSZD 3G13A 5FPQA 5CB4B 5KVAA 4JI7B 3EVBA 5DP2A 4BNWA 4DR3B 2IYSA 2Y1DA 4J9NA 5DU2A 4TMVA 2J7PA 3DOFA 1Z8NA 1I4OA 1LWNA 3GELA 3IIKA 4BUCA 5KFYA 1BVRA 1KO4A 1UJBA 4OXRA 3OPYI 4J16C 4X6UA 2Z02A 3G7UA 2XCAA 4P4GA 1QHIA 1H93A 1ZUNA 2C61A 1K5GA 3BDVA 4Y2YA 1NVVQ 2D00A 1N5IA 2CBZA 3VR3D 3I42A 3DEKA 3O93A 4MUKA 1M6WA 3TLEA 1OWPA 3TW6A 3TLMA 2VAMA 4EHIA 3T5HA 4N0PA 4XE5A 3KT6A 2A7XA 4QAJA 2PQ6A 1XHEA 2HHAA 3DLIA 3PW7A 4ILEA 3Q12A 4LVNA 4S24A 4ZOLB 5EJ7A 3QNWA 3EIQA 1ESZA 2CKDA 2AMFA 4EMSA 3OZIA 2HMYB 4PU0A 5IJ9A 4V38A 1YFLA 2H5JA 3SQXA 4TYYA 3H2ZA 3D7MA 3QU9A 2FLNA 3RIMA 3Q1KA 2FK1A 1RSZA 3PWTA 1YIOA 4ZALA 4BNMA 2OG2A 3T1HH 2PUJA 4IJ5A 5TJHA 1KSHA 2XVZA 4D97A 5AUPB 2BLNA 2QV0A 3FMGA 4CKCB 3M9XA 4XLTA 3WGLA 1J0CA 4YRKA 5TIIA 2X14A 3K4PA 3ZWMA 2AK2A 2A7QA 2FP4A 2PT5A 4MVYA 1XEXB 4RH1A 2HNKA 1DJOA 1OKKD 3QKWA 3LAWA 3FTPA 4FKBA 5DMHA 4AJKA 1JBKA 4XRRA 5ITVA 2JJMA 4LYJA 4IDHA 2X2PA 1ZU4A 2XDQA 1A0OA 3VDQA 1TD1A 2ONKA 1EESA 2CFRA 3RB3A 2ALZA 4O3RA 2WZBA 4LV8B 4QE3A 3EXEA 2WHQA 1NN5A 4XQ9A 2UYQA 3ZTWA 5K3BA 4PAWA 1GCIA 4BWSC 2CFTA 1ZM9A 2FW7A 1V1RA 4ZAWA 1GZVA 3WDSA 1P81A 4A2QA 4LH6A 4D8YA 1FUYB 3EGXA 1SIBE 1BHO1 1M7GA 2BFDB 4NXMH 4Q4HB 4DNPA 1XEAA 1DJPA 4X97A 2P9FA 2ZUCA 3HSSA 4M0FA 1S5PA 1RJ9A 3KK0A 4J0QA 4PICA 2AT1A 1NY5A 3K09C 5BWCA 3BIJA 4Q34A 3ELBA 1BEUB 1KE2A 2R87A 1ZK2A 3NBAA 3RSGA 2Z2YA 3CZCA 2Y4RA 3L6OO 4YROA 3CIOA 4AU1A 1J97A 1RIFA 1THTA 2Q7XA 2JEZA 3GAFA 3AIKA 1T0BA 3OH8A 3OZVA 5GJVC 4C4PA 1S4MA 3DJYA 4L75A 4PC1A 5MFPA 1DLJA 1KOLA 1K6EA 1Y1WG 5DTQA 3S99A 1H3EA 3WK6A 1IBLB 3BQ2A 2LBPA 5KFQA 4Q4AB 1P9RA 1XTUA 1TQ6A 4S1TA 1KJIA 4UW9A 3ZQJA 2QMEA 2IPLA 4YJDA 4NABA 1NLUA 1WCIA 2XDAA 5EKTA 4O25A 4NCJA 3LKBA 4KE6A 1GPLA 4BWGA 3IUNA 1BE1A 1F7UA 1GYPA 3BE8A 1X3SA 2PUBA 3O4RA 5C1BA 5HOEA 3PUIA 4MWEA 4AT1A 2X0SA 3I34X 4RZXA 4QGHA 1M76A 1RM4A 3E1GA 1IUOA 5EC8A 4EJ6A 4ZMRA 3D6MA 3L7NA 3QYPA 4LGYA 3RTDA 3TAXA 3CW9A 3P4UA 2YWVA 4UCRA 5GZ3A 4Q4DA 1DTWA 1JEEA 2P79A 1Y6FA 1DFIA 1GGVA 2AN5A 2I4NA 3SDZA 1BE6A 3OMXA 5BYJA 1T2EA 4OMFG 5PGMA 1RXVA 1YRBA 1VRVA 2PCLA 4DNFA 1SZPA 3QLEA 3UAXA 1N48A 1QOPB 3IMCA 1LBHA 2QJOA 2W93A 3HCNA 4IGIA 4DMCA 5EESA 2CV0A 4QG3A 3PE3A 3EHDA 2OAQ1 3GY0A 4LGVA 2ZBVA 5AKJA 1CHNA 4O7TA 1I1LA 1DDGA 4EI9A 1YS2X 4A0SA 3SJCA 1U9IA 3WFZA 4C6HA 2PL9A 1NMYA 4F72A 5H5JA 3JYNA 4OI1A 4B7CA 2BH9A 2G0AA 4F06A 3Q3HA 4MQFA 2QI9C 3GJXB 1U8EA 3EXFA 1A98A 2V4MA 2V6BA 4JP5A 5JCOA 3EEBA 3WYGA 4MK4A 2QL7A 2HU5A 1MPXA 2F9LA 4JT2A 4B40A 2OOSA 1K1QA 4LW8A 2O8DB 5BW5A 2HDHA 3LE8A 5JS8A 3QPVA 2OYRA 1YMQA 3ITNA 2GXAA 1F38A 4JVNA 3ZU5A 2B5WA 3FJ1A 3HXPA 3I9NA 4ZCPA 3OUUA 1DARA 4UCVA 2FPWA 3CNEA 3JQFA 1TL7C 3Q5EA 4L8GA 3BYZA 3K4QA 3AU9A 2NXCA 2RBKA 1M1YA 2MJLA 1E0SA 5IAKA 1H05A 1R4MB 4KYUA 1QKIA 2ZT8A 1W59A 1TAEA 1O95A 5CLFA 3C1OA 1XVUA 4JBXA 1BMTA 3IUJA 4P8RA 3QRWA 3CB4A 4M8KA 4X8MA 5K0LA 1O4VA 2AVDA 1DX6A 2X8LA 4MCIA 3RVOA 3WZLA 4JV2A 1AF4A 2A5GA 2FRXA 4JLVA 4ZVKA 4AY2A 3ANNA 2G72A 1LS1A 1F14A 4ECSA 3NTXA 4P3OA 1Y5NA 3TZEA 4LMYA 1JDUA 5K8JB 4KGVA 4AIIA 2YJZA 4QYIB 1GZ4A 3EXHA 3SBXA 3WVNA 4D0LB 4DRYA 5JJ5A 1YFKA 4XIIA 2VT2A 4DY4A 4WHMA 5D84A 1AQYA 1ORTA 4C6SA 4GX5A 1PFYA 4M86A 2BUCA 2JAUA 4WKNA 5F5XA 2IP4A 1XDZA 3ZY3A 5BR4A 3MCTA 5FOSA 3SZLA 4BYGA 1SOVA 4M53A 4NBLA 2HDKA 4UULA 2QL9A 1DTSA 1UMBA 1ZWKA 2DC1A 3CZPA 4XFJA 4EGSA 3K8OE 2B4KA 4L5YA 5EYPB 4DR1B 4QHTA 2JH8A 5LM3A 5JSYA 5FD8A 2B8WA 2WE6A 4B33A 2RHWA 5DGBA 2VPWA 3K6JA 3K9WA 4LJ6A 1XQVA 2FSSA 4HLUC 4OQXA 3VU8A 1F0YA 3RTEA 2IXGA 3DKPA 3REGA 3QKRB 3H5RA 1FXWA 5K0EA 1J8YF 1OCEA 3NAGA 5EWGA 3PC7A 4MMYB 3RASA 3EVDA 3I0ZA 4BB6A 2IHNA 2D7JA 1GG8A 3M1LA 3HBAA 3W2EA 1RPNA 4I7EA 1E5XA 1L5SA 4KI0A 4CG3A 2V6MA 3D4OA 4KJZA 4ZCTA 3RUPA 2O03A 2NZWA 1XXHB 2JCYA 3N8KA 2IYLD 1C81A 2PZGA 5FEMA 5IBQA 4BNLA 5COQA 3S7ZA 5C3EG 1UC9A 4KQFA 1CTQA 4DA4A 5H82A 1UMCB 1TA9A 2BKXA 2QZSA 3I76A 1SWVA 1WY5A 2JA5A 1Z39A 4DMUB 2P67A 4EB6B 4CM4A 2I2DA 3FX2A 4RVCA 4DLWA 3VM6A 1KSGA 4W7IA 2FG5A 3TOCA 2VH1A 1OWMA 2DH6A 4QUDA 4RIHA 3MR5A 5CFPA 3LMKA 3HHPA 2BN4A 1NZJA 2IYFA 2WPDD 2YOFA 4BAUA 1A72A 2H48A 2WE8A 3IPYA 1NC1A 4GUAA 4X45A 5LP6B 4OJQA 4ZARA 2QPAA 4AMUA 3N2GB 2COKA 1UUFA 3H5WA 5L3RA 4EB8A 3B7PA 5LMZA 5JJLA 3RBDA 3KT3A 2C3MA 2QNBA 4EHNA 6LDHA 1C1DA 1BMFD 1P7PA 2X8BA 5L53A 1KDRA 4AO8A 5P21A 3E15A 4MWOA 3EPIA 1CY1A 4P32A 4U1RA 2OFOA 5ETJA 5KFEA 4CKXA 4IOJA 5FL7A 7MHTA 3EIFA 3Q3CA 4REQA 5BRJA 3O94A 1YGYA 1BO6A 2QN3A 2IDZA 3EQ6A 1SXPA 1AKQA 1EA5A 5EWJA 4GMFA 5K0JA 2F55A 4YAUA 4B3CA 2LDXA 5THXA 5B1EA 1RYHA 2O2GA 4EJSA 4PWQA 1NFFA 2JZNA 1DC7A 1I3QA 1C29B 3ZWVA 4QM7A 3T5BA 3W6OA 5AVWA 4TQRA 2PXHA 3EG9A 3KOWA 4QJIA 4YP9A 4LXQA 1T5BA 4KUEA 3SX0A 4G5SA 2P7HA 2CB0A 3E0XA 2BGKA 5AM5A 4AZ0B 3QVUA 4M9RA 1IY2A 1LSUA 3I9MA 1BOFA 4N7JA 1EE1A 2XHZA 4I8DA 2H4ZA 1VLQA 2P3LA 2ZIXB 3ECAA 1OF1A 2X0NA 5EWFA 5AVYA 2W7TA 5DN9A 3I6BA 2AEFA 3QX8A 5IEBA 3SS8A 4DIFA 1VCHA 3R8CA 4TV9B 3R0XA 3LLSA 3AETB 2W57A 4ER5A 1H6AA 3ROQA 5HCUA 4BMZA 5BPFA 2C5LA 2NVWA 3KQHA 4C7OA 5AJXA 5E4TA 5CIQA 4YAJA 3GLTA 2FLKA 1UM9B 2JFGA 1GD1O 4JEMA 1LPOA 3A1WA 4FWTA 3ZD6A 4LFCH 1ZLXA 3LW8A 4MIYA 5LZ9A 2EZ9A 5EJ6A 2ZUVA 4G63A 4ARAA 3L6DA 2R4TA 1DG3A 3RHFA 3EG9B 1TLLA 2B82A 4XAQA 3N86A 2E4VA 1DV1A 4LQLA 4N5LA 4YLGA 1I4WA 4JGIA 4KREA 4H7EA 2ZSIA 2PVPA 3MAJA 4L15A 3VR4H 4UTZA 2CXPA 3AEXA 1G0OA 4BMPB 1WG8A 1HG1A 1RQPA 5AUNB 4KCGA 2HMTA 4V1CB 1C0KA 4ILKA 2PJUA 3ETGA 1R9JA 2O48X 4HYEA 2JDID 2ZITA 1IHDA 2O8EA 5LQKA 2P8JA 3PHHA 5G0WA 3PQ2A 2I6GA 3DDWA 2GLXA 3AJRA 3IYLW 4ZVOA 3WTBA 1JEQB 4BFWA 3I9JA 2GAAA 5TPZD 3ONFA 3CH4B 3GTPA 2P2CA 1VMEA 4TKVB 1PL8A 5CLLA 1DGSA 5CE8A 3K35A 1L4YA 1LXCA 1QR2A 3ZX4A 5I8WA 1A2BA 5HBRA 3VKWA 1DWPA 1Z6TA 4DUZB 4KFRA 3FHTA 4WLOA 2CUNA 4XJXA 2A1HA 4KWEA 1QAOA 2FNAA 3EIXA 3C14C 3FUCA 1G3UA 2C2YA 4GBED 4JYBA 4UHKA 1BKDR 3NIDB 2EHDA 5DP1A 1ORRA 3ZCTA 2QROA 3TY9A 2RDMA 4G0OA 1G42A 1PFGA 1DP4A 4WXMA 1VKNA 3ENZA 3OSPA 1PS9A 3NJRA 2QTMA 4E31A 1QRAA 1O54A 3CMMA 2RK3A 3NU1A 3O9MA 1KBLA 1GU1A 4HGNA 5GM2A 2X4LA 4DAOA 4DG5A 1VLLA 3RRXA 1AKTA 4TQAA 1XXHA 2Z04A 1U8UA 1Y4SA 2CDNA 1PNTA 4I55B 4R0NA 3K0AB 1RWWA 1TQ2A 2B1GA 4GMGA 4GR9A 4O3FA 2PMDA 3BK7A 4D3XA 3T0GA 4F9EA 1KO5A 5KFOA 5F3RA 4QWWA 5D5QA 4U5QA 2NZ2A 4Z3DA 3W2HA 2Y0SE 2BEVB 2DCMA 4D9BA 2IF0A 5BXQC 3WIUA 1Z0KA 4AO6A 3K7EA 3NGDA 1D4AA 1NC3A 621PA 4Q48A 2R8PA 4LYYA 5HZHA 2BPOA 4QLBA 3AF5A 4A16A 4V24A 1WCV1 4HLNA 1V8DA 5A3JA 3BA9A 5E9JA 5GJBA 1CXZA 2N42A 1Y7TA 3QTBA 2H2WA 3B60A 3SIRA 1GPKA 4ED3A 2A67A 2QJFA 1LQ2A 5IUKC 4RDHA 1EUQA 1WHTB 1XDDA 2CMHA 3RUHA 3WGVA 5LNK6 4L7QA 5DHSA 1GCOA 1QIIA 4ZI7F 3RGXA 1P5JA 5GY7A 5IXYA 2JLYA 2FFRA 4WA8A 5HXAA 3AXTA 2GD1O 3A9TA 5L3ZA 3VAZA 1VIYA 4WHXA 2AQ4A 4QC2A 4R41A 1BJKA 2O3JA 3PXCX 3VZRA 4CWAA 3KB1A 1XMIA 2AFIA 2QN9A 3PK0A 4FDAA 4IWYA 2AX4A 4A5SA 3RFUA 3M4IA 5E6UA 3X2EA 4DGQA 6Q21A 4OBBA 1D4FA 1KQFA 2WB2A 4NBNA 4OX9H 3GB8B 4H2DA 2OXIA 5FP0A 3T7JA 3V6HA 1DBVO 1A27A 4BBSG 3IIIA 4K0KH 2XKJE 3BGWA 5BUZA 3GDWA 1EVIA 1HDYA 2PHZA 3JQAD 1IFXA 1RLUA 1E6EA 1NFQA 1W88A 3B48A 3DP9A 3HDHA 2Q99A 4IRCA 4HNAA 4JODA 2PUHA 5ALDA 5F3DA 5IC5A 1VBKA 1T0PA 2XKBA 5K8CA 1O57A 1SC9A 1YDFA 2VA8A 4TN1A 5A7HA 3EMDA 3SICE 4BNNA 1TZMA 4J07A 1E3MA 3Q88A 1FMCA 3TSOA 5J2UA 1ACMA 2Z58A 3OFJA 3UW1A 3PPXA 1WMAA 3ZHUA 4AROA 2NM0A 4RUKA 1OBFO 3GZ4A 3GFPA 1VJDA 1TF2A 1F9AA 1YCGA 2CFOA 5EE1A 3KXKA 3BXOA 1QIGA 2D6FA 2YASA 5DLFA 1AKVA 2GQSA 1V6CA 3CY6A 3HOWG 3GV0A 2JEIA 2FWBA 1UBTS 1XQ9A 2OO5A 3FCSB 3GJYA 3P9RA 1XX6A 3Q2KA 2WFZA 2X6QA 3RVLA 2BKLA 2N47A 2VPZA 4FYXA 5DQIA 3MQFA 1M0SA 1N7IA 2D2EA 3N2KA 4C4SA 1JQEA 1KYZA 3DVAA 3FHOA 5JEDA 4FFMA 2L42A 4Z3KA 5DISB 4AG6A 4WZBE 1W8DA 1D6JA 1C0PA 1MX9A 1TCCA 2FMFA 3D7SA 4WVFA 4E4RA 3ZD7A 2XWQA 4BP9A 4EO4A 1EK2A 1U0LA 3MMSA 5HKBA 3KLMX 4G56A 2W6PA 4ZOLF 3DZCA 2JANA 2I0FA 1TCUA 3K9BA 4YJGA 2ODTX 1L8QA 1V1RB 5ALVA 2ZUUA 3TZHA 1UOQA 4ZVNA 5BV2P 3JQ8B 2BKAA 3U0GA 4C9BA 1DELA 1G0NA 3E03A 2FZEA 2O0MA 3F8TA 3EWNA 3GRRA 3W1BA 2YW2A 3OPXA 1LKZA 3BKXA 3SYTA 2EBWA 2I78A 3VH3A 1ONBA 3EK2A 3A0UA 2PQMA 4CT0A 4INOA 1KY5A 2VUMA 1WUHS 2EFCB 3G5AA 1RYSA 1W1WA 3G49A 3GEMA 4J9QA 3OZBA 2COUA 3P2MA 4N3AA 3WLMA 4C0WA 4C7JA 5DLQC 1NX6A 1NVFA 1UBRS 3HM2A 3M6LA 2JJQA 4PSUA 3V34A 3K9CA 2Y77A 1H9CA 2DWCA 2R93A 1ZH2A 4H3HB 4Z2AA 1C9EA 5T5QA 2FPIA 4XX0A 1OYWA 3W79A 3CBQA 3IIJA 5FAXA 1I4DD 2RAUA 3ZGNA 4LF8H 1S6YA 1OVMA 4A5OA 5JNWA 4OGKA 4FKMA 4PC7A 3BGSA 2WYHA 4W4TA 3A9WA 4KKVA 1KJ9A 1GRNA 1ZHFA 3SYMA 2GM4A 2AF4C 5I5EA 3RADC 4D4IA 2XH8A 4FQ7A 5KEIA 1NUHA 1VG0B 3NWJA 4J76A 4KNWA 5AK0A 1OWTA 5AKEA 2I7CA 1NF3A 1C9MA 1EP9A 4UHJA 3UPDA 1I1QB 1SKYB 4R8UA 2PZMA 2NN3C 4M3NA 4O08A 3RK0A 2QGZA 2ZEJA 3L92A 1SG6A 3IP9A 3JQAB 3P19A 3QQMA 1YHYA 1B43A 2G28A 1WF6A 4GW3A 1J0DA 4GM0A 4QTUB 2YCLA 4JQCA 5FTLA 3TGPA 2KS6A 4RMNA 4J0HA 1P1FA 4GSKA 4DCSA 3IR5A 1TOAA 3BS4A 1KO8A 2AMYA 2NZJA 3RB4A 1PGJA 2C03A 2ORVA 4JIGA 1YQ9A 4NH0A 4RY2A 1ZVVA 2JLQA 4KJXA 5CBPA 2WG2A 1UKZA 3Q10A 4DLKA 4RNOA 1INLA 3T3IA 4RF5A 2JHAA 3CZAA 2HN9A 2RC6A 3OP1A 4RPCA 1O1YA 1XLWA 2X41A 5E6RA 2GDJA 4DSTA 1R6VA 4RKWA 1HE8B 2P9ZA 4MVJH 2FOXA 2ZRFA 5L3QB 1FRZA 4Q9NA 2HDNB 4WEOA 2ACKA 1B76A 1YE3A 1Z6AA 3UY4A 2HT6A 5HBRB 3LPCA 1T8RA 2IHTA 3D1VA 4MRNA 1X8KA 2P91A 4AJJA 5HKKA 2EFJA 4IRKA 2OHHA 5LXTF 2C9OA 4J1TA 2GF0A 3KV1A 4N65A 1J2JA 3R8FA 1EUDA 1JEQA 2PRZA 2IEIA 5E7QA 2GBPA 4MAMA 5KCMA 1RM5A 1CWUA 3ITKA 4R8RA 3V7NA 2L18A 1QQ7A 5CJPA 1DB3A 2BGMA 2OXTA 3EOBI 5LL6b 2R85A 4FOSA 1ZRSA 5DLEA 3UKDA 2MT9A 4Y6OA 1ODFA 2HRBA 3CKKA 3E9MA 4HAXA 5F7OA 5FOTA 9ABPA 4HLCA 3MA0A 5ALFA 1N57A 5FWYA 3JZDA 1FB5A 1YBAA 1U28A 4GIBA 2JH9A 4HNGA 4PS1A 4HDRA 2D1QA 5EY5B 2KI5A 1WIWA 1ESEA 1HBJA 1N25A 1JHOA 1Z2DA 1M3SA 1S8OA 2G36A 2VNJA 3LT0A 2BHSA 4DXHA 3R7WB 2RI6A 1U4NA 4Q1AA 4QUEA 2EF1A 3LXUX 2A6PA 5ISMA 1XVAA 2LDBA 2OQIA 4HAYA 4ETMA 1W36D 4YI5A 3HB5X 4PAQA 4V0SA 2ZTLA 3CC8A 4PONA 2NUAB 1FQOA 4WMLA 5L7YA 5JLJA 2JEYA 2ZANA 2ZVQX 4FYMA 1FJ2A 4P3YA 2XCIA 3D7RA 1ZO8A 2QTAA 3BMNA 2QMOA 1T6YA 1PR5A 1VBHA 1ZM4A 5DM70 2WT4A 3MPOA 5EIAA 2Q41A 4CMAA 4C87A 2AI2A 2A0FA 4DLPA 4UOZA 4F5YA 1QRUA 1LUAA 3ROMA 1N8NA 2IDKA 2MWMA 3OTIA 3UT5A 4AZ3B 1PGOA 5E3JA 5IBCA 2WDTA 5L3VA 3QVXA 4FHDA 1XB2A 3H4MA 4XYGA 4IDAA 5KQPA 5A9SA 5BW6B 3VTZA 1QR6A 4D02A 2O8DA 2NO1A 1USUA 1ADCA 4N5DA 5K01A 5ALIA 1W2HA 2OA0A 4IPTA 4E6PA 1GAEO 5JYBA 4H9GA 1YCDA 3ZJYA 1AIPA 1N5LA 2XYQA 3IKJA 4ZO8A 3EIEA 3RWOA 2VQFB 1Y1QA 1RHJA 1EINA 3FMAA 2PLWA 1YB6A 2YQZA 4Q9IA 3QOWA 2FVXA 3UMJA 1A8UA 1GCGA 2ARKA 3OLZA 2HHJA 2GTHA 1R74A 1YXMA 3QEJA 3Q87B 1OAOC 1YI8A 2RCNA 3QJ5A 3HDYA 1XC7A 3WGZA 2GRUA 4O86A 3P5BA 2PS0A 3W4JA 5F7XA 2NU9B 3A25A 1X9IA 2VP3A 1C7IA 4Q18A 5HOQA 3E48A 4WOCA 3NT4A 5JUWA 4PF1A 5B2ZA 2CXSA 1TECE 4TKZA 4FBTA 2FQ1A 2P2DA 2X4DA 4GL4A 4HRVA 2Q0QA 4MUEA 3U7EB 4F1JA 4ZYLA 3N2GA 3R6DA 1A7UA 3ZCUA 1YTUA 5LOVA 1UBGA 4IOKA 2BZ0A 2J45A 3AKCA 1BDJA 2Z56A 1WUKS 1YZLA 4RABA 1FQWA 3WI7A 4M21A 4UREA 4B0PA 3WDKA 1JXQA 5CURA 3V1NA 2I4IA 3BG5A 2UYOA 3RU9A 1U3CA 2KLBA 4A0RA 1BQEA 3I53A 2JBWA 4YRCA 4TLAA 3CQZA 3VHLB 4Z1MD 2MSEB 2QTLA 5DKFA 4EO9A 5EZSA 3ZU3A 2PUDA 4E11A 3WWOA 4O6VA 5KO2A 3KBBA 1WUIS 2XBLA 5D00A 1G20A 2WZDA 4M0DA 4O4IA 3LY5A 3CWZA 5JBIA 1KIFA 2D8MA 3K5IA 3HKCB 2CUTA 4YPVA 1TYZA 2VPQA 1PJBA 2C4HA 2LD4A 4HEJA 4DNXA 5L45A 1POXA 1MD9A 1KBOA 1HZZA 5EJMA 3M9MB 1SCDA 5BWTA 1WXQA 4MV8A 1FDTA 4GBGA 4DIKA 3NEAA 3THYB 3ADKA 1FZTA 3UYYA 1E1CA 1NW7A 1P5RA 2IYWA 3U6BA 4FCWA 1MOPA 1NMXA 3CX4A 3EVFA 1RZRD 3H19A 4US1R 1KWGA 2EDCA 2QPTA 1M1ZA 2IV7A 4N5IX 4MQ4A 3OQPA 2K6GA 3JQ8A 3QEMA 3DT8A 4LRUA 1QQAA 1U7DA 3GJZA 2PX0A 3S2EA 1EE2A 1PFQA 4X6YA 3T0FA 3OCJA 5EMLA 4C0XA 3CR8A 4BP8A 3KYDA 4M2LA 1SU7A 3PEEA 5CDYA 1G8SA 4ZOCA 1GIAA 3KTAA 1DVRA 4OFZA 4Y2QA 3EGCA 5L4LA 2QHXA 3NBFA 2OBBA 3NC0B 2HL6A 5E3IA 1K5DA 3SNOA 4GZ5A 3L1IA 3RKRA 4A7PA 1J6UA 3L8DA 3BA8A 2Z6AA 2H8GA 1V3TA 3FVQA 2F8TA 4O2RA 3V7YA 3UAWA 4EI7A 2X13A 4BYMA 4QFBA 1VHDA 2BSAA 4OFXA 1CUFA 3BJIC 5PNTA 4G4JA 5EQDA 1MR3F 2AOUA 2ZB2A 3IAM6 5LA6F 2J3DA 1Y7PA 3ZY4A 4F3YA 3IMEA 2X1LA 3QKSA 4CLOB 2ZJ4A 1XD8A 4MVJA 1QG4A 1L4UA 2OHFA