3VPBA

Argx from sulfolobus tokodaii complexed with lysw/glu/adp/mg/zn/sulfate
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
281
structure length
281
Chain Sequence
MRVVLIVDIVRQEEKLIAKALEENKVQYDIINVAQEPLPFNKALGRYDVAIIRPVSMYRALYSSAVLEAAGVHTINSSDVINVCGDKILTYSKLYREGIPIPDSIIALSAEAALKAYEQRGFPLIDKPPIGSWGRLVSLIRDVFEGKTIIEHRELMGNSALKAHIVQEYIQYKGRDIRCIAIGEELLGCYARNIPPNEWRANVALGGTPSNIEVDEKLKETVVKAVSIVHGEFVSIDILEHPNKGYVVNELNDVPEFKGFMVATNINVAQKLVEYIKENYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative acetylornithine deacetylase
publication title Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Ligase
total genus 92
structure length 281
sequence length 281
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.16: Acetylornithine deacetylase.
pdb deposition date 2012-02-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08443 RimK RimK-like ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 3vpbA03
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 3vpbA02
3.40.50.20 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vpbA01
3MJFA 4J6EA 4EA7A 3K5HA 3SE7A 3OUZA 2CQYA 4EGQA 4MA5A 4MV4A 3TIGA 1DV2A 2ZDHA 3AW8A 3K5IA 4O7VA 4M98A 2W6QA 5HBRB 1CQIB 4YJ2F 3U54A 2FP4B 3WO1A 1DV1A 2VR1A 3Q1KA 5J2UF 3K3PA 4EGJA 2P0AA 1EHIA 2ZDGA 5D8DA 4O84A 3JRXA 1KJ8A 2DIKA 2FPPB 4FFPA 2R7NA 2NU6B 3U9SA 5J2TF 3WO0A 5LXTF 1M0TA 2DWCA 2R82A 3RFCA 5HV6A 1CQJB 2YZNA 4YJ3F 4O2AF 1KJ9A 2FB9A 4IWXA 2R87A 1AUXA 2R7MA 4FGRA 2FPIB 3HBLA 4FU0A 2YW2A 5IYZF 3VA7A 4HNTA 3QFFA 5LP6F 3TIIA 1IOVA 3U9TA 3E5NA 1GSHA 4O7SA 1GSAA 2R86A 5BMVF 2PVPA 5BPHA 1C30A 3ETHA 3GLKA 2VHEA 2DZDA 4GGMX 2R7LA 3WNZA 1GSOA 1KUTA 1JKJB 4M9CA 1M6VA 5JQGF 2C00A 2HJWA 2CNUA 2YRXA 2V58A 3N8DA 3RUPA 5JQWA 1C3OA 2R84A 3JZFA 1UC8A 1Z2OX 4O2BF 4MV7A 1ULZA 2GPSA 2VQDA 3BG5A 4I50F 5JVDF 2CZGA 2V59A 4FFMA 4O4JF 1KJQA 2GPWA 1DIKA 4XX0B 4TUYF 1PX2A 2YZGA 4YAKB 4O86A 4Y8VB 4O7WA 2XD4A 4O81A 1A9XA 3GIDA 4IHJF 4O83A 2PBZA 3AX6A 4FFNA 2YS7A 3I12A 2V5AA 4WD3A 1OBDA 4M99A 4XYLB 5KKNB 4C5AA 4MAMA 4DIMA 5FNVF 4EA8A 3V4ZA 1A48A 4MV6A 4O7TA 2XCLA 3DF7A 2NU9B 4EAAA 3N6RA 4FFOA 3R5FA 2NUAB 4EG0A 4IZOA 4QSHA 4HQ6A 4ZHQF 2W71A 1BNCA 1E4EB 1UC9A 3U55A 2OLSA 3VOTA 2W70A 4YB8B 1Z2NX 3BSWA 3TQTA 4MV9A 3ORQA 3VMMA 1OBGA 3ORRA 4RZQA 4FFRA 2R85A 3MWDA 2Z02A 4HNVA 1EZ1A 1CE8A 1KJIA 1KC7A 3OUUA 2W6MA 2VPQA 1W93A 4IIJF 1VBGA 5CA1F 5GONF 4ZI7F 2WYOA 3RV3A 4MV8A 5LA6F 3R23A 4O7YA 2YZLA 5CA0F 2IP4A 5CB4F 4FFLA 1KEEA 3MWEA 4YAJB 2YS6A 5JH7F 5LOVF 1B6SA 2SCUB 1IOWA 2DLNA 4E4TA 2W6OA 2QK4A 2I8CA 1AUVA 2W6ZA 4O4IF 1JLLB 4NYEA 4O4LF 4WBNF 4HR7A 4IWYA 3JZIA 4MV1A 3RV4A 2NU8B 2YRWA 2R6FA 3KAKA 1E4EA 2W6NA 1T36A 1KBLA 1M0WA 3ETJA 3LP8A 4ZQIA 3KALA 2NU7B 3UFXB 4O4HF 2I87A 3G8CA 2GQRA 5I47A 4I4TF 1CS0A 2CNVA 2NPOA 5EZYF 4ME6A 2Z04A 3V4SA 3KREA 5JVLA 3R5XA 2J9GA 4HNUA 1GLVA 4C5CA 3VPDA 4EABA 3VPBA 4TV8F 4MV3A 1EYZA 4O82A 2ZDQA 4TV9F 3VPCA 4O7RA 2QF7A 1SCUB 1BXRA 4FE2A 2GLTA 1GGOA 1I7NA 5LYJF 4O7LA 3HO8A 2W6PA 3LWBA 2PN1A 1EUCB 4O7NA 1KJJA 3NUAA 4XZ3B 5BPFA 3KAJA 3TINA 1VKZA 5K2MA 3TW6A 2I80A 3BFPA 4XYMB 4M9UA 2CNQA 1EUDB 2YL2A 3JRWA 5DMXA 5C1PA 4EA9A 3R5HA 1W96A 1Z2PX 5C8YF 2HGSA 3BSSA 3Q2OA 4ZOLF 1B6RA 3G8DA 2YZMA 5KX5F 2YWVA 4C5BA 1PK8A 3BSYA 5H80A 2GQSA 4O7ZA 4YBZB 2FPGB 4L1KA 5C1OA 2R7KA 5CAEB 4MA0A 1JDEA 1VBHA 1WR2A 4DLKA 3R9RA 3HB9A 4I55F 2YYAA 1JDBB 2X0SA 1I7LA
chains in the Genus database with same CATH superfamily
1XLWA 1ECPA 4JV5B 4ZI7B 4A8HA 3H11B 3VTFA 3OHSX 1JXLA 3ESYA 1MB4A 5JXJA 1PEDA 1E8NA 4YMVA 1U8YA 1IN4A 1SCQA 4GLWA 1MW9X 1IMJA 4YGYA 5JXHA 3LL4A 4DGSA 2ZB7A 1WRVA 3N70A 1X7DA 2ZDGA 1ECCA 5K0TA 3KLNA 3Q9NA 4UXJA 2QTBA 2WABA 3C1AA 3IDAA 3WG9A 4MHSA 2CF5A 4EX7A 1JLKA 3AHDA 5DAAA 4HFJA 1PJ4A 3BDAA 2FP3A 3QWUA 5EIXA 2QVZX 3ITNA 3GGOA 1OYOA 4W82A 2JGJA 4CR8A 1XCOA 1E2NA 5L1LA 1HGXA 5KVCA 1NSTA 1ODFA 4INPA 1QTRA 5EJ2A 2VHEA 1I1QB 3ICOA 4BC0A 3Q8XB 3WK5A 3NTQA 1YMUA 3UFXA 5HKOA 3BE8A 2I1VB 1KYVA 1X7XA 2LCQA 4WCFA 2V4RA 4HQKA 3H3JA 4BNXA 5LDDC 3BA1A 1IEQA 4ZJPA 2RHTA 1MGOA 2GN4A 2BAGA 1G64A 1WPXA 5SY9A 4E5YA 4TKVA 2INGX 1ZINA 5CVUA 4OQZA 5KWIA 3IPXA 3SXPA 5HKLA 2FUNB 1NBOA 3TX2A 2V6BA 2ZXFA 1ARZA 5LL6P 1Y1RA 2CBZA 3C97A 3CUTA 4A3DG 1Z0AA 3Q15C 1QBKC 5BR7A 1PWYE 1U4OA 3GEEA 1Y9ZA 2H4XA 2OC4A 3PR1A 3EIHA 1XZKA 1TF2A 3W4IA 2RARA 3BJIC 1Z07A 2H08A 4F06A 2WKPA 3Q8QB 5AWFC 3ZCXA 5HOQA 4F7WA 3TNYA 2D4AA 3ZI7A 2A9VA 4UFPA 4EYEA 1PW7A 2HYIC 1EIZA 3WGVA 3C48A 4CMIA 3D7MA 1SBCA 4UEOA 1T4CA 1L2ZA 3ZQ4A 4D74A 2VXOA 3HUEA 5TLSA 4IZHA 1P0MA 4HYQA 2FOXA 4J0GA 2GJ9A 2JIBA 3KR1A 4CMFA 3TIXB 2FRDC 2O5RA 1BXRB 2ZW9A 5E1OA 4EF5A 1ZCFA 2QRZA 5IKXA 4JLKA 4HYKA 2P5YA 2AR0A 2ZULA 1CUZA 2B21A 4BP9A 2K7FA 3ROEA 2EATA 1B6SA 3WJ1A 1Q95A 2IP2A 3QEMB 3DONA 1Z4QA 3ELUA 4BB5A 4U5XA 3SF0A 4NFSA 5BNZA 1RKUA 3G9ZA 2CDCA 5CVCA 4N6NA 4ALMA 3AFOA 1T94A 3SHOA 4C06A 1E7MA 4BX8A 1MUUA 3K20A 4E7OA 1ONNA 4BQPA 1KT8A 5CIWA 3PCXA 4K9PA 1TVKA 2C7BA 3A0UA 2JFXA 3N0WA 5I7AA 1N2SA 5A7GA 1EHCA 5G3YA 2ZB3A 4L6IA 5GM2A 1A4XA 4J0DA 2FMKA 3DEHA 3ZEIA 4PLPA 3EULA 3WWHA 5FTLA 1GO2A 3TPZA 4REQA 4HG2A 4HB0A 3G49A 1ZMRA 3HCAA 4XD2A 4TS9A 2RK3A 1IYEA 3NJRA 5IEBA 4CMJA 3IAM6 4GOOD 3TMYA 1JG2A 4K6GA 3GT0A 1M3SA 4LGCA 1J56A 5DM4A 2GAOA 5EJFA 4INAA 4QTYA 2FLVA 2R7KA 4QOIA 3VZRA 2JIZD 4EGFA 1RS0A 4MVJF 1DELA 4DUYB 2PGAA 3RT7A 2GN6A 3OSZA 3OPNA 4MV0A 2XNDD 2RHCA 2EJBA 3DP7A 5EZ6B 2OM2A 1F6DA 3IKMB 1MG5A 1R6DA 4KLAA 1HE8B 2WTNA 4YT4A 4UE6A 5EE0A 4J7UA 1PEYA 1WCWA 2VWHA 4I6JA 4WWHA 4NG5A 5COAA 1Z06A 4FLEA 1FXUA 4CLXA 4DQDA 1UADA 4FEAA 4MQUA 3MR6A 2ETVA 3NKLA 3E82A 3SLRA 3MR5A 4KXYA 4QOGA 2FKNA 4MVJG 3A2LA 4E5SA 3S5UA 2V0GA 4EEYA 2J7KA 1N2XA 1YJ8A 2O8BB 3KJNA 3N8KA 4BMYA 2JZCA 5CM9C 5CFZA 2H5EA 2YN4A 1P2VA 1EM8A 2LVBA 5CA1A 2IBSA 1X8JA 5DM0A 2I54A 2CXSA 1JIIA 1K8YB 4ZV9A 1G5RA 1G8JA 2BFEB 1UP4A 1KDPA 2NVBA 1T0HB 3U0VA 3ZE0B 1M7JA 4E6NA 3KWJA 3CINA 1N33B 5I9MA 4DMKA 1SELA 3FWKA 1SXJE 4F45A 4AT1A 2IBMA 4LW8A 2HIMA 4DM7A 3ED1A 4UOQA 3CNLA 5B3LA 2WD7B 3QJ5A 1XXHE 2OV2A 2P2GA 3S1LA 3F90A 4P92A 4ZKEA 3PPWA 4WW0A 3BQ2A 5J4LA 1C8KA 3T7TA 2F1KA 2OVBA 1N0WA 4FNMA 1JJIA 3UXMA 4FI3F 2JFQA 4WOKA 1CF9A 3UHJA 1M7BA 1G63A 2C2RA 3LXUX 2BONA 1LV7A 3HLTA 2YYYA 3N3AC 2IV3A 1P8LA 5BP7A 2QP4A 4DEVA 3IEKA 2FEXA 2JLYA 5D3QA 1WTCA 1Y5NA 3FAKA 3OX3A 3I64A 2FPLA 3OCXA 4I3GA 4AY3A 3GYGA 4U0KA 3RCBA 1BU8A 5HKAA 4WV3A 3NMUF 3NHZA 4RNDB 4MGEA 4Z99A 1K4YA 5ADHA 2D0OB 1L5MA 3PITA 1KOJA 2O2DA 3ER8A 1ZK4A 3E8MA 4H3VA 2WOJA 4ACAA 2HMUA 4TSFA 4NXNB 4WJLA 4E46A 3EGXA 3ZGYA 1N1GA 3ADOA 2TMYA 2BHSA 1P2FA 1N5OX 3QITA 3MJCA 4KQ6A 4BAGA 1L1FA 3IQZA 1F4LA 2IT1A 3I6BA 2F4VH 1RBYA 3EJ6A 1XMPA 1W93A 1ZUD1 1VI6A 2PH7A 1ICEA 3N40P 1L7XA 4ZPJA 2BFFB 2NNWB 3R24A 4EO7A 4JVLA 2ZPUA 2AXQA 4HT3B 1HLPA 5IG2A 3V2IA 1AQLA 2DAAA 2XDWA 3TXYA 3UAOA 1YFJA 1QK3A 3AUFA 3DMRA 1ZN2A 4QREA 4ZVPA 2R8JA 1B93A 4BY7G 1NASA 1Q0TA 2I8CA 3IAS6 5KG1A 1NKTA 4WBNF 3LBIA 3HVJA 3W05A 4HVCA 2VP3A 2OO7A 3HUDA 1X74A 1ODSA 1O6CA 1U2RA 4CTKA 1H4QA 3OQMA 4F4CA 1QHNA 4JJAA 4FINA 4V1CI 1I2DA 2I1QA 5KMGB 5C1DA 1ZVQA 2P5TB 3V4LA 4ND3A 1I2ZA 4GBGA 5JBIA 4S12A 4ROTA 4F46A 4PGFA 1BS2A 1NWHA 2EBWA 1YI0A 5TMEA 1VLHA 2HLDA 3F6PA 1DX4A 4MA4A 3HRHA 4A8JA 1BHO1 1ZK1A 1JDZA 4O59O 1Q74A 3DAFA 2VH5R 5EE1A 1E9CA 5BUCA 3BSSA 1IBMB 1Z5GA 4BNJA 2HAEA 1XMJA 2DU8A 4D26A 2QUBA 2ZM6B 1CZNA 4RMJA 3SEFA 5HNEA 1H2YA 2COEA 2Q50A 1A04A 2GTIA 1HFKA 3ZZUA 3G6YA 4ZMSA 1R0CA 1YKGA 1EP9A 2CNLA 2JAQA 3K9LA 1X7YB 3KOYA 3TPFA 3WFZA 1GPUA 5K8TA 2LZ0A 1PL6A 4IWNA 2XUAA 2Y2UA 3PSAA 2QRVB 5HBRB 2W48A 1AKQA 3LZDA 1WD7A 2QUJA 5BNFA 3U54A 1I6WA 4MRSA 1DV1A 4DBVO 2FPMA 1RXWA 3CLSD 4Y1FA 5DVZA 2HO5A 2Q0XA 4GE0A 4DLAA 4DDWA 1BJRE 2J0QA 3H20A 1I1OA 2QU7A 3DTVB 3SVLA 1EFRA 4GLBA 3VRHA 1QVWA 1M0TA 2XIJA 3H2JA 4DANA 2XDYA 4GQIA 5T41A 3B48A 2Z2ZA 2IUTA 5AJWA 4F9EA 5L1KA 5DTQA 3ZIAD 3C4VA 3RYCB 3L8DA 1TM4E 4YJFB 4M8LA 2WD8A 2QN7A 2ASEA 1GSHA 1FX0A 2IPLA 1REQB 2FWPA 2A4MA 4GL2A 3CNHA 3JTEA 3VGJA 4QRIA 3DT9A 4XKJA 3TLGA 3ND7A 2GM4A 1X7ZB 3D0QA 3MZ0A 2WJGA 2P6PA 3TTSA 2EL7A 2XMZA 3ZE9A 4J75A 2WYIA 2V96A 4Z3KA 3T41A 1ZU4A 3LUFA 3F8SA 4KBFA 4JUCA 2FLKA 3RTBA 2LV8A 5G0VA 4NBWA 5LMNB 5HKKD 4EFKA 1AV7A 4I55B 2PGLA 1QMPA 2OCDA 4IBOA 4EO4A 3PQ6A 1JZTA 1YB4A 2AOUA 3F67A 1KK1A 1K5DA 3MQFA 3TL3A 2KI5A 3K2IA 2XZTA 3G2KA 3AVWA 3E5RA 3KRTA 4XYLB 3MJEA 1HT0A 1I2CA 2XV1A 3LOQA 1NQOA 5LZ4A 4B8YA 4EA8A 2IC5A 4P32A 3AEZA 2H3EA 2QBYB 2NO1A 3OMLA 1MOPA 2G63A 3GIPA 3QELB 1QF9A 3JQAB 1XCLA 2BHRA 3B2EA 3HEBA 1V41E 5KFXA 3P0IA 2BEWA 3OLVA 3U26A 1F5SA 2C84A 4L08A 1D09A 1NR5A 4C2BA 2J6UA 1QB7A 4YV7A 5DNUA 1T1JA 5DYNA 4F56A 2O0LA 4F12A 1NX9A 4FFVA 2QN2A 1JBKA 1J25A 3EZFA 2YICA 5ENVA 5LMZA 2VUIB 1BCRB 5CNJA 1Y7HA 1ZWKA 3B3GA 6REQA 4F6RB 4ZI7F 5MFZA 3OCUA 1YMQA 2SBTA 3JATB 3MK31 4HK4A 3UF0A 3V1KA 4N1AA 1XFDA 1RYNA 5EIHA 3WLHA 3L6CA 4TQ9A 1E61A 4BEJA 3KUCA 1Z4IA 4TWAA 2ONKA 2OHVA 2VG8A 2NSHA 3B78A 4L16A 5KNDA 4RY9A 4JOQA 1M0WA 1X7GA 1HURA 2A58A 1G19A 1PTJA 2NUPA 5IHPA 2FFAA 1YI1A 4L28A 1WW2A 3R0ZA 1NT2A 2AG5A 1M1ZA 2JLXA 4B3HA 2RHGB 3EY4A 4LF4B 4HGYA 3R6LA 1ZMOA 4G1MB 3EDQA 1Z16A 1MQ9A 4O33A 1QGUB 2PY6A 4C22A 4QQRA 3E18A 3SICE 4P22A 3L0ZA 1A76A 1DKQA 4XYMB 2HQSA 1XN4A 1EUDB 2V6GA 2GFIA 1XAGA 2G40A 5IK2A 3J7AK 3NTVA 1TF5A 2F1OA 5LUBA 4W9NC 2NQTA 3BSYA 3ECAA 5BWUA 4AF6A 3DFKA 5L6LB 5J47A 3SM3A 1A9QA 3UAGA 2EQ5A 3RRBA 4XLLA 3TEKA 5L40A 3H1EA 3D6AA 4A2WA 3MB5A 1QGDA 2Z5FA 4TMFA 4G0PA 2QPTA 3IN5A 2NU9A 4XA8A 1L5ZA 4JI0H 3KR9A 4LOIA 3CN9A 3PICA 3Q88A 4EGQA 5AP9A 5CW1A 4JP2A 4RABA 3N2KB 4WUVA 1Q7CA 2X8JA 1GUBA 4O25A 1RVV1 2VWPA 3O2SB 1KQ3A 4Q9IA 3NTUA 3R3ZA 4JJ4A 3GGDA 5J5VA 2IDJA 4L8WB 5LQNA 4TMZA 3PEYA 3NHUA 1NVAA 3H8JA 2QVLA 2PMZE 1OT5A 4F2WA 2UXDH 3T5TA 1JDVA 2QLFA 4QUKA 1PSZA 3DNMA 2C2OA 4PLCA 5CVTA 2BELA 2GEDA 4LCJA 1L1RA 1G55A 2FEOA 1ZVVA 2OCBA 3DBHA 1PJQA 1AKMA 4BLRA 1EDEA 1FS6A 4CHIA 4LJ8A 4OM8A 3CXUA 3NC0C 2G5TA 1VSUA 2HA3A 2WUWE 2PGXA 5LLTA 4F9GA 3AXTA 4BO0A 3AR6A 3L6BA 4NMWA 1I14A 1YZGA 4A3IG 4YACA 1TTPB 3CZ9A 4P4GA 4TXJA 1X9GA 1T5DX 3VVMA 1JXOA 4IX9A 1UIRA 1KARA 1PAUA 3KELA 1TUIA 1EGMB 1D0IA 3VBEA 4NEGA 3X1KA 3UAXA 4RHFA 4JHXA 1DFHA 3SGIA 4P54A 3C5EA 5BNTA 3WSVA 2RG1A 5HCNA 1C3LA 4F5WA 1ZLYA 4RUCA 1S0UA 1I2MA 1P5RA 5FRDA 1ORHA 1V7QA 4KNVA 4FWTA 4Z9BA 1Q3HA 1TYBE 3BB3A 1XU9A 3KDSE 3M4IA 3M5CA 4C0JA 2VPSA 2C42A 3JASB 2R6CA 1X1BA 1HNZH 1G1MA 2NTEA 1T35A 3AKDA 4Y2SA 4RM2A 5HJ2A 1I4OA 4Z3DA 5KHAA 2LW7A 2YJZA 1NJ1A 1JJ7A 3WWYA 4KBYA 3GPIA 2O8EA 1TD9A 4LZNA 4EGCB 4JYAB 5B2EA 1NE7A 3EPJA 2DMRA 3KSZO 2UUCB 3K0FB 1V43A 4TXHA 5IPFA 1NYLA 4YMIA 1QCDA 3J81A 2N42A 1U9IA 2I3ZA 3M4YA 2RKOA 3T7SA 2WJ4A 4N18A 5TXGA 3VNNA 1DUVG 3EZ9A 3HKZA 4ZQCB 3KYDA 2EX4A 3JYPA 4OXIA 3L4EA 5DLDA 5EE3A 4RJIA 2KMLA 4PIPA 4JLMA 3EDRA 2ZSFA 3TUIC 5C37A 1H23A 4D6PA 4AYXA 5KYVA 2R11A 3O47A 5B1SA 4O1HA 5GQSA 4ETIA 2H0RA 2F43A 1VCHA 3CA8A 3NHRA 1B76A 4LI0A 1QX3A 4R0VA 4GOXA 2J6CA 3D0RA 4QU8A 3DE6X 2FPRA 5FPQA 3OO1A 4RTMA 1U2QA 4AP6A 1H6CA 5F9FA 2WJ6A 3QK7A 1JDJA 3WK9A 2F7SA 2CD7A 2QRHA 3CURA 4GX5A 2Z8ZA 4C5CA 5JJIA 4PANA 4LVOA 1GD1O 2A30A 1YXMA 4O82A 3HA2A 1XRPA 5IYBG 3BTUA 2C95A 4MDEA 5ALRA 3HYNA 4RZ2A 2PKQO 1O95D 3ZU3A 3FKJA 4NESA 1KOLA 1GQQA 4NS4A 4AF8A 3O26A 3Q8LA 3DLAA 5I5UA 4NWIA 3UAVA 1U2SA 3BBPA 4KHPB 1OTYA 2DOKA 2GARA 2D0PB 2HA2A 2XQGA 3ZLVA 1RWXA 4U7WA 2X5RA 1XCGB 2EKZA 3EQ8A 1PK8A 3E3AA 4DYDA 1CVLA 4FGWA 1C1YA 4A82A 2OK7A 5CAEB 1HKUA 5BQ3A 1HV8A 3BRWD 2NUBA 3L1IA 4PR0A 2OXEA 2QZZA 4PFJA 3NOXA 1U8EA 1S9DA 4CW7A 3O4RA 3KTOA 1SXIA 3OEEA 4ZFNA 3CXRA 3UA3A 2UVPA 2QQEA 2W2KB 5HOEA 4QFBA 2A5FA 3BWVA 3IAAA 2C5BA 3DHNA 5KB3A 2BD0A 3FMGA 2C78A 5D6OA 3IV7A 5E4TA 3OIDA 5LWQA 1J2YA 1SBIA 2D6FA 4I1SA 5F33A 4OI1A 4ISCA 4JP1A 5LD2B 1SC1A 3R0JA 1RACA 2BFCA 1S03G 4KLCA 4XRGA 2G28A 3HKEB 5EHZA 4FFPA 1Y1VG 5IM5A 3QPCA 5F78A 4QPPA 3GLIE 4OM7A 3NDIA 3UQZA 4K2HA 7AT1A 2IYSA 3GV8B 3QVUA 3MTAA 1GRCA 1ZJ5A 4RZSA 5TX7A 2C28A 5CT8A 4KI0A 1RXEA 4NCJA 4MV5A 4BN5A 5BR8H 5DGIA 1V71A 4KRXA 2IHYA 3RVDA 5C35A 4L5AA 4OYLA 5AI8A 3GLFB 2OFFA 3W7VA 3R7WA 1TTQB 4IJWA 3ZKAA 3ZHQA 1QUFA 1IY1A 4JLVA 3U7HB 2J5BA 1T3SA 4RHTA 1UC8A 3N07A 5TT1A 1IXKA 1PFGA 2JAHA 4QWCA 3BF8A 1UOEA 3FPCA 4YRMA 4XB2A 2C4VA 3W78A 4NVRA 3PEEA 4A3KG 1EKXA 1SCDA 4BQRA 2VH2A 4A0RA 4YA6A 2H57A 3DZKA 3EZXA 1YS1X 1AGPA 3R6TA 3PW5A 1T5OA 5BWLA 3KBOA 1L7RA 4EUEA 3IE1A 1P1RA 1YOBA 3BMQB 4V38A 4BZPA 4DIFA 4OKIA 3MBOA 2DQKA 4KH1A 4Z86A 4DV5B 1DS6A 3KO8A 5BN3A 5THQA 3AOEC 4X6YA 4DG8A 1QIGA 1JKFA 3F97A 3HY6A 5DN6A 5T5QA 1GT6A 4XYBA 2Q1XA 1NYQA 2WIFA 1W4ZA 3I5UA 2QGNA 2OESA 2QYSA 2IIBA 3PNMA 4JB0A 1FBTA 4XI9A 1TW2A 4EBEA 2D7CA 4NBKA 5IDVA 4ZDJA 1FFYA 4GYJA 1VCIA 4ZZIA 3IQWA 5D3MA 3IJPA 1TZKA 3KOZA 2OO5C 2W8LA 4C2MA 5BOSB 1I3OA 5FPHA 5KYGA 4MW1A 1SXJD 2B94A 4HWGA 2DERA 2AXPA 1I30A 4YN3A 4ZEOA 3E53A 3RS7A 2NZXA 3IBGA 3KL4A 1KVUA 2FN8A 4LJ9A 5AM0A 5KFWA 3BHMA 3DMTC 3ELYA 1ES9A 1R0KA 2JZOA 1VI2A 1G8AA 2QTGA 4K1LA 2XYGA 4BLSA 2P9FA 1MZVA 3S7TA 5HQJA 2Q3CA 3WOVA 3HWX1 4DLSA 3FB1A 1P7PA 4IV0A 1IXSB 5D1OB 3MHPA 4IMRA 3CG0A 1U6JA 4I50B 3BMCA 5C80A 2XR1A 4KK4A 4BNIA 5FUQA 4DCUA 1HF3A 3V9PA 3U81A 3C6YA 2XGQA 2X3FA 2IITA 4LSXA 4JOBA 2GZAA 2EIYA 1YS4A 1YA4A 2C3OA 5EERA 5CH5A 1E8MA 2LRHA 1CUIA 2QF7A 5IC6A 1FFAA 2WG0A 4YCAA 2VP5A 5LB4A 1OXBB 1IXRC 3QV1A 5IXYA 2OQIA 4TLAA 1HOTA 3KJHA 3D2LA 1RRGA 1XZQA 3R5HA 2GEBA 3NXSA 2JAPA 3HGQA 4ASUD 3BWMA 3M33A 4KN6A 4RVCA 1XNGA 1A77A 3AI7A 3DD1A 2ABWA 3TSYA 1W0JA 3LCJA 3C1UA 3W6OA 2E4WA 1DJNA 3PXAA 3L8ZA 1LSUA 3R9RA 2XZDA 2WHQA 4I55F 4CU5A 2ZRKA 4IIJB 5L4LA 2E37A 4JLAA 2AFIB 2QSJA 3ANNA 1ZNXA 2HJSA 3KYCA 2O8NA 1I1HA 3G2NA 2Q1YA 3I6YA 4CI9A 3QI7A 4RK6A 3IP7A 4ZO6A 1K63A 5FL7D 3HJUA 3W8FA 6PFKA 2YWHA 2W7PA 5F5XA 3E4CA 4FN5A 5FV4A 2EW1A 3IKJA 3QLVC 1B26A 5J4KA 1IEWA 3AF2A 1MQAA 3NBQA 5KYYA 1DQZA 3QUBA 4D4KA 1II9A 4XD7A 1ZGCA 1KO1A 4DR6B 5ALZA 5JNSA 1O96B 4AZTA 1Z0IA 3DVAB 2EJ3A 5G4LA 1H3NA 3MWLA 2M6LA 3RUIA 4KVGA 4KLNA 1BJTA 4Q3LA 4R8LA 1P1JA 3QP9A 2PDAA 2YWGA 2CXRA 3WB0A 4A3GG 3HS3A 3A6JA 1ZD8A 4CR6A 4Q1VA 1CDDA 5BMVF 4OFBA 2MCFA 1IWBB 4HX9A 3TEJA 3WB2A 4ND7A 4J1TA 3H7AA 3KSBC 5I7SA 1UKVY 2Y9MB 3PPIA 5BSUA 2ZI7A 3DZJA 2PL5A 1Z88A 3Q3HA 1RHRA 4NQZA 3ZYCA 3AETA 1A96A 1E79A 1QORA 1ZZEA 5EHGA 3PT5A 4IDFA 4BNUA 2FLWA 3OPYA 4O2RA 2GN1A 4X1YB 3RRXA 1BGXT 5IZ4A 5KFGA 2C4UA 1GRVA 1FJGB 2QD1A 1UOOA 4XPZA 1BKSB 3CIOA 5M3BA 3GA0A 5B1EA 2P4HX 3OAAD 3V1UA 1TUBA 3I45A 2R9VA 1G8FA 2JFOA 4ERXA 1OBDA 1SBYA 3FOZA 1EZ4A 3PUZA 1CRLA 4NLGA 5GOTA 4ZMBA 1B74A 1CY6A 1RFGE 4MQMA 2IYWA 3F8NA 5T4FA 4ZDKA 3ET4A 4PPNA 1JHRA 1X6VA 3D4PA 3M6WA 5KYUB 3W3ZB 3QMVA 4R5MA 4ZU6X 2CJWA 2SKCA 1VKRA 1DAFA 5DNVA 2VJKA 4QBFA 2IYOA 1J8VA 1UJ2A 1YC2A 2ZE8A 2WQ7A 1RWPA 3B8HA 3M6AA 3Q8KA 3ORRA 3HKBB 4FB4A 1V8OA 3D0KA 2VNAA 2FWRA 3WIVA 1AUOA 4FQ5A 1OFUA 1L5NA 4MICA 1D8AA 1RNLA 2BEVA 1HY3A 3WBFA 3CF6R 1RQNA 4EKDA 2Z0MA 1HT2E 3U5ZB 5AM2A 3GILA 2B7CA 2WSYB 2EFYA 4DLYA 5SYMA 3TQSA 5IASA 4XUDA 1W0KD 4YV1A 5KJ1A 2D5CA 1KDZA 2JFPA 4KQ1A 3VZQA 5K6TA 1BWRA 5D7NA 1F2DA 4LMAA 1E58A 3LA6A 4WESA 1QQ5A 5HHTA 2QY6A 4MQLA 3PFFA 3CRW1 4ZAWA 2XDAA 4QTTB 4CFSA 5EJAA 1I7PA 3RSLA 2OD9A 2F55A 2Q3MA 2GN9A 1VHLA 4RSHA 4IXMA 4WBNB 1XK5A 4U8GA 1A8IA 2QP9X 1E9AA 3OHPA 1QRTA 1D2NA 5HQTA 4PTLA 2OORC 2O5VA 4WXRA 2Q62A 2H3HA 2PG3A 4XFKA 4IKPA 3OOYA 3DZIA 4U5QA 4O7NA 5I3ZA 2I62A 1QKIA 3TIFA 1GLGA 2ADMA 5JFGA 4PBCA 3CVYA 3CNQS 1ZLXA 1EFLA 5CX4A 4MW2A 4Y6QA 1NN3A 4E5KA 5JAPA 3A14A 2R6R1 4GVXA 2CY0A 4MYSA 5JSYA 4MQ4A 1NVKA 5JJCA 5JNRA 3ZWWA 2C4NA 1GDTA 3W5OA 1WDKA 1NW9B 5JVDA 4KDCA 3OE7D 4U7FA 3C5WP 5DF1A 4AD8A 3RTEA 3ZE6A 1Z35A 5JYEA 3FOAA 3GLUA 2ZSAA 1F6WA 1OBOA 1WR2A 4O3OA 3EH2A 2C8KA 4ZCIA 5KDOA 4XSVA 4CTMA 2YCHA 5EGSA 2HK9A 1POWA 3S24A 2WIDA 4S1WA 3TTUA 1RWVA 3ECSA 3T7AA 5KFFA 1YRQA 1LVHA 3HOWG 1A2OA 1E2LA 2VYQA 5C31A 2AHOA 4F93B 4HNHA 4XQCA 3K3PA 1TJ5A 3EXIB 4IH4A 5EPOA 2IOFK 4N9QA 4EENA 2LTAA 2Z8YM 4EQ5A 2BFPA 3HJNA 1EK6A 1GPAA 4GNRA 1VYTA 5JIBA 1SUBA 3RRNA 1WULS 3QG1A 2IQ5A 2BBOA 1KP3A 3PVXA 1FJXA 4UDOA 2W9BA 4AS1A 3QHPA 2E5LH 2PYZA 1ZVJA 3NGLA 2JRCA 4B3TB 1KRXA 5AR1A 1NPYA 4PPQA 3SHVA 5KOIA 4K0RA 5BVGA 1FA9A 4BCCA 2FFRA 2Q2TA 1W0CA 5AW0A 5B12A 3BWYA 5K3FB 2D5AA 4N3NA 4F50A 2X5NA 2HHFA 1XAIA 2O5CA 3H0GG 1SUWA 1FRFS 4A26A 1Z74A 4CDNA 4O02B 4TTIA 2ZQZA 4UZEA 4QQKA 1SVIA 1BX0A 3AR5A 3QMMA 1J97A 4JT4A 2CYCA 3P0RA 3FIJA 4NZMA 4Q7EA 4URZR 4EF6A 3INGA 4O6VA 4OU4A 1N48A 1EXNA 2QRPA 3T1QA 2IUFA 2VXYA 5JUMA 4ZN6A 4Q9AA 4HWRA 2W2QA 2HOQA 3FGPA 1WMBA 4WXMA 5SZIA 2O2CA 2XMPA 3RJMA 1O03A 2GWRA 5AKIA 4V24A 4YYEA 5E3JA 2QG9A 5C4IA 2QLJA 3IHTA 1V4NA 4HQ6A 3KQMA 4ER7A 5DBEX 4JV1A 5CLGA 3AB8A 2DUMA 4R81A 2QUKA 2ZROA 1T36B 2BLNA 2DQYA 1Z5WA 3M0EA 4GKAA 2WQZA 4J9PA 1MQSA 1FZQA 1HMYA 2O14A 3X1JA 2XTJA 2WZBA 4MQ5A 3IJEB 1N5KA 3AEUA 3UMVA 1PSDA 1YDEA 4JR0A 1KTAA 4Z4HA 5FA5A 1TU4A 1DQNA 1JB1A 3SIPA 4ZAVA 2OCGA 4C9BA 1CQJA 2Q5EA 1NKVA 1OIWA 4KIFA 2FMAA 3I8SA 1AD2A 2IFTA 1DJQA 1DKPA 1MV5A 4QDTA 3IVMA 1Y89A 1W4LA 1E4EA 4C7VA 4JB2A 3O8RA 4COOA 1XCBA 2GD2A 4ZQIA 2RAPA 1T29A 1PK7A 4RDCA 4H4CA 1ZQ9A 1ODIA 1DGQA 2YKGA 4WXYB 5IT9A 3TO5A 3DMFA 4YT8A 2POQX 2DP4E 1JFTA 4YP6A 2I7TA 2R8BA 1BXZA 1CHNA 4CMCA 1KZ6A 4WACA 1PLKA 2HEIA 3T5HA 3SHQA 1GGOA 1V1MB 5J9FA 4LOKA 2YJ6A 2GM9A 3TOXA 5LZ7A 3EMBA 1ZW6A 3P9SA 1GCIA 4DCSA 1T5HX 2IEZA 1GFIA 2A5DA 1KY2A 4QL3A 3FWPA 4HRYA 5TEVA 4A3CG 3UJAA 2G1KA 3QNMA 2HJHA 1XNJA 3NWPA 5JS6A 1EPUA 3X2EA 3ZHZA 3NCHA 3QF4A 4ON9A 5FWYB 3W5HA 2H5JA 3EQZA 3AONB 4HDRA 5H8WA 4QTZA 3IBSA 3SKVA 3W2FA 1ZHOA 3KXIA 4M60A 1EGVB 1T9AA 3GTMA 4WZZA 3PRHA 2HWYA 3R7NA 3SE7A 3OKAA 3NEJA 3L9WA 1AMOA 1CR0A 3N2GA 4YRSA 5CA0B 5EIEA 5DYTA 1YSCA 3WAJA 4O7VA 3H2KA 2FWNA 1ISHA 4GR4A 1UF9A 4G23A 3HJHA 1XTRA 2ODTX 2D54A 3K8YA 1JMYA 3OETA 5MHTA 4IR1A 2BM1A 1Y1WA 4IHAA 4AMZA 5E38A 1SIWA 5LSAA 3TNJA 1IBKB 1H8HD 4ISBA 1TAUA 4ZC1A 3GTOA 3GIIA 1O54A 3VHXB 2XEDA 3FVRA 2VTKA 2YUTA 3I6IA 3MGGA 2VATA 3IIMA 3GQCA 4YCMA 3OQOA 2ORIA 1TK3A 3WGMA 5ANRB 3V3TA 1XELA 4URVR 5DSZA 3CPJB 4UEQA 2OVFA 2ZI6A 3EFEA 1JDNA 2AB0A 3KVNA 2UV8A 5BXQC 4KQ9A 2CHEA 3GRAA 1W36B 4HMQA 3PXBA 4E1AA 4YX9A 4X93A 1M76A 3UM9A 2XJ4A 3W9YA 1H1LB 4UM9D 1VSTA 4C2AA 5FAKA 2RDJA 8ABPA 1TAHA 2RCYA 4EL0A 4NABA 5TPZD 4H15A 4YFYA 4XSGA 5A5DA 1XZBA 2R6DA 4I50F 2HA4A 2ZI9A 4O1MA 3HZRA 2X2OA 4JVNA 5LM3A 3QA9A 4ZGBA 2ZUEA 4O86A 5BN5A 3ENZA 3RTGA 2YIJA 1HFWA 1ZG3A 4QO8A 1KPIA 2AZMA 2GPNA 3OE5A 4PCLA 1TAQA 3SQNA 1DQRA 4MR7B 1DC4A 4MCIA 1IEVA 1LDEA 4EBFA 2IOQA 5TEWA 4IVQA 4OQMA 2V7QA 1SWWA 1SVUA 1VHQA 3ND6A 4CMGA 4D0LB 1JT9A 2IHKA 3AWDA 1OWTA 2GZSA 5BQ5A 4UCTA 1UMKA 3B20A 1HYGA 4IIJF 1I3KA 4Z0TA 3KOXA 3VYSB 1Z82A 2VF7A 4G0QA 1JNYA 3THSA 1B73A 4MWZA 3GCGA 1Y34E 2VHQA 1NMEA 2QRNA 3IUYA 2OOSA 4BNDA 4FFLA 2WAQE 4ER6A 2GASA 5LLSA 4DRXB 1KNQA 5BN4B 1DDIA 3DA8A 3K0SA 5AI9A 4PYJA 5JDCA 3PC8C 3PDCA 1Z6TA 1PUJA 4TVBA 2ZR8A 1GHTA 3CN7A 4OQNA 2R8HA 5I7FA 5C34B 3T7DA 2DQ4A 4RQTA 4BVHA 5C7LO 4UTXA 3ZKWA 3FCCA 2UYQA 4H1HA 1W47A 5ICMA 3WB1A 2HT1A 3WADA 2VVTA 5B5SA 5C8ZA 4Q5IA 4LBYA 4QAQA 2E4AA 4LBWA 3PWSA 3PIDA 3KVYA 2AJDA 1KYXA 4R7GA 3IMKA 3MCTA 3DZBA 4BMCA 3OZFA 4MRMB 4Z2YA 1D1QA 1QO0D 1FDIA 1YHYA 4MQBA 1DC8A 3PX3A 3CZ4A 3DO5A 1Z34A 4HMOA 4GKJB 3D2CA 3U3OA 1B1CA 2Y0SE 2XY4A 2Z2YA 5IWAB 5K7SA 5BW5A 5DTJA 1VIAA 4A36A 4JBIA 2E7ZA 4O2BA 3Q0TA 1OSNA 3H5TA 1QG0A 2UZ1A 2YWVA 1IE3A 5IULC 3LUGA 5BWXA 4B2LA 2I6QA 3T0FA 3B1FA 2ZXUA 3HLYA 4PSCA 3K94A 2RB5A 3KKPA 3IE0A 4Z0NA 3L4SO 2JGDB 3VAZA 5GZ6A 1IQUA 2FGJA 2E4UA 2FFJA 1ZFNA 5H83A 3SFZA 5AFSA 3D3WB 1UBHS 4AG5A 3FPAA 3JWHA 3I72A 5DDIP 1GPYA 1E6UA 3O8BA 4I6GA 3ZWPA 3BXXA 2OLKA 4B3MB 2MSNA 2ZJ8A 4ZZ1A 3FDSA 4PYQA 2AUNA 2CV1A 1YK1A 2BZGA 2H11A 1T8WA 4GKKB 2VUSA 3OC0A 4EUKA 3F3MA 5KVSA 1RLIA 4G0NA 4YUYA 4UU1A 5F73A 5SYAA 3VR4D 4JFAA 2XKAA 5HV6A 2BCJQ 2HHAA 2X23A 3QYFA 1W87A 4TMVA 1DDOA 4OMUA 1U1EA 5IBCA 3FYUB 3RR2A 3OOEA 4M8SA 4AY2A 1CR6A 2YC2C 3A06A 3CVJA 2X2FA 4LV5B 3A7DA 5K8CA 2QLBA 4DM4A 1MVOA 4CN8A 2HH9A 3PEFA 4MWBA 1BFKA 1GG9A 2JI8A 5HS4A 1V1RA 3ETHA 3OESA 5AIBA 1H2WA 1N32B 3WNVA 1HPLA 3IEMA 3BWXA 2PWYA 4E12A 1ZSYA 4B6FA 2HPZA 1XZDA 4MI9A 2J5KA 1OYWA 1NXTA 1AG9A 2D59A 2F2TA 1KFJB 3WY9A 3G2HA 1C5KA 1H2RS 1GGJA 2V98A 4I4TA 4L4YA 2H16A 2OD7A 1K8QA 4P08A 3V34A 3JX9A 4CM4A 4YHBA 5I5WA 4EHLA 2DE0X 1ZJWA 4RY0A 3GV0A 2WQ6A 1FUIA 2O05A 2YMMA 3T6KA 4PGAA 1TC1A 1I24A 4I66A 2PMEA 4FC7A 2YVQA 1L1EA 3N2EA 2FH5B 2I2WA 2ZTVA 1LDBA 4P4UA 1N8NA 4FQ8A 2F9LA 3U7GA 1K5GA 2BKVA 2AEEA 1JTEA 1E32A 1A4UA 1NPTO 4YR0A 3LCVB 1KTIA 2PMCA 4JUBA 1HNWB 3ZCTA 1G9XA 5CM2Z 4EPVA 2NPFA 3PKJA 3PDJA 3VR2D 4L95C 2IH4A 2I4TA 4DY6A 1EINA 1U2EA 1Y4DE 3TR0A 2ZP1A 4DCPA 1SAYA 4ARZA 3WL7A 2WPDA 1OFGA 3C0KA 3CBGA 1C1HA 3PQ2A 1WOMA 3T34A 1Y6ZA 3AMVA 4D3FA 4B3BA 4MH0R 3GIKA 2HN9A 2XMQA 1F2UA 1WKBA 3H2IA 2YXEA 4DWOA 3C1TA 4C3ZA 1F3OA 3GFBA 2E55A 3TZEA 4MJ3A 2BRUA 4HWSA 5KTKA 4X20A 5FR9A 3K7EA 3MLAA 2FK7A 2IRWA 3ZE8A 2QUZA 3EVGA 1IBCA 2PD3A 3INTA 3T5GA 2O8DB 3G6XA 4WA8A 3WL3A 2ZS8A 3GK3A 2LNDA 3W3AH 1J1ZA 3KALA 3PW4A 2TSYB 1PNRA 1ZRNA 4CWAA 3UZBA 2HADA 1HYHA 4CMDA 5JR3A 2BQ3A 2WWGA 2C5SA 2BFAA 3PC7A 4GFDA 4RMHA 3FDJA 4FLFA 2NX2A 4WJKB 3MTGA 4LECA 4M83A 1QXSA 5CLHA 4ZYLA 5HJ7A 1MEEA 4YAWA 2EKPA 2YHIB 4JR1A 3CUUA 1GZVA 1FUEA 3W9UA 2AL7A 2QTMA 4C01A 3A3NA 1Z4NA 4PS1A 3KB2A 4M9UA 1NUUA 4GDMA 2QQ5A 3ILSA 5T14A 5AVZA 2PX5A 3AVOA 1M2OB 1I6LA 5ISMA 3THWA 4HBGA 5BSMA 4EJMA 3OI7A 4EIWA 1B6RA 3HWWA 2JI6A 1E5VA 4JL6A 4DIOA 1XC7A 1U0FA 4BX3A 2CCGA 2GPAA 9LDBA 1NVGA 2AEFA 4ZAGA 1X42A 5LQSA 4JLBA 1G2QA 2C9CA 4UCUA 2CVQA 4BFWA 2I6TA 4U1RA 3FCEA 4Q82A 3BHNA 4BRWA 2R1VB 3U1BA 2AQHA 5JSHA 3W3AD 1G2PA 3T99A 3I52A 1NTOA 3AW8A 2GAJA 4N6GA 3SGLA 1QF7A 3MWDB 4Q4HB 4MKFA 3K0AB 4FHDA 2A94A 3Q1KA 2YWXA 1OI4A 4CIYA 1KWGA 4UZFA 3WXBA 3WYAA 2X58A 3EISA 4MS3B 2ZWPA 4Q4CA 3UCXA 4WJZA 4I7HA 3ZDZB 3F3KA 4EHKA 4IIYA 3IYLW 2RHHA 5LN1A 1T2FA 1U11A 4N7RA 2YZNA 2P2NA 4UHDA 2HPAA 3SMVA 5FI1B 3RC2A 2E0IA 4I1VA 5AHRA 3K32A 4L5IA 5B1HA 4LVUA 3PVZA 2A86A 2VHYA 1Q1QA 3KHGA 3NAQA 1LF0A 3PDHA 5IT5A 3ZHXA 5K6RA 5I7OA 5LYJB 2CDRA 1NR7A 4Z7JA 1MR3F 3Q4GA 4E2WA 2GEVA 4IUCS 1FDRA 3BFXA 2P35A 3HR4A 1L4BA 4O5OA 1M6VA 2Y93A 5DGBA 4OBBA 4MWEA 5JV5A 2YXDA 4XWGA 5BMVB 2PZFA 1L1QA 3R4VA 4EEZA 3FUUA 4DA4A 1UJCA 2MSKA 5E9WA 5MFPA 3ZV7A 3DB1A 2J48A 3SOPA 4B74A 3TLMA 2YN0A 4GRIA 4JUDX 3BG5A 2PZMA 2CZGA 1EUCA 3I09A 1KY5A 3IPLA 1BW9B 2PXCA 4BTVA 4DR5H 1ENZA 3JQBC 4HLQB 4JP3A 2J09A 1KYWA 2W8KA 1YE5A 1A9XA 4EY6A 1J42A 3QWFA 3E15A 3SBOA 3D4BA 1WL8A 3AY7A 4Y6LA 3H6KA 5AHXA 3SS8A 3N41B 3V6LA 3GWZA 4FVTA 3CUYA 1U8UA 3FCUB 4AKGA 1E18A 3VPSA 1RXSA 4ZHQF 2HBYA 4NMXB 3HKZE 3CF0A 2M6SA 1XB2A 4F84A 2H5LA 4LIPD 4CIBA 5HIKA 4N76A 3O92A 4B0OA 4RZQA 4EPXA 1P44A 1XLTC 1CJKC 5E0OA 3CX6A 1CE8A 1XA0A 5ULLA 3ICEA 2ZGIA 1E2UA 1S1CA 1TU0A 3FDFA 4YT5A 3T9DA 1UEIA 1PJZA 3GEIA 3BJEA 3W34A 1O6ZA 3DEKA 4TLMB 3GARA 4A23A 4FILA 1BE1A 4IZ6A 3X1ZA 2JEIA 2IV7A 4UAVA 3SYKA 5CA0F 1LH0A 3WZ2A 2RK4A 5KAMA 4H9GA 5HTOA 3HOXG 1P2DA 4QGHA 3DNPA 5KFHA 2ZAIA 1ZOIA 2VF5X 4TQAA 3FNRA 3ENKA 1CEQA 1XNHA 4C1BA 4LZJA 4BHTA 3CX7A 2PZ8A 3IP1A 3Q9SA 4EHJA 1MJGM 1DDGA 3EIQA 2BKAA 4KXWA 4HMPA 4M21A 4C0AC 3AG6A 5IDYA 3ZNQA 4EI8A 3EIFA 3CLRD 2JLQA 4LTDA 3GDGA 2Z8YA 4HQ0A 4OFZA 2Q07A 1GQOA 2DPXA 3ONDA 2I55A 3DOCA 2WF5A 1P81A 3L05A 2VOBA 2BM0A 4GX2A 1YVPA 1E99A 4PWZA 5E9QA 2J9XB 1R0YA 2DFNA 4C20A 3Q0EA 1ETHA 2FSVC 3O4IA 4NZYA 1YA8A 4ZYUA 2P4SA 4X97A 4BTEA 4U2FA 4IJ6A 5T8KA 1GSIA 1JFSA 4JWTA 1TEZA 2BFDA 1Y3FE 3U4QB 2R8YA 1RKBA 2I91A 3K72B 3RD5A 3LY5A 3TLEA 3EW9A 4B4KA 2IPAB 2AQIA 1HG1A 2VJOA 4UBJA 5D1NA 2ZLBA 1GCGA 1ETUA 3U6KA 2CMKA 4ZT2A 4KN8A 1AQJA 4EFMA 1E1YA 4A4DA 3O74A 2EX0A 1YVRA 3LULA 4GP7A 3WQQA 3NBXX 3U62A 1XZCA 3RH0A 2B69A 1W75A 4MAAA 3TQCA 3FMOB 2NUAA 3PUKA 2GSDA 4QODA 4IDHA 2BSXA 5JI3E 1OU0A 2CF6A 4P31A 2XTAA 3X0DA 4E2YA 3EGDA 1PWEA 5BSEA 1ZNYA 4WOBA 4PHFA 4XR4A 3REGA 1BKYA 4DDTA 3NAGA 4PNPA 2DY0A 3P0JA 4EM6A 2AFRA 6NULA 3GOQA 3BQ9A 4M8IA 3NS7A 2R7AA 3QHQA 1EQUA 4IRCA 4ZYTA 4NSNA 2G70A 4HL6A 5IAKA 4R4JA 1XEWY 4F3NA 3E7FA 1GEEA 4KHZA 5LBUA 1BROA 3OD1A 4CT4B 2QG6A 5J4HA 5EQDA 4F4FA 4WZAE 3HNPA 4YJGB 5FOQA 3QPBA 4CKCB 1ZOOA 3WGJA 5C3MA 2HGXA 4F6LA 2V3CC 3HUUA 3JQQA 1ODTC 2P7HA 3BILA 4A93G 4DDMA 5AKJA 3CEBA 2XIQA 3HA5A 2B4QA 5LDGA 4RPCA 4EI2A 3T1YH 1DC7A 1DXYA 1D6JA 5K8JB 3VDNB 1JG4A 4W5NA 2FPKA 2FNAA 3QE3A 2BBTA 2B8TA 4L75A 4UFZA 3ZVNA 3KT8A 4DKJA 4BPRA 4AJ4A 2ZTSA 3DULA 2R84A 1JHPA 3D7SA 1VP3A 3AEYA 2XNSA 2KJQA 1BQEA 3K6SA 5C52B 3Q8PB 1G9SA 3QEKA 4M37A 3KYJB 2YZGA 2ZRJA 4OYYA 5I51A 3IVGA 3MWGA 4V0NA 3S55A 4TMKA 2RE8A 5EESA 1VXOA 2JH8A 2WNHA 4RIEA 2QN1A 4LRSB 2R3SA 3B6ZA 3VSAA 4BY1G 3EXG1 4JJEA 2PL1A 4RTKA 3HN6A 1FNDA 3VAAA 2C2XA 5IAAA 4IVNA 5C5DA 1WXWA 4HEA1 1LSJA 5C8YA 4QW8A 5JSQA 5AKYA 3Q7EA 2OHGA 5ALTA 1EVZA 4DHWA 1Z62A 4ECUA 2XUHA 3K6RA 5K3DA 2WLSA 2FHPA 2Q8QA 3CUVA 3KQVA 4HB4A 1XL1A 2DRIA 1J5EB 4DPKA 4NKRA 1O89A 3PE6A 2C2EA 1LCIA 4UKDA 4NR0A 1YBVA 2XCQA 4M55A 3WKBA 1EZ1A 2H2WA 3JAWB 3KBBA 1SOWA 3CJRA 3B9RA 4O4LA 4RU1A 3D5EA 5FH9A 2Y6VA 2XT6A 4Q4LA 3O7MA 2IXEA 2EDCA 3FWNA 2PBRA 1R66A 1R9JA 3VDXA 3OQIB 5BWWA 1SRRA 1OZAA 5I7RA 4Q6WA 1AGNA 3ROZA 1LPMA 1E9FA 5EZSA 5F1PA 2VPXA 1SUPA 1USUA 4MIOA 3NBYB 3I4CA 1ZXBA 4A92A 1CZLA 3DE4X 1CQPA 1J8FA 3QYPA 2IE0A 4CCSA 3DGFC 1UT5A 2BUBA 2O4CA 2XYHA 4IW3B 1C41A 4A3SA 4J9OA 3GQBA 5CFMA 3D9QX 1OR8A 2WUDA 2Q3DA 5TQ2B 2WWHA 1ZL0A 2WJVA 3OA0A 4I14A 1JEYA 3U4MA 3IOEA 4JQZA 1P7CA 5CB8A 4R1TA 3RVMA 1BA3A 3WC4A 1X1SA 1T8PA 1Q6YA 5G3ZA 4TSKA 4EQ6B 1EAYA 2RF4A 1T5LA 3HB5X 1XQXA 5H4HA 4YAKA 5C51B 2O20A 1DEKA 5T7BA 4OHBA 4M9QA 3EAQA 4NENB 2YHUA 3O21A 1P29A 1ZGAA 3LZ6A 4DDKA 1YFLA 5KYWB 2NU7A 3ONFA 1G2WA 2V55B 3SVZA 3K9CA 5CTAA 2N1MA 1Y5MA 4NZZA 2GI4A 2O2IA 5FI0B 4J6EA 4KGXA 2XRMA 5ICSA 4I1RA 3ZWKA 3LM8A 3AERA 5JAHA 3TQHA 2ZR7A 4TRRA 5KWSA 1HDOA 1P9OA 5DX8A 1QOZA 5M7EA 4OFXA 1BDHA 1W46A 4B83A 1EX6A 1V3UA 1TM7E 2JA5G 4GYKA 5L1IA 3RRJA 5TARA 1VC2A 4ZVSA 1DXQA 1UXHA 3EARA 3AUUA 3KXPA 4YRFA 1XYVA 3PENA 2P2LA 1SBZA 2IYRA 2R87A 1ZRSA 3MYYA 5BQPA 2O07A 3OCVA 3GB9A 4DV3H 5CLFA 5F9HA 3O1LA 4IQ0A 1CDEA 3D1LA 1KE2A 1QMGA 2FTKE 2ZVJA 4I99A 2AKYA 5LP1A 3JZAA 3VR3D 4MKIA 3MOSA 3QPDA 4UDXX 1ZKDA 1LV8A 4JYBA 1EVJA 3BCHA 3GEHA 2D0DA 3T12A 4Q05A 2CXPA 1C7QA 3I9JA 3RG8A 1O95C 4NU6A 2PCLA 13PKA 3HM2A 5KG5A 3JQ8A 3LSTA 1XD9A 4W7IA 2OZVA 4QIWE 4B3SH 5REQB 1KA9H 1YRLA 4CVNA 1LPBB 3L9XA 1EFRD 3T3NA 4P0PB 1I9GA 3QQMA 4EGAA 2FX2A 4NJOA 4I3FA 4C1NA 3DEAA 4CF6A 1GZDA 2Y71A 1EWTA 4DRYA 4BP3A 1SH7A 3HDVA 1RP1A 4NYIR 3RSSA 3KK0A 4GMHA 5AKKA 5G0SA 5G4KB 2J0SA 4QPCA 2JGLA 1NV9A 1Y7IA 2N0SA 821PA 3KKZA 1LRLA 1J5XA 4KR7A 3AR9A 3MSCA 3CFYA 1KRHA 2PKQP 3VH1A 3I73A 4DV2H 4EG8A 4LRTB 3SXUA 1O5TA 3IRVA 1KP9A 1Z63A 2R5FA 5CVDA 3KV3O 1ZI8A 2PGJA 1L7QA 2FEMA 1TQDA 4NS1A 4BS9A 1B6GA 1JR6A 2DKFA 2FF5A 4X60A 2CNDA 3M9MB 1OBGA 2N1BA 2VH1A 2W11A 5JAZA 1MA3A 1KZ9A 2PO5A 3HM9A 3IAXA 2V4ZA 4K9RA 3N53A 3GDHA 1E2IA 4AYTA 4YP3A 3GHHA 1TEVA 4ZT5A 1JF8A 4E22A 4HN4B 3GMDA 2H85A 2NNLD 1AO0A 3LYHA 4AY5A 3ZGZA 2PL9A 4CLDA 2W2XA 4O3SA 1A7KA 1U8XX 3P9PA 5BN1A 3U7QB 4HDKB 1PS9A 1Y0BA 4JD5A 2PTGA 5AKHA 2XMRA 1IB0A 3MINB 3AJDA 3WGZA 3ZHYA 1FMCA 4HSGA 4YMWA 1QE5A 4O2AA 2BTQB 2JIRA 2O1EA 1MAWA 2Y1FA 1WZNA 4GH5A 2PPLA 4HFNA 3AI3A 2H2HA 5EZYF 1C7EA 1XTPA 1KI9A 4QUBA 4OTZA 4BNVA 3NWBA 4KAXA 5EJ9A 2AUMA 2PMFA 3C5HA 4DBZA 4QU5A 1TQHA 4ZODA 4P7BA 1N8SA 5KFSA 2GPBA 1SMKA 1SCUB 3HBJA 5LYJF 2ZBEA 2YZ7A 1W5EA 1WUHS 1IZ8A 4U9HS 4J2OA 1CB0A 2J7PA 4ED2A 3IKLA 2H2DA 3NIBA 2WMOB 4BMNA 3DDCA 3RFVA 3F6SA 1OH8A 2WT8A 3H04A 1C50A 2GF9A 4L5JA 4MINA 1YJBA 1FRZA 1JHXA 4MW6A 1WDTA 1I5EA 1G42A 4YJHA 2D1FA 3KU1A 3OPYI 1PWXA 3O31A 3E35A 4FCTA 2GHTA 2FUG1 2X4IA 2ADOA 3NU1A 2C35B 5AJYA 2D06A 1X38A 1GILA 4O1IA 4ZGWA 2WAYA 3O38A 5JAOA 4YP0A 1ULHA 5CLIA 5HRUA 4JP8A 3C6BA 1U8AA 1SXJC 4FSDA 4DV6B 3FRIA 5E6SB 2W2TA 2PLFA 1M8KA 3DBLA 5ITZB 2FZVA 1V3QE 5A6SA 3AF5A 5KFUA 3IQDB 1OZFA 2H4ZA 5L3SA 2V5VA 3A36A 1CUXA 5ALMA 4JI8B 1F8UA 4JC4A 1S3FA 1OVMA 1CZUA 5IYCG 3MJ4A 3UT5A 2I6UA 4KE9A 1ZOSA 1AKNA 2IUUA 3OWOA 4L51A 2ERXA 1B8OA 4CL3A 3X3HA 1GKLA 2CHUA 721PA 2J3MA 4B2YA 2Y68A 4BFLA 4TL6A 1Q12A 4BN4A 1YUNA 3J7AC 3K0BA 4QYIB 2VJMA 2SICE 2JLUA 5AKGA 4JZKA 4BB0A 1YBAA 3GGSA 4ITVA 4DSOA 4L0CA 5F4BA 2AJLI 1C0IA 3H1GA 4URYR 4QPNA 2Q6LA 2V8OA 1Z8NA 5A6VA 1P75A 3P2MA 3SX0A 1ADGA 5FUBA 5K0EA 1X0VA 1U2ZA 4LYGA 4BX0A 3JQ7B 4IRXA 4ENVA 4HYTA 4I81A 4A0HA 4U7JA 2C3UA 4O3MA 1ZL2A 3GV5B 1QYIA 3L8CA 1MN6A 5ALHA 4FNOA 5KFNA 1L7VC 5B1YA 1HTWA 1KEWA 4DC9A 5SZKB 2CXUA 1JMVA 1G41A 2JJYA 3K0CA 3AT1A 3EY9A 1XWFA 5AJTA 1G6OA 4GOMD 1E2JA 3K96A 2XEXA 4P4SA 3NHAA 5MGBA 2GT1A 4UU7A 4EJSB 5JCOA 2JATA 4YQFA 5CVJA 3LS2A 1YKSA 3DWGA 4ZTBA 1W85A 4ZO8A 1GIAA 4IG4A 2GVDC 3EPKA 3W5IA 4MS1B 4ZIRA 1PR9A 2ZJOA 4IINA 1YIAA 5FFFA 3EXFB 3OUUA 4IXNA 1EUQA 3A6EA 9ABPA 4IGAA 1IATA 3V5NA 5GONF 1HE2A 2JLBA 2N46A 4UQPA 4PF1A 4J1NA 4H17A 2PFSA 3H8VA 4CEHB 5A5FA 5EMNA 2WTFA 3NH9A 3KC2A 2FW1A 2HRQA 4EO9A 2GZ1A 5EJGA 2GB4A 3WNBA 4QKQA 1J06A 5GTDA 3ZQJA 4BO8A 1I94H 3RVRA 3EPGA 2E49A 1D2HA 4K28A 2AYZA 1R6BX 1K9SA 1FYXA 4RS4A 3QG5A 2CDNA 1EUYA 3ELWA 1R5BA 1DZ3A 1CS0A 1QQAA 4WZ6A 3V8QA 1O0BA 3AP2A 4KL8S 1RDFA 1UAGA 2BR5A 3FBWA 1RM5A 1QP8A 2HVRA 4QRHA 4RY8A 5DISC 3V1TC 5CYFA 1QNFA 4O0MA 2QD2A 3ILXA 1DMRA 2NO0A 5JJ5A 2C5HA 4L4SA 1W1UA 5JD4A 2CXQA 2JGIA 5C1IA 2WAMA 1PW5A 1NP7A 4M1MA 1LZLA 2WTEA 3ZWXA 1Q20A 4JDUA 3EFOB 1TO1E 3CZ5A 2DQSA 4TOIA 2Y1WA 1QFZA 1V2HE 1S8NA 3EMKA 1COWA 1N2IA 1E6LA 5C1BA 3LOUA 4ESVA 2Q41A 2RB4A 4IHJA 2AOWA 3CTMA 4L3WA 3T0IA 2WRZA 4MJLA 4ER0A 5CNKA 3D4LA 3UY4A 3P27A 3DT8A 1ZOPA 2HG8A 1E3DA 4MYUA 3LGAA 1CU1A 4R5HA 4M98A 3WQHA 3DF9A 3K09A 1M2EA 2C9DA 3HHPA 4HFMA 1Y8QA 3DYIA 1LK7A 4AQDA 3UG6A 1QONA 4Q4JA 2Z83A 3QU4A 3PVSA 3C87A 2V54A 2A0FA 2HO4A 3VYVA 2D8AA 3BGVA 1HL7A 4R2HA 5PGMA 1XDBA 2A67A 2B4KA 2DWCA 5C18A 1A95A 5EFOA 4BEBA 3BK1A 5ECDA 1EFUA 3QFSA 1YQTA 1F2VA 4OD0A 1JB9A 2VRCA 4DJAA 1KEVA 1E77A 1H5NA 2X5XA 1XDDA 2QTFA 1U3UA 1D2GA 3H5RA 3RSQA 1TI7A 2Z43A 4X84A 1S96A 3FDIA 3RUDA 1T13A 2R7ZA 1TU3A 5E1DA 4B0PA 1ZUNB 2QV7A 1Z2AA 3E5MA 3N8DA 3WLPA 1OF1A 3GNTA 5JQWA 4U6PA 1U5CA 5KFLA 2IY7A 2PEYA 4UC0A 5KTMA 1U7TA 1WA5A 2OE2A 1EP2B 3PGA1 5JZVA 2CUKA 1PDOA 2ZSKA 5C5CA 4A0QA 5FHRA 1OVGA 4RH3A 1L8AA 1QU2A 1KDOA 3RVNA 1MJGA 5AK0A 1ML3A 3MN1A 1HLDA 4NBUA 1GWNA 3SP1A 1YHNA 1TM5E 4OHMA 1SK8A 2Q4EA 4E5VA 4L78A 1BMFA 2WBLC 4GO1A 4L8GA 3EGVA 3PQEA 3EZGA 2W7TA 3D3EA 3ND9A 1M74A 2BHLA 3H1TA 5H02A 4TKZA 4D8TA 1TM1E 1X0XA 4HS9A 1U2DC 4TLDA 4ZT6A 5DNYB 5KFQA 1T1SA 2HTFA 3KJZA 3IT1A 3HA7A 1GFWA 1OX4A 2J3DA 5LP6B 3LCCA 1YIOA 2VQFB 1IBLB 1OOEA 4ZHQB 1Y5RA 2W9CA 1AKUA 4PO8A 4TM7A 2A0XA 5LCXA 1LI7A 5JZ9A 8AT1A 3FKIA 2VPTA 3QLEA 3U6BA 3PRYA 2J5QA 2YOHA 1Y9JA 3PD0A 5JY1A 3ANYB 2J6HA 2FR0A 4EUHA 1H22A 2BJWA 3PO2G 4UEWA 3PYMA 4LSWA 2RIRA 2WOOA 4LQCA 4ND6A 2P9BA 4HVTA 3EUFA 3VU9B 2MMGA 3OPQA 1E3LA 3LUAA 1W4CA 4P5PA 2CUTA 2VZ8A 4LE0A 1W52X 5IMBA 1TYEB 1RIFA 2ECQA 3TXAA 3VC2A 1UZMA 1DWQA 5FJIA 2M6RA 1NF3A 4TRMA 1HDYA 1LLQA 2WC1A 3WIOA 2AOTA 5AMXA 3BPSA 3M49A 5DN6D 4KSCA 1DXOA 3MJHA 4K05A 1SUIA 4DV0H 3O2NA 3F6YA 3SZRA 4OI0A 4PIMA 1Z7BA 3M9LA 2QPAA 4E7PA 4JKIA 1A9OA 1GU0A 4HC4A 2GAFA 1ZCAA 1F9AA 1DG9A 2E4ZA 2ZDQA 1PN3A 2R8IA 2OV3A 2VUGA 2IYUA 4YO7A 1A97A 4XZ3B 2XA1A 1DAPA 3ADBA 4ZCLA 4KKXB 4PC1A 5LJLA 1O08A 3EWSA 3HR7A 2JC3A 3L4BC 3C7CB 1Z4PX 3GR6A 1WUKS 5KCZA 3TTXA 3P0HA 2REQB 3U4IA 4OP2A 1DUSA 4ZD6A 4DUPA 4ZT3A 3GCWA 4MUFA 1F0NA 3JQCA 3Q3VA 3EUWA 1S3SA 2IPNA 4ECXA 1JDEA 3PLRA 1D4AA 2P65A 5IARA 5A2QA 3QUTA 2L2QA 4KV9A 1SHJA 1UPFA 2CL5A 5C8DA 4K87A 4WH0A 1WJGA 1QB8A 1ORTA 5D3KA 1MAAA 5TPWB 1N2CA 4R1PA 1V5IA 4HEQA 2HIHA 4HCJA 4M6WA 2XVXA 3KAQA 5KAPA 1Z5OA 2XYQA 3GEMA 4K81B 2BKXA 2AN5A 2DKOA 2V7BA 4EYOA 1U99A 2HJGA 1C3OB 4M1ZA 2OKGA 2RBGA 2DWQA 4DADA 1NZJA 4TTQA 1VPDA 4TZTA 4V3BA 2OV1A 2O8FA 4I1PA 4AF7A 1GL9B 4GR5A 3F3SA 4QDKA 3J81W 4MDYA 4C14A 3UG7A 5J4YA 4JC5A 5AVWA 5TRTA 2H92A 1VRWA 1K66A 5AKLA 5CLQA 4BL5A 3VKHA 1U3FA 4EI7A 4WZBB 2ATVA 3BF7A 1ZNWA 5CM0A 4GS5A 1C1XB 2OEPA 5KNLA 5U4QA 2Y4OA 3LF1A 1G0OA 3CB2A 3DP9A 3X1YA 2D13A 2HCTA 3KB6A 1UXKA 1SU4A 2X7HA 3ZE7A 5TVGA 4IDNA 2W7OA 5DGAA 5DULA 3HP4A 4UMDA 1G4UR 3A1DA 4R68A 4MQEB 3JAMA 4DQ0A 1ABEA 3AR2A 1SXQA 3RNOA 3UGKA 1EFPB 3TN7A 2J5RA 4UHHA 3FNFA 1DZIA 4ER3A 4CEJB 5A02A 1GTVA 4F4DA 4J0HA 2XQJA 3VAYA 4GI5A 1IDN1 1CJSA 1NDUA 1RT9A 3OLYA 4PV7A 3F8TA 3VH3A 3UHOA 4XX0B 4LMYA 1AS0A 3N7AA 1M34A 2PUGA 3MGKA 4CHTA 4LNHA 2HDNB 3UJ3X 3K73O 4XJSA 5KKAA 4IDOA 5E3HA 5DT2A 4X64B 4UBLA 3N0VA 3FF1A 3WKEA 3EAGA 2M1ZA 3FOWA 6ADHA 4Y6GB 4FD2A 4ZVKA 3N59A 3WWPA 1PJSA 1DEAA 2XXJA 2QUAA 4B6RA 5ERXA 1LJ8A 3KFXA 1EX9A 4GI7A 1NXOA 3JTMA 2Q0QA 4HTFA 2O2EA 3BQ0A 3T5PA 3VR4H 4LH6A 4ALJA 5A7HA 1ESZA 2K2QB 3FDZA 1OGYA 4N3CA 1J70A 1P7ZA 3GDEA 1NI3A 3E4DA 4N8DA 3GLSA 3MD9A 3GTJA 4XDYA 1E79D 2IKSA 3NUQA 5ELXA 4P4NA 1VBGA 1VLLA 1XI2A 1XD2B 4FEYA 1QG4A 2XGMA 2PBLA 2RGGA 2A7XA 4G5OA 2GS9A 2J0EA 1EJ6A 4L73A 2UZIR 2WWRA 4J8PA 2W6OA 1ORVA 2J31A 3I32A 3W6UA 5KTTA 3KKEA 4LBVA 1IPFA 1OAOC 3S2GA 1NVVQ 4IQ4A 2QSYA 2JGNA 1TVMA 4AO6A 4QDXA 3U3JA 2FW8A 4B3GA 5FDFA 2XH8A 2X14A 1S5PA 5FPTA 1NJFA 3ZJ5A 4J07A 2D5BA 3JZ6A 1JPNA 3IPRA 9MHTA 2X2PA 4Z7QB 1USWA 4Z7OB 3LMKA 1ZM4A 4D82A 4HSEA 2FG6C 4TRNA 2R65A 1YONA 5IH7A 2RHRA 1L4LA 1KJJA 4RTRA 4IILA 4BDTA 1WF6A 3Q0IA 1M6HA 2QMUA 1JH9A 3VO2A 1E9RA 3H87A 5CEFA 1JKMA 4ZOLF 2YJ4A 1NONA 2PLNA 3PHIA 4F97A 5KFTA 1W9HA 4NXMB 4FT4A 4XWYA 2WIGA 4B6PA 4HEHA 3AEKA 3NTLA 4NG4A 1NXWA 4JSRA 4MWCA 3MXOA 3CT4A 2QVXX 4KXVA 3AWIA 3RYIB 3DAHA 4BO9A 4WAUA 1I7LA 3OCZA 2QL6A 1ZAYA 4DLRA 4EA7A 4MSUA 5BWMA 5FPYA 1VLQA 4KFSA 1QH8B 5AESA 4N3BA 2A5LA 1SC3A 1M8FA 5HVNA 1V5FA 4HX5A 1HDXA 1JE0A 3OTQA 3E7WA 4EVSA 1UFVA 3AFNA 1P9LA 1KK3A 1PU2A 2XNJA 3BE5A 4BFUA 4GEGA 4PX3A 3ADDA 1A8SA 2H4JA 2VQ6A 1N1DA 2ONCA 1G5HA 1QTIA 4R7TA 4XSHA 2XB6A 2G88A 2EG9A 1CUDA 2IGTA 3GC6A 4AUKA 3LVQE 2C4WA 3KPWA 1YCDA 5L3VA 2P27A 4MGYR 4ZYVA 2FQYA 1IONA 1VBKA 1RAFA 2IDZA 3RFXA 4H60A 4KU4A 4YQZA 4KSBA 2P1DA 5IKEA 3U44A 2ZJ3A 3GRYA 3LHDA 4Y1GA 2XA9A 3DC7A 3JQPA 3A4YA 4J16A 1FDVA 3WWZA 3QRWA 3B3FA 1LI5A 1TTHA 4MGZR 4TVSA 3R9WA 4O4IA 2X1VA 2Q0HA 3N58A 5DCLA 1A0OA 3WAGA 1FMTA 2I29A 4BVBA 4GZ5A 1UP6A 2RHMA 1X1CA 3DJFA 4JROA 4F1KA 1SYXB 4RQUA 2I8AA 3O84A 3LRXA 3SDZA 1XJCA 2G4CA 1RC0A 2ZUCA 2V59A 4MPRA 5F5LA 1AHNA 3REOA 5FBRB 5DNWA 4K9MA 2VDWA 1PNTA 4LRXA 3L0OA 2TMKA 1XDSA 4NF2A 2YNMA 4N54A 2HHLA 2Q3HA 5FLXA 1RZUA 4G5RA 5ALFA 2Q5CA 1XHLA 1T3TA 3BREA 1R6XA 1C9KA 4BB9A 3QZ8A 1CWUA 3EXAA 2PUHA 5J2UB 5IX8A 1K6IA 2J9RA 4HLUC 1JXAA 3SFTA 1MEOA 3QGMA 1M66A 4EHIA 1PG0A 4L3OA 3MRTA 5B1IA 2Q5IA 1W88A 1UM9A 2I4IA 1XFAA 1F0PA 3HJTA 2BGRA 2ZVQX 2J3HA 4EYHB 2ODAA 1G5FA 2G1AA 4PYOA 3VMMA 2M05A 3ZZMA 4JBLA 4UCWA 1CULC 5AVQA 1V1JA 3E3OA 2CDBA 2EKLA 4XASA 2IHJA 1UBOS 4BEWA 3U17A 4UXHA 4UPEA 1U0GA 3H05A 2YYSA 1NNSA 3DCNA 1UJMA 3LLUA 2J3EA 1Y3CE 1YU9A 2H0QA 4GLOA 4WK6A 1RABA 4JI2H 5K3BA 3WHKA 2MDTA 3NBZC 4QATA 2PNFA 1TNDA 2OR3A 4CLOB 4TKUA 5KU7A 3JR3A 3CUWA 1GPKA 1FFXA 2B8WA 4BGVA 4Z8YA 4NOKA 2W4MA 3KLOA 3I3OA 5JAMA 1FDWA 1N5MA 1DRKA 3SLGA 3UJBA 5DHSA 4N0QA 2IK8A 4UUAA 3FSEA 3HYRA 2A92A 2A35A 3GGGA 2C4KA 2XKBA 3M6MD 3BK7A 1H2AS 1ZRHA 5DWVA 3C8DA 2W6PA 5EZYB 1BC5A 2C94A 3AJRA 3FCAA 4UCSA 1ISMA 5E7IA 3CPSA 2FI1A 3T7CA 4OB7A 1JSZA 3WE7A 4QM7A 5IJXA 3S44A 4ECEA 3LPAA 1ZD1A 1V8DA 3O1IC 4UNNA 3R3VA 1A4IA 5B64A 3L0YA 5A9SA 5CVEA 1P33A 2CLDX 2Q4RA 3K1YA 1RHMA 3AK4A 3BYZA 1DRVA 3E2PA 3V1YA 4AN4A 4HS4A 2BDEA 4ZK2A 1B04A 2EKDA 3VSEA 3KD2A 5EP2A 1Y8AA 2OCKA 4NPAA 3K5HA 4MNTA 5FYDA 5IXSA 1B33N 1HC7A 4BC1A 3QPUA 3REQA 1KWKA 4TYWA 3EJWA 3FYDA 3SF8B 4QLOA 5KSPA 1N7GA 3QXJA 1KI1A 1D1TA 4ZYWA 2Q9AA 3BWBA 3T06B 4Y3UA 1XR3A 4HUQA 4AWXA 4HYYA 2CYBA 3ACCA 4RE6A 1WLSA 3T1OA 4RGVA 3CUKA 2F67A 5KFYA 3OQ1A 1U4NA 4BLWA 2OBLA 1J39A 3AV3A 3DDUA 1EK5A 4PE5B 2O59A 4GZ6A 3PE4A 3JQGB 1OQAA 1JL3A 1T34A 3P97A 1IOZA 3EVFA 2EF0A 1XZEA 4C6RA 4HRVA 5LP6F 2C9ZA 2H00A 2OFPA 2AJBA 5TJHA 1JYSA 3ZDDA 1JIHA 4O7SA 3C3XA 1ZIPA 1G38A 3RJ5A 3CLSC 3R74A 4Q39A 2EZ8A 4B1FA 2QT0A 2AMVA 5JXIA 5JAUA 5D3ZA 4EYKA 5EJ6A 2QN8A 1QANA 4JI4H 4QOSA 2ZRIA 3UVEA 1NZFA 2ZBQA 4G1EB 3DE0X 5L9XA 2ZRAA 1P0PA 3LXMA 3SYLA 2VQ3A 1GUZA 2V7VA 4FHGA 1Z2OX 1P5HA 4CQLA 2BWJA 3OCJA 3IFSA 1G8PA 1CK4A 4QDUA 3HXTA 3FBTA 4XFJA 1LDNA 1RYFA 1E9SA 2C99A 5TB5A 1FU8A 2G72A 5D2CA 1L7PA 1T8UA 3SQLA 4D99A 1ZH6A 3RVQA 2R92G 2RD2A 4MYDA 2WWWA 1CPYA 3SR0A 3N0XA 1G21A 4Y2UA 1DXHA 2NW6A 3N2ZB 2VK2A 3AP1A 4JC8A 1IAQA 1QGAA 3K6JA 2XADA 1OAAA 3CHYA 2CEKA 4MHTA 2QM3A 1X9HA 3VVBA 4GC5A 3K4PA 5ADUS 2YFHA 4F86A 4FYYA 3RREA 2X1HA 3B8EA 3DEFA 3BQNB 5C81A 4N47A 2A1UA 3DWEX 2ID9A 3KKNA 4FFWA 1O8CA 1XCJA 1MT3A 2PKWA 1CERA 3VSCA 1IM5A 3TW4A 3OX4A 2W83A 4MZDA 2P6UA 1JW9B 4XCQA 1KPGA 1Y98A 3U4GA 4X45A 5AVSA 3AEQA 1R5JA 3MNFA 3PGVA 1MB3A 1M33A 5CT6A 2ZYWX 1V16A 2GSWA 2ACVA 3OMWA 1Z0JA 1SC9A 2FW0A 3M6FA 3WQSB 2FK1A 3Q3JB 3U3DA 3WK6A 3UMBA 5EDWA 2PSDA 4EFDA 1OA0A 1E6EA 5AHOA 4C76A 5JYCA 4ZA2A 3EZ7A 3GTPA 4D3XA 3JQ9A 1K7CA 5AYVA 4B17A 2SCUB 2B63A 1Y3DE 1SUEA 2RGNC 1R4NB 5EXEA 5GONB 3TR6A 1WM1A 1OCEA 3ETGA 4EB6A 4ICIA 1MAUA 3MFQA 1C81A 3JQEA 4LSMA 3W9BA 4KFUA 4K5QA 1YE3A 2GYUA 1YBFA 3NO4A 2NIPA 3RAPR 4PZ6A 2R6GA 5JYBA 4XB6B 4QLBA 4FYIA 4HATA 4AZ0B 2NZJA 4HQFA 2IH2A 3UXEA 2V7QD 4OG2A 2YY5A 4EPWA 2FGKA 4JBHA 1SOVA 3ZBQA 1H9BA 2B5WA 5BV8A 3VR5A 4MTCA 2J46A 4HQOA 5DTMA 5HR5A 1UMBB 3EGOA 3WIBA 4UNRA 3AQIA 1OZGA 1NXSA 1JLSA 4NC9A 4M54A 1QRRA 5DIZA 1HYEA 4UFNA 4P58A 1XIVA 4WBSA 4AFNA 3AIMA 1YASA 4IDAA 3MUEA 1QTNA 3UYYA 2CD9A 2JA2A 4UMFA 4XIFA 5I45A 4GM4A 2HSGA 3VC7A 2BMFA 1WBDA 4N7MA 2DF8A 2CLFB 2GPTA 4F3RA 3O9ZA 5JCXA 3VNVA 4AUNA 5GMOA 4MRPA 2W2PA 4DMHA 3RBXA 2VDOB 3HMKA 1FP6A 3DQPA 3GUYA 5G40A 1KHHA 4B7CA 1CUAA 5E6UB 3GVXA 3A6PC 1CRWG 3SYMA 4GRAA 4KO8A 3ZV6A 2PJRA 2I4OA 4YC7A 1MGPA 2QV0A 2ZYTX 2BIFA 5FJ8G 1I4TD 2X0EA 4REOA 5B3JC 2VLIA 4CCYA 4IWXA 1N1EA 1RQRA 4IKEA 2B6NA 2ATIA 1XEXB 4NYMQ 2RHWA 2IZ1A 3L7MA 3IDZA 3BTVA 3IDSA 2HU8A 3SM9A 1P74A 5I4KA 4KE6A 2XE7A 4DSAA 1KYIA 4C0QC 2QAIA 5C7YA 2PX2A 4BQIA 2ORVA 4P9NA 1NN1A 1EDZA 4BKUA 3R0IA 3FXAA 2IZOA 1M1UA 2G25A 4EDFA 2QMHA 4LDZA 3HE3A 2ZANA 1YR8A 2ZVPX 1NMYA 4HZUB 1EB9A 2AK2A 4FM9A 3B1WA 2X7XA 1MX9A 5CJPA 4HGZA 1NR1A 3W5DA 4RZXA 1FFEA 3FPHA 2BHNA 2HVSA 1U31A 3IP9A 3HCRA 3DHWC 2ZRBA 1R4MB 4YI3A 1QDLB 3L43A 1RWMA 5IT9W 3IMEA 2CW8A 5JCPA 2L69A 1P6UA 3IPYA 1YU6A 5TS2A 2G77B 4G56A 5K99A 4AJPA 4TSFD 3MMXA 1TGVA 3SZOA 1WBJB 1KEEB 1X7HA 5JDIC 3V4ZA 3MWEB 3R6GA 4L3VA 3DLTA 3VJKA 3DZGA 2F00A 4L9WA 2PWBA 5K05A 4PC7A 2ZB4A 3RSZA 2YOFA 3SK0A 4M38A 3GRCA 5ALIA 2P9CA 4IGEA 4RTJA 4E2ZA 4E5MA 1J0XO 4YHHH 1JU4A 1E0SA 1NM5A 2X5KO 2Y66A 3E0QA 4EB3A 2BKLA 1JEDA 5KFKA 2Q3FA 2DECA 1QP0A 1MPXA 4MW0A 4QWEA 3ST7A 2C98A 4ZQFA 5JAIA 3BAZA 4U39A 4AS2A 3RK0A 1IAVA 1FP4A 3CR8A 2WP0A 4PGMA 4PN3A 4DR2H 1KS2A 2ZBFA 3VI4B 5JMPA 4OJYA 1J9ZA 4ZVVA 4UEKA 4R3UC 4L4RA 1P45A 2ZITA 1GGVA 3DEZA 3OU7A 4IWYA 5PNTA 3NW9A 1A9SA 2E5FA 1QIFA 2R6FA 1NW5A 4BBRG 3HDGA 5DNCA 4QDOA 4LJYA 2I65A 2HLDD 2WJ3A 1WQ1R 2JVKA 4PW0A 2GAAA 5TJ9A 4CQJA 3V55A 1FCJA 3NJ4A 4PRYA 1H6DA 4X1KA 1C9YA 1Z6AA 1XRJA 4YP5A 4OJKA 5HYVA 4BNYA 4KUEA 3D3KA 2OPHA 2BGTA 2WPDD 3W1WA 3CNEA 3LWBA 1SRQA 3LJKA 1THTA 5JLAA 1E9VA 1NSFA 3ROMA 4OLAA 5E7QA 3HU3A 3B51X 4DDHA 1DPGA 4K8RB 4OI2A 1XMIA 1HK7A 4YAOA 1JPUA 1C14A 2D5LA 1N6NA 2FN9A 4QWDA 3OJWA 5EUBA 2J6BA 1XMVA 1RADA 5EQTA 3P9YA 3PDIB 5CFQA 1NQXA 3PA6A 4NARA 2CFMA 3UT0A 2XAUA 4C4YA 1GA4A 1QR2A 4UNQA 4A6DA 4MIKA 1SQGA 4FHEA 3E23A 4FXPA 3GIMA 3OLXA 1SU6A 5DCYA 2AR9A 1SHZA 1BIFA 4ETWA 4M0KA 2C58A 1S2IA 4V2UA 3AYZB 2G08A 3Q9LA 2CVOA 1VJ5A 2J08A 1GU1A 1OBVA 3WI7A 3Q85A 1NHGA 4RSRA 3NEYA 1CJUC 1CFZA 4AJJA 4UHCA 3HB0A 5J2UF 4KMOA 1TGYA 2J67A 3CH5A 1VJGA 5BVHA 4RZUA 1G60A 2Z1NA 1N7HA 3OKCA 3ET5A 4RTQA 2K7ZA 3R09A 4OGFA 4J2TA 4HJXA 3FJOA 2IS4A 2FKAA 2BMAA 4YJ3F 3ZK7A 2QAGA 3UKDA 5TS3A 3KSRA 2HIGA 1KK0A 3U7EB 3HBLA 5IJ9B 4N0PA 5AK5A 5J63A 2GJ8A 2QWXA 1GRNA 2Q9BA 3BFVA 2OGSA 2HIAA 3E5NA 4O8CA 4AKIA 2OZPA 2R00A 3HXMA 1J24A 1R15A 4DIDA 1QE3A 3BJRA 1GA1A 1FXSA 5EHIA 1PWHA 2R1TA 2C00A 3MD0A 4CDMA 1TX4B 4HLDA 4QAJA 1A50B 3R9IA 3HNRA 1UEJA 2GBGA 1FC0A 2WYWA 4BVLA 2ZRPA 3G2JA 4OKNA 1NGSA 3WDLA 1P2SA 2IELA 4L57A 2AFVA 2P62A 4IDEA 4MQFA 4W7SA 4H77A 1ORRA 2JGEA 3RYTC 1XQ9A 1WHTA 1WQ4A 3WA6A 5KNDH 1N5DA 2AFHB 1GZHB 1DKUA 2DUUA 1OBCA 5KOHA 3D1VA 2YCLA 3RSOA 3MUOA 4PO9A 2XMGA 3OZBA 2C0PA 1NXQA 1E1RA 3R7DA 3FUTA 4JBWA 2P9ZA 4P2BA 1Y7TA 5ARBA 1VE1A 2P90A 1G8YA 5TQVA 4FGJA 5CIYA 3USCS 3QFRA 4TXMA 3RAGA 2Y4RA 3I2JA 1AUPA 4DV4B 1FX1A 4OJQA 2OWEA 3T52A 2WFZA 5J1SB 3G5MA 5FPRA 4RD6A 4RMNA 1RQLA 3IQIX 3K70D 2XPCA 4UVEA 3GPDG 3O8CA 4OAPA 4Q24A 4RCNA 4HAZA 1MRSA 3FRHA 2R2AA 1R8JA 4KO1S 2FEKA 1KEZA 2D1SA 3UCEA 1T9DA 3ICWA 1SEPA 3U0GA 3HCDA 1CG6A 4QUDA 3P45A 4V39A 5LZ8A 3OQPA 3ZLTA 1TZBA 3GFOA 5KNDD 1VCNA 3MWJA 4R83A 4E4TA 3T61A 4JXKA 5GJVC 2D8MA 1Y33E 1II8A 1UDWA 5CDTA 3USZA 1SWVA 2QD5A 5FF9A 4IF6A 1T5TA 3F5QA 4ZRNA 3Q3IA 2OCPA 4UCOA 1ZM2A 2QTZA 3GJRA 3AL2A 5TQJA 3PL1A 3GP8A 3I9FA 3AUAA 1DBVO 1NQUA 4YVFA 3KR0A 1DIHA 3UKJA 5L1JA 1WUYA 2CWWA 2OYCA 3ABOB 3OFJA 4G0ZA 3KP1A 2BSAA 1WXHA 4OIFA 2OILA 1EEHA 5IK2D 3I4LA 5FCDA 1RI1A 4IUBS 3MTIA 3UWOA 2OCIA 2QE7A 1JHOA 2QGFA 2FE1A 3L8HA 4HDMA 1W2WB 3LCMA 5CGQB 3ZV5A 4U0JA 1JX6A 2XITA 1W5AA 2HFJA 3EWAA 4WVFA 4HY3A 1A9YA 2VDNB 3PWZA 4PU0A 3V2UA 2XRFA 1T2VA