3VPFA

Complex structure of lactobacillus casei lactate dehydrogenase penta mutant with pyruvate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
311
structure length
306
Chain Sequence
ITDKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFTSPKKIYSAEYSDAKDADLVVITAGAPTRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of penta mutant of L-lactate dehydrogenase from Lactobacillus casei
rcsb
source organism Lactobacillus casei
molecule tags Oxidoreductase
molecule keywords L-lactate dehydrogenase
total genus 103
structure length 306
sequence length 311
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vpfA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3vpfA02
5JYEA 2OBNA 4IZIA 1MXFA 1SOWA 5HM8A 3ZHZA 3LC2O 4ZJUA 2HRZA 5DCWA 2X23A 4DLLA 3OEYA 3WIDA 1P1JA 3K9QO 3PIDA 3BMCB 5TC4A 2VTEA 4CLOB 4PN3A 2GZ2A 1QYCA 3VHRA 1DJQA 1OZAA 2NNLD 2VHVA 1V3VA 2WSBA 3H9GA 1XA0A 3PTZA 3U4IA 5DP1A 3T4EA 3ZZNA 4BUCA 5HS4A 4DLBA 3VAZA 2W2LA 5TX7A 2HRBA 3P5SA 2IE0A 1R16A 1DB3A 4M87A 2CF5A 4ILKA 1Q7BA 3WQQA 1DFGA 3DO5A 1W8DA 2P5YA 3IOYA 3VPGA 4O59O 3QJ5A 1D8AA 2PH5A 2ZIZA 1Q0HA 4NHEA 4R51A 3ZV5A 1R4MA 4CM6A 3G79A 2VWQA 4P8RA 5TIIA 4XR4A 3WGTA 5ILOA 3QHAA 1UDCA 1W0CA 5TQVA 1JU9A 4JXKA 4E30A 5IDQA 3PHLA 3KVOA 3QIVA 4RVHA 3IKVA 3TNLA 1ZZEA 4JP2A 1Y9EA 3WBFA 3Q3CA 2D1YA 2DFDA 2PFGA 3DR3A 4OH1A 3WQRA 3FWNA 4KZPA 5TLSA 3BA1A 3KUXA 1EQ2A 1CDOA 4PLGA 3DMTC 4P22A 3RIHA 1J49A 1H2HA 4QX6A 4UUNA 1Y9AA 4XB1A 5HS6A 5EL0A 1D3AA 4WOJA 3PIIA 1EBFA 1IOLA 3FRJA 3GY0A 1HDOA 2R2GA 2RHRA 3NRCA 5ER9A 5G0SA 5C37A 3OQ1A 1DC3A 4A73A 2CSUA 3E9NA 1WZEA 3JQFC 4L4RA 3DZGA 3ZHXA 2QIOA 2Q2VA 3ANMA 1C1DB 4PZEA 3S2EA 5IFLA 3JYNA 5HTOA 3SX2A 5JMWA 4G2NA 4RVSA 1YB1A 3COSA 2HKIA 4K6FA 4DYVA 3KYDA 1TLTA 1WNTA 3F9IA 3NT2A 3LSYA 2Y68A 3SLKA 3JD0A 4FB5A 3EZYA 4IDFA 4XGKA 3D3EA 2BLLA 3V1TC 4H16A 3M2TA 3WGGA 1PIWA 1BG6A 1YDWA 1ZXBA 1MUUA 2PTGA 5JAQA 1T4DA 3ITKA 2IDZA 5JMPA 4YJFA 4CLXA 1CEQA 5DT9A 3R3JA 3R6DA 1Z73A 2GZ1A 2OL4A 3MCVA 5ILGA 4UUOA 3WX0A 5BSHA 1XU9A 2ZJ1A 4DMMA 2PY6A 4AG3A 5A9SA 4A0SA 1E7WA 4ROSA 2B4RO 4D3SA 3AUSA 1ZMOA 4GQAA 4TVOA 3GGGA 4LMRA 5BT9A 5T5QA 1E7MA 3I4CA 4WCFB 1B8UA 1K6XA 1P1FA 5G4KA 1LLDA 4TZTA 5DDIP 4Y6RA 4KQWA 2IYPA 4CMKA 4BVAA 3RFXA 5JS6A 1BXZA 3Q6IA 3UCEA 1V0JA 4DGSA 1NAHA 1AUPA 3MOGA 5COBA 4RF5A 1NR7A 3GR6A 2E48A 4E2WA 1HL3A 3JQGA 4YJHB 3I9LA 2EW8A 2EGHA 2O4UX 4J4HA 3LF2A 1L7DA 4Z0TA 2V6FA 2FZWA 5JNLA 1H6AA 3IS3A 4QEDA 4E4YA 1M6WA 3RJ9A 4R41A 2Q50A 3UW3A 3DBLA 2NV6A 1DAPA 2VUUA 4RF2A 1T1RA 3W4IA 2VRCD 3I6QA 1QYXA 1QYVA 3IL2A 1QXSA 4RV9A 3HG7A 3WLFA 3RKUA 2ZB3A 5L45A 4XRRA 1LC3A 1ZSYA 2PA3A 3ZWOA 4CPDA 2PH3A 1H0KA 1JAYA 1R12A 3RUAA 2LDBA 1BHSA 4M8SA 1TVEA 1Y8QB 2ZTLA 4M54A 5I7EA 3BHJA 4F3YA 4DMLA 1I01A 4AJIA 1EDOA 1P44A 3K2BA 3CIFA 5F3RA 3BAZA 4DC0A 1GYPA 1HSZA 2GD1O 3CUKA 3ICCA 4XZ3A 5C7OO 2AHRA 1HZZA 3QVWA 5JBIA 3W4JA 1WWKA 4OMUA 4OKNA 2VUSA 1DAOA 3C3XA 4IZHA 1P9LA 3BTUA 1UAGA 3GPIA 3LYLA 4OL9A 4TMFA 4M1QA 1CETA 4I9NA 2VYND 5L7YA 5A5EA 4DPLA 1E6EA 2OO5A 3DWFA 5KVCA 4W7IA 4WLUA 2O50A 1SOVA 4J3FA 3UKOA 4UEOA 3EUWA 1R0SA 1X1EA 4Q3NA 3TL3A 3K6JA 1XQ1A 3G1TA 2DBRA 3NT4A 3PJDA 3UCXA 3GGPA 1C0PA 4K1LA 4JROA 4N5NA 5I7VA 4MVJI 2WJPA 1R0KA 1X15A 4RF3A 3PWKA 3QQPA 2E37A 1JW9B 2O3QA 2HLPA 4G65A 4GLOA 4GLLA 3GNTA 3PDJA 1C0LA 4ZRNA 2J3HA 1NFQA 4UAGA 4PG8A 3EAGA 1N9GB 4OO3A 4WNCA 4XDZA 4XCVA 3H65A 4FDAA 1KVRA 1Y8RA 2F00A 4RDIA 2A94A 1JWBB 5CPFA 1GEGA 1BW9B 4ALNA 4WCDA 3OBBA 1DFIA 3CPSA 3HJAA 3GRKA 3U9LA 3NT5A 3GA0A 2XPCA 3F6YA 4ZQFA 3QWHA 1WLYA 1BXGB 3UN1A 1E5LA 2PK3A 2CDBA 1DEHA 4F45A 1FK8A 3O8QA 3WMWA 1NHGA 1V6AA 1UR5A 1YQDA 3M6IA 3PHGA 2GLXA 4BO4A 5DULA 2GZ3A 3RWBA 5TT1A 3PP8A 1NQOA 4WECA 4PLHA 2V6GA 4FS3A 1J5PA 2OUIA 1C1DA 3KOUA 1JAXA 3E1KA 2X0NA 4RJTA 2JFFA 2O3TA 2X22A 2I6TA 2Y66A 1ZVMA 4DLAA 4U6SA 4GMGA 2B69A 4IDBA 3OECA 2ZCUA 4BNLA 3WTCA 4CLRA 4W9NC 4CUZA 1Q0QA 3L6OO 2P2SA 8LDHA 1UXGA 2BHLA 2O3UA 3JD3A 4BO8A 4O1MA 3GMSA 2W2KA 3FR8A 2FPIA 1I0ZA 3ETGA 5JPIA 5KTKA 1NQAO 4Y98A 2FSSA 2X1HA 1FDUA 2CDCA 1GUFA 2FPPA 2JAPA 5HBRA 2B5WA 2ZKLA 5A5FA 2VRBA 4BB6A 1UZMA 1KIFA 4J1QA 3AI1A 3GDOA 2GN6A 1NYTA 3C24A 3L6DA 3L6EA 2BGLA 3GHHA 2GN9A 4E5PA 2C2YA 4IS2A 4XQCA 1X7GA 2G82A 1DFHA 1X13A 2ZYAA 4QO8A 2ZATA 4YT8A 4L4SA 4DIOA 4EJ6A 5I9LA 4J9UE 3GG2A 4D41A 1X1TA 2Q2QA 4Z0PA 1S6YA 1QRRA 4D3FA 3I9KA 2NVUB 4BNFA 1Z7EA 3ANLA 3WYEA 1OFGA 3ZW8A 4XYEA 1A71A 3B1FA 5CDTA 3ZGYA 3JYLA 1F17A 3AI3A 1Y8QA 4J2HA 3HDQA 2P4QA 4INAA 4TSKA 3PI7A 5DBIA 1BVUA 3K5PA 5BNFA 1ENZA 2PNFA 3H6KA 4O5OA 5EIOA 1M6HA 1P3DA 2FR8A 3SLGA 3EMKA 4TRRA 1ENYA 5JW6A 4AVYA 2GPTA 4PZCA 3TWOA 1PZHA 1YL7A 1ISFA 1WP4A 3LDHA 1MC4A 4NBVA 4DQXA 1NFFA 3DFUA 4E2ZA 2X9NA 1M67A 4FC6A 4OJNA 5AVOA 1FF9A 2O7SA 1KY4A 4R4JA 4EJMA 3IKTA 2Q4BA 4ZA2A 3JQEA 1IHYA 4IINA 1TT5A 3HDHA 1PZGA 5IF3A 2VT2A 1YXMA 1HT0A 1BTOA 1LSUA 4JX8A 2HMWA 4Q39A 2Y1GA 2QQ5A 2RBEA 1L7EA 3DQPA 5IDYA 5EINA 2P9EA 2P5UA 1C3VA 1OBFO 1CERA 3H8VA 1GY8A 3HFSA 5L4SA 4MPDA 3IAHA 1OOEA 1E3LA 2G1UA 3DBHB 1KS9A 5CP8A 2EF1A 3GLQA 2Y1DA 2JD1A 2YHIA 1J6UA 4Y67A 4PG6A 3MWEB 4UUMA 3CH6A 4WASA 3MZ0A 4C7KA 5ITVA 1PZEA 4LK3A 4UREA 1HXHA 4LRTB 4XWYA 1YJQA 1X0XA 4KWIA 1E3WB 3KLPX 3EZLA 4UEJA 3QWAA 2NVUA 1UJMA 1C0KA 1SO8A 2IZZA 3MOIA 4AJPA 1U5CA 5C7IO 3X2EA 1YOVA 2ZB4A 1ZO8A 2Q1UA 3BMQB 3VH2A 4YAIA 3GZNA 5AOVA 4DYDA 4RORA 1A7AA 2X0RA 4RLHA 3X2FA 1C1XA 4G81A 5EQDA 4PFJA 3ZWWA 4BOYA 1BXKA 2DQ4A 3QVSA 4YR9A 1DHRA 1XYGA 3PDUA 5U1PA 4AJ4A 1SNYA 1QV6A 3PQDA 1ARZA 1LBEA 2VNAA 2PGLA 5TNXA 3H5NA 3BTSA 3SC4A 2JFHA 3U5TA 3H3JA 1GR0A 1ZSVA 3R3SA 3OJEA 1LUAA 1LSOA 2Q1SA 3ANNA 1E1KA 1O9BA 1QLJA 4R1NA 4XJSA 4MDHA 5A9RA 3IQDB 1GZ6A 3GEMA 1TB4A 2BFAA 1I5RA 3D3WB 4XRGA 4P4NA 4RGBA 2UVDA 2FN7A 3O8QB 1HDRA 1KVTA 4YACA 1NTOA 4W6ZA 1U28A 1DRUA 3D0OA 3D7LA 3W6UA 3ZWVA 3DC2A 3EVNA 2GCGA 2PWZA 1GD1O 4TRMA 3H9JA 4W4TA 2G17A 1SZJG 1GCOA 4IJWA 2E82A 4NJMB 4LGVA 1LRKA 4XQ9A 4YVFA 4BO2A 3OFSA 3BTVA 5CHEA 5KOIA 2UYYA 2JJYA 1GAEO 3I83A 3LT2A 1IHXA 2QRJA 3NUGA 5TJ9A 1ZFNA 3V2HA 3WXBA 2I67A 1PGQA 3PVZA 3AM3A 1HDYA 1CQIA 1ZEJA 5GZ1A 3I9MA 3WIEA 1W6UA 2X86A 3PGJA 3EW7A 4QQRA 1E5QA 3ROMA 1LI4A 4N18A 3V1YA 3WNVA 1P1KA 1T2EA 3HSKA 3WICA 2PD3A 2J5RA 1EQUA 2AQ8A 3FPCA 4TQGA 3U3XA 1BDMA 4E2YA 4H15A 4ZRMA 5JAZA 3OP4A 1YRLA 3L9XA 3K96A 4WJZA 1C1XB 4IMRA 3C1TA 4AJOA 3M1AA 4I8XA 1U4SA 1DC4A 2GDZA 2R00C 3A9WA 2JKVA 3JTMA 4WE3A 4WCFA 5EPOA 3RAJA 4YPOA 2GSDA 1PJBA 3HWRA 1IULA 5JAIA 4YJGA 4Q3EA 3NTRA 4J0FA 1EVJA 2EKPA 4MVJG 5A9TA 4YT5A 5L4LA 3DTTA 1PWXA 3ON5A 3TJRA 1DRVA 1BRMA 3ZWMA 1L1FA 1MG5A 4CQLB 2OOSA 3H2ZA 1ZMTA 2FZEA 2JL1A 3KSDO 3AUUA 3V2GA 5KWEA 4OXKA 4CV1A 5L4NA 3PHJA 1E7QA 4TWRA 3GOHA 4ND2A 1F12A 2AQHA 4MO2A 2CVQA 5I7FA 4CMAA 1T4BA 3PFWO 4U0JA 3ROKA 1NX6A 1I3KA 1I33A 1NFRA 3KB6A 3H5AA 3QE3A 3FBGA 4B3IA 2WYWA 3PEFA 1TT5B 3PQFA 3EY4A 3R0IA 3LT4A 4ALIA 5AXBA 1PL6A 2VHZA 4FFRA 4HFMA 4OOEA 4J9VA 4BQRA 3W4KA 2GN8A 1VJ0A 3PFFA 4CMEC 4CLEA 3HADA 1BVRA 3ONFA 4CM7A 4EUFA 4URFA 4CM5A 2QW8A 1HE3A 3DDNA 3WTBA 4BNTA 1ISJA 1T24A 1B0AA 1BWSA 4UVIA 2HU2A 5DBGA 5FFFA 4HXYA 2TMGA 3TZ6A 4HP8A 5AXCA 4ID9A 3G0OA 4R54A 5CG1A 1UXIA 2Q3EA 1LRLA 1R4NB 1VKNA 2DLDA 3SXPA 1UZLA 4CV3A 5K6AC 4B3HA 3BYZA 5I8WA 3DBVO 3PJEA 4J6FA 5CEEA 4KTTE 3ETEA 2NLOA 5T57A 3FPLA 4QT0A 1JKFA 3I9JA 1XQ6A 5I9NA 2VZ9A 2I5PO 1E0DA 3HDYA 1P77A 3DMTA 1EZ4A 5JDIC 4RPJA 4YCAA 5G0VA 2NWQA 1GPJA 3TN7A 3WYCA 1B3RA 4BNMA 2BELA 2BF7A 5A06A 2EKQA 2XXBA 2C0CA 3ZNOA 1X0VA 4BNNA 2C07A 3WDSA 3RU7A 1ZEMA 1KVUA 4OHUA 2YJZA 4CQLA 3WWZA 3MJEA 2FPGA 1O94A 4CMBA 2DTXA 1DIGA 2X58A 1E7SA 3WOHA 3I23A 4BNJA 4HUJA 3BMOB 3RC9A 3EYWA 3JQBC 4JQCA 4IDCA 1MFZA 3VPHA 3ZU5A 1GTMA 3ZWYA 3I9OA 3PYMA 3E5MA 2ZTMA 2ZYDA 4ND3A 3WNQA 4NJMA 1PWZA 3CMCO 5KVQA 3MTGA 4EEZA 4WCFC 5B12A 3HB5X 4ZHSA 1U7TA 5B4UA 1HLDA 1A27A 2A9FA 6ADHA 4UUPA 2J6IA 5KJCA 4RL6A 4PCVA 1LU9A 4FD3A 1IPEA 4RPKA 1H9BA 1O0SA 3AFNA 3K73O 1U1IA 4S1VA 5FYDA 4GKVA 3RUEA 1KVSA 4CM4A 3E5RA 4K28A 4DPMA 3QVOA 4EUEA 1LDBA 4CM8A 7MDHA 1YBMA 1ENPA 1X7DA 1VJTA 1NASA 2A4KA 1BXGA 2X0IA 4LW8A 1O8CA 3FNEA 3IP1A 1NQ5A 1FDVA 1V3TA 3B70A 1DPGA 2OBYA 1LC0A 3DB2A 1CIVA 1LDEA 2V6BA 1WDMA 1I2BA 4NZ9A 4EGFA 5IXYA 4DL9A 1QP8A 4KTVE 3AY7A 3UF0A 5G4LA 2Q4EA 1DXYA 1N7GA 1SC6A 4A7PA 1IB6A 3VPFA 4E32A 4OSOA 2O2YA 3STHA 3AI2A 3BXXA 1YQGA 3U62A 3S2FA 2EV9A 3DAPA 1E1LA 5JCJA 2D2IA 5COQA 4FQ8A 2V7PA 4XEHA 3BMCA 5JO0A 2DUWA 1YE3A 3GRPA 4Z3DA 3F1LA 1E7RA 1UP4A 3OJOA 3VPSA 3SC6A 4KUGA 4EEXA 4OKIA 3BMOA 3GZ4A 1PL7A 2VHWA 5JDCC 3WGOA 5H82A 5JCXA 2UUOA 1EUCA 4L76A 2PV7A 3IMFA 4A27A 1J0XO 1PTJA 3WBBA 3KO8A 4BNIA 3ZWPA 5A3JA 4YQYA 2HK9A 4AJLA 4DA9A 3U0BA 1JVSA 1F0YA 2B83A 2X5KO 1GYQA 3MJSA 4JN6B 3ZWNA 1DOHA 4IUYA 4IY1A 2C2XA 2NVWA 2AXQA 2O48X 4HV4A 5U9CA 3DOCA 2EWMA 4TKLA 3UCFA 4Z9XA 3TZKA 1YB4A 4B4UA 5B4VA 2C29D 5JY1A 4IDDA 3JQDA 4L75A 4GMFA 2YQ5A 1NPDA 4DXHA 1D1TA 4BO0A 3QLJA 2I9PA 4NNJA 5ITWA 4R01A 4E5NA 1U9JA 2WYVA 3MJVA 2QYSA 3TOXA 4IMPA 1NAIA 4XGNA 3FHLA 5T67A 1UZNA 1ZXLA 4IDEA 2AW5A 1A7KA 1B3BA 1E6WA 2I66A 2HK8A 1SAYA 2HMUA 3QY9A 1T25A 4R69A 4XJTA 3LT0A 5ER6A 4IJUA 3I6IA 4D43A 1E3WA 2BFOA 1XIVA 5ADHA 1XGKA 4D7AA 5A3VA 3UVEA 3DZJA 3ABIA 1W73A 3WYBA 1ZBQA 4XYMA 2EEZA 3KLMX 3Q2KA 1EBUA 5IN5A 3TPCA 4WLVA 4BNXA 3PQEA 1WZIA 2D0IA 1KEVA 4FFMA 5HA5A 2VHYA 4I5EA 3NEPX 1T1SA 2C82A 4GAEA 5BNTA 2X6TA 5L7WA 3FSRA 4EJ0A 5EERA 3JQ7A 1KC1A 2YW9A 1ULUA 2HQ1A 3AW9A 4LSWA 4UVHA 2CMDA 4RVDA 1LDGA 1PQPA 2H9IA 3GDGA 4CMHA 4I5DA 2D8AA 4BO7A 5A4DA 2IEBA 1UP7A 3E6AA 5C7LO 5EMHA 4CLDA 1ZK1A 2Y93A 1EE2A 4KOAA 1JKIA 3UAGA 1JQBA 2VHXA 3WFJA 4CMCA 3GG9A 2DVMA 2VWGA 1SBYA 3UUWA 3RC2A 1R6DA 1V8BA 4IJKA 9LDTA 4J1SA 1HEUA 3RCBA 2P9GA 2RAFA 4C4OA 3C85A 4CL8A 5JXWA 2IXAA 4GWKA 1EEHA 4MVJH 1VPDA 1OAAA 2C5EA 3ONDA 3PK0A 1Q2XA 1IPFA 4GVLA 3IC5A 4L73A 4BGVA 2NQTA 3C7DB 2VN8A 1VC2A 4LVUA 1Z75A 4BMNA 4E12A 4PG4A 4EI2A 2ZQYA 3S2GA 3TL2A 1P1HA 4IQ0A 4JJFA 4GX2A 2IRWA 2YYYA 2J3KA 5A9SB 4OXYA 2ZJ0A 1AXGA 2F1KA 3GVIA 5KJEA 4NJOA 3L9WA 4Q3BA 5CG2A 3CXRA 4UVEA 1A4IA 5A05A 2HK7A 3RUFA 1EVYA 1G1AA 3JYOA 4PLFA 2PZKA 2HMVA 3NJ4A 1GQYA 1MP0A 2EP7A 3BMQA 1ISIA 5MDHA 3WSVA 4YWJA 4XKJA 5B4TA 4FFNA 4YEDA 3TQHA 1U3WA 3KM0A 1KEPA 3GK3A 4CMGA 1XSEA 3VH4A 2Z1NA 2CF6A 1ADFA 3DL2A 2CVOA 4GGPA 3N7UA 2GERA 5KVSA 3JQ7B 3ZWXA 1U8FO 4BGEA 4E33A 3A4VA 3D4OA 1YBAA 3S55A 2GASA 5CFZA 2IYOA 1E1MA 4MIYA 3NDJA 3JQ9C 4KQXA 3WS7A 3L07A 3F1KA 5G2OA 3PGXA 1CQJA 5IZ4A 4LCJA 1FDTA 1PU2A 4ND4A 4IQ8A 1CYDA 3WWYA 3ZV3A 4TZKA 4ZQBA 2E6UX 1SCUA 4E3ZA 3E82A 2JCVA 1QR6A 3IP3A 7ADHA 2NU6A 4TRNA 4DC1A 2QRLA 2EG9A 3PPIA 3Q0EA 4NFYA 5JAMA 3LZ6A 3DBRB 1PQUA 4KMSA 3DZBA 2VYVD 1B14A 1D4FA 3JQBA 4IGEA 3I4FA 3K2EA 1E3IA 4R9SA 1VE9A 4I08A 4NI5A 4FCCA 2FOIA 3FR7A 3TZCA 4CMIB 1H6BA 3AM5A 1E92A 3RASA 4LISA 4I5FA 3FI9A 1JN0A 3DHEA 1MG0A 2D5CA 4AJHA 1DJNA 3HN2A 2X4GA 2CUKA 1HDZA 3RC1A 1HE2A 1YH3A 3C7AA 4PRKA 1PJSA 2XOXA 3ADPA 4L9RA 1YGYA 4ZGWA 5ENDA 3BHMA 1VL0A 1ZUD1 2J5KA 3K92A 5JC1A 1PR3A 3A14A 4GSKA 5T8KC 3JQAD 5JO9A 2Y67A 4I1IA 1Y8RB 4YAJA 4AFNA 3ST7A 4MVJA 2Y1FA 2VCYA 5FWNA 4JGBA 2B35A 3H3FA 4B7UA 1PQWA 4WGGA 4MKZA 2TMDA 5F21A 3D3WA 2NUAA 2UUPA 4FFOA 4OAQA 1GQ2A 3D64A 3RBXA 1A9ZA 4N5LA 4ZQGA 3T7EA 2FHSA 1TEHA 3O26A 3R1IA 4PG7A 1EK5A 2D3TA 4BNKA 3RU9A 3GUCA 3JD1A 1LDMA 3WGQA 3T7CA 5DN9A 4B79A 5K9ZA 4WLNA 2NU9A 4BL5A 2DBQA 5AXDA 2D59A 2D5AA 4NBTA 2Q1WA 1I3MA 4PLYA 5JSFA 1OC4A 3AWDA 3AM4A 4BNUA 3K30A 3OA0A 4XIJA 2A92A 3FNHA 3NX4A 4CV0A 4YTEA 5IN4A 5IDWA 4HFNA 3ADOA 4JJIA 1V3UA 4BKOA 3HNPA 2X8LA 5KJ6A 2XF8A 5GY7A 2JHGA 1HYEA 2NTJA 2I3GA 4EZBA 2W98A 2PKRA 2EGGA 5L51A 1HYGA 1GADO 3H9QA 3ZV4A 3KETA 2ZTUA 4M55A 3JSAA 4IS3A 2YHUA 4J4BA 3ZWBA 3TRIA 1EFLA 1RYEA 2I3AA 3EVTA 3JQAA 3BTOA 1M2WA 4W82A 4QECA 1QYWA 3GFGA 1I2ZA 5F1KA 5L40A 4LRSB 3P19A 1ADGA 4XQEA 1MC5A 4J1TA 4Z9YA 2DU8A 1F8GA 4F6CA 4L8VA 4NFSA 4CQMA 1PSDA 4KUEA 2V65A 4JLWA 5BNIA 1V35A 1U3TA 3I5MA 5F5NA 4J16A 4WEOA 1Q7GA 1GL3A 5TSDA 2O3JA 2I65A 2W2KB 3OH8A 2X9VA 1U2GA 4E5MA 1F8FA 2PZLA 2Y99A 2G76A 4FSHA 5T64A 3F5SA 1DC5A 3ZHBA 4R1UA 3KSUA 3QP9A 4XX0A 4R3NA 5JE8A 3AOGA 3LQFA 4YQZA 2HJRA 8ADHA 1HLPA 4J91A 4A5OA 2V6MA 4J7UA 1KBZA 1UXHA 2SCUA 2YFQA 1K2WA 1WDKA 3P7MA 2B4TO 4K6CA 5FI3A 2OP1A 1ONNA 1WXDA 1ADCA 2YDXA 1UUFA 4O63O 3VDRA 1FDSA 1IUKA 1Z45A 1ONPA 3RSHA 3WMXA 4QFDA 3TFQA 4Q3CA 3HHPA 1DIHA 1PJLA 2WM3A 3GFBA 4Y6PA 3S8MA 3OJ0A 1WMBA 4OOFA 1AN9A 1XEAA 4L74A 5COAA 4EW6A 3WFIA 3E9QA 1FMCA 1LXCA 1I32A 1H6CA 2HO5A 1YWGO 3VZPA 4CQMD 1MLDA 4YA6A 4A03A 5T8KA 4TRJA 5JC8A 1T26A 4YAEA 3U09A 2Q1TA 3HB4X 4BGIA 4MKXA 3PYXA 1ZNQO 1TA4A 4L0QA 1IYZA 2DPGA 3DFZA 3PHHA 4OGWA 3DZHA 2GUGA 1CRWG 2YQ4A 1E3EA 1K6JA 4CM8B 4BNGA 5G4KB 4R68A 4CV2A 1DIBA 1HF3A 3IUPA 2ZK7A 3E9MA 2OORA 3AY6A 1K89A 4XQGA 1ZIDA 2BI7A 4NU5A 3F3SA 1PGPA 3ZDFA 1GFSA 1E6UA 3ZNQA 3OSUA 1XCBA 5AYVA 3SBOA 1QKIA 3G1UA 1RPNA 2FRDA 1MX3A 4CUJA 4XYLA 1H5QA 4JBIA 3OICA 1O6ZA 4YT2A 3NTQA 1KC3A 2P4HX 5BR7A 3CMMA 3GVPA 5JLAA 2YV1A 3CE6A 2LDXA 3FTNA 1ZCJA 3LT1A 1D1SA 4E31A 4Y9DA 3DBHA 2AQKA 3FNGA 1EDZA 2A35A 3CTMA 3ASVA 4R16A 1VM6A 2FSVA 1YS4A 4IPTA 4MOWA 2AEMA 4PLPA 5KNLA 2B0JA 4PLTA 1MXHA 4MIOA 4CR7A 4FFLA 1HDCA 5FEUA 2QRKA 3MJCA 3O38A 4XA8A 4RO0A 1UXKA 5F5LA 1LDNA 3UH1A 4D0RA 1PGNA 2H6EA 3JQ6A 1HE4A 1IL0A 2BKAA 4GX5A 2VWPA 3TZHA 5KIAA 2IZ1A 1QV7A 2VWHA 2W90A 3GNQA 2EIHA 4GVXA 3IJPA 3PJGA 1RM4A 2QG4A 3A06A 4CQMB 1XR3A 5B1YA 4B4VA 1I2CA 1VLLA 4IJVA 4R9RA 1RYDA 3DONA 1JKJA 5CDUA 3GNSA 4K9DA 2XAAA 2QHXA 4DQUA 3OJFA 1EUDA 4I5GA 3C1AA 1NNUA 5DNAA 4QTZA 2HMTA 4NMHA 2Z5LA 2CDAA 5KKAA 3T4XA 2CD9A 2ZCVA 1WDLA 4FFPA 4FW8A 3ULKA 1MV8A 4WLEA 4D45A 2PZMA 1VKOA 4LN1A 1BGVA 3MTJA 2P91A 3BZUA 2PD4A 4BQPA 4NH4A 1A5ZA 4BO5A 3JD2A 3OA2A 3K31A 5TS3A 3UFXA 3P2YA 3HFGA 4J43A 2JCXA 4N5MA 1I8TA 9LDBA 1M75A 4KWHA 3NGXA 3ETDA 3E8XA 2DUUA 4PRLA 3C7CB 1QORA 3C8MA 3Q9UA 2IXBA 1NVMB 2B4QA 3DAFA 1DO8A 4Z6KA 3GVCA 1SB9A 1NWCA 4CUKA 1WAMA 4YRBA 3IJRA 3JV7A 3ENNA 2EERA 3PJFA 1R0LA 1SB8A 2C20A 1J4AA 4E6PA 5TJHA 1ZSNA 1YO6A 3U49A 1S7CA 3KV3O 5EQFA 4HY3A 4ZN6A 1AXEA 4BMSA 1TT7A 4E13A 1P0CA 1R4MB 3WR5A 2XXJA 1N2SA 3TDKA 1MA0A 2OGUA 4B4WA 1MGOA 4MP8A 3KTDA 3G17A 2YV3A 3HUDA 3PRJA 1U5AA 3AU8A 1NPTO 5IG2A 3S1LA 2P9CA 1E3JA 3O4RA 2X0JA 1N1GA 3B1JA 3JQ8B 2C7VA 2ZB7A 1I10A 4J7CA 3SJUA 3BMNB 1SPXA 3KSZO 3W8EA 4ESOA 1B8PA 5THQA 1K5HA 2OMEA 6LDHA 1ISMA 3IUSA 1E3SA 5GZ3A 1PL8A 4Z0HO 4YXFA 1CWUA 3KEQA 1A4UA 3Q11A 1CF2O 4BO3A 3QRWA 2HSDA 1IZ0A 2YZ7A 4II3A 4BIIA 4YJGB 1LQUA 4AJKA 3DZFA 4JJGA 4CMJA 3AJRA 3ZCXA 4MVJM 3QWIA 3ZV6A 1HRDA 4J4TA 2C5AA 3RUIA 1R4NA 5BQFA 4CM1A 2HCTA 5EN4A 3RJ5A 1LNQA 4FGSA 1PJ2A 3CKYA 3UXYA 3GMDA 1I36A 2GYYA 1T2CA 1Z7BA 2C7GA 1R37A 3L0DA 1WVGA 2QX7A 1M66A 2JD2A 3QSGA 3FTPA 1O5IA 1MFPA 3NDRA 2AA3A 3FNFA 1RJWA 4ZVVA 3BHIA 4PLCA 2AE1A 4FR5A 3W8DA 4IIUA 1LSSA 1DIAA 1SEVA 2Q99A 2WWRA 1Y5RA 3DEYX 4HKTA 1HETA 1B15A 4FC7A 1LJ8A 3FN4A 4LMPA 3F4LA 4ZQEA 2Y0CA 1PJTA 3FD8A 1P33A 3GEDA 3OEWA 3VZRA 4MP3A 2B36A 1JDJA 1PR9A 1CJCA 2AG8A 3RI3A 3F4BA 1ADBA 4FN4A 4AJ1A 5KJFA 1NHWA 3WJ7A 2J5QA 1E1NA 4BNWA 1LRJA 3HQ4O 4GSLA 3KYDB 2WDZA 3RUCA 3ZH2A 3L4SO 5L7TA 2OFPA 5KCZA 1KEWA 4BMVA 4ONEA 1UDAA 2W4QA 5MGBA 3QWBA 3KHUA 2O23A 1PGOA 4E21A 3F46A 4BHTA 3D4PA 4OSPA 1NXQA 4YJDA 4UVGA 4IXWA 5F1OA 5HWSA 4KP7A 2VNSA 4U5QA 5BSFA 2Y1CA 2AEJA 3Q1LA 1H6DA 4GWGA 3WGHA 4BO6A 1EMDA 3INRA 4HWKA 2Q46A 5TT0A 1BSVA 5GZ6A 4DREA 5C3MA 3JQGB 1T2FA 4MP6A 4TVBA 4YJHA 2PD6A 1KYQA 5T6BA 4LVCA 2GF2A 1PX0A 1B7GO 1UDBA 2J8ZA 4H7PA 3B6ZA 4CR8A 4PZDA 4EYEA 1R66A 3H9UA 1Y6JA 2JD0A 3ICPA 4NFHA 1YL5A 3CINA 1A9YA 4JCOA 4D3DA 4BV8A 4IIVA 4P4GA 1ULSA 3HDJA 1Z74A 3KBOA 4A10A 1HKUA 1QLHA 3PWZA 1ID1A 4FPXA 2WD7B 2EHDA 5ICSA 5IDXA 1LQTA 2R6JA 4R5MA 5EESA 4GKBA 1NVTA 2WMDA 4TKMA 3UHAA 1N8KA 1O95A 1DC6A 1K6IA 4YAKA 2WTBA 3VH1A 5U4QA 1C0IA 3ZU4A 3EK2A 3I9NA 2VTDA 5THKA 4D79A 3C1OA 4QO7A 2YHIB 3H7AA 4FJ1A 1HWYA 4PVCA 1KOLA 1VL8A 4GPD1 4YAGA 1I30A 5LDHA 4AJ2A 4ITUA 4J1NA 4CMIA 4WPGA 3UOGA 3V5NA 2ZB8A 1EE9A 4XD2A 4AJJA 1EUZA 5CEFA 3DXFA 5DBFA 4FIZA 2CFCA 1ZK0A 3BMNA 4RZIA 4EBFA 5L95A 3Q2IA 4ZQHA 1B2LA 1F14A 1GEEA 2CY0A 2IODA 1RM0A 3NYWA 4F46A 1Y7TA 5I8ZA 4YRAA 3LU1A 3WSWA 3PLNA 2GN4A 4RCVA 3AK4A 1LA2A 4BNYA 4DBZA 4L4XA 1XG5A 4DPKA 2NACA 4DWVA 3OQ6A 4MIEA 1GDHA 2FR1A 3WJAA 1AGNA 1NBOA 2HDHA 3PZRA 4XR9A 3CSDA 4BNHA 3KYCB 4OQZA 1YONA 2VT3A 4BKRA 1GPDG 1EK6A 4GL4A 4NG5A 2NTNA 2VQ3A 3GHYA 5KVVA 4NU6A 2ZTVA 4CM3A 2YUTA 1D7OA 3WLEA 1GV1A 3QVTA 4MJLA 3RFTA 1FDWA 2VOEA 4FJ0A 4NPCA 2DTEA 4E2XA 2DBVO 2EJWA 3ROPA 4B3JA 4WKGA 1Y5MA 2B37A 4DVJA 4P4LA 4NBWA 2JAHA 2W8ZA 5B37A 3U4HA 4HX5A 1EFKA 2GRAA 4UULA 4IDGA 2X5JO 3VDQA 3W8FA 5DCUA 2AG5A 4M89A 3ZNPA 2JCYA 4JP3A 4D46A 4LSMA 5JDIA 4BKUA 2YV2A 4GX1A 2DFVA 3GH3A 1SMKA 3GPDG 4R3WA 1ZJZA 1KVQA 2OZPA 5J23A 4R1SA 4DRYA 1RWBA 3LC1O 4BGUA 3U4DA 4AJEA 2UAGA 3P2OA 1GUYA 4QFCA 2NU7A 4HFRA 1PJQA 1Z6ZA 4I9UA 2VOJA 3V8BA 2H1SA 4IDAA 4G5HA 1I3NA 3JYPA 3PXXA 1WMAA 1TXGA 2AQIA 4I9HA 2QZ9A 3JQ9A 5TRTA 5F1PA 1IZ9A 3ZHYA 4EITA 1ORRA 3ZI0A 4WEQA 3GN2A 3V2UA 2FY8A 4C7JA 1LTHR 3NDIA 3ZW9A 1JWAB 1P0FA 3AY3A 4RVUA 3GUYA 2NSDA 3JQFA 2VRCA 1EVZA 3L4BC 1RM5A 4J2OA 1YJ8A 1PZFA 2Y0EA 4J7XA 2BFMA 3ORFA 1B26A 4PG5A 4UVDA 1RKXA 3VZSA 3UICA 1KETA 4J49A 4S3MA 4DBVO 2AEFA 4YRDA 4A2CA 3TFOA 2DBZA 4IXTA 1NWHA 1HDXA 1DSSG 2FR0A 1G0NA 3KXDA 3JCZA 3K8ZA 1ISHA 3H5RA 4CR6A 5KJ1A 4ZU3A 2UV8A 4Z3KA 4B7CA 3DHYA 1DHTA 1NP3A 2WD7A 4HNHA 1H93A 4MINA 3EGOA 4U6QA 5CDGA 1LDYA 1T2AA 4NQZA 4CM9D 1ZK2A 4U0KA 1VRWA 2W2LD 2ZQZA 4WK6A 4CL3A 3QW2A 2J3IA 1IE3A 2JFGA 2VYNA 2PKQO 2GO1A 2PR2A 3RBVA 4PLVA 2CVZA 4JIGA 3I3OA 4M86A 3OMLA 5H83A 1KEUA 1OC2A 4Z9FA 2R00A 2G0TA 5A04A 4GGOA 3EC7A 2PZJA 4N54A 1GUZA 1HDGO 2B5VA 2O2SA 4J90A 2HUNA 4U8GA 3LC7O 4MVJD 1NQTA 1EVIA 2GNAA 3E03A 4E5KA 1UH5A 3FWZA 4O6VA 2OP0A 1DLJA 3RFVA 1HTBA 4D0SA 5H81A 3VC7A 1HYHA 1ZJYA 3AFMA 4CJXA 3W6ZA 4A26A 2AMFA 4NK5A 4W99A 4FOSA 4Y8VA 2FMUA 3GN1A 4NDNE 4QSMA 5I9MA 4YB8A 5LCXA 3ZN2A 1N1EA 3HZZA 1GQQA 3FCOA 5ENVA 1VJ1A 3RC7A 1JVBA 3SEFA 1XU7A 5ES3A 1P1RA 2VYVA 2NM0A 1C14A 4Q9NA 3UGKA 3OM9A 3NAQA 2E4AA 1Q1NA 3M2PA 5A03A 3JQCA 1F06A 3RBZA 1QG6A 1LEHA 2Y1OA 4N7RA 5LDGA 3H4VA 1JLLA 3NV9A 2AE2A 3DAGA 4FJ2A 2O3RA 4D42A 3ROQA 4EDFA 1UP6A 3ENKA 2EXXA 2RCYA 2PLAA 3GDFA 5ICMA 3RROA 2Y0DA 4K26A 1W4ZA 2VUTA 1PS0A 2D4AA 3D5TA 1OI7A 3AOEC 3H2SA 1HZJA 4XIYA 2WD8A 1R15A 3GVHA 4MVJE 4YBZA 5AXAA 1GCUA 2ILTA 2PKQP 4RQUA 2VZ0A 4D44A 3GAZA 3GQVA 4RZHA 1YKFA 2DM6A 3E18A 3OHSX 3DOJA 5CAEA 1XHLA 1GZ4A 1XWFA 4BNVA 5DP2A 2BD0A 5HRUA 3GC6A 3EHEA 5IJZA 1U3UA 3B1KA 1GZ3A 3L4BA 2OHXA 3VTFA 2BGMA 4BKPA 4OXNA 3QWFA 4BO1A 3D1LA 2NU8A 3WB9A 3ZWAA 3D5QA 3QVXA 4ALLA 2PGJA 4DTIA 4NR0A 3KEOA 4PLZA 2DT5A 4WOKA 4WLOA 3RD5A 3VVCA 3CZMA 1AE1A 4CM4B 5DZSA 2NADA 1MB4A 1LX6A 3ITDA 1DDOA 4BKQA 5BSEA 4GBJA 2C54A 4DIFA 5C5IA 2NQ8A 4WNIA 1KERA 2WE8A 2WE7A 2HAEA 5IZCA 3CZRA 1P45A 4PVDA 4HFJA 4B7XA 3KZVA 4RDHA 5G0WA 5KKCA 4J0EA 3IDSA 4E0BA 2I76A 1DRWA 1G0OA 5JCJD 2RH4A 4BV9A 1ZW1A 1N5DA 3WGZA 4JBGA 1YOVB 3OIDA 4IM7A 1HSOA 1B8VA 2EW2A 3G49A 4MVJP 5EJ2A 3RVDA 4DIBA 5K0ZA 1E77A 3MJ4A 2IEDA 3NTOA 1VSVA 2WYUA 4ND5A 4OQYA 5DOVA 3O9ZA 5GMOA 2BI8A 2IZ0A 1DLIA 1KY5A 4PLWA 5IAAA 3F5QA 3LLVA 3JYQA 3MJTA 1ZK4A 5DF1A 4RPHA 4W7HA 2VZ8A 3VKUA 5CDYA 3LK7A 1GV0A 3GF4A 1UXJA 4II2A 1QMGA 2H63A 5A02A 1NM5A 3LLSA 3N58A 2DKNA 3WGYA 1P74A 2DC1A 3B20A 2POQX 1PJ4A 4OYRA 1BW9A 2X7HA 4IGFA 4BS9A 5I7SA 4MVJF 4RVFA 1YDEA 4QXMA 1ZH8A 1U4OA 1YB5A 1B16A 1LSJA 2BFPA 1U2DA 2C59A 4XB2A 4XDYA 4CMEA 5L53A 1XKQA 2DPHA 3AU9A 4NK4A 3ZWCA 2HJSA 2ET6A 3OIGA 1U7HA 4P38A 1K0UA 3GVXA 3FF4A 5LC1A 3ZU3A 3MWDB 1BMDA 5BSGA 3SVTA 2CZCA 1JTVA 3JQAB 1OMOA 2O3SA 1SEPA 2O7QA 4WUVA 5G0TA 3KRTA 3MEQA 4BO9A 1YQXA 3HN7A 3L77A 4XYGA 4GX0A 1U8XX 2BMAA 1X7HA 4FGWA 1M76A 1VL6A 1GU7A 3VPXA 4CODB 5AQ1A 3WQSB 3TZQA 5L9AA 1T2DA 2YFHA 2PGDA 1P1IA 5G0UA 3DBLB 1Y1PA 2EKLA 3OIFA 5JYDA 1FJHA 3KYBA 1BDBA 1H9AA 1XDWA 2Q45A 1N9GA 1H94A 3VTZA 3DMYA 1WPQA 3RQSA 3D4NA 4R1TA 4BB5A 2J3JA 4AL4A 5IZCC 2NVBA 3A28A 3RUHA 1I3LA 1A72A 1H2BA 4JBHA 3HE3A 2RHCA 4DUPA 4Y6SA 2YDYA 4XGIA 4KDEA 4CM9A 4BNZA 4M49A 3OF2A 2EJVA 4RF4A 1ZK3A 4CLOA 3DZIA 2DTDA 4IQGA 5IXSA 1Q7CA 4RPLA 4ZICA 3FBTA 2H5LA 5L3ZA 4B4OA 1PEDA 3VH3A 3NJ8A 1PGJA 3I52A 3W1VA 4JNKA 4NIMA 1VI2A 4KDFA 4RPGA 4WLFA 2G5CA 1X14A 3AUAA 1PJ3A 4HADA 2Z95A 2CNBA 1V9LA 3VKVA 1NR1A 4AJNA 3O03A 4R5HA 1K3TA 2GGSA 4RLSA 1TI7A 2HMSA 1DBVO 4NBUA 3BIOA 3SJ7A 4ZD6A 1PS8A 5JFOA 4CLHA 1ZKMA 4FBGA 3I1JA 4CLRB 1AHHA 4YT4A 4Q3DA 4RVGA 1WW8A 3WGIA 3TSCA 4AICA 5A1TA 3U4CA 1ENOA 3GEGA 3KYCA 1NPYA 2I99A 4XYBA 4DQVA 2WEKA 5CDSA 2DAPA 3PHIA 4Q3AA 1PS9A 1LLQA 3TOZA 1RM3A 4PGFA 1YBVA 1Z82A 3GGOA 3NGLA 5DCYA 4ALKA 3INTA 4QUKA 5K6AA 3CEAA 1LLCA 3OQBA 1Y81A 3GAFA 4UEKA 2GR9A 4HNGA 1XLTA 2OXIA 4PIVA 4YYZA 5CPBA 1ML3A 2ZYGA 4U7WA 5TGDA 3RUDA 1YL6A 2Z1MA 3DTYA 4W9NA 3VVBA 1PJCA 1QYDA 4ND1A 5FF9A 3VZQA 4ALMA 3V1UA 3JD4A 2UDPA 5DOZA 1U3VA 1QSGA 5FI5A 3ONEA 1I24A 4X54A 3ZNNA 3LVFO 3H9EO 4RQTA 3INGA 3NKLA 1DIRA 1XELA 4B8WA 3WG9A 3AUTA 4OM8A 1E7YA 1Q0LA 1ONOA 3E48A 3DBRA 3A1NA 4MKRA 3VOSA 2NTVA 2FWMX 4TROA 5CEJA 1P31A 4GH5A 1FXSA 3PLRA 3DOOA 3EDMA 4OIMA 4ALJA 2Q2WA 1GYRA 2QYTA 2YY7A 1ISGA 3OJLA 4O0LA 3AOEA 3S2IA 5JDCA 3PWSA 2X5OA 4FOOA 1JA9A 2BRUA 3JQ8A 1O89A 4KUHA 3GT0A 1G6KA 2EP5A 3M1LA 3N74A 3RKRA 4YDRA 4YJFB 5JY6A 4H3VA 1IY8A 3IIEA 3DHNA 1UAYA 2Y05A 2BGKA 5TF4A 1NVGA 1VSUA 1N92A 2O4CA 3F47A 4F6LA 2JHFA 3TF5A 2X9GA 1AHIA 4GI2A 1LLUA 4IBOA 3Q9NA 3ZU2A 4B8ZA 2FP4A 2E49A 3QA9A 4LCEA 3G3EA 3GZNB 3PZBA 3LF1A 2P68A 2QZZA 4HBGA 4JK3A 4EUHA 2Q49A 3OETA 3ASUA 2Y1EA 4NBRA 4E5YA 1N7HA 2RIRA 3QV1A 1YVEI 1HE5A 3PYLA 2BH9A 3DZKA 2RH8A
chains in the Genus database with same CATH superfamily
1I0LA 4UKDA 5HM8A 2ACEA 3DVAB 1JB9A 1R4AA 3E9DA 2Z57A 2ZRNA 3LC2O 1KH1A 4K9RA 4OQLA 2HRZA 3U3KA 1ZGJA 2DJIA 3PUZA 1G8PA 3Q7TA 4R2IA 4YJ2B 4B4KA 1KFKB 1U1EA 1DRJA 1A8HA 4YCDA 2ONKA 1SZPA 1RW4A 4ZCTA 5D87A 3H0EA 4EB8A 1EXDA 2BGGA 3K5HA 2A33A 4PN3A 1NXWA 4URUR 1W0KD 1QYCA 2HNBA 3UJPA 2K2WA 2AFHE 3NKVA 5E7MA 3SXJA 4C14A 3U4IA 1RJFA 4G0ZA 4BUCA 4A6PA 4EGJA 4DLBA 3FUXA 4YCSA 2CXPA 1VJ5A 2VK2A 1FX0A 3SSMA 4M1TA 2JLXA 5TX7A 3CW2A 2HRBA 2P6MA 2WJGA 3NBYC 2QTMA 1DB3A 2PU5A 1Q7BA 3IQFA 2GXSA 4U2FA 3U7JA 1DFGA 3DO5A 3R7AA 2P5YA 3GLGE 3VPGA 5D5QA 1NBAA 4JV5B 3PEVA 2VLIA 1R4MA 1IY0A 2QR5A 1E1QD 4P3OA 2QT9A 3LZDA 4QYXA 3G79A 1B6GA 3C6QA 1QGAA 4ENWA 2FFQA 2HREA 4X8LA 5B1EA 4EHLA 1UDCA 5KYGA 3N05A 3MS4A 4QDTA 5TQVA 1H8EA 1U0JA 4D3ZA 4M8LA 4HEJA 3KVOA 5K0FA 3IKVA 4B6EA 1ZZEA 4MV4A 3LA6A 3WBFA 4QSHA 3S0JA 3PDIB 3GLSA 5FLKA 4EYOA 4F6RA 2FDCA 2D1YA 1YASA 3ZVNA 2DCUA 2XTJA 3DR3A 4OH1A 3FWNA 1OASA 2RIPA 3EWNA 4KZPA 7REQB 3WL6A 3DUWA 3AI7A 3LCJA 1U90A 3IIMA 3PSAA 4PZ9A 5CB4F 1JAHA 4PLGA 2IXFA 1D5CA 2G4LA 3INNA 5C8XA 1H2HA 5K0GA 3T7SA 2JLZA 2YS7A 2ZJ5A 1UQRA 3O4HA 1IOLA 3Q85A 4M9UA 4GP9A 5G0SA 4KQKA 4UHEA 5JSZB 4L4ZA 2GKGA 4FHFA 1T91A 4K3UA 5KKNB 5CVJA 2IS1A 3MS2A 3TI7A 4F91B 4PGGA 3ZJ5A 4CT5A 3P4YA 3NP7A 2EWVA 2DCMA 4QOSA 1U2DC 3RIEA 3T0GA 2CMFA 5TMEA 2QIOA 1NKVA 5FWDA 1R0WA 5JJKA 3QK7A 2E5LB 3VR5H 1A9OA 4PZEA 5BOVA 1J7KA 1EWTA 1CP2A 1G2PA 5IFLA 1W5AA 3E8MA 4OQPA 1TYCA 4A16A 5AVUA 3K09A 1YB1A 1JIVA 2HKIA 3GJSA 4Q7MB 4NBNA 5TGTA 2RGDA 3B1VA 1PUXA 3UMJA 4DYVA 2IELA 1S2IA 2ONYA 4ENTA 3EZYA 2GXAA 3A2KA 1Z16A 3CY6A 4PFQA 4BQSA 2H5JA 3G2HA 5CT6A 1C3OA 1RP1A 4MO9A 4Q05A 5FV4A 3ZJUA 4H16A 4YECA 2C7BA 3QYAA 2EJCA 3LQ2A 4QU5A 3WGGA 2HYIC 2FX5A 3B9PA 1CQIB 1RAGA 1KI8A 1AF4A 3G0IA 4PM4A 4RVNA 4X61A 1XHEA 2X4LA 4BWFB 4DN6A 2JIQA 2PTGA 1AK1A 4U7JA 1EFUA 3T3DA 1WD5A 3QFFA 1CRZA 1LF0A 1T4DA 1T5SA 2WMYA 3BIFA 5JMPA 2DUMA 3G0GA 3CNEA 3NIDB 1O2DA 4P3NA 5HFJA 1W5SA 5BUZA 4EKGA 1Z8FA 2VP2A 1RVV1 2OL4A 2PJUA 4K2AA 4UUOA 3WYDA 4Q7EA 1LFDB 3LRPA 1MAVA 1G291 4Q24A 2MSKA 2FZKA 1VOTA 2UXCB 3C4JA 4YN3A 2A9OA 5CHYA 5A9SA 4DRXA 4PCAA 1WBDA 4A0SA 4WNAA 3A1CA 1FYDA 4GQAA 2AFHA 4FGKA 1DP4A 3GGGA 1GLGA 1F8XA 3Q12A 4UNPA 5T5QA 1ISRA 4OHZA 3M4NA 5AW8A 5KYKA 1ORTA 2WIJA 4WCFB 5EFOA 1E1RD 4YR7A 4N0EA 1OHHD 5G4KA 1I51A 2XE4A 4EWLA 2J3MA 1O4WA 1QHGA 3JSXA 1RSZA 1OV4A 1UC8A 3ESBA 4R9VA 1A8SA 1MJGM 4X7PA 2NV0A 1UPBA 3LHIA 1Z0ZA 3LA8A 4V0OA 5IBQA 2KWIA 3MVEA 2KYRA 2I3ZA 3QGMA 3VBEA 4A9AA 1VMKA 2MMGA 5E38A 4BVAA 5JS6A 2JK1A 5K0SA 2G1AA 4MWEA 3NXSA 5JXGA 3SHQA 4HLNA 3E9ZA 1ZR4A 1K8YB 3HBLA 3NHBA 2G71A 3BL8A 1M2EA 4Q7KA 5EUBA 4KMOA 1WXWA 5DIFA 4B45A 1QIMA 1AUPA 2IK8A 4NU8X 5COBA 2X4DA 3RJZA 1OLSB 4RF5A 2H52A 3GR6A 4UEQA 4E2WA 4YJHB 2UZ0A 3I9LA 1TMYA 1DCTA 5D3QA 3SXUA 1KXZA 5ERYA 3WB2A 1XNRB 5FTMA 2V6FA 1JYEA 4OLJA 4OSEA 5FPQA 4F85A 1H6AA 1TMOA 4NHOA 4QEDA 3T8YA 4ETWA 4Z8XA 4LF5B 4IG9A 2XNHA 2Q5LA 2WJVA 3JASA 3SF0A 2NV6A 1C9NA 3DKVA 3IP9A 4FFWA 3M6FA 4Q16A 1NX9A 1KQFA 4CGZA 2HQOA 4TKZA 2WJAA 2HNKA 3OWXA 1V2HE 1T9KA 2FSUA 2AN5A 1NDUA 2OAP1 3UAOA 3NV7A 1QXSA 3HG7A 3ZVLA 2ZB3A 3RSCA 2JC3A 4XRRA 2PL5A 4PF1A 4A3SA 1LC3A 4JYPA 4CPDA 2BEWB 2YQZA 2J4DA 2PH3A 3AIOA 3BH7A 3RUAA 1ZD4A 5EFZA 3JYHA 1TTHA 1GTSA 3D3JA 1TVEA 3VMFA 4WACA 4GMKA 4RESA 3T3GA 3BGVA 1LVUA 1TJNA 4I55A 1DAFA 4MQEB 4UCWA 1S3IA 1Q11A 4YWHA 1EDOA 1JLHA 3RH0A 3CR7A 3CIFA 2XSZA 2CHUA 1L7RA 1VSQA 2QPLA 1GRRA 3ICCA 4N39A 2H65A 3MWDA 2X9LA 3CF2A 3QVWA 1HNNA 3OTWA 5AI5A 3KR9A 2ST1A 3TKLA 3ZDZB 1EAYA 3O8OA 2ZG6A 4LF6B 1U8EA 2QM8A 4D4IA 5FTJA 4ARIA 4IZHA 3G2LA 2NZ2A 3ZHRA 2B8JA 5LQRA 1T34A 2MTBA 1P9LA 3TQIA 3LYLA 2EFEB 3LP5A 4G5XA 4TMFA 1Q0ZA 3RTBA 3IAM1 1G20E 1WTCA 2CFOA 3E2PA 3RRXA 1ZGAA 4I9NA 3K6SB 1O6GA 1E6EA 5FPPA 1IAQA 3BD7A 3DL0A 4R2HA 3W3ZB 2IPXA 1BJTA 4URWR 3TMYA 2XYVA 4DLSA 1RCTE 1X1EA 3O5AA 1IXKA 3PUVA 1NW7A 3K3PA 4L6AA 1X77A 2I1LA 1FS6A 3G1TA 4Z9AA 1RIIA 4RUKA 5C3MA 3AX6A 3R09A 3GGPA 2A30A 4K6HA 3T5AA 3CWZA 1E64A 1TM3E 5E7IA 2FCRA 4MCJA 1V11B 3ENWA 2PGAA 5EXSA 3W3AD 1JVNA 2WJPA 3AEQA 5AK0A 1X15A 3OMXA 4NDZA 1Y1LA 3PICA 4P6VF 3RRZA 1RWQA 2RH5A 3KQPA 5A4KA 2PZ8A 3HKBB 2GZDA 4P35A 4L22A 1N33B 1VLMA 2FG7C 3OUUA 2ZJYA 4RS3A 5GVRA 1RDFA 4YUVA 3R8CA 4F0JA 3V7FA 3N2ZB 4PG8A 3THXA 3EAGA 4RV4A 4OO3A 1CZHA 3X44A 4XDZA 4XCVA 4G89A 1YAHA 3I4LA 2CUNA 1V47A 4OQFA 2DG2A 3UHFA 4O3FA 1USIA 5KYUA 4B6GA 3ZR4B 3BICA 2CK3A 5AW3A 1ZN2A 3OPXA 3C8DA 1TQ6A 2AOTB 3HJAA 1Q44A 4L7QA 2H2AA 5YASA 3TMKA 3U9LA 1UBTS 2YOFA 3KTAA 4A8PA 3GA0A 4PRZA 1JHAA 3W04A 1HE8B 4EY3A 4F93B 5ALSA 1QIJA 2QEQA 1CRPA 1RLOA 2JATA 5D86A 1OXMA 3CT4A 2R3SA 1BXGB 3CKLA 2PK3A 3UN1A 3L5KA 1D1QA 1EFAA 2HR1A 2X6RA 1OFVA 1V8FA 1FK8A 2E5FA 3LO8A 4UATA 3WMWA 4JWTA 3ZE9A 4MQBA 1L7NA 1V6AA 2CDNA 5LMCA 3I2HA 1NW3A 1E1QA 1U2TA 3M6IA 4GI3A 5EMNA 4BO4A 1YAJA 1M2GA 1T35A 2G06A 2GZ3A 4RK7A 4Y2VA 4HLUC 1YJCA 2XMPA 2XTNA 1ORVA 5H3LA 4O4LF 5HFNA 3ZQJA 1TTTA 3LWBA 3RNLA 1J5PA 2OUIA 3NWOA 3KELA 3KOUA 2ZCJA 3QBTA 3IJ5A 1EX6A 4AZTA 1R1DA 4I50A 4DCVA 2ZANA 2X0NA 2O3TA 1JU4A 4O4HB 2H51A 4KYUA 3HUUA 3SDZA 1OVGA 1ZG3A 3R5FA 2ECFA 3OECA 1WU8A 3SJZA 1SHJA 2ZKIA 3DW3X 4FM9A 4N8SA 2VQDA 2FW9A 3MBKA 3X1WA 2VDOB 5A6SB 1NP6A 3FSJX 3UY4A 4F96A 1XI2A 3PFKA 2Q5OA 2GF0A 4LPSA 3WQBA 3SX4A 3GLIE 4JS0A 4Q9AA 5B64A 3TW8B 4WVFA 2BHLA 1UT5A 2QLLA 3JD3A 1V1MA 4O1MA 5HXAA 2B2NA 3EGXA 3WWOA 4TYYA 4FYXA 2GBPA 1ZOOA 5AFSA 3ETGA 5JPIA 3KWJA 4ENRA 3TLGA 4PBTA 1FDUA 5G1OA 2OZKA 3LCUA 1D1PA 4D0NA 2BGTA 3HMKA 1GUFA 2I8AA 5DHRA 1Z5UA 1YGPA 5IH3A 1OLSA 3K2QA 3B38A 2EBUA 4J1QA 3TGPA 1REQA 2GN6A 4D97A 4X6UA 3V9AA 2C58A 1BC5A 3L6EA 2ZSDA 2LKCA 3PITA 3JS5A 4FEAA 4E5PA 2HJHA 1XRPA 1YIDA 1TRKA 2PEZA 3A3OA 4XQCA 5CDFE 5J4KA 5FTWA 3UWMA 1NIJA 3G0CA 1IHPA 5FUXA 3RVOA 4CEJA 1WXHA 2JGLA 3QQ5A 3B9RA 3MF4A 2ZATA 2P27A 1GZUA 4I6EA 1VHWA 3I2YX 5BSMA 1AGRA 4GRAA 4F5DA 1SIOA 3WZ2A 4MV0A 2I7CA 1HR0B 3I9KA 3KKPA 1I4EB 4EJSC 1UMKA 1Z7EA 4BNFA 5LUAA 1T13A 1KO1A 1XTBA 4YMHA 2QOEA 4XYEA 2RGNA 3QFHA 1DKOA 1A71A 1UZUA 2HMAA 2QJOA 4AT1A 1JHYA 3ZGYA 2F67A 1BKDR 1F17A 3LBIA 3F8SA 3P9XA 4JXZA 5B30A 2XKJE 4PTZA 1ZCBA 2I6GA 3IIKA 5AM1A 2O52A 2PQ0A 5DHTA 3OLVA 4R8RA 1WXGA 2BGIA 5DBIA 3K5PA 3QM1A 4F97A 5L3SB 1ENZA 4MEJA 1U9ZA 3CUTA 4Y0NA 1SZCA 3U4GA 2PS0A 3VSBA 2P3OA 3ZUGA 1H2FA 5JW6A 2RHMA 4FYVA 5FNVF 5LU8A 1XQWA 1U6KA 3OHPA 2R1UA 4N03A 4PZCA 3MTQA 3GD7A 1RNLA 3NCHA 1NUTA 4TLCA 2J9GA 3L7NA 4TMVA 1NFFA 4BLQA 3DMPA 1M67A 4FC6A 4LWZA 1VDMA 4KPEC 2I3BA 1E4YA 3IKTA 2O7SA 3JAKA 4TVSA 4ZA2A 4KQFA 2HYDA 4BFUA 5BN1A 3KOMA 2BDUA 1V5EA 2AG1A 4DQKA 3FBWA 1RC1A 3QOWA 2PE5A 2SKEA 2AC2A 4JX8A 1XNQB 2QQEA 4DQLA 1N6OA 2WZBA 4UQOA 1J09A 1ODIA 5IDYA 3W0LB 1JHQA 2VP3A 5C4IA 3VSEA 1C3VA 4LGCA 3BK1A 4WFJA 5I7HA 2XCUA 2WA1A 1OBFO 4KR6A 3H8VA 3R2JA 1GY8A 4IL5A 4DV6B 4F3TA 5L4SA 1VLZA 3IAHA 1OOEA 3L18A 4I1UA 4JOCA 3THXB 1JFVA 3W8NA 2FOLA 2OGSA 1KS9A 3DBHB 4LTDA 2CVFA 2J3QA 3H05A 1J1ZA 2JD1A 3MTDA 3EN0A 3TGLA 2G83A 4PG6A 5FFNA 5BW5A 5KHOC 2HGSA 1ML4A 2CLFB 4B6JA 5JQGA 1PZEA 2C2MA 1P4RA 2I4IA 1F3OA 3O73A 3A9CA 2ZDGA 4QHTA 4ZU1X 3SC2B 3CSUA 5A7HA 2QSYA 4HLQB 4DSOA 3H75A 4QASA 5K7SA 2C96A 1P8AA 1RBZA 4HI0E 4RLQA 1C0KA 4WA8A 4ETNA 2DFNA 3NYQA 3OI7A 3U80A 2VDJA 3KWLA 2VXOA 3OO0A 4MVWA 5C7IO 3LX5A 2H57A 2B98A 5DK4A 2OV3A 2ES4A 4TS1A 4YAIA 1AHPA 1E1CB 1DO2A 2C2ZA 4JKYA 4NEGA 4R9NA 1HFWA 5F73A 3VVLA 4HB2A 2X3FA 1HLFA 2P3QA 2X0RA 3C1UA 4RLHA 1C1XA 4CDMA 1MV5A 4DCOA 4BOYA 1XZJA 2O19A 1WUIS 4YV1A 3QVSA 4IIXA 1DHRA 2FRDC 3PDUA 4P08A 3T7TA 4AJ4A 1QV6A 1Y5LA 4LXTA 4ER6A 5LQNA 1JZTA 1Q92A 2VJCA 5CURA 4F2HA 4AIIA 4P53A 3EE6A 2IYRA 3F4KA 5GJVC 3KKEA 3ORYA 4L5CA 4GEKA 4N9WA 2OXTA 2P1RA 3QELA 1X9HA 1X1RA 3H3JA 1NMSA 2WW8A 3B7WA 3RIXA 1Y9DA 1GR0A 4X3CA 4JI8B 4MAAA 4DSTA 1LUAA 1LSOA 4HEHA 2IS6A 1GFIA 2F3RA 4HXGA 1X70A 2OTCA 4R1NA 3CBGA 4MDHA 1T0HB 3E0XA 1P9NA 4GGMX 1RWVA 3EPHA 1MNQA 1OWPA 2ISCA 3IQDB 2FGJA 4TWAA 1TB4A 2BFAA 3D3WB 1JU3A 2BR4A 5AM5A 3HYNA 4P4NA 4XRGA 2UVDA 3Q9LA 4RW0A 1I9CA 2WM2A 3FLAA 3FPAA 2PS3A 5AW9A 4W5QA 1OB5A 4IVRA 4ZANA 3K9GA 1U28A 2Z83A 1DRUA 3IV6A 4LRUA 3D0OA 3ZWVA 4L78A 1ZUWA 4IWYA 2PWZA 1NI4B 4R98A 3TXAA 4OI4A 2ZS9A 3VZCA 4NJMB 4HNRA 1ULAA 1LRKA 4LGVA 3SDBA 2VP6A 4RFSB 3ZI4A 5IUJC 1P4GA 3B85A 3ZX5A 3BTVA 1IDOA 5KOIA 2JJYA 3NUGA 4UHFA 1W75A 3RK1A 2W22A 1FDRA 1FW8A 2ZTSA 4NX2A 5L3RA 1ABBA 4FYPA 2QYHA 2PRYA 1JE1A 1NT4A 1ZEJA 2GN0A 1A1SA 3DE7X 4IW3B 4P5EA 3GLFA 1FA9A 1JFRA 5BQXA 4FILA 4HHEA 3CR8A 4MRSA 2IBTA 4K81B 5FIUA 1SKQA 4B9AA 2WIKA 4BXOB 3V1YA 3FE2A 1GWNA 3CLKA 2WUFA 3HSKA 1QVWA 3NEYA 4UUQA 5GONB 3U37A 4CTMA 4YMGA 2P6RA 2A0FA 3ZVRA 3TCNA 3ADCA 2J0EA 5FOQA 3FRHA 5IJAA 2WHPB 4QC2A 4EFLA 4KWTA 1OPXA 3MWYW 3Q5EA 4PV7A 3VTAA 4TYNA 1YRLA 3L9XA 3K96A 1OCEA 2W37A 3HU1A 4WGFA 3C1TA 3RU2A 2OM2A 3M1AA 2NVOA 2OXCA 5HCIA 1U4SA 2BR5A 3BEOA 2Q41A 4R1MA 3BFXA 3RAJA 5BSRA 3MILA 4Q9JA 4RTLA 4NNPA 4EBBA 1UPUA 3D4IA 2JIPA 4UQLA 5TQ0B 1SKYE 3KQVA 5ED4A 3I5YA 1H66A 2J7PD 2O6LA 2PMWB 3D6MA 4INOA 1RYFA 2XB9A 4URYR 3TRHA 4C20A 4F4UA 3LY7A 3MHPA 1EVJA 1QE5A 2EKPA 4H08A 5L4LA 1KSFX 3AZPA 3FFWA 3FAZA 1QFXA 1L1FA 1MG5A 2QMOA 4GKKB 4X63A 4IIFA 4IIHA 2V5AA 4KREA 1KK3A 1Q6YA 2AGVA 3AYZB 1JFSA 2XUKA 5KWEA 4OXKA 3THYA 1MCZA 2AC4A 3GXBA 2ZGVA 1E7QA 3NEAA 3TJZA 4ND2A 2CYAA 1F12A 2AQHA 1XTKA 1Q1ZA 4MO2A 4TL9A 2O06A 3STWA 3CZCA 1NNLA 4CMAA 3UMFA 1GPLA 3R7DA 1KOJA 4ROTA 1PHPA 1DXOA 1I3KA 4KPGA 5CH5A 5KZMB 3KB6A 1N6LA 5JD6A 5ULLA 2JIRA 2WYHA 1VLHA 3G0DA 3FBGA 3GLKA 4B3IA 3EJ6A 2X15A 3PEFA 4B1FA 1J23A 1RPAA 3GJ8A 3LPMA 3EY4A 1BX1A 4I4TB 2BVNA 3LT4A 2FUNB 4TKVB 4DSUA 1T1IA 4BQRA 2VHZA 4HFMA 4RH1A 1NVDA 2IPLA 4D2IA 3FFAA 1C9EA 2FW0A 4CLEA 3HADA 3ONFA 4PSDA 5K3EA 3AF6A 2J32A 5CNIA 4CM7A 3TVYA 2LXNA 2QW8A 5IYZF 4CM5A 3OM8A 3E2MA 3KEMA 4QVGA 4GPTA 4OJQA 3WNZA 4BNTA 2CNOA 1BWSA 2QVXX 1VIMA 3QTLA 1UPAA 4WA7A 5IH7A 1X42A 1C50A 2XAUA 5H59A 4DDKA 4HNTA 4KH1A 4HQNA 4B6PA 4WJLA 3AVVA 4P3YA 1TK9A 4ID9A 2VO1A 4C43A 1ESNA 4H7EA 4Q1BA 5E6RA 2XSZD 4UTXA 3TR5A 3SICE 2QRHA 3T1HB 2YMPA 1V16A 3SXPA 1HYBA 1M1YA 2O2JA 3FIJA 4B3HA 2QD1A 3EOZA 3VJRA 3TD9A 3DBVO 1YI8A 2HJVA 2FKAA 5IT0A 4EJSA 3R9WA 3FPLA 2F6RA 2WU8A 3IJEB 4MKHA 3I9JA 4TLEA 2XOKA 1J8YF 3CIOA 4WTOA 4MS4A 2VZ9A 5GV7A 4BFCA 2I5PO 3HR4A 1QH1A 2QDKA 4W1QA 4EHBA 3NWBA 2QUZA 3H1GA 3DMTA 2O9JA 1D4OA 1QWOA 1EZ4A 1RAFA 1ZGGA 1GP2A 2P78A 2PT5A 3DD5A 3DMHA 5JS8A 2R8PA 4MW1A 2ZRKA 1GAJA 4RPJA 2NWQA 2BLNA 2EL7A 3T9FA 3TN7A 1K5DA 4P92A 2BELA 5B1IA 1ZISA 1PWEA 2VH5R 5LP6F 1YHNA 3QXHA 4X20B 4BNNA 5E6SB 2BFFB 1UFRA 3O21A 1ZEMA 4H31A 4QPPA 2YJZA 4TM7A 3SQMA 3WL5A 4CQLA 3LL7A 3OPYB 1APBA 2F3PA 5BQ5A 1ZBDA 3AUFA 2DTXA 5DISB 4EFDA 5LD2B 1E7SA 4U00A 2YWCA 1DKPA 3EYWA 3E22B 4IDCA 1MFZA 3NYIA 3SHOA 3ZU5A 2OO3A 4LPKA 4CT0A 1FTNA 2PNJA 1O7JA 3COZA 3ZWYA 4HT3B 3P71T 4BJ3A 1GSIA 1M54A 2N3ZA 4JFRA 3WKBA 5A4FS 1SRRA 1ZJ6A 1ABFA 4MYSA 3HCWA 2X0FA 5J2TA 2ECOA 3EGCA 2UVPA 3MTGA 4PONA 5KVQA 3H42B 4EEZA 1QNLA 2HUPA 3HB5X 1RQGA 2R8YA 5B12A 3GUUA 2VPTA 4ITRC 4RSGA 3J7TA 1R9NA 1A27A 2A9FA 3D2CA 4HQLA 4UUPA 3IT3A 3KDSE 2Z4TA 1A2QA 4GYYA 4X5OA 2HW8A 3KIPA 3ND7A 3U60B 3FTCA 3DFFA 3JVEA 2OWDA 3G5MA 1IPEA 4LGMA 3K73O 1DAGA 1W581 3VNUA 3PUYA 2JB9A 3LDAA 4L9AA 1XA3A 1LV8A 3RUEA 3L8FA 3OJCA 4C7MA 4K28A 1U65A 4CM8A 7MDHA 2OG1A 5LQAA 3TR6A 3GJTA 4OUDB 4EUSA 2CCKA 4D02A 1KMIY 3AEXA 3NLLA 5KQMA 2I4OA 3FNEA 1JMYA 3M4ZA 1MZVA 4MQFA 5IBCA 3SNHA 1E6LA 5BW6B 3B70A 3PUHA 4FEYA 2DQZA 1LC0A 3DB2A 5CXXA 3JARA 2D0PB 1AXRA 1WDMA 1I2BA 1XL0A 2YZKA 4C4AA 5IC4A 4K8OA 2WG2A 2PFKA 1G4AE 3NTLA 5G4LA 1KAOA 1X1DA 2WJIA 4PQEA 1N7GA 1UMCB 3D8SA 1CUDA 2C57A 2OBMA 2OD7A 2X7XA 4P7BA 4N6GA 3VPFA 4BAUA 3RRJA 4OSOA 5KOHA 2O2YA 3AI2A 3HCDA 3U62A 1SBZA 3BJMA 2C00A 3S2FA 5JRZA 1RCFA 3TEMA 3NDBB 3KQTA 5JCJA 4JLPA 4NYIQ 5J2UA 2HXGA 4YUWA 5COQA 2QW1A 2P2LA 2V7PA 4FQ8A 4OP1A 4FYJA 4RACA 4XEHA 2V97A 3TLGB 3EGEA 5FR1A 4TVKA 2ODAA 1T5BA 3AR5A 4DGQA 5LBTA 3W6OA 1IXZA 2Z6UA 1K7SN 4JI1B 1E7RA 3L8MA 3G88A 4E6EA 4GYKA 2ZSIA 1F2UA 1Y3FE 2P7IA 2FN8A 5H82A 5ALHA 2XOEA 2GM3A 3OZSA 5ICFA 1AKEA 1EUCA 5LB2A 4TWZA 2VEOA 1ZCZA 4X97A 3QFSA 4A27A 3ZHUA 2REQB 2ZVQX 4YQYA 4ZOQI 2NZ8A 5B3AA 4AJLA 2XYQA 2BM8A 3SR3A 2OZLB 2ZPUA 3EEBA 3MJSA 2R11A 1DOHA 2LTAA 2O5RA 2BMFA 4KODA 5GJCA 2OCPA 1Q3HA 1IC6A 3NONA 3EZNA 2EWMA 3SQWA 5ALLA 3UCFA 4V0NA 3TZKA 3AY0A 4GMDA 3ZS8A 1YB4A 3KQMA 4B4UA 4RLFA 2EWWA 1EDBA 4GMFA 2G36A 1U4NA 2IOHA 3N28A 4ZOLF 4ENSA 3AW8A 1NPDA 4V3CA 5HQJA 3VR4D 2H3EA 3FHCB 2O8DB 4NNJA 4FT2A 4KRYA 4R01A 3ONNA 1V43A 3HBAA 4M7OA 4QBTA 5DB4A 2PUTA 3V3TA 4B43A 2BYTA 4IDEA 2ZVJA 1MW8X 1B3BA 3EZFA 4BZXA 2JPDA 2HK8A 1SAYA 4KIGA 1OKKD 1Z4PX 1IVNA 1U0EA 2AMVA 2X7JA 4R69A 4ARZB 4IJUA 4D43A 3R40A 1YACA 3BOSA 1PFKA 1XIVA 2GJKA 2ZULA 2WMNB 2BBWA 3UVEA 5EWJB 3DZJA 2V58A 4JBNA 2VZLA 1NP7A 1M1YB 3KOOA 3OIYA 5C2JB 4CG0A 8ATCA 1XRRA 2Z09A 5IN5A 3VR3A 4OQDA 3IPXA 3VR5D 4NNOA 1M1UA 1C41A 4CQNA 5HF9A 4RZQA 4WWHA 2X8BA 2HU8A 2VHYA 4YONB 5FOTA 2A9QA 2Q2OA 3QVGB 4WY2A 2C5LA 2I8LA 3RYIB 1AGXA 2X6TA 3UO8B 1WB4A 3AUJB 3ESAA 4B87A 1XTUA 3EZXA 5BURA 4XM0A 3DLBA 3BRQA 2PH7A 3F6RA 4UHCA 1EH5A 1SD2A 5IJ0A 1GCIA 2ZBGA 3IT0A 3LUHA 1JYFA 3I0ZA 2BJHA 3R7WB 5JBQA 3F7OA 5KYXB 3KQUA 4I81A 4X6XA 4BO7A 1H42A 4WOBA 5A4DA 4YCCA 3PQ8A 1GILA 1QV9A 2FE1A 5FHQA 3VO2A 3GIWA 4UMDA 5LVAA 4DKJA 3VNBA 2J85A 3BULA 1XD9A 2OESA 4HBZA 3M5PA 4KOAA 1YS7A 1KRHA 1NYRA 3ENZA 3H4TA 3NGMA 2VHXA 4FZ5A 3WYFA 2W6MA 1M7GA 2HQSA 4ZALA 2DVMA 3W79A 4I9GA 5GVSA 4LV5B 4AK9A 1QRDA 3MTIA 4JELA 1K8ZB 2R1TA 3E4DA 3O93A 4J1SA 3EEOA 2P9GA 3A25A 1BE0A 2DUNA 5JXWA 2OCXA 3PD7A 1LWOA 2WOJA 5EHGA 5K4HA 4MVJH 5I5EA 2BFCB 1OAAA 3IEXA 5F3DA 3TSOA 2VJLA 4EVSA 3F78A 4L73A 4EW3A 4ZCLA 4F86A 2NQTA 2G7ZA 1WKVA 2VN8A 3AHHA 2D3WA 4W5HA 5ARBA 4E12A 1DAIA 1Z63A 3EQZA 2UZ1B 4IICA 2OGZA 2ZQYA 1PVVA 4QYTA 5LN1A 1YHYA 1J22A 1LPMA 1XVIA 2X8AA 3IULA 4IQ0A 2IRWA 2YYAA 1RJGA 2F1KA 3UHOA 1IJBA 3EARA 3GGSA 3A6LA 5IX8A 1CUFA 3MPOA 4J2TA 3L9WA 5CG2A 1KDRA 3CXRA 4UVEA 1V45E 1J2TA 2HBQA 3MW8A 4XPZA 4TQUS 4ZCSA 1TTPB 2BP7A 7MHTA 1EVYA 4KR2A 4LZNA 1SQ5A 2Q9AA 4NPAA 1J2UA 1FVOA 1RZRA 1NN0A 2HMVA 5CYFA 3KSBC 2B4YA 1MP0A 1EX7A 1IOZA 1IMJA 3BMQA 3FSEA 2WFAA 3BJEA 4QEKA 2DQSA 1EXMA 3ZZTA 1QQBA 1ZCFA 3S27A 2ZVPX 3TQHA 2VK8A 1U3WA 2XYHA 3G2NA 3KM0A 5C3UA 5IMSA 1DUIA 1KEPA 3GK3A 3IVRA 1QPZA 4JJ8A 1XSEA 1H65A 4M8IA 3VH4A 1EHCA 2Z1NA 1Y3DE 2F9LA 1MH9A 2CF6A 2W4MA 5DBOA 4KAXA 2CVOA 1JFLA 4D9BA 3N7UA 3WB0A 5KVSA 3ZWXA 1U8FO 1QRUA 1EUCB 2D5IA 5CFZA 4BP9A 3WAJA 3GA5A 2PXHA 2LVBA 3N53A 1KOFA 4ISBA 4BVHA 3LY8A 4KQXA 3JWPA 3WS7A 1J97A 2JFYA 2ZRMA 4OATA 2I03A 1MEJA 5DXAA 3PGXA 3WK7A 1FDTA 1CS4C 1E2GA 2HADA 3Q10A 1PWYE 3FKSA 3WWYA 2XCQA 3E81A 5JJ5A 3MN1A 4ZQBA 1EFTA 1DARA 1T6ZA 5E0OA 1U8UA 2EG9A 3Q0EA 4NFYA 1UMDA 4KMSA 2EDCA 3DBRB 4ZCQA 1YRQA 1EFVB 2DHEA 3NWJA 1D4FA 1VQ1A 3V8VA 1VFPA 2PRZA 4PAQA 1SD5A 3P9YA 4PYLA 1E3IA 4R9SA 4I08A 1NW9B 2FZVA 3MWLA 4EKYA 3DTVB 3A6PC 2FOIA 3FR7A 4YFYA 4CMIB 1Z4LA 2HT6A 2BC9A 1P60A 3VNQA 4N0MA 2QT0A 3ACCA 3E84A 1PG5A 3I8SA 3WK8A 2P11A 2F48A 1DCKA 4AJHA 1JXMA 3IIIA 1Z2NX 1MR3F 2ZIXB 3RSSA 4DARA 3RC1A 1KFCB 2IGTA 3C7AA 3I04M 3V8NA 4PRKA 5AT1A 4CDNA 4F9TA 6NULA 2FUEA 3W5SA 1E9EA 1PT7A 5AKIA 5I01A 1UOOA 3EXG1 4QDUA 1QDEA 4L9RA 4YP0A 3NBFA 3QU7A 2AG0A 5LZ9A 2G40A 2J5KA 1VKHA 5TE9A 4A8JB 1R7RA 5CA1F 2P90A 1WF3A 1CJMA 2PV0A 4G56A 1SN7A 3W2EA 3LGAA 1W94A 5JO9A 4CN8A 4F2PA 4F5WA 4OX9B 2EU8A 2Y1FA 3BCHA 2VCYA 3Q8XB 1W30A 4L2IB 3FCXA 3SHVA 3AHJA 4QVIA 1V4VA 3DXZA 1PF7E 4I1YA 3H5OA 5ILQA 3SF8B 2OEPA 1BJRE 1DTWA 2JS7A 2TMDA 4G1FA 5F21A 2XCIA 3GLTA 2NUPA 1IZ7A 2LIPA 2UUPA 3IP8A 3SHFA 1NG9A 3D64A 2JFZA 1TKAA 2CHGA 4JYAB 3O4IA 2FHSA 4PG7A 4TV9A 4BNKA 2D3TA 2ZWPA 4MWSA 5GM2A 3NBZC 1JRLA 3KKNA 3JD1A 1SUEA 4C3OB 1ICEA 5EUQB 5DN9A 5DLPA 4MTLA 2VI5A 4WLNA 2GESA 3WL4A 3N76A 1O9GA 2DBQA 4DV0B 3BIXA 3OOSA 4EF4A 2D59A 2D5AA 5BVHB 2Q1WA 2GD0A 4ZJYA 1KI6B 3TGWA 1KFJB 4BV2A 3NHLA 3ZE7A 3AM4A 3K71B 2I29A 2PTHA 3BQMB 1GAWA 4PIPA 4V0LA 1G8YA 4G9EA 4YTEA 5IN4A 5IDWA 2Z3WA 4BKOA 1QVRA 2JHGA 4ASUD 4F9EA 3AB8A 1DZIA 1TCAA 3PG5A 2F17A 3KZOA 1AKQA 5CK4A 4DV7B 2PKRA 4LJ6A 4EB6B 1L4KA 3KETA 3ZV4A 1DKLA 1RLMA 3ILXA 4C0KA 3RVQA 4IS3A 4J4BA 2QA5A 2QVCA 3EVTA 2I3AA 4EQ6A 2Z9BA 2EFGA 4DZZA 1WKBA 4GU5A 1M2WA 4W82A 1FMLA 2R5WA 2OCYC 3CWQA 1IQPA 1OGYA 1M5UA 3RW9A 4LMBA 3SFZA 4YPVA 2IDJA 1CZUA 3KXLA 5FAXA 1TVMA 5CVTA 3GFGA 4OHCA 5TS2A 5E95A 4UOZA 5C51B 4E1VA 1MRZA 3HJTA 4URVR 2C3YA 4TTVA 5F64A 4XM2A 3SYLA 1VZ3A 4PAMA 4Z9YA 5FWXB 5LYJF 3QBDA 4CTJA 1F8GA 1SHZA 4W5JA 2II6A 3KL2A 1PQ4A 1XDBA 2JH3A 2HZBA 3EH2A 2V65A 1AV7A 1L7QA 4JLWA 4BBZA 1CY7A 1VP3A 1U3TA 3EBLA 1R8YA 3I5MA 3H2KA 4DG8A 4XVUA 4J16A 1CUYA 2Z2YA 2OBXA 1ZD5A 3KOYA 3ICVA 1Q7GA 1GL3A 4DWWA 4DS3A 2XLBA 2TS1A 4QULA 1U2GA 3U13A 5CVDA 3GLGA 2QL5A 1DKNA 1L1QA 3A1TA 4G0MA 4QRHA 3ZHBA 1YS1X 3T5CA 4X8OA 4OCZA 1W9MA 121PA 2VDNB 2XIJA 3BKXA 3SLRA 4NCKA 5GINE 5UKDA 4A5OA 2PPVA 3DOEA 4CNBA 1LPPA 3G6WA 3H5WA 5CYPA 5KSWB 3U3JA 1U0LA 2ZAOA 2E3JA 5FI3A 4PN7A 3GEPA 4ETMA 4WFIA 4TXJA 4DHWA 1UUFA 2I22A 5E2IA 1ONPA 5BW8A 5JPDA 3U6KA 1ZH0A 1V48A 4UU7A 4HH0A 3HHPA 3CBQA 5LZ7A 3VX4A 1QK4A 2PAFA 1YC2A 3PHCA 2WU1A 4OOFA 1XEAA 5FUWA 2FK7A 3IGFA 3F3KA 4L74A 4N3NA 5COAA 5KNBA 4GHWA 1WOYA 3FOBA 1FMCA 1OQAA 5IAKA 5MFPA 5FNZA 3VNAA 5I7WA 4LDRA 1OILA 4LHSA 1FYVA 1YWGO 3S5UA 1GFZA 4A1OA 1Z36A 4PSUA 1MLDA 4A03A 5ALJA 1HM5A 8GPBA 1E5TA 1FBTA 4FHCA 4YAEA 3ZBPA 2IEYA 3JALA 3HB4X 1J70A 3OY7A 3OZVA 5G1PA 1JQAA 1G9SA 1N2EA 3OE7D 3QYJA 1YMQA 2DPGA 4P33A 2CXTA 1YRYE 4RK0A 1K2VN 1KHHA 1KZ7B 1CRWG 2EZTA 2WSLA 4M1KA 4I8DA 4CM8B 3VA7A 3PTAA 4L16A 3AESA 4X92A 4Z54A 1FXWA 1WCV1 1I9GA 3IUPA 1N6RA 3R7LA 3C3EA 4M83A 3LBAA 4NCAA 3E9MA 4XSGA 1G8HA 2OORA 1K89A 3AY6A 3K1YA 4H3SA 5E3HA 1N2XA 2JBAA 5BQOA 2BI7A 3OKPA 2B1IA 4LHEA 4DM3A 2IT1A 1QONA 4KGVA 4YY3B 1I4OA 2CMKA 4KE6A 2YIDA 2CHVA 3RTEA 1E6UA 2ZTHA 1FNNA 3HL4A 1JEYB 5HSGA 1IEVA 2HSEA 3KJZA 4NTZA 4WZZA 3CVJA 3L7IA 2P9BA 2Z8XA 1H5QA 4JBIA 5EJ4A 2CNWD 2VDWA 4MYRA 4JBYA 3FLBA 5CU7A 5KPDA 1G1MA 1R3DA 2G1PA 4MW6A 2P4HX 3MA0A 3ASZA 3ZYCA 4C5BA 1QZUA 3CMMA 1E8NA 3FCAA 3R77A 5C4GB 3GROA 3NZEA 3L0PA 3HZOA 2ZI3A 3F98A 5JLAA 1X7YA 3IUEA 2ZI9A 3T0IA 3CLRC 4GE0A 1FTGA 2ZBRA 4OB6A 3EULA 2LDXA 4L8GA 5AO9A 4QG3A 4KK3A 1Y6GA 1D1SA 2MWMA 2HM7A 2NYVA 2AQKA 2RJ3A 4Y9DA 5DHQA 2HWXA 5EJIA 4Z53A 1QU2A 4TKUA 1KWKA 4MI9A 5CA0B 2SHKA 1UIRA 2RI0A 4FX2A 4IPTA 4MUGA 1YS4A 2CLHB 4NPHA 4MOWA 2D1RA 4LDJA 3HXLA 4WDQA 4B85A 3FKQA 1WPGA 4IDNA 5KOYA 4WNYA 3RT7A 4PLTA 4S0ZA 1HDCA 4FX5A 4QGAA 1GXSA 2Y77A 3MJCA 3O2QB 5H3CA 4B7ZA 3IOBA 4R40A 2H1CA 2QSZA 3J81A 3ABQB 1MVOA 4TL6A 3WLHA 3UH1A 1W85B 2WHQA 1P39A 2X2PA 1PGNA 3JQ6A 3WMRA 4Q02A 4FBLA 5ESWA 3F67A 2BKAA 4YREA 2VWPA 3SZOA 5KTTA 2IZ1A 1V1JA 1V2GA 2ZJ6A 3I9FA 2VK4A 3KJEA 3IJPA 3OT5A 3PJGA 4EYGA 1HDEA 2PN1A 4B2PA 2GAAA 5KNDA 1COZA 2I2WA 2PMFA 2VL7A 1ZGCA 2WUEA 3O74A 4IGKA 3HA3A 5EWLB 3A06A 3ZZ0A 1I7PA 4CQMB 1XR3A 2JLQA 4IDOA 2GO7A 3PUJA 1XPJA 2FX2A 3HFJA 3O8OB 1MGPA 3DO6A 2A6PA 3EPJA 5EIXA 2IXTA 2AF3C 3A3KA 3GMTA 2XAAA 2QHXA 3IDAA 3OJFA 5ALYA 1EUDA 1SBTA 3KEFA 5FNVB 3TNYA 4A4DA 4UTPA 2QRPA 4QTZA 2LE0A 5AIBA 4WVLA 4Q3OA 2CDAA 2OK8A 5KKAA 5BSUA 4RK1A 2CD9A 1TZCA 2ZCVA 4I55F 1XTIA 1WDLA 3P9ZA 4JC4A 4MUEA 3S29A 4CDGA 5I9SA 5HRAA 1JG4A 2XLCA 3I76A 3GPLA 5AOBA 1O77A 1OJ7A 4LN1A 3MTJA 1YJ5A 3BZUA 1SQGA 5JH7A 2WBLC 1XPUA 5HE8A 1KJIA 1P7ZA 3LLCA 5F7OA 2OHHA