3VPFA

Complex structure of lactobacillus casei lactate dehydrogenase penta mutant with pyruvate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
311
structure length
306
Chain Sequence
b'ITDKDHQKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFTSPKKIYSAEYSDAKDADLVVITAGAPTRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSVHAYIMGEHGDTEFPVWSHANIGGVTIAEWVKAHPEIKEDKLVKMFEDVRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-lactate dehydrogenase
molecule tags Oxidoreductase
source organism Lactobacillus casei
publication title Crystal structure of penta mutant of L-lactate dehydrogenase from Lactobacillus casei
rcsb
total genus 103
structure length 306
sequence length 311
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3vpfA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 3vpfA02
1SOVA 4MVJI 2BH9A 4OKIA 3IP3A 2DUUA 4ZD6A 3TZHA 3PHHA 3WTCA 4KQXA 1DXYA 2SCUA 1F17A 3ZCXA 4D42A 4YBZA 3ZWAA 4BOYA 3FBTA 3GVPA 3RJ5A 4N54A 4M1QA 4J9VA 4R5HA 4Y8VA 3OF2A 1NASA 1ZH8A 4YQZA 4BVAA 3RSHA 1EMDA 1NR1A 2CF5A 1ENZA 4IMRA 2XPCA 4PLHA 1UP6A 3ETGA 1HLDA 3WSWA 2JFFA 1E3SA 3I9LA 1B8UA 3UAGA 3VVCA 1E1MA 3GNQA 1ZK0A 4NBRA 4XB2A 1LQTA 2QRJA 1UAGA 4LK3A 1C1DA 3LT1A 4L4XA 3F4LA 2RBEA 3BMOA 3RKUA 2A4KA 3HFGA 4CLRB 4RPLA 1YRLA 4LCJA 4XR4A 3TWOA 3KEOA 3OJLA 4GSLA 3VZSA 4U6SA 1R66A 3AOEA 4FFRA 2IYOA 4PRLA 1U8FO 4D79A 4QX6A 4DRYA 1EFLA 1VE9A 3KTDA 4BNFA 3I5MA 3WIDA 5H83A 2B5VA 4WCDA 3ZWYA 2BFOA 2VWQA 3AI1A 3RFXA 1WLYA 3PTZA 2ZKLA 4UREA 3JQ7B 3UXYA 4F45A 5CAEA 3DZGA 3CMCO 1B26A 4CQLB 2YFHA 2JD2A 2GUGA 1JAXA 5T6BA 5TGDA 3VTFA 4J1NA 3ITDA 1MLDA 2I5PO 3PYXA 1WMBA 4IGEA 3WGGA 2JHFA 4Q3EA 3AI2A 3KYCB 1MGOA 4BKRA 2PZJA 1ZEMA 4DQXA 1C1XA 2RHCA 4D0SA 4TZTA 2P4QA 3L6EA 5KVQA 4IDFA 5KWEA 3A4VA 1Z7EA 4UEKA 4JN6B 1DAPA 4MP3A 4NBVA 5TQVA 3VH1A 1XYGA 5B4UA 1KEVA 1LC0A 3RBXA 4E21A 5IN5A 4GL4A 2WTBA 1CETA 3JYNA 4RPGA 2V6GA 3DZIA 3EHEA 3PJEA 5L53A 1E3WB 2EHDA 1O8CA 1YS4A 2CDBA 5T5QA 3DL2A 4MDHA 1L7EA 3I6IA 1MP0A 3V8BA 2NV6A 1HLPA 4IQ0A 1V9LA 4FIZA 5TRTA 1E1LA 3E9QA 3RI3A 2ZTVA 4BO4A 4CQLA 2NACA 2HJRA 1IOLA 5I7VA 3S2IA 1N1EA 4GH5A 3TJRA 3H2ZA 1QLHA 1A4UA 4A27A 3VC7A 4S1VA 1K0UA 1U7HA 2OGUA 4OQYA 4IY1A 2GDZA 1RYDA 5LCXA 4KDEA 1NXQA 3I9MA 4KTTE 1DHTA 2J3HA 2Y1FA 1H5QA 2AQHA 1HE4A 5G4LA 1XR3A 1UP4A 2Y1DA 7MDHA 1PJ4A 2VOJA 1CERA 1LBEA 1RM4A 4BO2A 3OHSX 3GZ4A 4P38A 2NNLD 4JNKA 4OSPA 2AW5A 3L9XA 4CMIB 1CEQA 1JVSA 1BXZA 1N8KA 2WM3A 5KJEA 1LRJA 2QX7A 6LDHA 1EUCA 1I33A 3CXRA 3AY7A 2AXQA 3U62A 4RZHA 3I52A 2H63A 3RFTA 4TRRA 5FYDA 1T2AA 3C8MA 4Q3AA 4K1LA 4AL4A 4B3IA 1PZHA 2PWZA 3NTRA 4IS2A 2HO5A 2HUNA 1LXCA 4Z0TA 2DBRA 2EJVA 4LISA 4DLAA 2WMDA 1DIGA 3AM5A 4DQUA 5JC1A 1FXSA 1GEEA 3K2EA 2OBYA 4DUPA 2ZCVA 1QKIA 3VPHA 1E6WA 2D5CA 2VRBA 3D3EA 2C29D 4JQCA 4YT2A 4L4RA 1QXSA 1T1RA 4GX5A 3PHGA 3UHAA 1T4DA 3WXBA 4YT8A 3PYLA 3N74A 3LZ6A 4E0BA 1LLUA 3L77A 3DAPA 4Z0HO 4WJZA 3DXFA 4OSOA 4WLFA 1P1HA 4IM7A 5L4SA 5JYEA 4A7PA 2PK3A 1YVEI 2QHXA 1PWZA 2QG4A 1CIVA 1NPYA 1OAAA 1U5AA 5CEJA 2EJWA 1DJQA 5F1OA 4Z9YA 2G5CA 1GUYA 1OZAA 1K2WA 1YDEA 1CYDA 4BNHA 1O6ZA 2VHWA 4NMHA 3QY9A 3GFGA 4OOEA 1E1NA 5KJ1A 3ZWPA 3K73O 5DDIP 4NFSA 4DVJA 1EBFA 4O5OA 1GD1O 3HB5X 2I9PA 4B4WA 4YPOA 1NFQA 3EVTA 2EKPA 1Y81A 4QT0A 4KUGA 5JDIA 3P7MA 3IOYA 3PGXA 2X6TA 3F9IA 3DHNA 4OQZA 4WCFC 3PYMA 3P2OA 2OP1A 4AJ2A 5A06A 4WLEA 3GR6A 1D4FA 4W7IA 1PJTA 3B20A 2NM0A 1Y7TA 1LU9A 1ULSA 4WNCA 2WD8A 5AXBA 1O0SA 3GHYA 4FJ2A 4CL3A 1M66A 9LDTA 5L9AA 1E3LA 1ZUD1 3QJ5A 4CV0A 1DEHA 3C7DB 4XGNA 4KP7A 3MJSA 4YT4A 4YQYA 1H9AA 1VKNA 1RYEA 4PLPA 4TMFA 5BR7A 2UYYA 3WQQA 2X0NA 1PJLA 2ZTUA 2HK9A 2BGLA 2V7PA 4NI5A 1L1FA 4ONEA 3G0OA 4OXKA 4W6ZA 3AFNA 4DYVA 1LNQA 1PR9A 3ST7A 3I6QA 4FDAA 4WECA 3ZV5A 2O3UA 4BO3A 3UW3A 4Y6SA 1HE3A 2G0TA 4FPXA 3VTZA 2H1SA 3A28A 4R3WA 5AVOA 1PQPA 2ET6A 4RDHA 5EJ2A 1LUAA 3I9NA 4L8VA 3EYWA 3E82A 2UV8A 3FBGA 4Y67A 4BNIA 1Y8RB 3JQFC 3O9ZA 1LC3A 3VVBA 2IZZA 2Y0EA 1H9BA 3KHUA 2I3AA 3L4BA 1C0KA 5L7YA 4AG3A 3A14A 1YOVA 4IZIA 2UUOA 3GQVA 4ID9A 2Y93A 4BUCA 1B14A 3X2FA 5T8KA 4W82A 1XHLA 4IQ8A 1HKUA 1P0CA 4FN4A 3CH6A 2CD9A 2D59A 4GLLA 5TSDA 2POQX 1H2HA 4R5MA 2YHIB 4OOFA 4L75A 4DA9A 4DQVA 2B36A 3BZUA 3HN7A 4PLGA 4WK6A 4YB8A 1R37A 2G76A 4AJKA 5I7SA 3D0OA 2RHRA 3H8VA 4OKNA 1T25A 4XYGA 5EQDA 2FZWA 3DAFA 2Q46A 1WMAA 4L73A 4FSHA 3ZHZA 2VUUA 4UEJA 2GASA 2O48X 4LSWA 1HDZA 1HSZA 1OC4A 1AGNA 1SCUA 1NAHA 2VRCA 4LVUA 3GEMA 4HFRA 3DBVO 4DPLA 4BGIA 5G4KB 5JAIA 3U9LA 5B12A 3EZYA 1U4OA 2VCYA 4J16A 4ZGWA 1P0FA 1ZW1A 1X7HA 3D3WB 3RUFA 2HMUA 2NADA 3D1LA 3KVOA 1NR7A 3QIVA 3STHA 1UZLA 1RWBA 2V6BA 3OA2A 2VNSA 2Y0CA 3U0BA 3E9NA 1U9JA 4JIGA 5L45A 4N5NA 1ZVMA 1I3KA 3W8EA 1Y8QB 3NT4A 4JP2A 3FNHA 2VTEA 1ZEJA 4XDYA 2ZB4A 1EEHA 3VZQA 1MG0A 4Q39A 2P2SA 1P45A 4NJMA 2VYVA 1PL8A 1NM5A 1OI7A 2PLAA 3ICCA 3MJ4A 1A5ZA 4L74A 3WICA 2PGJA 3ZNPA 2GR9A 2JCYA 4XQGA 5C3MA 5FF9A 3BHMA 3KOUA 4KWHA 5JMWA 2NVUA 2OXIA 2ZYAA 2Q4EA 3WBBA 1A9ZA 2VT3A 3IJRA 4EZBA 5BSGA 4S3MA 1ISGA 4FFLA 3GMDA 1PQUA 2DT5A 4FR5A 5I9NA 3LC7O 4AJIA 3PZBA 4A26A 1P31A 2P91A 2X58A 2O7QA 1YL5A 1VJ1A 3HWRA 1HYEA 4NBUA 3NDJA 1V6AA 4PLWA 4Z0PA 1VPDA 2RAFA 3VPXA 1Y9EA 4R1NA 4GVLA 1UXIA 5KJ6A 3TFOA 4CMJA 2HMTA 1XU9A 5F3RA 5LDHA 4NK5A 2O3TA 1E3EA 2FSVA 3TOXA 4CM6A 4A73A 1MFPA 3F5QA 3ZU2A 4I1IA 4ZHSA 1HYHA 3DZHA 4II3A 2V65A 1LSJA 4Q3CA 1Q2XA 2O3QA 2G17A 5TS3A 2Q45A 1GTMA 5JBIA 1HEUA 2D2IA 3ASVA 2NTJA 3K31A 2PZLA 4LRSB 1VL6A 3UF0A 4RCVA 5HM8A 1KBZA 1ZSVA 1HDCA 2O2YA 2B37A 2C2XA 2AG5A 4H16A 3RUCA 5IG2A 1UXKA 2X8LA 1JU9A 1I10A 1PS9A 5K9ZA 1LJ8A 5KJFA 3RVDA 1HDYA 2FR0A 3CMMA 3RD5A 1SEVA 3IAHA 3TDKA 3ZV3A 1DIHA 3GGOA 3N7UA 5JDCC 4YWJA 4BQRA 3NV9A 4XD2A 3EMKA 1P74A 5IFLA 2EGGA 1GL3A 4BNJA 1AXGA 2X22A 3U4IA 3L9WA 2VWHA 1MC4A 4K28A 4W9NC 3O8QA 1BW9A 5L4NA 3V2UA 1N5DA 1W0CA 2C5EA 4D3DA 4I9NA 3GG9A 3GHHA 4MVJM 4WLUA 5AXDA 1Q1NA 3SC4A 1CWUA 3H5NA 4GX0A 7ADHA 1H6AA 4XRRA 1H93A 2DTEA 3IUSA 1R4NB 1M6HA 2R00C 4I5EA 1D3AA 4MIOA 2IE0A 4JBGA 4QXMA 4WEQA 1QYVA 3GH3A 1XA0A 4RLHA 3ZWXA 2PZKA 4Z9FA 1QMGA 2YDYA 4CR8A 3NKLA 4WLVA 1N9GA 1VKOA 3RROA 1GQ2A 2VNAA 4UEOA 2EV9A 5KKCA 4KOAA 3FCOA 4XQCA 4CM3A 4XYMA 4MIYA 4CQMD 2W2LA 3W1VA 4PIVA 3EGOA 3RUAA 2IXBA 1BVRA 1U8XX 1Y6JA 4FOSA 1QYDA 1YJQA 1VLLA 4HXYA 3NGLA 4DBVO 1PL7A 4NPCA 1DHRA 4LMPA 5K0ZA 1YQGA 1HETA 3ABIA 3ANMA 1E5LA 1PSDA 3I9JA 1M6WA 2X0IA 3PK0A 4NBTA 4DIOA 3WGIA 3M2PA 1P3DA 4FFNA 3QV1A 2Y05A 1KEWA 2B35A 2NQTA 4R1UA 1ZCJA 3Q2KA 5KVVA 4JJIA 1K6IA 3P2YA 4WUVA 2JHGA 1VSUA 3VKUA 3KETA 5BT9A 4AJEA 4EYEA 2Z5LA 4PZCA 3C1TA 3IKVA 4B4OA 4DIBA 2QZ9A 4EUHA 1MUUA 1KVTA 2O3SA 4RVFA 4XIJA 5ITVA 4QO7A 2GN6A 3RIHA 4Z6KA 2PGLA 3WWZA 2FR8A 2YFQA 2Y1GA 1O9BA 3H3FA 1DC4A 4BNXA 4UVIA 3WFJA 5DF1A 2PY6A 2DTXA 4BKQA 3M2TA 3B1KA 1LDNA 1DBVO 3ZZNA 4XCVA 1YOVB 2Q2QA 5DOVA 1B3BA 3DMTA 1T4BA 4GX1A 1T2EA 2QYTA 2C2YA 3E6AA 2Q1WA 3IDSA 1BXGA 4CV3A 1RM3A 1XQ1A 3V1TC 5L95A 4M49A 2VUTA 4X54A 2JCVA 1DIBA 2ZJ1A 2CFCA 3Q2IA 1I36A 2Z95A 1W73A 2ZATA 3JYOA 3GPIA 4BNZA 4FB5A 3K92A 1B8PA 5HA5A 3WS7A 5A5FA 3DBLB 2IRWA 4P4NA 3W6UA 3OICA 2BLLA 1TXGA 3PGJA 1E7QA 3B1FA 3FRJA 4E31A 4Q3NA 4RO0A 3RJ9A 2YV3A 3A06A 2GN9A 5COQA 5F1PA 4AJ4A 4AJJA 2JFGA 3AK4A 2HLPA 2W98A 1EZ4A 2XOXA 3ZWCA 2NU7A 3LLSA 3MZ0A 4RF3A 3SVTA 1PGOA 3E1KA 2Y1EA 1P44A 1Q7CA 1EBUA 4QSMA 1DJNA 1WZEA 4TQGA 1CRWG 3Q9NA 1KVRA 2Z1NA 3LDHA 1PGPA 4AJHA 4JROA 1Q7GA 4XKJA 4P4GA 5ER9A 3VKVA 3AUUA 3GF4A 2IEDA 1V35A 3AUTA 1B2LA 4J43A 5F1KA 5DNAA 5G0WA 4YEDA 1KVSA 3INRA 3SX2A 3HN2A 3E03A 3GUYA 3LC2O 3P19A 1GV1A 1ONOA 4W7HA 3H4VA 4MKZA 2X9VA 3MJEA 5EINA 1JKJA 3DO5A 3TL3A 1UDBA 5JO9A 1E7MA 4PLCA 1BHSA 5IN4A 2VOEA 1BG6A 3GT0A 1YH3A 1ADCA 1Z7BA 2YQ4A 3OQ1A 2EIHA 5DBFA 3GDGA 3ZU4A 4F3YA 4B4UA 3AY6A 2Q49A 4A03A 4XJTA 1X15A 2A94A 3BYZA 4MVJF 3E18A 1HE2A 1XCBA 3H6KA 1TT7A 3ZWNA 2UAGA 1XSEA 5DP1A 2CVZA 4MIEA 5THQA 2EKQA 2D4AA 4TRMA 3RUDA 2JL1A 5KNLA 1GZ3A 4EEZA 3WLEA 4NJOA 5A05A 3WNVA 2RH4A 1HWYA 1FDWA 1BXGB 3DOOA 5BNFA 5CHEA 3TN7A 2C7GA 4FC7A 2YZ7A 1LRLA 5KVSA 1N1GA 2NTVA 2P5YA 3LLVA 1A7AA 1JKIA 3FD8A 1KETA 3ZV6A 2HU2A 2R2GA 3INTA 4B7XA 1RJWA 4F6LA 2VQ3A 2J6IA 2YDXA 4K6CA 3DB2A 3COSA 1DIRA 2P4HX 3PIDA 4Y9DA 2VTDA 4GMGA 1I3LA 3G3EA 3HE3A 1LSOA 1UZMA 1BMDA 4H7PA 4RQUA 3TPCA 5ICMA 4DPMA 1VM6A 2Y99A 5CEFA 4TROA 1NPDA 3RC9A 4HBGA 3G1UA 5C7LO 4HFNA 2NWQA 4ESOA 3JD2A 3GNTA 4FD3A 1GV0A 1Y8QA 3C3XA 5DP2A 2X0RA 3BMQB 1PX0A 5IF3A 5KKAA 3QSGA 1IUKA 4I5DA 3UVEA 1K6XA 4CM8B 4D41A 2IODA 4HKTA 5DT9A 2FN7A 5EMHA 4H3VA 3JQAD 1DFGA 1I24A 4XA8A 5JS6A 3ROPA 4M87A 3PJDA 1O94A 3H65A 4PZDA 4BO8A 3AOEC 3HNPA 5JNLA 1ZMTA 3DEYX 1DFIA 4PG4A 2OO5A 5H81A 2Y0DA 3U49A 2D1YA 3NTQA 4J9UE 2W90A 2NQ8A 3JQCA 4YVFA 1ID1A 3BAZA 4OL9A 3Q6IA 1YJ8A 3FI9A 1PGJA 3KBOA 4HX5A 3T4XA 3ZHXA 4BV9A 5TX7A 3F47A 4IDBA 2AA3A 1WP4A 1UP7A 3BTOA 4LRTB 3M6IA 4CUZA 4BO1A 1ADGA 3I3OA 2NU8A 3DMYA 1PGNA 2CDAA 4ZQBA 4FFOA 5CPBA 3W4KA 1W4ZA 3UCEA 4J4BA 1SB9A 3KYBA 4G81A 2Y1CA 2JAHA 4YCAA 4BO9A 2H9IA 3Q0EA 4MP8A 2WSBA 5AXAA 1NX6A 2VZ9A 4J7CA 5ITWA 1I2ZA 2OOSA 3PQDA 4ZA2A 4R16A 5IZCC 4E13A 5G0UA 4Q3BA 1T2CA 1ISHA 1UH5A 3PQEA 3DTTA 1QP8A 2EF1A 4RPKA 1YL6A 2ZQZA 4YJFB 1C0PA 4CLHA 3AUSA 1C1XB 3E5MA 4IGFA 5GY7A 1B16A 2WYUA 2JFHA 5IZ4A 4M55A 4W99A 2BFMA 2JAPA 4CM7A 5KOIA 4IIUA 2HRBA 4GSKA 3GZNA 1ZFNA 4ZQEA 3OQBA 4GWKA 1EDZA 1EUDA 4R9SA 3JQ7A 1B15A 1DC5A 1H6DA 1I3NA 3TFQA 3FWZA 3RASA 4IJKA 1BTOA 4GKVA 4TVOA 3DR3A 1HDGO 1P1RA 3M1AA 3T4EA 5A02A 1GYRA 2AEFA 1EE2A 2FY8A 2JD0A 3HDQA 3G1TA 4WOJA 3ONDA 2IZ0A 1HDOA 1J4AA 3PHLA 4E5PA 3PIIA 3L4SO 3ZDFA 3AY3A 3IMFA 1Y9AA 4YR9A 3C24A 2GCGA 1YQDA 4FFPA 3JQBA 4OXNA 4QECA 3DQPA 4RVDA 3RAJA 3MCVA 2FP4A 4TKMA 3H9UA 4WLNA 3GZNB 3WDSA 3VZPA 4WEOA 1G0NA 2VHZA 1YBVA 4BHTA 3ZGYA 1EVZA 1XGKA 3ANNA 4MVJD 1PZEA 2VHXA 1FDUA 4EEXA 4JP3A 2B83A 4FC6A 4YJFA 3SJ7A 5JPIA 4D3SA 1ENPA 4MO2A 2B4RO 3KRTA 5JCJA 4AFNA 4MVJA 4GGOA 2NTNA 3PFWO 3WYCA 3TL2A 4PLVA 3U4DA 2YY7A 1ONPA 2X0JA 3EVNA 1ZIDA 2J5RA 2NVUB 3HSKA 1IPFA 1TEHA 1AUPA 2IYPA 1ZMOA 5A4DA 1ZSYA 2E82A 4DC1A 2AEJA 4U6QA 3IJPA 4OYRA 2BRUA 4BKOA 4A10A 2DFDA 2XF8A 4P8RA 4U0JA 1ZJYA 4I08A 3GA0A 1Q0HA 1O89A 2P68A 3JD3A 2TMGA 4J2HA 4HFMA 4J1TA 3R3SA 4MP6A 2FHSA 5L40A 4O1MA 2V6FA 5A9TA 1HF3A 4ITUA 3QRWA 4NU6A 4RGBA 3QWBA 1VJ0A 4RVGA 2EXXA 4B3JA 4II2A 3K8ZA 2BI8A 4ZICA 4ROSA 4I9HA 5A3VA 3OJ0A 1YBAA 2WE7A 4U7WA 2C54A 5C37A 4DBZA 3PLNA 4E6PA 1I5RA 4BGVA 2I6TA 1PJQA 3ZI0A 2O3JA 4IZHA 2ZTLA 1U1IA 4CM8A 4PZEA 3DBRB 2GLXA 1GU7A 3EAGA 1CDOA 4RVSA 3NJ8A 4M54A 5C7OO 4OIMA 4BMVA 2CVQA 4XYLA 1D1TA 3I4FA 5J23A 3MOIA 2P9GA 1GQQA 4XR9A 2BELA 5JO0A 2VZ0A 3C85A 2PH5A 4ALNA 2I76A 4IQGA 3RUHA 5FI3A 2VHYA 2O3RA 4EJ6A 3U3XA 3WGTA 4TRJA 1P9LA 3CZRA 5KJCA 3SC6A 4K9DA 1U3WA 5TLSA 1XQ6A 3FR7A 3TNLA 1PJCA 3I9KA 3VHRA 3ICPA 1I3MA 3BTVA 1MXHA 2PD4A 2WYVA 4J49A 4PG8A 4XQ9A 1SO8A 2Q2VA 1ZK1A 1ONNA 2QIOA 1Y8RA 3CINA 2EKLA 3L4BC 2EG9A 2AG8A 3ONFA 3ANLA 5U4QA 2QYSA 4MVJH 1ISMA 2PGDA 3GAZA 4CMKA 4OM8A 1PIWA 1EUZA 2O50A 5CDYA 2RCYA 2W2KB 1GFSA 1MB4A 4GAEA 1E5QA 5JDCA 4LCEA 4R1SA 4BO0A 1ENYA 1A9YA 2Q1UA 2J3KA 2YUTA 3WQRA 1C14A 3PJGA 4FQ8A 4CMCA 1QSGA 3LT4A 4CLDA 3RCBA 5JLAA 3DOJA 3WYBA 1N7GA 1XELA 3VH3A 1IULA 2PV7A 1SPXA 3AU8A 4XQEA 4D45A 1UZNA 1XWFA 3WNQA 5IXSA 3B6ZA 5GZ3A 3IS3A 3WX0A 1I2BA 1F12A 3JTMA 4M86A 3DZJA 4I8XA 3GG2A 4ND5A 4ZJUA 2O2SA 2GZ3A 3QVSA 3AJRA 4GPD1 2X4GA 4BNKA 3Q1LA 1WZIA 4IJVA 3HQ4O 3ZV4A 3PWZA 1YQXA 1FMCA 3GPDG 4MOWA 4ALIA 1K6JA 3JD1A 5MGBA 2FPGA 2OORA 3MWEB 5ENDA 1I2CA 4DLBA 3OSUA 1Z75A 4CMEA 5KVCA 2VWGA 3F6YA 5IAAA 1UR5A 2D5AA 3GMSA 3TSCA 2ZQYA 4O63O 2EW2A 4UULA 5DCYA 4UUPA 1ZK4A 2W8ZA 3JCZA 1YB4A 3EUWA 5L3ZA 1P1FA 3P5SA 3WQSB 3C7AA 4KWIA 4FGSA 3BHJA 1TI7A 2O4UX 4ZU3A 5BQFA 3D5QA 5JYDA 1LI4A 1L7DA 3K9QO 1LA2A 3IC5A 3R3JA 1ZK3A 2F00A 3HDHA 4C7KA 5DULA 4J6FA 4GVXA 5CP8A 2DC1A 1R0LA 2UDPA 5EPOA 1X1TA 4GI2A 1OOEA 1C0LA 3RBVA 1CJCA 3JQGB 4NU5A 3K2BA 3LQFA 1RM5A 5EERA 1SEPA 4C7JA 3ZNNA 1GADO 2BHLA 4E2YA 3D4OA 2EERA 2PA3A 3OEWA 4YAEA 4EITA 1GYQA 1DFHA 4R54A 2BF7A 2PD6A 1HRDA 4EDFA 3HADA 1TLTA 1D1SA 1R6DA 4CQMA 4NR0A 3L07A 4NJMB 3RC7A 1AHHA 1QLJA 4Z3KA 8ADHA 1KOLA 1WAMA 4J90A 4AICA 1W6UA 1J6UA 4XRGA 3PI7A 1GUFA 1QYXA 3X2EA 2J8ZA 4B8ZA 1YONA 1JQBA 4PVDA 1M75A 1TB4A 3RKRA 1OFGA 2ILTA 1GQYA 1BVUA 2BMAA 2O23A 1W8DA 4JXKA 4PLFA 3UICA 4YAIA 1P77A 3OIGA 4R01A 3QVXA 3SLKA 1FDSA 1JWAB 2Q99A 4MKRA 2PNFA 3DBHB 1KVQA 3PJFA 4WE3A 4IINA 5DCWA 3QLJA 1QR6A 4MVJE 4U8GA 3HDJA 4EJ0A 1E3IA 1O5IA 3PVZA 1M67A 2AQ8A 2BFAA 2E49A 2DBQA 3EC7A 2VT2A 1UJMA 4UUMA 1NQTA 2HK7A 4BNGA 3HJAA 3S2GA 1R12A 1YL7A 3H5AA 4BNTA 4L4SA 3BMCA 2YYYA 5DN9A 3FHLA 4EBFA 3ZN2A 4Y6PA 1PZGA 3O8QB 1FK8A 5BSEA 1HE5A 3CIFA 2GYYA 4PLYA 1E6UA 3JQ9C 1FF9A 3JQ6A 3NDIA 3JYQA 1ZBQA 4NDNE 4AJLA 1E6EA 4FS3A 3FPCA 1B8VA 2EWMA 2I66A 3GVCA 4CODB 2B4QA 1AN9A 3WMWA 5JCJD 4WNIA 2VYVD 2ZYDA 3FN4A 5CG2A 4AJOA 3GAFA 3I83A 4K26A 3TQHA 5IJZA 4DLLA 3UKOA 4OAQA 2GO1A 2PD3A 1X0XA 1BRMA 4R68A 1UDAA 1X7GA 4CM4B 4CV1A 3CPSA 1Z73A 5U1PA 3RC1A 4CMHA 1KVUA 3I4CA 3QVTA 3C1OA 1DRVA 3PWKA 1ARZA 3OA0A 4KUHA 2R6JA 4YRAA 2QRLA 4B79A 1D7OA 2A35A 1K3TA 3FSRA 2BKAA 1KEPA 4NNJA 5ILGA 3ADOA 3JQEA 1SNYA 3H7AA 5L4LA 5K6AC 2W2LD 3QWFA 1BDBA 3TOZA 1XU7A 3ETEA 5ADHA 3EK2A 4Q3DA 3NTOA 9LDBA 1ZXBA 1ISJA 3BMOB 3SXPA 2FR1A 2EP7A 5AQ1A 1GZ4A 5JMPA 2ZB3A 1C1DB 4YTEA 2YW9A 2AE2A 3O38A 4BNWA 2JJYA 3L0DA 3MEQA 4IS3A 3VOSA 4EGFA 5T67A 2VYNA 3L6DA 4IDAA 4CM9A 4E32A 1DB3A 5TJHA 1S7CA 3B1JA 4KUEA 5ES3A 4D44A 4DPKA 5IZCA 4HP8A 1MX3A 3LT2A 1R0KA 1V3UA 1Z82A 4NG5A 1F14A 1KYQA 1P1JA 1T24A 2OZPA 4IMPA 4XGIA 1X0VA 5DCUA 1F06A 4WPGA 5U9CA 4HADA 4D7AA 3C1AA 4O59O 3F3SA 4XB1A 4DYDA 1CQIA 5AYVA 1UXHA 3M1LA 2XAAA 2XXBA 3GVXA 1C3VA 3FNFA 1ML3A 5C7IO 1A4IA 2X86A 3R1IA 3U4CA 3WBFA 1X7DA 3D5TA 4I5GA 3FWNA 4BNLA 1P1IA 5A9SA 1GPDG 1IHXA 2HMSA 5FFFA 4RV9A 1DPGA 4LGVA 5JAQA 4E3ZA 1ZO8A 3I1JA 5AXCA 3OEYA 3DAGA 1HDXA 1I30A 4WOKA 2HAEA 1GUZA 1B0AA 4Y6RA 3WR5A 1IB6A 3ROKA 2P5UA 5FWNA 4TWRA 1Z45A 4BO5A 1T2DA 3NJ4A 1DLIA 3WG9A 2J3JA 4CM5A 1A72A 3G17A 3KLPX 4J4HA 2B5WA 4LN1A 1GDHA 5F5NA 1H6BA 4BKUA 1ZXLA 1CF2O 2E6UX 3HHPA 3TZCA 4E5KA 3KSUA 3GEDA 1LDBA 4NIMA 4CMAA 2ZYGA 3JQDA 4R41A 2OHXA 3Q3CA 2NVBA 4JJFA 3ORFA 3D3WA 1QG6A 4BNYA 2X5KO 1BSVA 1VRWA 3AUAA 4R4JA 3U5TA 4N18A 1WDLA 3W4IA 3PLRA 1QRRA 1NWHA 2Y1OA 5G4KA 2DFVA 2I3GA 2QRKA 3Q11A 4D3FA 1LSSA 4ZQFA 4NQZA 4R9RA 3BTUA 1DC3A 2G82A 1B7GO 3R6DA 4CMIA 2FPIA 3DHYA 3A9WA 3L6OO 4OO3A 1EVYA 3H2SA 5JAZA 2UVDA 1YBMA 2C7VA 5G0VA 1HDRA 1NVMB 3S2FA 3UCXA 4BV8A 5FEUA 5KTKA 3V2GA 1Y5MA 3LSYA 4U5QA 3A1NA 3JYLA 3B70A 3JQ8A 3QQPA 4XX0A 5TIIA 4PLTA 3GRKA 3DTYA 3IP1A 1NHWA 4IJUA 4OHUA 1G0OA 1NBOA 4MKXA 3V1UA 2YHIA 3ONEA 4A5OA 1A27A 3OECA 3QWIA 4ALLA 3WGZA 5EN4A 4BL5A 3S55A 3VH2A 4YA6A 3R0IA 4MVJP 5CDTA 1WPQA 4I5FA 3OJOA 1EFKA 4CR6A 1N9GB 5JDIC 1LDGA 1TT5A 3DHEA 1WNTA 2DAPA 2VHVA 3GEGA 3GDFA 4GX2A 4CMGA 3UCFA 1I8TA 5IDXA 3GVHA 4FBGA 3E5RA 3ZHBA 2CNBA 5THKA 4KQWA 3IUPA 1ORRA 3DMTC 3QP9A 3GGGA 5HS6A 3NT2A 1R4NA 2PR2A 1JAYA 3Q9UA 3AM4A 5EQFA 4DGSA 4EI2A 1JDJA 3GY0A 1WW8A 3SLGA 3S1LA 4O0LA 2X5OA 5BNTA 5JY6A 4TSKA 1KY4A 3CEAA 3GDOA 1E77A 4J7XA 5A03A 4CR7A 3ENKA 1GPJA 4J7UA 1PJBA 1DLJA 4L0QA 1LDMA 3K5PA 1IZ0A 2E48A 1XIVA 3AWDA 1U7TA 4D46A 5BNIA 3CTMA 3LT0A 2BFPA 4HNHA 4DXHA 1Q7BA 4E5MA 3DFZA 4G2NA 2OMEA 4QFCA 3HDYA 1JA9A 2CY0A 3UFXA 4BNMA 1SZJG 3DOCA 3WGHA 3OETA 2W4QA 3WJ7A 1U3VA 3V2HA 4E2WA 4AJ1A 2NLOA 2F1KA 4EJMA 4AVYA 1E3JA 4ZQGA 1WVGA 4PLZA 5A9RA 1E7YA 4G5HA 5F21A 1JLLA 3F1KA 3WGQA 3DBHA 3KM0A 3ZU5A 1TVEA 1MC5A 2GGSA 4WCFA 1H6CA 1DC6A 4E2ZA 3ZU3A 3LK7A 1ZNQO 4LMRA 1T1SA 4D0RA 3ETDA 5FI5A 2GSDA 3D64A 5LC1A 2QW8A 1JWBB 4E5YA 1PEDA 2O4CA 1KC3A 1XEAA 4JX8A 1X1EA 5G0TA 1WWKA 4TZKA 3MTJA 4TRNA 3WOHA 1ENOA 2V6MA 4MINA 4B7UA 5ILOA 2DBZA 3S8MA 5L51A 3CUKA 1JVBA 4QQRA 4LVCA 1V8BA 3EY4A 3FNEA 2C20A 2GZ1A 2HKIA 4XYEA 4CJXA 4QTZA 2X5JO 3F4BA 5G0SA 4YT5A 1J5PA 4YJHA 4NK4A 4FFMA 2GRAA 2Y68A 2ZB8A 1PR3A 1SB8A 3MJCA 3N58A 2Q1TA 1FJHA 3KSDO 4YRDA 2X23A 1QV6A 5BSFA 1ULUA 3WJAA 2I99A 4QFDA 3PQFA 4CLOB 5JCXA 1GYPA 2FRDA 2HMWA 4HWKA 4E2XA 5L7WA 3H5RA 1JW9B 2IZ1A 2ZK7A 3JQGA 2PZMA 4Q9NA 3V1YA 1PL6A 4Y98A 1DIAA 4GWGA 5CPFA 5B1YA 1LEHA 2IEBA 4IDDA 3LF1A 3BA1A 4WKGA 3AM3A 3UN1A 5CDSA 4RLSA 2GPTA 1SOWA 1R4MA 2GN8A 1U5CA 3FNGA 3RC2A 3ZWVA 1YKFA 4DMMA 1MFZA 1MG5A 1UXJA 3WFIA 1PU2A 4HUJA 4ND4A 1SC6A 1K89A 1PWXA 3O4RA 3U09A 1QYWA 4H15A 4RDIA 2CZCA 4B3HA 1GCUA 5HWSA 3RUIA 3JQAB 4AJNA 3MJTA 1Y1PA 2D8AA 2VN8A 4PCVA 4WASA 1VL0A 4KDFA 2CUKA 1G6KA 2EP5A 1PJ2A 2X7HA 4J0EA 3GLQA 3SEFA 5A5EA 3U4HA 1LSUA 1O95A 1XDWA 2ZIZA 5COBA 4E30A 2NU6A 1DDOA 4MJLA 1HT0A 3GFBA 1U3UA 5HS4A 4IXWA 4AJPA 2AQKA 4DC0A 3KXDA 1EVIA 1EVJA 3PZRA 4UVHA 4XJSA 5TC4A 1ZJZA 3LF2A 1HZZA 1X13A 3BMNB 3WWYA 5DOZA 1DOHA 1LRKA 1F8GA 3DZBA 2FOIA 4JBIA 5KCZA 5ER6A 1P1KA 4YYZA 2EGHA 1R15A 1LX6A 3D4NA 3LYLA 2CF6A 1J49A 5DBGA 1OMOA 4XWYA 3WGOA 2QZZA 4E12A 1U2DA 3PEFA 1EE9A 2BGMA 3ENNA 2Q4BA 3RFVA 2J5QA 3GOHA 1QV7A 4XIYA 1ISIA 4L76A 3RBZA 1MA0A 1HTBA 1HXHA 3OBBA 3VDRA 1BWSA 4GKBA 4RJTA 6ADHA 2HK8A 2BI7A 3KEQA 1U2GA 3W4JA 3NYWA 1RM0A 1SMKA 1DRWA 1IE3A 1PS8A 1U28A 3I9OA 4J1SA 4XEHA 4OGWA 1ADBA 2NSDA 3ZW9A 4JJGA 5A1TA 3FTNA 3RWBA 3RU9A 3H9EO 2P9CA 4YXFA 1FDTA 4NHEA 4PGFA 3VPGA 1MXFA 4YAJA 3PXXA 3NAQA 1N92A 4JLWA 1ZSNA 3VPFA 1QYCA 2AHRA 5I8WA 2ZTMA 2P9EA 2VUSA 3RUEA 3W6ZA 1P33A 4NH4A 4CV2A 5DZSA 4RQTA 2C59A 1HSOA 5TT1A 3HZZA 2J3IA 4R3NA 1J0XO 3DFUA 4M89A 5K6AA 4WLOA 4F46A 4IDGA 4G65A 1D8AA 2EW8A 3ULKA 5B4TA 2DLDA 3PHJA 1E0DA 5T57A 5B4VA 1LDYA 2C82A 2Q50A 1KY5A 2WD7B 3BXXA 3PRJA 4NBWA 4CM1A 4IBOA 4NFYA 3QWHA 3EDMA 3ZHYA 4DREA 3BMNA 4M8SA 1XLTA 2OP0A 1YWGO 3D7LA 1R16A 3JQBC 2B4TO 3OP4A 4FGWA 1M2WA 5LDGA 4O6VA 3INGA 1NWCA 3CSDA 1R0SA 1NVTA 3VZRA 3WYEA 2H6EA 3MTGA 4TVBA 1C0IA 1SBYA 4UUOA 3GVIA 4EW6A 2GF2A 1LLCA 3OMLA 5EL0A 3WLFA 3MJVA 1GR0A 4BB6A 2YQ5A 3PDUA 1DSSG 1YXMA 2CSUA 3UGKA 3ASUA 3PP8A 3NUGA 3GGPA 2FMUA 1OC2A 4EUEA 3O26A 3KLMX 3GNSA 4YRBA 4A2CA 4CL8A 1DO8A 4W4TA 5KIAA 5B37A 4UAGA 2LDXA 4QEDA 3OJFA 1OBFO 4RZIA 3GK3A 2Q1SA 1IL0A 2WDZA 1R4MB 3QE3A 4IDEA 1BDMA 3E8XA 4BMNA 5T64A 1HZJA 2WYWA 3ZNOA 2E37A 2I67A 1Q0LA 4JK3A 4N5MA 4PG6A 1RKXA 4DMLA 4E4YA 3MOGA 4URFA 2UUPA 3GN2A 5A9SB 1F0YA 5MDHA 1VL8A 5I7EA 1F8FA 1YB1A 2YJZA 3WSVA 2YV1A 1SAYA 4CLOA 3PDJA 1YB5A 4HV4A 2FSSA 5CG1A 1U4SA 3FTPA 1Q0QA 1V0JA 3GUCA 4XDZA 1WDMA 2RH8A 5G2OA 2GERA 5CFZA 1FDVA 4YJHB 2VRCD 3JYPA 3ZH2A 1NFRA 4ZQHA 2C0CA 3JD0A 4IDCA 4U0KA 5JE8A 4GQAA 1I32A 3GN1A 4IUYA 2OFPA 3VAZA 3WB9A 2TMDA 5C5IA 3QA9A 5DBIA 2BGKA 4RORA 3PHIA 4B7CA 1NPTO 3CZMA 1U3TA 4ALJA 4Z9XA 2GNAA 3TZKA 1X14A 4RF5A 4JGBA 4ALKA 1GAEO 4Z3DA 5T8KC 5JFOA 2WD7A 1JKFA 5L7TA 4CPDA 3ZWBA 2NU9A 2DBVO 4WCFB 4OJNA 2B69A 3G79A 3KZVA 3F1LA 1NP3A 4RVHA 3D4PA 5EESA 3SJUA 3QW2A 1PTJA 3F46A 3NRCA 1JN0A 3PFFA 1KEUA 2DU8A 2I65A 3WTBA 2QQ5A 1GY8A 1E7WA 3S2EA 1IY8A 1NFFA 4YJGA 2C07A 2HSDA 2OL4A 1E92A 5IDYA 4WGGA 4EUFA 4B8WA 4YJDA 4XGKA 3NEPX 1ADFA 2GN4A 3C7CB 1A7KA 3RQSA 4BB5A 2VZ8A 4B4VA 1H0KA 1E3WA 2O7SA 3LC1O 3TZ6A 4BMSA 1AXEA 1BW9B 1UAYA 1VC2A 3ZWWA 2E4AA 2IXAA 3O03A 1LLQA 5AOVA 4F6CA 2HJSA 4PG7A 1H2BA 4ND1A 5JW6A 2YHUA 3OH8A 1NAIA 3EZLA 4BQPA 5CDUA 3BMCB 1BXKA 3W8FA 1VJTA 3AFMA 5H82A 3KYCA 5IDWA 4RF2A 1EQ2A 4GMFA 5HRUA 3F5SA 3UOGA 1B3RA 3OIFA 1A71A 3HG7A 3IQDB 4HFJA 2HMVA 4IJWA 4YJGB 3WIEA 1LTHR 2ZB7A 1TT5B 2WE8A 2AQIA 2DM6A 1ISFA 4IIVA 2ZJ0A 3NX4A 2AMFA 2RIRA 4BGEA 3VDQA 1VSVA 2H5LA 1Y5RA 3ROMA 1ZZEA 4I9UA 2JD1A 3ZWMA 5ICSA 2BD0A 2HCTA 3T7CA 3BIOA 3UH1A 3TF5A 1RPNA 2D0IA 4BO7A 2PKQO 4CLRA 3JQ8B 1LLDA 2OUIA 4J0FA 4HNGA 4CMEC 5TT0A 3NT5A 4ALMA 5COAA 4ZRMA 5A04A 5IXYA 2ZCUA 4PRKA 3TZQA 3AOGA 3OQ6A 3DC2A 4UUNA 3DDNA 4QO8A 4KTVE 1WXDA 4CLXA 3BMQA 4LSMA 3QVOA 4NZ9A 4DIFA 4PN3A 1JTVA 5JSFA 3JSAA 4PG5A 3LVFO 1EQUA 4YDRA 4MPDA 1YGYA 4E33A 1I01A 4KMSA 1WDKA 2FPPA 3DZKA 1XG5A 3V5NA 4RF4A 4R51A 4OMUA 1E7SA 1KIFA 2VWPA 4RVUA 4RL6A 2GZ2A 4XYBA 4W9NA 1Z6ZA 2PKQP 1ZKMA 5GZ1A 1PQWA 4GLOA 4J4TA 4RPHA 2CMDA 4DTIA 5I9LA 1DAOA 4YAKA 3BTSA 2Q2WA 3KSZO 3JD4A 2Y67A 3H9GA 3H9JA 4L9RA 2DKNA 3ITKA 3FPLA 5GMOA 2PH3A 1NTOA 4BO6A 3DZFA 3ZNQA 4PVCA 4BKPA 1AHIA 3NGXA 1NQOA 4UVGA 4CUJA 1TA4A 3I23A 3EW7A 2HDHA 4GGPA 4INAA 3UUWA 1NHGA 4GBJA 3HFSA 3H9QA 1GEGA 2GD1O 3K96A 2WJPA 1XKQA 1LQUA 1YE3A 5F5LA 4TKLA 1YO6A 4YAGA 2HQ1A 1K5HA 3KO8A 3ON5A 4J2OA 4CLEA 2PFGA 4KZPA 2AEMA 1UUFA 3QHAA 4J1QA 1E1KA 3CE6A 4P4LA 4UVDA 2CDCA 8LDHA 3KB6A 5TJ9A 4ILKA 4ND3A 2JKVA 2JCXA 4E5NA 1IHYA 1VI2A 4ZVVA 4D43A 4JBHA 1NVGA 1AE1A 2X9NA 1KC1A 4OH1A 3HB4X 1EK6A 1T26A 3K30A 5TNXA 4FOOA 3IL2A 3T7EA 4DWVA 1N7HA 4PFJA 2DPGA 1KERA 2WEKA 4IPTA 4BGUA 3DONA 1G1AA 3AW9A 5HTOA 1H94A 1HYGA 1NQ5A 2A9FA 3SBOA 2PKRA 3PPIA 2B0JA 1M76A 1PJ3A 3BHIA 3G49A 5JC8A 2LDBA 4UVEA 3KYDB 1PZFA 2A92A 4BNUA 3FR8A 3KUXA 4CM4A 4FCCA 4BS9A 2W2KA 1PJSA 2HRZA 3DBLA 3GC6A 1V3TA 4N7RA 3PWSA 4FJ0A 3JV7A 1QORA 4HY3A 5EIOA 1Z74A 2DQ4A 3AU9A 3H3JA 5A3JA 3QVWA 4J91A 5BSHA 5CDGA 5CEEA 4FW8A 2DPHA 2DVMA 4CMBA 1GCOA 2AE1A 3OIDA 5I9MA 2R00A 1HL3A 2PTGA 2FWMX 5I8ZA 1ZK2A 3CKYA 4XZ3A 4BNVA 1EDOA 3KYDA 2CVOA 1YDWA 2IDZA 3ADPA 3TRIA 1EK5A 1S6YA 4RPJA 5JY1A 3IKTA 2D3TA 4YACA 3WMXA 3W8DA 3OFSA 4DL9A 3E48A 3ZWOA 2Q3EA 1UDCA 1PS0A 5HBRA 4QUKA 2VYND 3NDRA 2X1HA 2EEZA 3VPSA 1E7RA 4J3FA 5JXWA 4ND2A 2G1UA 4R1TA 4BIIA 4OXYA 2J5KA 5JAMA 3K6JA 2NVWA 1LDEA 1IPEA 1NNUA 3DBRA 4NFHA 3OM9A 1MV8A 4JCOA 3FF4A 1GZ6A 1BGVA 2OBNA 2WWRA 4IXTA 2C5AA 1NYTA 3AI3A 1IZ9A 2DUWA 3HUDA 3MWDB 2XXJA 4ZRNA 4P22A 4N5LA 3JQAA 2Y66A 5IDQA 5GZ6A 3KV3O 1I0ZA 2NUAA 3JQ9A 4C4OA 4CUKA 1KS9A 2YV2A 3DWFA 2DTDA 4MVJG 5ENVA 3VH4A 2Z1MA 1UXGA 3IIEA 4CM9D 4FJ1A 3LU1A 3QWAA 3OJEA 3E9MA 2FZEA 4LW8A 3ZW8A 4ZN6A 5I7FA 3WGYA 2X9GA 1DRUA 1PGQA 3ROQA 3JQFA 4A0SA 3GRPA 4BNNA 1IYZA 4K6FA 1T2FA 4R69A 4CQMB 5TF4A 1NQAO 1CQJA 3RU7A 1N2SA 1V3VA
chains in the Genus database with same CATH superfamily
3VU1A 3IP3A 3NMUF 3MC1A 1XTPA 4X63A 1FSZA 1MOQA 5LZ9A 2NV0A 5FOWA 5H3CA 1WCYA 3WTCA 1MV5A 2GOYA 1OZFA 4BLRA 2SCUA 2R1ZA 3OT1B 2C4TA 1FTNA 3LCUA 3V4LA 4YBZA 4S0ZA 2JIQA 4M3NA 1NU8A 1QBGA 4QWWA 1C7EA 2IYFA 1H3EA 1JIKA 3GVPA 2ZANA 3KZMA 5ALPA 3RJ5A 1Z47A 2X7XA 4N54A 3REQB 2PDAA 4RNCA 3COZA 2N9UA 1UKVY 4OKSA 4M1QA 4R5HA 2R8BA 4Y8VA 1UK9A 1ZH8A 2NYRA 4YQZA 5BSTA 3VYTB 4YRTA 3ADDA 2QJOA 4BVAA 4EG4A 3BH6A 4JT4A 1ENZA 3HMKA 2P9FA 1EFVB 3OX4A 5EE0A 1DS6A 1BWQA 3ETGA 3OZTA 5GOZA 1THGA 4QPJC 3ESAA 2R8YA 3I9LA 1WG8A 5K51A 3STYA 3UAGA 1E1MA 2VPWA 3GNQA 3VVCA 2AX4A 4IMJB 2J1LA 1C1DA 4L4XA 1PZXA 3RVOA 4RZXA 5I47A 3F4LA 3T9EA 1KFBB 2FCRA 2A4KA 1I94B 4P7JA 2QJFA 3HFGA 4ERXA 621PA 2XBMA 3IAAA 3GFPA 4BRZA 2P3SA 3N53A 4LMAA 3BAFA 4OL0A 4OXIA 4CLRB 4LCJA 3R7FA 3KEOA 3HO1A 2XAUA 5BSMA 1AZTA 1JIVA 3QMVA 1FDOA 3HM2A 5JJ5A 3GGCA 2LCIA 4DRYA 2FPGB 1A50B 3MWEA 1YSCA 1VE9A 3M3PA 1NI5A 1NQUA 2GK6A 2XTZA 3AMVA 3KKPA 1E2KA 4NAVA 3AHEA 4TWBA 3ZWYA 3MGBA 4NCBA 1OR8A 2CXPA 2VWQA 3AI1A 2JIZD 5EIFA 2FLVA 1KEZA 2BR5A 2ZKLA 3JQ7B 4KO4S 3UXYA 3DZGA 4OHRA 4ZODA 4R1LA 5CAEA 4RS4A 1UFRA 3OLQA 5CMLA 4HC4A 1D2MA 5TMDA 4KMMA 2QTHA 4NWIA 1RLTA 1JAXA 5T6BA 2GRUA 1KJJA 2VK1A 5TGDA 2XRZA 4J1NA 1KZ4A 2DPXA 5TV2A 3T9FA 1RW4A 2AVDA 3OF3A 1O08A 1OU0A 4IGEA 5DHSA 2AR7A 2RGBA 4ZYLA 2JHFA 4Q3EA 2BGUA 3NNNA 1P7YA 4NESA 5FLXA 4INPA 1QRAA 3L0SA 4UNRA 3R7BA 1C1XA 4D0SA 4ZP1A 3U1VA 1OT3A 1PK8A 1YIAA 2P4QA 3L6EA 5KVQA 1Z2CA 2YHBA 1YKGA 3FXAA 3A4VA 4NE7A 4B1FA 1DT5A 3ILVA 4NYMR 2HXGA 3T7SA 9ATCA 1U0SY 4MP3A 1YZTA 1G18A 1P6XA 5BVGA 2X8WA 1U1EA 1UPAA 3L18A 5KX5B 3STVA 1R6VA 4RPGA 3DZIA 3EHEA 3PJEA 4GOKA 5L53A 1E3WB 1VGQA 3TE7A 2CDBA 5T5QA 2BMDA 2PUTA 3AUKA 4FKZA 4MDHA 5D86A 4R1QA 4ZCSA 3BGWA 3V8BA 2YRXA 3CF4A 3F98A 2OFOA 4IQ0A 4LV5B 5BN3B 4FIZA 3T0GA 1I6MA 5TRTA 3E9QA 4CQLA 2V6IA 3IQXA 1ST2A 1KZGB 1WUKS 2A9RA 2KX7A 1IOLA 2IZOA 5I7VA 1EWVA 3BIFA 2W37A 3L41A 3QF7A 4JKIA 3T3EA 5JQGB 1IEWA 3TJRA 1G8HA 4JAVC 4FDMA 3ZR4B 1WP9A 4MQFA 2YXEA 3OX2A 1DBPA 2C97A 3T4PA 4EG0A 1H4SA 1K0UA 1YDMA 2DFLA 1YZVA 4GOXA 1UBMS 1K88A 2PBZA 2W6JA 4CIWA 2R8XA 3ROZA 1R0XA 3TLEA 2ADMA 2OQ2A 1RRGA 2QUHA 1NXQA 3HJRA 4Q47A 4RMHA 3I9MA 5EA2A 3WWDA 3A11A 4CTJA 3Q4GA 4F11A 1VKRA 1KF0A 1BEEA 1MOSA 2HF7A 2AQHA 4OAPA 4PZ9A 4DDTA 1XR3A 1UP4A 7MDHA 1F2VA 5DNVA 1PJ4A 2VOJA 1KO1A 4ZVPA 1U0GA 3B3QA 1JAIA 3OHSX 5DM2A 2CW5A 2H08A 2NNLD 4EG5A 3FZYA 2QWXA 1OH7A 1H9CA 4CMIB 4C4SA 2VHJA 4IX1A 2I4NA 5E1MA 2H2GA 5M34A 3O4IA 3UK2A 4AK9A 4ETIA 4WACA 1DKMA 2PSHA 3U62A 3ZZMA 4BMZA 1ZN8A 3QX7A 4WI1A 4CFZA 3IIMA 2RGRA 5KAPA 1VL2A 4WSOA 1J07A 2WHQA 4TRRA 3MSCA 2VAMA 1JAZA 5FYDA 4ZXFA 4ER7A 5CFOA 1CYEA 4AL4A 3KL2A 4B3IA 1L5KA 2PX5A 1UFOA 1R6AA 3BEOA 2BKEA 3DP7A 3UJ8A 2YTZA 3URKA 1XZJA 3GOQA 1AQUA 2EJVA 1RLJA 4X8OA 3FNQA 1Z29A 3AV3A 4DQUA 4ZQCB 4ZHQF 1YE5A 3G2PA 3BREA 5ANRB 4LY6A 4TMYA 4Y1EA 1YZGA 3CRRA 2HF8A 1P7VA 1T3TA 2VRBA 2OG1A 1AMUA 4L4RA 5B1SA 1M33A 1S2OA 1T1RA 4KE9A 1KKLA 3DLAA 4JY7A 3PHGA 4JDPA 3UHAA 3WXBA 2D06A 2NAFA 2ZJOA 4YT8A 2XCLA 3A31A 3EQ8A 5A2GA 4DQKA 4FMBB 2DMRA 2XJ9A 1LLUA 1XZHA 1J20A 3DAPA 3GP8A 3N5CA 4FR0A 4RMJA 2OECA 1P1HA 3I09A 5I7RA 1XTSA 1Z4JA 2EQAA 4KIUA 3JZMA 4JKYA 3H1FA 5AR1A 2PK3A 2ZJBA 2EZUA 1ML4A 1T3SA 2XR1A 4H7FA 4NZOA 3O8RA 3A4TA 4ISBA 4KPUA 1OAAA 1Z68A 1U5AA 2BR3A 5EVCA 3RO7A 2QROA 2EJWA 5F1OA 4D98A 3UAZA 2H2WA 2WJAA 1OZAA 4JCCA 4S1OA 4DBLE 1A2QA 1O6ZA 3PSHA 5IT0A 4XWGA 4DNOA 4I1PA 4B6PA 1IZYA 3S6JA 4II7A 1X1RA 2GUWA 3T38A 1D2HA 1FMJA 2B82A 3DE3X 5DDIP 5EWJA 4KR9A 3DGEC 2D6FA 2ZIGA 4PC1A 5EUBA 1VA5A 2D2XA 1GD1O 4EECA 3HB5X 5KINB 3EIOA 2Z3VA 1P61B 3L8YA 1FQOA 1NFQA 1YKSA 5K3SA 1EK0A 1SOUA 2A1TS 1GQOA 2VKTA 3FOAA 4G8JA 4KOEC 4KNYA 3ZVNA 2H51A 3U40A 1TFUA 1FQJA 2JANA 1QIFA 1TMOA 1ISRA 3KQKA 3FJ1A 1W88A 4P2BA 5BSUA 1PJTA 3HV2A 3FA2A 2Y2UA 3QOYA 4D4IA 5I7HA 4NARA 1U0FA 5J4VA 5LR6A 2XTMA 1LU9A 1HEYA 2J5XA 4O3FA 4JYMA 4C6HA 2WD8A 3NNSA 5AXBA 1TUEA 3KJNA 4FJ2A 4CKXA 1VL5A 1M66A 4KH1A 3PNMA 1LJUA 2GD2A 4WDQA 4ZV7A 4C0XA 1K08A 1F51E 1G5QA 4QARA 2OGZA 1U2TA 2ZQ5A 4H3SA 4CV0A 1RXWA 1VB3A 3ZCSA 1NSFA 5CJ2A 4P3PA 4KP7A 2VS1A 4LK2A 4K1XA 3WNCA 1WA5A 1H9AA 4YT4A 3CCBA 4DV3B 1Z62A 3EEIA 3WQQA 1JJAA 2ZTUA 4LWQA 1B6SA 1IN4A 3S70A 1J2YA 4F4UA 1L1FA 2QMUA 5F5XA 4A82A 1ZWLA 4D80A 4EY8A 2KE5A 2FTKE 4JITA 4DYVA 3RGWS 1N6KA 3ST7A 3I6QA 4YP9A 1RYHA 3SHQA 2YIVX 2HADA 1P4AA 3MCZA 4L9SA 4FPXA 1YQWA 1OXUA 1QO0D 5AVOA 1VZ2A 4PY2A 1AM4D 2WIGA 1P9OA 3E9EA 3PPWA 4PZZA 5EJ2A 5EIEA 3FPHA 4LHEA 5EHXA 3CONA 4D26A 4I55F 1Y8RB 1H4QA 1T3ZA 4S05A 5AJWA 5ENZA 2IZZA 4RNDB 2Y0EA 1Z2DA 2Y6VA 3KHUA 4E88A 2EEPA 1NXVA 2GB4A 5FOSA 4QQFA 4G0UA 2WTMA 3WY9A 3NB0A 5B2FA 2MSKA 3GQVA 1C80A 2ZT7A 5CB8A 4E7OA 4K6MA 1ND6A 4W82A 3G2OA 1XHLA 2QIPA 5ICCA 1O96B 2WR8A 3L0BA 3LYHA 4FN4A 3ZHCA 2BSAA 1VBMA 3U9TA 1C4KA 1X7XA 2I29A 4QQ8A 1GNQA 1KK2A 1NKVA 2PH1A 4R5MA 5TSDA 5J2TA 4DA9A 1R0YA 2FEAA 1T9HA 2FXVA 3CSSA 3IP6A 4DR3B 3O8BA 4WK6A 2O8BA 3NS7A 4YB8A 5CVUA 2WHEA 2HJHA 1V43A 2WKWA 3G8YA 1X92A 3TIXB 5L3VA 1IJKA 2NU8B 5K3AA 2VCHA 1H69A 3H8VA 2C42A 4LYDA 3HKCB 5EQDA 1A2KC 1T5LA 1THTA 2AOWA 3LDFA 2YKGA 2H31A 3CO0S 2C95A 4ZIRA 1IIRA 4JI6B 3ZHZA 2VUUA 5KC8A 1Y9JA 2GASA 1OLOA 2O48X 3KVYA 3QF4A 1HDZA 4KAJA 3WRXC 2OBMA 1OC4A 3W2EA 1CLUA 2CJYA 2JBAA 3BERA 1KARA 2VRCA 4H08A 5KSPA 4X0EA 4CKEB 4QLAA 3FAZA 2JGLA 5L3RA 3WK6A 3A25A 5DNCA 3W5UA 1TMGE 3Q40A 3FUVA 1NOJA 2HBZA 4FXPA 4GP9A 5B12A 4J16A 1ZW1A 1FA9A 4I4CA 1X7HA 5IVPA 3TQRA 1E4VA 2RI6A 3KXKA 4H18A 3D3WB 2XCSB 3RUFA 1RIIA 2HMUA 4UQLA 2NOAA 3KVOA 1NR7A 1QJ4A 1RE0A 1VIMA 3HLTA 1E79A 2ANBA 1UZLA 2QI9F 1NP6A 1RWBA 2V6BA 4W5WA 5FNZA 3CKLA 2AXNA 1LBHA 2AFIA 2B5OA 3OA2A 1CEXA 2W6CX 3U0BA 5K3CA 1NSYA 1PO7A 1VIYA 4L5JA 4QBGB 3E9NA 3IOEA 5ELXA 4JIGA 1O95D 4KPFC 1B23P 4L3OA 3OAAD 4N5NA 1ZVMA 4R2MA 3W8EA 5CXXA 3O6VA 4JP2A 3FNHA 1OLXA 4RJKA 1CG6A 1NXTA 4OOFA 1BOFA 3CLTD 4JEHA 4Q34A 5GVRA 5HKKD 4IIXA 4PGHA 4U7FA 5DI3A 2D7DA 2P2SA 3HCWA 3HYSA 4NJMA 1SXPA 5ELMA 1TKRA 1FFCA 3LUDA 5B64A 4WE3A 1U28C 3Q5GA 2CSXA 1M9NA 1RMYA 2QK4A 5AD1A 2PGJA 2QNIA 4AF6A 3ZNPA 1UT5A 4QM7A 4MV7A 2XRMA 2R97A 2WQ6A 3FCAA 4XQGA 3BHMA 2K4MA 2C3YA 3ZD7A 2ZUVA 3C3CA 2UUAB 4DLTA 4C6TA 3MB8A 3J80A 2VT3A 3KQQA 4S3MA 1ISGA 4QVGA 4C06A 3PXGA 1PQUA 4RMGA 1P3JA 3GXBA 2DUMA 3M5DA 1E4EB 4M83A 3PZBA 4P5EA 3WYFA 4A26A 1P31A 4AJIA 1M34A 2X58A 4B3CA 5KMGB 1DELA 1HYEA 1OX4A 1TJ5A 1SU6A 3NDJA 3HA3A 2ZBPA 4BEWA 5FL3A 3CX6A 4DM3A 3OI7A 2RAFA 4GPIB 3VPXA 3SMQA 5GV8A 3UBTA 2IHYA 2YIDA 4I0WB 2O3TA 2XUIA 1R9JA 3CNQS 4J94A 2MTBA 2ODAA 4ZVSA 3LUPA 4G8BA 3MXTA 1YHZA 5FPQA 4CM6A 3A9VA 3ROGA 3GLFE 4M9RA 3K1YA 1C8BA 2JCBA 2ODEA 4O08A 5EJGA 2RKBA 1KR5A 2IA5A 3H1PA 2V65A 1B1CA 2ZRGA 3N2KB 4KQ1A 3BD6A 2RG7A 4WERA 4Q3CA 4JA2A 4PAWA 1ZH6A 3V8VA 2Q45A 3DDOA 3AXTA 1IIBA 1VXRA 1TIBA 1RACA 3N2KA 1R0RE 3A6KA 2W8BA 4WY8A 3TLAA 3ASVA 5BRJA 3K31A 4H59A 3ZTWA 4RD0A 1P4SA 4V39A 3FGOA 4LRSB 3UF0A 2RGXA 1I7LA 4YS6A 1EX1A 1BXRA 3A10A 5FTJA 5HCIA 2O2YA 2P2GA 3SOPA 3TPZA 4EPTA 2AG5A 3PFBA 4F9EA 5FD8A 2QPLA 4D6XA 4N7BA 4NDZA 2P30A 4EHBA 2IYZA 1I10A 2B7LA 3V9AA 2G4LA 4WH0A 3MLEA 3V34A 3S2YA 3CMMA 4ZZ2A 2G7MC 2SBTA 1X7YA 2F62A 2F1IA 2R751 5JSQA 1Z2EA 1S2DA 4O0MA 1NNI1 1DIHA 3Q7RA 2GA9A 4L02A 5JDCC 4C4XA 1MBZA 4N9QA 4O2RA 3ESDA 4L7VA 2RHJA 4XD2A 4BQRA 1KO8A 2D54A 3EMKA 2LR0A 3I9V1 4ND8B 3UXMA 5IFLA 4LJ6A 3GCDA 1CJSA 3SJBA 4BNJA 4MI9A 3K9HA 2VWHA 2YVAA 1Y6FA 4KI7A 4HT3B 1V1RA 3KQMA 5L4NA 2J9ZB 1DL5A 2Y1WA 1QANA 1W52X 2C5EA 1P18A 1Q6YA 1X94A 1Z0FA 2Z1DA 4LOIA 3U0VA 2O7NA 1Q1NA 3ZGOA 4DJ5X 3H5NA 4ZZ3A 3NONA 4GX0A 2FWRA 4XRRA 4OU5A 5KNCD 4R8KA 1PI3A 1M6HA 3ERCA 1EWRA 1D3AA 1QG0A 4MIOA 5IC6A 4A23A 2IEGA 1P4RA 4JBGA 4V03A 1AN0A 5JYBA 2EIXA 1QYVA 3UV6A 3I2HA 1JHOA 2I8LA 2WMNB 1NMQA 4J07A 2QTLA 4RLHA 1ZESA 3FVWA 1AKTA 4LJ8A 4DWOA 3BXGA 3ZS8A 1YRBA 3ACBA 3REOA 1N9GA 4EGQA 5ALKA 2Q6TA 3FCOA 3EAQA 2PH7A 3CJQA 2RE8A 3W1VA 1QMPA 1UKEA 2ZXEA 2PX6A 1L0BA 4AZ3B 2O0MA 4RS3A 5HKOA 4Q9LA 2AFIB 5BUZA 1PT7A 4QREA 1XB2A 3FHCB 4FOSA 1I3OA 4YAOA 1UBKS 2GTPA 3NGLA 1TQ2A 3IIJA 3A04A 1KE1A 2PSSA 1PLLA 2IUYA 4DBVO 4NPCA 1MQSA 4GXNA 5T41A 3EXG1 4Q21A 3PB3A 5J1TB 1G7RA 4HOYA 1KH2A 4LMPA 2BZGA 5K0ZA 4QXRA 1OI3A 1HETA 3HCBA 3QPUA 2CV2A 2Q9BA 4IHQA 4JT8A 2IIVA 1MHTA 3RS9A 2JGRA 4IOMA 1P75A 1VKHA 2PIAA 2FPIB 4R8LA 3OKFA 1L4MA 3Q3HA 1OBHA 4XSHA 4P7KA 4DIOA 1P3DA 1E98A 2E85A 3QV1A 3H2YA 4MMZB 1QG2A 3PGKA 1MB9A 4RXUA 3WWPA 1ZCJA 4HZUB 4NCHA 1Z6AA 1MEOA 2A33A 4BTVA 3L6CA 3CVOA 4WUVA 3EXFB 3CH5A 3K35A 4JT9A 4AUEA 1G4HA 1I5EA 1QTNA 4KVFA 5HUHA 4URYR 3KETA 3AVYA 2ZBRA 2JH8A 4HZIA 4L28A 4AX4A 2O8BB 1B93A 1IFXA 1CEEA 3C1TA 3IKVA 1ONBA 4DIBA 3FUTA 3ZDRA 1U11A 1J21A 1MUUA 4XWWA 3R7SA 4PYNA 3DUFA 1O8BA 4DMKA 2PSEA 4RHFA 3RIHA 1SCIA 2PGLA 2WWVD 1NNLA 2GNPA 1O9BA 1K68A 4D9NA 4YXWD 2PUVA 5BXYA 3KT3A 5DF1A 1ACJA 1ZJ5A 4GQBA 3VR5H 4BKQA 3ZY2A 2LIVA 1L4YA 4LS3A 3DNFA 4M0FA 5DOVA 5J59A 3TPFA 2IUEA 3T9DA 1A9XB 2X42A 4O4LF 3FYHA 4EKEA 1FW8A 1CJVC 4C21A 1RM3A 1I6KA 1XQ1A 1YI1A 2D7CA 3I28A 3HNRA 2C5GA 4BFVA 4TUYB 1GFWA 4QQKA 4DCVA 3Q2IA 4QDZA 2NMVA 3JYOA 3A6GA 1BKDR 3D0QA 2P8JA 4BNZA 1B8PA 4OV6B 1UWVA 2GCEA 4R0VA 4P4NA 4DWJA 4KBYA 1CQZA 1ULHA 3E7XA 2NZVG 3OICA 3AGQA 4PBTA 4NG4A 3B1FA 5TPZD 2XT6A 3GI1A 4R7ZA 1NF3A 4Q3NA 4BVKA 1H8ED 2CMHA 3A06A 3T99A 4B46A 2JFGA 2W98A 1NNSA 4AS2A 3FB4A 3FMGA 4I6GA 3ZVMA 2WWFA 2GJ4A 2GJAA 2IIQA 2RGUA 3K9LA 2NU7A 2H1CA 2Y1LA 3LLSA 4LJ9A 1DAKA 4CEHA 2OHOA 1EH5A 1B6GA 1C7IA 1NY5A 2Y1EA 2JC3A 3LW7A 4QSMA 3ES9A 3M6FA 3STWA 1NVKA 5KO2A 1FDIA 1KVRA 3P45A 3LDHA 4YI3A 1H2WA 4XLTA 4JROA 3THWB 4TSFA 1CFZA 3MUNA 5ER9A 1V35A 2W93A 1B2LA 1W8IA 2W5UA 1QS0A 1RXSA 2JLSA 4OBEA 2GPNA 3WGUA 1KVSA 3INRA 1YMQA 4FI3C 3SX2A 3GUYA 3LC2O 4TS4A 4W7HA 1ONOA 4J0JA 3H4VA 1NATA 3OFNA 4KQ9A 4ZVTA 1Q3KA 3MJEA 1W35A 3HO6A 3O8CA 3TL3A 2WAOA 2DERA 1G6Q1 1CNEA 1E7MA 2XE7A 3N8KA 3Q3EA 4PLCA 5IN4A 3V8PA 3K5WA 2MCFA 2Y9PB 2YWFA 3Q12A 2HXSA 3FWPA 3HLKA 5IVKA 2Q9UA 4BYGA 5AVVA 2YQ4A 3HL0A 2FSUA 2EIHA 5DBFA 1MJGM 1Z3IX 3GDGA 3PENA 1FTWA 2BAGA 2HY7A 2LD4A 4UMEA 3AY6A 4A2QA 5FOVA 3BYZA 4MVJF 3BFVA 3E18A 4PHGA 5EHZA 3ND6A 3H6KA 5F98A 3PNVA 3K0CC 3O2JA 1XSEA 1QCCA 1QP7A 5DP1A 1KAGA 2CVZA 1WF3A 2EKQA 4TKVA 2FUNB 2JL1A 1J9ZA 2DUJA 3QG5A 1FQWA 4ZVRA 3MF4A 1RZRD 4FVTA 3WLEA 2ADFA 1J2JA 5FR1A 1F2UB 1KHTA 2RH4A 4P80A 4ZXPA 3VSDA 1FDWA 1BXGB 4YV7A 4FYKA 5BNFA 4GIBA 5CHEA 3TN7A 1T0PA 2C7GA 4DRXB 1TJ4A 1W93A 1ULAA 4IYJA 2YZ7A 3V46A 3FDFA 4GO1A 2H06A 3GB9A 1ES9A 2JGIA 4AY2A 2NTVA 1OY1A 1UOEA 1JKIA 2ETVA 4X61A 1SK8A 1WLSA 1J09A 1Z7GA 2EJUA 2VQ3A 3BK7A 3V32A 4Y2VA 4GPEA 4A9AA 4DDHA 5CIWA 3ZD8A 4Y9DA 2W2QA 4ZAFA 1KGDA 1M83A 2VTDA 2I2WA 3A7EA 3M6UA 2RBGA 4BWYA 1U04A 3AJ8A 4WZAA 3HE3A 2QTVB 3IDZA 4H7PA 2OV3A 3TPCA 1GILA 2OYSA 2ZRNA 2J09A 4L4ZA 1N0VC 1G6OA 2AG1A 3OOYA 1ZZGA 1VM6A 2DR0A 1WCIA 3LWBA 2Q9CA 4NOMA 1VHJA 4J3NA 4HCJA 2WSMA 2B9VA 4M0CA 5A3QA 5C7LO 5J4LA 2K7FA 4NCAA 4ESOA 2BT4A 3GNTA 2PX3A 3JD2A 2RIPA 1BJTA 2WWGA 1Y8QA 1NZJA 3EA4A 4IGAA 3VC2A 5JCOC 3QSGA 2GPAA 3HRIA 3BVPA 4C7OB 3G6WA 1FSSA 4C87A 1R7RA 3UVEA 1K6XA 3L4JA 3G5AA 4CM8B 3E70C 2IODA 4R6XA 3N6RA 2BMEA 4TTPA 3ZDYB 3DB1A 1BHQ1 4R1PA 5IK2D 4KGVA 5FUXA 4M87A 1O94A 3H65A 1FP6A 4NL4H 3UKDA 4D9IA 4BO8A 5JNLA 2CFSA 3HNPA 1QIEA 1K75A 2FFBA 4PG4A 4FI3F 4PC3A 1S2NA 1RC0A 5H3HA 2OO5A 5H81A 1J90A 5BP7A 2D1YA 2PPLA 1L9XA 3O0DA 3QNMA 2H29A 2QUZA 1SCUB 4WKOA 2AUNA 3SNKA 1RBQA 3ELWA 1NJ6A 4MQFB 4OL9A 1V5WA 2ODWA 3FI9A 3KBOA 4HX5A 9GPBA 4U8HA 1IEVA 1ZRHA 3LVBA 3VYWA 4PM4A 1BCRA 5ALEA 3M4NA 1GGKA 2JI7A 4QGHA 3REGA 1UP7A 3BTOA 4LRTB 4GLJA 3R74A 4V0LA 2MYNA 2MIIA 1XL0A 2JLQA 4EF4A 2BH2A 1B2RA 1PGNA 3OIYA 4ZQBA 2F6RA 3OE5A 4XE5A 5CPBA 1T8UA 4GQIA 5FTMA 3KOXA 4O4HB 1SB9A 4YCAA 1Z0JA 7YASA 4MP8A 2I8CA 2WSBA 1NX6A 1GL6A 4PTZA 2QE7D 1I2ZA 1C8KA 4R16A 2IV2X 5B3JC 5BVGB 5C1DA 4E13A 1O3YA 3GUVA 3PXCX 1C4WA 3TD9A 2XB2A 3DLIA 5FWAA 1UH5A 2E3JA 4IVNA 5BXQC 1GPUA 5LP6B 4MUBA 3FVQA 4RPKA 1JE1A 1Q20A 5K4GA 1RXCA 3HV0A 4YJFB 4DJFC 2A5YB 1C1XB 16PKA 1WCWA 2A1UB 2QMZA 2XUQA 3OY2A 3VM6A 4LYYA 2LBPA 2QTGA 4L5IA 3WIOA 4K46A 4W99A 5BYBA 1ZIPA 3W9SA 1HRKA 3OEHA 4YO7A 1FTQA 5EWMB 4GR5A 1IWOA 4CM7A 2PR7A 2FU5C 4GSKA 1IH8A 1SWVA 1W44A 3GZNA 4IIUA 4JUBA 1ZFNA 3TKYA 4M0PA 4S04A 4RTSA 1BQ3A 4DXDA 3SHOA 5CUQA 1EUDA 2V7QA 4R9SA 3JQ7A 1F1JA 4X41A 5CAEB 3ICOA 5BUSA 1DC5A 4JHLA 4TYPA 1NJ5A 3VPDA 5CFNA 3KU1A 3HJCA 2OOKA 3RW9A 1SPBS 4MW2A 3DOUA 4DV6B 1PAUA 1QTRA 2VSXA 4HAYA 3DR3A 4TVOA 2JIZA 5DHQA 5A02A 4NYJR 1GYRA 2JD0A 1EE2A 4BEVA 2ZUBA 4A4DA 4ARUA 3ONDA 1Z5OA 4DW8A 4EPRA 3U4QB 1HDOA 2VP3A 4UMVA 1UBTS 2ISQA 3AHJA 4E5PA 3PIIA 2DQSA 1YK0A 3DTVA 3HA7A 4B34A 4RIHA 1QO7A 3I92A 3C24A 4JUIA 4YR9A 5CLJA 5ALVA 4FFPA 4ZDWA 1KDPA 1AK1A 1FNBA 1OWMA 1NW7A 3L1HA 2F90A 3H9UA 2NSJA 1H23A 3ISVA 2WAAA 2QZSA 3GZNB 5AKIA 5J2UF 1OH5A 4G5YA 2YHAA 4NKRA 4YN3A 2QVZX 1KPIA 3OURA 4N12A 3OOHA 3IOCA 1Z8NA 3ZGXA 1XL1A 1PZEA 5CLQA 1YB2A 2VHXA 5DWQA 4ZPXA 3T7AA 5JXIA 1O54A 2AOVA 4EEXA 4JP3A 1QFJA 2WKQA 1JQKA 2H4FA 2IKQA 4YJFA 4BPBA 3N8IA 4M46A 3M4YA 1IG3A 1YDHA 3ODGA 4K6HA 3ELYA 3IP8A 1DEKA 3G2HA 4EZEA 2FFAA 3UYLA 4GGOA 4LPSA 2CVPA 2WUEA 3MJFA 1QNFA 2BR4A 4K7JA 1G19A 3BD7A 4ECAA 2ORIA 4RLQA 5DLPA 2HRCA 3DV0B 2NVUB 2QJTA 5FI0B 3UG7A 2OO7A 1TEHA 4OXQA 1VRVA 3W1EA 2GZHA 4MW7A 5ELLA 5CCXA 4G0YA 4Z4EA 1HQDA 4DA6A 5A7FA 1GPNA 1ZSYA 4DC1A 7MHTA 5EJ8A 1ZGAA 1H66A 2A0WA 4N6NA 3CURA 5E7QA 1HGXA 3IJPA 3MHPA 2H4JA 3L6UA 3QK7A 2YWHA 2O07A 2C98A 1GZ5A 4K81B 1ZJYA 3TW8A 2BFFA 4P53A 3MWJA 3GA0A 2D1RA 1ZA2A 2G67A 3Q3GE 1BCRB 3HEMA 1CJMA 3UM9A 2TMGA 5C46F 3AR6A 3NRBA 3R41A 3WMEA 4FNGA 3CLHA 2I6SA 3GFVA 3NHKA 5DX1A 4NU6A 2C2GA 4ITUA 5DLQC 4CF7A 1D2AA 4HXEB 4JELA 1S9DA 4RGBA 5K3EA 4B3JA 4II2A 3K8ZA 3GQBA 4N7MA 3EY9A 4ZICA 4UATA 4ROSA 4EUKA 3KQLA 2F9LA 4WNAA 1Y6ZA 2E4YA 3DHVA 2X4LA 4ILEA 4IKOA 5BV0A 2C54A 2O6HA 4CBVA 3N0RA 4E6PA 3RVJA 4BGVA 3MB5A 2ID4A 2AN5A 2AJBA 2ZVPX 4JENA 4JC0A 1N3BA 4CM8A 5KPDA 3DBRB 3HFJA 3KJIA 3LTNC 1KQGA 5C8YF 4KQ2A 2RHBA 1CV2A 2HL6A 1IUPA 1QIDA 2HBRA 1QDUA 2F43B 4J29A 1T9BA 2X3FA 3G5LA 3UWMA 1D1TA 4X65B 2DETA 2FSFA 5J23A 3WZMA 3A1EA 3CLTC 1WCIB 1OXKB 3BJIC 1GQQA 5JISA 1DUSA 4MV8A 1FYFA 2ECKA 5CVTA 1OFUX 3ADCA 4CNBA 1UPBA 1EHYA 4WUTA 2PH5A 1TKAA 4ETMA 4WZAB 1M1YE 2HU8A 5IVDA 4UZFA 3I9V6 1H1TA 1U3CA 2VHYA 5AFSA 8OHMA 1VE3A 5MGNA 3SF0A 1Z5WA 4C3OB 1JSXA 2FF5A 4EJ6A 4DR5B 3IEVA 2YVUA 4TTRA 3LPAA 5CM8B 3PEWA 1P9LA 3DFMA 5KJCA 1BH2A 2JFUA 2P75A 2Q8NA 3JZAA 4S12A 4LFBB 5TLSA 2IYXA 1XQ6A 3EWSA 3FR7A 4N5HX 1XTIA 4Y2UA 5BR1A 4TMXA 4M4SA 3VHRA 3ED1A 2C5BA 1N0WA 5ESWA 2HWXA 4JL6A 5BT8A 5JSZA 4IVRA 1ZBDA 1P2GA 2CWDA 4G5FA 1BE1A 2G4VA 1Z16A 1UEXC 1QE0A 1W96A 2Q2VA 1FVFA 3EZ6A 5AVXA 3K4PA 2EKLA 2ZSJA 2R44A 4F2HA 3OCWA 3WZ2A 1QOQB 2Z2JA 5AJYA 2CGEA 3LKZA 1FOEB 2JA1A 3B6JA 3GAZA 4M0DA 4MWBA 4P86A 4FKMA 1PIWA 3O8OA 5E7IA 4JZKA 1EUZA 1UWCA 5K6TA 3PEUA 4U2CA 4RHTA 2RGAA 3WOVA 3PC7A 1GFSA 1HMYA 2YOHA 4TWIA 2QE7A 4RPCA 3ORSA 4BO0A 4F5WA 4U3JA 1A9YA 2BF4A 1Y42X 4ND8A 2YMLA 2OC4A 2LKCA 3T15A 1GPYA 3IKMB 2QRUA 3OZCA 3RCBA 4IZ6A 2ACVA 3DOJA 3ISTA 4U02A 5JLAA 1XELA 1WPGA 1XHEA 4U2EA 4CKYA 4D9FA 1TFRA 4RTQA 4UNIA 4XQEA 1K92A 1T0HB 1L3BA 2AR9A 2Z2IA 2OO3A 3H6GA 1TAQA 4D45A 3ETCA 4JLPA 5IXSA 4UNQA 1R3UA 5GZ3A 3IUEA 1I2BA 3WX0A 4DB2A 3JTMA 3ZGZA 3DZJA 4I8XA 4ZJUA 1GNPA 2Z08A 3QVSA 3EMDA 1V3QE 3EGXA 1F7UA 1BXRB 1TQ6A 1EVEA 4IL5A 3HSYA 1OAOA 2CEAA 2JDID 1UT8A 2XGJA 3BKXA 1MPXA 3PWZA 5PNTA 2I9KA 1Q12A 2W8BB 1XMVA 2FK7A 2P77A 3Q2OA 3V4OA 2PLNA 2VFAA 3AF1A 3BB3A 4QICA 4PNPA 2WU4A 5LJLA 1YFJA 2CFRA 1JG2A 1Z75A 2G08A 2HCBA 2NO0A 2YOFA 3OSUA 3RYIA 5KVCA 3DDSA 3HCEA 3MWLA 1TZJA 2PUFA 4O63O 4O1HA 4IDNA 3BIWA 3D54D 3TRFA 4EABA 4UBMA 5C5CA 1M0TA 2G9VA 2ZVDA 3G2MA 2FMHA 2KJQA 2QAGA 1E61A 4RAQA 2O1EA 2WJHA 3N8GA 4O2AF 4HQLA 5EIAA 1LPNA 2GNOA 2G9QA 2YBEA 4OLFA 1TI7A 4UDOA 2GM9A 4Z4CA 2CZGA 4WOPA 1NUSA 2PUJA 4US2R 1ITZA 4XDHA 1ODFA 1Z7YA 2C9ZA 2JDIA 3GYGA 4LJYA 5LQJA 5FAKA 5EI5A 2FRDC 1ZK3A 3L02A 5AK6A 3NBZC 3SX4A 3GRZA 3L6RA 2PT9A 2Y0PA 4GVXA 5CP8A 2HYDA 3ZQJA 2DC1A 5EPOA 3RTGA 2AMVA 2DR3A 2ES4A 2WHYA 4AAYA 3RODA 3F6SA 1EFDN 2FSHA 3NR2A 4HF7A 3KJXA 4NU5A 5SYAA 4DLYA 4WVLA 5LQSA 1BU8A 3JARA 2HN9A 4LI3X 3FPKA 2R65A 4IZOA 5EE3A 4C7JA 4XGRA 2PE5A 1HA3A 3SQNA 2BHLA 2AFRA 1VMDA 2FZVA 4MXDA 4MV9A 1A88A 4EITA 3OCXA 1DFHA 3MMPA 1KFJB 2GMWA 4R54A 3V1MA 2BF7A 5LMUB 2VEDA 3W3AA 1A9QA 1HRDA 2B2CA 2H2HA 3RVPA 4LHSA 4XWKA 4PZ0A 1PR2A 1D1SA 3ANTA 1YS2X 1S2LA 3OZDA 1E9SA 2CE7A 4OQ4A 5E3JA 4AG6A 4EK9A 3EXFA 1DC8A 4IJMA 4NJMB 3FUWA 1AHHA 3UH0A 1BE8A 1ZN2A 3HVIA 4IJ6A 1BH6A 1PJZA 3RFCA 1RI4A 1A69A 4EX6A 1QE3A 5GADl 4C0BA 1WAMA 2QTNA 5BV2P 2FVXA 1XVLA 2W4IA 1WMSA 1TU4A 2CFOA 4EHJA 1GUFA 1D9XA 1KIMA 1U9IC 2ZRFA 4G56A 3V6MA 1GL7A 3WRWA 2X8JB 5FAXA 3QH4A 2X7JA 4BBJA 1Y33E 5H4GA 4PVDA 4GEKA 1M75A 4C0AC 2XTJA 1TB4A 1Q1ZA 2QMYA 3FPGA 4G07A 4PONA 4TTVA 4X44A 4K9OA 4MCHA 4REOA 1BVUA 1NU6A 5GM1A 1P0IA 2O23A 3F5FA 4JXKA 3AF5A 1A5TA 2PKYX 4IIJB 4R98A 3UICA 1MJ5A 4H17A 1ZCZA 3PNBA 3QLUC 1V26A 2WUFA 3TO5A 2E2WA 1YBHA 3O1IC 2QU7A 2VP5A 1IRXA 2RAPA 2Q99A 2HGZA 1N36B 2JBAB 3PJFA 2J45A 2H11A 4K9NA 1LTQA 2F3TA 2DP4E 3AZPA 4DANA 3LQQA 3G5UA 2XA2A 1QCDA 1F6DA 2VP2A 4EELA 1CHNA 2GBCA 2NT3A 5H7XA 1M67A 4B7ZA 5HIMA 4CHTA 2B4KA 2GKGA 4BNDB 3VI3B 3L8ZA 2H85A 2QN3A 3MXOA 1UJMA 1C8VB 3V4FA 4UUMA 4TMTA 4EYGA 5L3SA 3ZXYA 2DFPA 3KJHA 3PFCA 2HK7A 3B9QA 1YC2A 1N5IA 4N82A 3ND7A 3S2GA 3Q0IA 1YI8A 5JZVA 1CUGA 2BTOA 5LNK6 1C9DB 3TTSA 3EFEA 2G8LA 2YYYA 2BPOA 1SQ6A 3ZN2A 3JARB 1NRWA 4Q6BA 2JLCA 1FK8A 1FFGA 2JI8A 5DW3A 2GEBA 5DHTA 4ZCIA 1K06A 3JQ9C 1FF9A 5EFZA 2FWIA 3QPBA 1JSCA 1RWWA 4RVCA 2Q41A 3SFTA 3T94A 3JYQA 5J3JA 4NDNE 3AL3A 3HI6A 1E6EA 1U0LA 2ZYSA 1DXHA 2EWMA 1F4LA 2XHZA 3FPCA 4FS3A 3WLRA 1E1YA 2C9CA 1GQRA 1DBSA 1ZD5A 2Q5IA 4L27A 4CIAA 1G5TA 3BF7A 2GLUA 3LXXA 4WNIA 2I7DA 3RVKA 2ZYDA 2X5XA 3ZX4A 3D6NB 3GLHA 4AJOA 2QZ4A 5K0LA 3TQHA 3VUEA 5IJZA 2A5JA 2FPRA 1U3GA 5LQMA 1QHFA 4AMUA 3ND5A 2GO1A 3OX1A 5FEMA 3GWGA 2PD3A 3B8HA 3SJZA 5KQRA 3PTAA 1ID8A 1R64A 2ZIUB 2OAEA 4RQBA 1UDAA 1X7GA 2XMRA 1E0KA 4KV9A 4C4AA 3OFND 3QFRA 4CFSA 1O0BA 1EUQA 1Z73A 4D74A 2H59A 2VJKA 2YRWA 4AY4A 4CMHA 1NBMD 5E0KB 1PL0A 4P36A 2V9CA 2YVKA 3R3ZA 2IOFK 4UMDA 4DLUA 2R6JA 4AI6A 1A9OA 1XLWA 1DCFA 1K3TA 1PT5A 1N5JA 1QIGA 1XHFA 1SIWA 2BKAA 2JBHA 5E2BA 3ADOA 2ASVA 2QRVB 4LDJA 1KS2A 3RPEA 4QYWA 5K6AC 2R1TB 1XU7A 1GG2A 3ETEA 1A4RA 1A8SA 2PS3A 1NN5A 1TQHA 4Q3DA 5ALYA 4D57A 1ISJA 5KYTA 1W4CA 2FR1A 2YNMC 4HEJA 4RTNA 1B6RA 4B80A 2H1VA 2QT9A 2VHEA 1Z4PX 2UYHA 1QC5B 4Q24A 3QYPA 4UCWA 2W70A 3O38A 3VPAA 5IBRA 3IODA 3CRQA 1SZPA 3MPUA 1A5BB 3TW0A 2LW7A 2QRGA 1NVWQ 2VYNA 3L6DA 4TTJA 4GS5A 1Q91A 1JZTA 2OCPA 2TECE 1OX4B 1VJ5A 4FYWA 1MX3A 5ARBA 1V48A 1F14A 3PXUA 4HTFA 9MHTA 1EP9A 5G02A 3SXJA 1WOMA 2O8NA 4LZWA 2PQMA 1EJ6A 3PC8C 4U3JB 5F1YA 1GZDA 1DEAA 1M7BA 5C18A 4XGIA 4YRIA 2VUHB 1PEAA 3A6HA 5E7JA 3CVUA 3LTEA 1UXHA 2XXBA 1UMCA 1AQJA 1C3VA 2EP8A 3FNFA 5AI4A 1C8LA 3TCKA 1IXKA 5C7IO 3ZDAA 2X3YA 4I5GA 4Z7JA 2HIMA 3O2QB 4FE4A 1YCGA 1XEWX 1Z22A 5CDFA 5A9SA 4JJEA 3GLIA 1D04A 3GUZA 1NVXQ 3ND9A 3QU9A 4E3ZA 4MGYR 4BTEA 2G1AA 4YCMA 5ADUS 2EFEB 5K03A 2VI5A 2HM7A 1HDXA 2PL9A 2ZYWX 3HGQA 2HAEA 3N2ZB 3R7WA 3EPLA 1UBHS 3L6BA 5ALTA 2ZG6A 4BBPA 1RYZA 3ROKA 3ZXUB 2P5UA 5FWNA 2GHQA 1TAGA 4TWRA 4Q3LA 3RAPR 4BO5A 1OILA 2FW1A 1NXPA 3TIGA 4J4HA 1MAUA 1OTHA 4DKXA 3RRJA 1CF2O 5J4KA 5HG0A