3VQPA

Hiv-1 in core domain in complex with 2,3-dihydro-1,4-benzodioxin-5-ylmethanol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
141
Chain Sequence
b'SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 50
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqpA00
4DF4A 3HL8A 3K58A 4JS4A 4QAGA 3AVFA 1D8YA 1RDBA 1WSGA 3VN5A 2NUBA 1CXUA 1VK0A 4JLHA 4CF9A 2VG6A 2ETJA 5HBMA 1WAFA 4W5NA 3VQQA 3VQAA 2Y1JA 1NJYA 4B9TA 4HTUA 4CJEA 2PYLA 2XY7A 1S1TA 3QO9A 5FDLA 4DLEA 4CEOA 4W5QA 1NOZA 3L3VA 4FJGA 4KB1A 4RW8A 3HVTA 1S1XA 4CIGA 4CHQA 1T03A 3E01A 3NDKA 3AO2A 4CERA 4FLZA 5DMRA 3V9SA 3SQ4A 1Q8IA 1Y97A 3TAQA 3NCIA 4PY5A 5JS1A 4DSLA 3D45A 3TAPA 1RT2A 2Z1JA 4CJ4A 1QQCA 1EP4A 4Y1CA 5DK5A 1NJXA 1IO2A 4CK2A 1KVAA 1J9AA 4OLAA 1RT3A 4F2SA 3LWLA 2BE2A 3LZIA 3NHGA 4E3SA 1GOCA 1BGXT 3B6PA 3RMCA 2YNIA 1U04A 4CF1A 4ZTFA 3KD1E 1ZBHA 3DOKA 3NF6A 2HW3A 3VQDA 2FC0A 4AHSA 4N41A 4KRFA 1G15A 2HHSA 1TVRA 4H8KA 2A1RA 1ZBLA 4PA1A 1SL1A 3RMBA 2KZZA 2HHXA 5KI6A 3AVLA 3M8RA 2IC3A 2Z1IA 4IDKA 4CJ3A 4CK1A 4DMNA 1BI4B 1IKVA 2F96A 3O4QA 2HVIA 1TAUA 4CEDA 3C95A 3DI6A 1SL0A 4Z4EA 2RN2A 1S1UA 2ITGA 4JRQA 4KHSA 1A5XA 2D0AA 3OVNA 3VQCA 4FK2A 3KLHA 1J54A 1HMVA 1RTDA 4I9QA 4KI4A 1S1WA 2KQ2A 5CYMA 1RBSA 4XIUA 1U48A 1S5JA 1LW0A 4CHPA 3TANA 4FJMA 1VSIA 3IAYA 4W5OA 5J2MA 4KHWA 3HP6A 2XY8A 4DFJA 3VQ7A 3HPGA 1NKEA 1TKDA 3WNGA 5J2PA 3QINA 2W42A 2G8UA 4KB0A 3K5NA 1TGOA 3SV3A 4OJRA 3ZSQA 1RT6A 4GMJB 4BE1A 2D5RA 3MXMA 1ZBIA 4KAZA 4Z4IA 3SJJA 3I0RA 3V1RA 4FJIA 4CGDA 4DG1A 5J1EA 2FBYA 3HPOA 2E6LA 3PUFA 3DOLA 4Z4CA 4F2RA 4UQGA 2E6MA 1HYVA 3OYFA 4LH5A 4E7KA 4Z4GA 3CM5A 3ZSRA 3TAFA 2BDPA 1RT7A 2OA8A 1B9FA 4KTWA 1QE1A 3ZT0A 1KRPA 4CJRA 4ID5A 1L3VA 1WSJA 3HP9A 1RDAA 4EP5A 3KK3A 1ZBFA 2Q3SA 4PQUA 1GOAA 3I0SA 4KO0A 3MEEA 5SWMA 2OZMA 4CIEA 1WSFA 1Q9YA 3OYEA 4ELUA 3OYAA 1FKPA 1BCOA 3ASMA 3LP2A 2YNHA 4Z4HA 4DSKA 4IFYA 3RR7A 5D3GA 1JKHA 3TI0A 4N47A 3FFIA 1EXQA 4O5BA 4W5TA 3SZ2A 4FW1A 2FBTA 3VQ4A 4BDYA 2AJQA 4ID1A 1RT1A 5CY4A 3NGZA 1L5UA 2KW4A 4MFBA 4DTRA 4CEEA 5HP1A 1JXBA 1RT5A 2IDOA 3AV9A 3K2PA 1YVUA 3OYKA 1LWFA 3V6DA 3AO3A 3V4IA 2VWJA 4FLUA 4CF2A 2OZSA 1Q9XA 2HHQA 1VRTA 3QEVA 4KHNA 1D9DA 4DSJA 4AHUA 3NGYA 2BANA 4DF8A 1VSLA 3TARA 1B9DA 3AVNA 4BE0A 4B9NA 4FZYA 3AVAA 4OLBA 3L2UA 4M3TA 3ZSXA 4FLWA 4O4GA 1UOCA 3V1QA 4AHVA 4ELVA 1LAWA 3ALYA 4CJKA 4RW9A 2XO7A 1C1CA 5KRTA 4GVMA 1X1PA 3K5LA 3NGIA 1TL3A 1UWBA 4DTSA 1XHZA 3ZCMA 4CFCA 1R0AA 4JRPA 2OPRA 4LSNA 2HHUA 1SUQA 3SI6A 3LPUA 3KKSA 2B6AA 3DRSA 3I8DA 1SKRA 3C6TA 1TKZA 2FBXA 2Z1HA 1XWLA 3RMAA 4DSEA 1NK7A 3DMJA 4ZTJA 4B9MA 3NFAA 1BIUA 5CZ1A 3V81A 3KLEA 4FM1A 4DU4A 3C6UA 4DLGA 2G8WA 3IS9A 1C1AA 4O0JA 4Z4FA 4CJVA 4EZ9A 1LW2A 1NK9A 3VQ5A 3ZT3A 3LAKA 2VG7A 1HYZA 4RW4A 4EZ6A 1JL1A 3A2FA 3TAGA 4KHQA 1VRUA 4RW7A 1U49A 2X6NA 1HNVA 5HRPA 3OYNA 2DY4A 1ASVA 3OJUA 4OKEA 3SYZA 4B9UA 4CFBA 4E7HA 1EKEA 3KJVA 3QEPA 3CFRA 1D5AA 3SUPA 1LWCA 3P5JA 1J5OA 4GW6A 1RT4A 4M3RA 1JLEA 1I39A 3EY1A 4DS5A 5HROA 1SL2A 5FROA 2HNYA 4FJNA 2XY5A 3G10A 4B3OA 4Z0UA 2PY5A 4DQPA 3LP0A 1KTQA 4AH9A 1NK5A 4YFUA 1SV5A 4OPJA 1DLOA 4I9LA 1DTTA 4NYNA 1T7PA 4CEBA 1S6PA 4CEQA 3OS2A 3HT3A 3NE6A 3DRPA 4CE9A 2B5JA 5C42A 2I5JA 1QSLA 3QERA 3CQ8A 3BDPA 3THVA 3PO4A 3U3GA 2OPQA 5T7BA 2HMIA 4B9SA 1EX4A 1IKYA 3S3OA 3VQEA 1JLQA 1NK6A 1N6QA 1UAXA 3NF7A 3C94A 4LSLA 3V1OA 3S3NA 2Z1GA 3DRRA 3VQBA 4FM2A 3SQ1A 2F8SA 2GBZA 1JL2A 1SKSA 3OYDA 3SQ2A 4J2BA 1C6VA 3NF8A 3JYTA 1VSMA 3K57A 1DTQA 3AO1A 1KFDA 1WSEA 2LSNA 1WSIA 1XHXA 2HNZA 4DFMA 1A5WA 1HRHA 3O4NA 4F8RA 4FJHA 4BACA 1VSEA 1J53A 3M8PA 4BDPA 1VSFA 4HCBA 5HRNA 1JLBA 5C24A 1L3UA 1ASUA 4E89A 1TV6A 4E7JA 2X6SA 1D9FA 3AA4A 1RTIA 3OYHA 2G8FA 4RG8A 4J2EA 2QK9A 3AVBA 4KPYA 1K6YA 1B92A 4E1MA 5KGXA 1HPZA 3F9KA 3CM6A 1F21A 3SUOA 3CG7A 2R7YA 2YNFA 1S9GA 2DTUA 2VG5A 1JXEA 4CGGA 2GV9A 3V9ZA 4CESA 3HYFA 1RTJA 1RDDA 3LZJA 1X9SA 4NCAA 4KREA 4E1NA 4Y1DA 4DU3A 1VSJA 4B8CA 3BGRA 4C8LA 1NKBA 2G8KA 2G8IA 1QHTA 3MECA 1CLQA 4H4MA 5I42A 2IS3A 2P5OA 2D0BA 1KCFA 4CFAA 4KTZA 4KHYA 3LDSA 3RR8A 4N56A 4AHCA 4K8ZA 5J2NA 1X9MA 2KFZA 4E7LA 1CZBA 5CYQA 4E19A 1KLNA 3VQPA 4B9LA 1NOYA 1BCMA 4AHRA 2DFFA 4NCGA 4NCBA 1YTUA 3LAMA 4FVMA 4FCYA 3LWMA 3AVMA 4DTUA 3TABA 2QKKA 1C0UA 5EU7A 3ZSWA 3QEIA 5FRMA 3EYZA 1JLCA 5I3UA 2EHGA 3RTVA 4OKKA 3JSMA 3LANA 4I2PA 4OPKA 4I2QA 1T8EA 1TK8A 2HHTA 5KTQA 4HUFA 1TKTA 1S6QA 3T19A 4OVLA 3ULDA 1NK8A 1N5YA 4C8KA 2YKMA 4B08A 1CZ9A 4FJ5A 3ZSVA 3K5MA 4HVJA 3HSTB 1S9EA 3QLHA 3WNEA 4N76A 5KRSA 4ZHRA 4M45A 2B4JA 1LV5A 3PX6A 1KFSA 3VA3A 3TWHA 4DTNA 2EX3A 1QSSA 3P83D 4CJQA 3OYGA 4DQSA 4DSFA 4I7FA 3KIOA 3K59A 3SPYA 1ZYQA 4FJ7A 4IG0A 2BGGA 2O4IA 3O3HA 3DLBA 1BIZA 1UA0A 2GUIA 4PUOA 4EP4A 5SZTA 1VSKA 4CCHA 1YTAA 3AA2A 2DFEA 4N5SA 3RRHA 1SKWA 2E4LA 2P1JA 3F73A 3KK1A 1JLAA 3HM9A 4CIFA 1KLMA 4RW6A 4CGJA 3SQ0A 3H08A 1U47A 3K5OA 4ELTA 4OKJA 2YNGA 2PZSA 3OS1A 4CJLA 3TAMA 3ZSOA 3OYMA 4HUGA 1RCHA 4DQQA 4DFPA 3QESA 1L3TA 2FBVA 4CEAA 2OPPA 1BQNA 4BWJA 3ZSZA 1UA1A 3PO5A 3OY9A 1W0HA 4QOZB 3KLIA 1RBVA 2XHBA 2RKIA 4WE1A 3QEXA 1RNHA 3P1GA 1I3AA 2G8VA 1HJRA 5JS2A 3VQ8A 1TK5A 4F3OA 4CJ5A 1A5VA 3SCXA 4CEZA 3KLFA 3SUQA 1IKXA 1GOBA 3MEGA 1LWEA 1FK9A 3ZT1A 3ISNC 4KI6A 5C25A 4FJ9A 2D0CA 3QNNA 3DM2A 3L2QA 3AVCA 3L8BA 4BWMA 3V9XA 4C8NA 2IGIA 3LALA 4C8MA 1HNIA 3QNOA 2OYQA 1RTHA 4CHOA 5HLFA 4BE2A 1QS4A 1NJZA 1IH7A 3OS0A 4KTQA 4KHUA 2JLEA 3L2WA 4FXDA 3S9HA 3PY8A 3U3YA 3NH1A 3HO1A 1WLJA 2F8TA 1JLFA 3DLHA 4E7IA 1QSYA 4CHYA 2ZQBA 3MEDA 3DLRA 1XI1A 3ZSYA 4CJUA 4DS4A 1IG9A 4M3WA 1VSDA 5K14A 4KFBA 5E41A 1RDCA 1ASWA 4KKOA 3DYAA 3AO5A 4CF0A 3CFPA 1U45A 4FM0A 4B9VA 3VQ6A 3SV4A 3MAQA 2DFHA 4DQRA 4CGFA 1C0TA 4CGIA 4CJPA 4CF8A 1FKOA 4O55A 3HK2A 5KGWA 4R5PA 3ZT2A 4CJTA 3AVKA 3SNNA 3KLGA 3IG1A 1EETA 3MXIA 3M8QA 4HCCA 3OYLA 1FXXA 1NK4A 3AVIA 2YKNA 4DQIA 4AHTA 4FLVA 3MXJA 3RWUA 3S3MA 2WOMA 3ITHA 2IAJA 3L3UA 4O44A 4TSXA 4CECA 2XY6A 2KTQA 3TAEA 2YHAA 1W9HA 1WSHA 1ZBUA 1WAJA 4W5RA 4ICLA 3OYJA 3PX0A 1Z25A 3B6OA 1MU2A 3M8SA 4K8XA 1YT3A 3TR8A 4DFKA 1HYSA 4PWDA 4LH4A 2P5GA 3HJFA 2YV0X 2X74A 4CJWA 4NYFA 3OYCA 1RBRA 3NF9A 3EZ5A 4FLXA 3QEWA 1U4BA 2PYJA 4FYDA 3AA3A 4FK4A 2X78A 1IKWA 4IG3A 4KV8A 3L2RA 3VQ9A 4IBNA 4OGCA 4DSIA 4DTXA 4G1QA 1REVA 1KSPA 4M3XA 4LD0A 1TAQA 2RPIA 4M3YA 3DLEA 3U6FA 4CEFA 1TK0A 5HRSA 3O3GA 2HB5A 1KVCA 4Q5VA 3G0ZA 1NKCA 3KTQA 3KD5E 1HQEA 3WNFA 4F3TA 4CJSA 3AVJA 2A1SA 1WNSA 4FLTA 3T1AA 1L3SA 4J2DA 2KZMA 1BISA 4F4KA 4L8RB 2HNDA 3V9WA 3L2VA 4FLYA 3OJSA 4E0DA 1C0MA 1BHLA 1LAVA 1TKXA 3AO4A 3NH0A 4FJ8A 3V9UA 1CXQA 3PX4A 4FZXC 4DTPA 4DU1A 4IFVA 4DTOA 3DLGA 2ZD1A 2VWKA 1T05A 2JGUA 3KKRA 1X9WA 4M42A 2WONA 3CYMA 2KFNA 3CFOA 4LY7A 2Y1IA 3ZT4A 1S1VA 4OGEA 4JS5A 2XRIA 4Q0BA 4CHNA 3NAEA 3D0PA 4BDZA 1VSHA 2ZE2A 5HRRA 4IKFA 1RBTA 1NJWA 1RILA 4J2AA 2QXFA 4FZZA 3LP1A 3AVGA 3HVRA 3HXMA 2G8HA 4FW2A 2O4GA 3AA5X 4DWIA 4FJJA 3WNHA 4CJFA 4FJXA 5FRNA 3QIOA 4B8AB 4DTMA 3QETA 1O1WA 3OYBA 3T3FA 3RRGA 4FJKA 4M3ZA 1BL3A 4CFDA 2RF2A 2P51A 3HPHA 3DLKA 4YNQA 3PV8A 3QIPA 1QTMA 4FJLA 1HQUA 4DTJA 4C8OA 1KVBA 2HVHA 1C1BA 1JLGA 1Z26A 3OYIA 4CK3A 4QCLA 3NH2A 1XC9A 4CHZA 4HUEA 3UIQA 3KK2A 3SUNA 2OPSA 3NBPA 4H4OA 4HHTA 2ATQA 4O0IA 3VA0A 4M3UA 1BQMA 3AVHA 4M41A 3SPZA 4FK0A 3IRXA 1TL1A 5CZ2A 2IOCA 2HHWA 4CGHA 2YHBA 1RBUA 1WN7A 4AILC 3RMDA 1ITGA 2QKBA 3O3FA 3LP3A 4MQ3A 2HHVA 1BI4A 5J2QA 3LPTA 1NK0A
chains in the Genus database with same CATH superfamily
4XH4A 3MCAB 3VN5A 2NUBA 1CXUA 3J7YP 2UXBK 4CF9A 4GNIA 5HBMA 1X3NA 2GX9A 2H3GX 1OVQA 2ZJQL 5FDLA 1NOZA 3L3VA 4FVUA 3VF6A 4CIGA 4CHQA 3NDKA 4KBOA 1D4XA 3SQ4A 1Q8IA 3NCIA 5JS1A 3BUZB 3UKRB 1QQCA 1EP4A 1HNXK 1IO2A 2NRHA 4CK2A 4DUYK 3U9ZA 3LZIA 2BE2A 4E3SA 3UE5A 3B6PA 1U04A 5LJVA 3NF6A 4GY2B 1N32K 2HHSA 1SL1A 3CC2N 5KI6A 3AVLA 5KRSA 4C23A 4IDKA 2QKBA 3DWLA 5BPNA 2HVIA 1SL0A 1GLDG 1S1UA 3OVNA 3VQCA 4NB4A 4C1NK 1J54A 4H0YB 3LDQA 1Q82O 4K43A 4FJMA 1YJ9N 3IAYA 5J2MA 5AQOA 2E1ZA 3CJ9A 3HP6A 4PKIA 3VQ7A 2F4VK 1YIJN 4KB0A 3K5NA 1TGOA 2D0PA 4OJRA 3BP8A 4BE1A 1CZAN 3MXMA 5M1KA 4KAZA 3SJJA 4FJIA 1SZ2A 1YAGA 5EXWA 3SAGA 3HPOA 4NXNK 1VQ6N 4F2RA 4K25A 2IVOA 2E6MA 4UQGA 4E7KA 4LH5A 3I56N 3UB5A 1V4SA 2BDPA 5LMNK 3UKUA 4G9ZA 4PQUA 1L3VA 4EP5A 2Q3SA 3HBTA 3OYEA 3G4SN 3H6EA 4Z4HA 1VQ5N 4XH1A 3WXMB 3RR7A 4AQYK 1TYQB 4A5AA 5KQ8A 4ILGB 5CY4A 2OCEA 4MFBA 3FZLA 4DTRA 1RT5A 2KLAA 1YVUA 3V6DA 2W6KA 4CF2A 3THXB 1T6CA 2HHQA 1VRTA 3TSQA 5BPMA 1D9DA 2ZF5O 5GAGP 2BANA 3DXMB 1B9DA 3THYB 1XC3A 4FLWA 4O4GA 2P9KA 1U6ZA 4DV3K 3ALYA 4ELVA 4CJKA 1C1CA 1X1PA 4JKHA 3K5LA 1TL3A 1HKBA 3CF5L 4CFCA 1XHZA 2NRXA 1Z6RA 4H0TB 3VGKA 2Q0UA 3CC4N 3GBTA 3LPUA 2B6AA 3PIOL 3DRSA 3C6TA 2FBXA 1ZBSA 3M5RA 5C0YA 3DMJA 3BZCA 3A5LC 3ATUA 4A2BA 4JI2K 3KLEA 4FM1A 3CJ7A 4DU4A 4IWVA 2QI2A 5AQLA 4Z4FA 1NK9A 2YCHA 1IJJA 1EO1A 2VG7A 1WB9A 4EZ6A 3T69A 5AQGA 4KHQA 4RW7A 2X6NA 1HNVA 3CXCM 3OJUA 3QEPA 3KJVA 3D6RA 1LWCA 1GLEG 4FWKA 4DS5A 1KQSM 1HR0K 2HNYA 3VGLA 5BRHA 4B3OA 2O8BB 3GE1A 4OPHA 1KAZA 5DM7L 1SV5A 1DLOA 4I9LA 2HBLA 1MDUB 2FSKA 1YVNA 4LF4K 3QERA 3BDPA 3PO4A 3C6HA 2OPQA 4DR7K 3VQEA 1NK6A 1N6QA 4LSLA 3O9UA 4FM2A 3ZX2A 1NJIO 1WSEA 3LL3A 4F8RA 4BACA 1J53A 3M8PA 1VSFA 5HRNA 1JLBA 5TKYA 2PFUA 5AQNA 4OPAA 3WXJA 4YOWA 3OYHA 2G8FA 4J2EA 4RG8A 4CBXA 1B92A 1ESVA 4CZGA 4BGBA 3CG7A 4DUZK 1ATNA 2YNFA 1S9GA 1JXEA 4NCAA 1X9SA 1MA9B 4B8CA 2G8KA 1CLQA 1VQ7N 2P5OA 4CFAA 1Z05A 3MCPA 3RR8A 2P9NB 3J7AP 2KFZA 1CZBA 5CYQA 3VMFB 1BCMA 5BREA 4NCBA 4EHUA 3LAMA 1BDGA 5HL7L 5FLXO 4FVMA 3LWMA 4IO8A 1YJWN 3ZSWA 3K9KA 1NU0A 1Q81O 3VEZA 4Z94A 5BPLA 3ZETA 4HUFA 5ELZA 3T19A 3OBYA 1N5YA 4M63C 4B08A 3QB0A 5C2FA 3HOSA 3HSTB 1S9EA 1K8KB 3E1YA 4N76A 3OW2M 2QWPA 4PKHA 4PL8A 3RSEA 4I7FA 3K59A 3SPYA 4V19S 2GUIA 3CCSN 1VSKA 3J8AA 5JVGL 4BG8A 3A5NC 4CCHA 3AA2A 5ADXH 2P1JA 4FWRA 1JLAA 1OH7A 4CIFA 3SQ0A 4JD2B 4OKJA 3OYMA 4DQQA 4DFPA 2FBVA 3PO5A 1UA1A 4FWOA 3KHYA 3MN6A 1RNHA 3U8XA 1I3AA 4O8UA 4BR2A 1TK5A 3O08A 3SUQA 1IKXA 1WBBA 1GOBA 1FK9A 4KI6A 1NGDA 5C25A 4FJ9A 1RFQA 4YOTA 3Q7CA 3I55N 3L8BA 2A40A 3QNOA 2OYQA 1RTHA 4KHUA 3HTVA 1IH7A 5JVHL 4LF5K 2JLEA 3L2WA 1DKGD 3NH1A 4JK7A 1N36K 1JLFA 2YHWA 1IV0A 4E7IA 4A2AA 3MEDA 3H3NO 4H5VA 5KPRA 4M3WA 5E41A 3EL2A 4A59A 4KKOA 3M1FA 4LFAK 4JI4K 3VENA 4H5WA 4Y0WA 4JKGB 5KGWA 3ZT2A 2E1YA 3C0BA 3M8QA 5LY3A 3MXJA 1VQPN 3ID6A 4TSXA 3CJBA 3GDQA 3D7EO 5GIOA 1WSHA 4W5RA 1DT9A 1MU2A 4K8XA 4YORA 4BVPA 4WQ4A 5BN8A 2P5GA 3EO3A 4EHTA 5GAEP 2PYJA 3AA3A 4YOUA 1IKWA 1U2VB 2WBNA 4JKFA 4G1QA 4M3YA 4JEPA 1NKCA 4CZEA 1HQEA 2A1SA 1WNSA 4J2DA 4L8RB 2E88A 5AJ3K 3WQTA 3V9WA 3FGUA 1X9JA 1LAVA 4FJ8A 1CXQA 3THWA 3DLGA 2ZD1A 1T05A 2JGUA 4JK8A 3CQXA 2WONA 3CYMA 2KFNA 4LY7A 2QWRA 4CZLA 1S1VA 5AQVA 3OHRA 2QXFA 3LP1A 3AVGA 3HVRA 2O4GA 4JKCA 4FJXA 3QIOA 3RRGA 3OYBA 4FJLA 1T44A 1QVGM 1KVBA 1JLGA 1Z26A 4CD1A 4CK3A 3BEXA 4WQ4C 4HUEA 3FE1A 3CMAN 3NBPA 2UUAK 4M3UA 3QDKA 1Q7YO 3QBXA 4M41A 1TL1A 5CZ2A 3C7NA 4CGHA 3O3FA 2NZTA 5J2QA 4DTOA 3DJCA 1NK0A 3WXLA 4JS4A 2NRZA 1IBMK 1NGIA 3AVFA 3ZEUA 1VK0A 4RWTA 2ETJA 1Y64A 2Y1JA 3QO9A 4H0PA 4KB1A 3ZX0A 3MN9A 2F7TA 4RW8A 3HVTA 3EKSA 5F0XA 1VQ9N 2QM1A 1VAZA 3E01A 3V9SA 1M90O 1Y97A 3U9DA 2Z1JA 4MDAA 1NJXA 1BOTO 2P9LA 1NBWA 1RT3A 2UYTA 3RMCA 3VQDA 4KRFA 2P9SB 1ZBLA 4PA1A 3WEEA 2KZZA 4RTFD 2IC3A 2Z1IA 4CK1A 4CJ3A 4DMNA 1IKVA 1BI4B 2F96A 3CCJN 3MWPA 4B1UB 4Z4EA 2RN2A 2D0AA 3KLHA 1S1WA 4K41A 3P39A 1RBSA 4XIUA 1S5JA 4CHPA 3TANA 3ATVA 4DR4K 5KPTA 4MLHA 4W5OA 4KHWA 2XY8A 4DFJA 3CCRN 1NKEA 1SS6A 3WNGA 5CHIA 5J2PA 2W42A 4CZMA 4Z4IA 4JHDB 4DG1A 3PUFA 4Z4GA 5AQXA 3CM5A 4EIAA 2OA8A 1B9FA 1ZBFA 5SWMA 4CIEA 3CETA 4BRNA 5C10A 1FKPA 3OYAA 3LP2A 2YNHA 4IEIA 1GLFO 1JKHA 3TI0A 3FFIA 4AM6A 4W5TA 3CCQN 4CW7B 2FBTA 3QFPA 5FPNA 2PBDA 1ZXOA 2CGJA 3AGRA 3AO3A 4FSVA 3JAMO 5A2QO 2IVPA 4BRPA 4A61A 1KAYA 4DV5K 3R3LA 4GKKK 3K0SA 3L2UA 5EVZA 1UOCA 3V1QA 4RW9A 4J8FA 4H0VB 2XO7A 4GVMA 4DTSA 3CPWM 3ZCMA 3UKUB 1IBKK 5MLCQ 2HHUA 2V51B 3KKSA 4NXMK 4AF1A 2Z1HA 3ID8A 5KQDA 4B9MA 3V81A 3IS9A 1C1AA 4O0JA 4EZ9A 1W2BM 3VQ5A 3LAKA 4BR0A 2KKZA 1C0GA 3OYNA 2DY4A 5IWAK 4OKEA 4E7HA 3O80A 3CFRA 1HX1A 2P9KB 4GW6A 4M3RA 1JLEA 1I39A 1SL2A 2XY5A 3G10A 4Z0UA 2PY5A 4DQPA 3LP0A 1KTQA 3GOIA 4QS9A 1NGEA 1HLUA 3G25A 4NYNA 1NNEA 1GLLO 4CE9A 1VQLN 5GIPA 3THVA 5HOOA 4GV6A 4B9SA 1UAXA 3V1OA 2ASOA 3CJCA 3KWIA 2Z1GA 2F8SA 3SQ1A 2HBMA 1XUPO 3O9RA 4JI3K 1C6VA 1FW6A 4NLCA 1WSIA 3VEOA 3OTOK 4DFMA 1HRHA 4B3MK 1VSEA 1XMOK 3HZ6A 1MWKA 5C24A 4E7JA 3AA4A 2QK9A 1ATRA 1K6YA 2GWKA 4FWNA 3CM6A 2A42A 2YJFA 1J5EK 5AZJA 4KREA 3LZJA 4E1NA 4Y1DA 1QHTA 4H4MA 5I42A 3D2EA 1S22A 2A41A 2YHYA 3LDSA 4N56A 4IDHA 4K8ZA 4JI5K 5J2NA 1E4FT 4B1YB 1YI2N 3VQPA 4LF6K 4BRHA 1YTUA 3C65A 3TTDA 1YXQA 4ISFA 2P9IB 4DR2K 5I3UA 2EHGA 3PLAA 3E66A 3FFKB 2O8EB 3JSMA 3LANA 1T8EA 4U7BA 1S6QA 3ULDA 3HSCA 2YKMA 1CZ9A 4FJ5A 3ZSVA 1HPMA 1QZ5A 2B4JA 3A0IX 4BRGA 3OYGA 4DQSA 1ZYQA 3DXKA 3KIOA 4IG0A 2O4IA 4WFAL 1BIZA 1UA0A 4CZFA 4PUOA 3BZKA 3IDHA 3UKRA 2DFEA 3RRHA 2E4LA 4R79A 5JMVA 3JS6A 3PSFA 3HM9A 1KLMA 4RW6A 2EWSA 4CGJA 3H08A 2CGKA 5AQYA 4BR4A 4ELTA 2HHHK 4HUGA 3QESA 1RCHA 3P31A 1L3TA 2P9PA 1OH5A 2O8CA 2OPPA 2BUPA 4B9QA 2XHBA 2RKIA 4M7YA 3P1GA 3LDOA 1HJRA 5JS2A 5B8HA 4CJ5A 3RVCA 3ZETB 3MEGA 3ISNC 1K8AO 5F2RA 4DV7K 2D0CA 1GLAG 4PL7A 3L2QA 3C6AA 4C8MA 1HNIA 4CHOA 1NJZA 4KTQA 2O8FB 3HO1A 4BRMA 1WLJA 2F8TA 3DLHA 2NRWA 3WQUA 3DLRA 4CJUA 4CZJA 4CF0A 3AO5A 5E26A 3CFPA 4B9VA 3VQ6A 3SV4A 4X66K 2DFHA 3R8EA 3MAQA 2I7PA 1VQ8N 1ATSA 1C0TA 4CF8A 4R5PA 4XEIA 3AVKA 3MXIA 3IG1A 1EETA 4FWSA 2UU9K 2GTDA 5GINA 1NK4A 1TYQA 4B1WB 2YKNA 4DQIA 4AHTA 2NRRA 4IJNA 2IAJA 4O44A 1YHQN 3BY5A 3OYJA 1W9HA 1WAJA 1OH8A 1YF5L 3B6OA 3M8SA 3MX5A 3TR8A 1HYSA 3A5MC 4LH4A 4FWQA 1HKGA 3THXA 4IEEA 4FYDA 3EZ5A 4FLXA 1U4BA 4IO9L 3DXMA 4IG3A 4IBNA 5H1SQ 4OGCA 4DSIA 4DTXA 3THYA 1KSPA 3DLEA 4CEFA 3LM9A 1TK0A 1KVCA 3G0ZA 3KTQA 1Q18A 4F3TA 4FLTA 3T1AA 3A5OC 4IZ9A 3QICA 3R6MA 5JICA 3AO4A 2YX6A 2BH1A 3V9UA 3PX4A 4FZXC 4DTPA 1I94K 4DU1A 3E9LA 3FZHA 3KKRA 3CFOA 2Y1IA 4OGEA 4IOAL 3JXUA 4DR1K 4Q0BA 3ENOA 4CHNA 3NAEA 3D0PA 5HRRA 3HOTA 1RBTA 4DWIA 4FJJA 4FW2A 4CJFA 1QZ6A 4FJKA 2W6LA 3H1VX 2I7NA 4DV1K 1HJOA 2P51A 1NGCA 3HPHA 4BRAA 4H03B 4K0KK 5CE3A 4DTJA 4C8OA 1VQ4N 3EZWA 4I6MA 1VQON 1KC8O 1XC9A 4CHZA 3T1YK 5M1QA 3E9OA 3SUNA 3VA0A 5AQKA 3TSPA 3FLCO 3SPZA 4FK0A 2IOCA 2HHWA 2YHBA 1RBUA 2E2OA 3RMDA 4JI6K 4BC3A 3THWB 4CEAA 5KPZA 4O5FA 1WBDA 4DF4A 1NGAA 1D8YA 1WSGA 4JLHA 4YOXA 4A5BA 3SK3A 4W5NA 3VQQA 3VQAA 1NJYA 1Q86O 4HTUA 2XY7A 4FJGA 4DKWA 4W5QA 3L4IA 5C12A 4GV9A 1BWFO 1S1XA 3K9JA 1E3MA 3CMEN 2AP1A 3AO2A 4CERA 3R1XA 3L6QA 3D45A 3TAPA 1RT2A 4Y1CA 3CQYA 5DK5A 2VGNA 4OLAA 4F2SA 3Q7BA 5JLHA 3LWLA 3S3NA 3NHGA 1GOCA 1BGXT 3PSIA 2YNIA 1X3MA 4BY9C 4JAXA 2HW3A 2BTFA 4N41A 3C7NB 1TVRA 4H8KA 3O1BA 2QWLA 2A1RA 3RMBA 2HHXA 4BRQA 1P90A 5C15A 3M8RA 1VQKN 1TAUA 4CEDA 3C95A 2ITGA 3VEYA 3ZEUB 1J6ZA 2QTDA 2P9NA 1RTDA 1HMVA 5CYMA 4FOEA 2O8DA 1U48A 5BR8K 1GLBG 2QA4N 3SMPA 1T6DA 4BVOA 5M1PA 2HF3A 3HPGA 1TKDA 3QINA 2G8UA 3H1QA 3VF2A 3SV3A 4GMJB 2D5RA 3LDNA 2Q36A 3BF1A 1ZBIA 3V1RA 5J1EA 2E6LA 2FSJA 4Z4CA 1HYVA 3OYFA 3ZSRA 1RT7A 4KTWA 4CJRA 1WSJA 3HP9A 3KK3A 1EQYA 2Q2RA 3I0SA 4KO0A 2OZMA 3LM2A 4JKEA 1WSFA 3WEEB 4YOYA 1Q9YA 4BROA 4ELUA 3TPQA 3ASMA 4CZKA 5D3GA 4B3TK 1BA0A 4FW1A 3WT0A 1W97L 4ID1A 1RT1A 3GG4A 1S3XA 4BR7A 2KW4A 5HP1A 4GVEA 4A62A 1JXBA 3O9TA 4A57A 4CEEA 3AV9A 3NMUA 2A3ZA 2F9TA 1H1VA 3V4IA 2VWJA 2WUSA 3CCVN 1Q9XA 4KHNA 4AHUA 2ZJRL 4DF8A 4OX9K 4PKGA 5LL6Z 1GLCG 1QVFM 4FL9A 4MO4A 4OLBA 1BU6O 2Q0RA 3TTCA 1LAWA 3ENBA 5KRTA 3NGIA 1UWBA 4FOIA 3W0LA 1V4TA 4JRPA 2OPRA 4LSNA 3WXIA 5AZIB 2VGMA 1SUQA 3SI6A 1HUXA 4WQ5C 1K73O 3F5TA 1SKRA 2CH6A 4BG9A 3N4PA 1WUAA 1QQNA 1NK7A 4ZTJA 3FR0A 2D4WA 5AR0A 1BIUA 2QXLA 3ZLJA 5EOYA 1RDUA 2UXDK 4CJVA 1LW2A 5AQHA 1W7AA 4RW4A 3TSUA 4L3QA 1JL1A 3A2FA 3TAGA 4FWLA 5HRPA 1ASVA 4B9UA 3H3OB 4WCEL 3CERA 3EN9A 3P5JA 2P9UA 3EY1A 5HROA 3SBTA 3I8BA 1KD1O 4FJNA 3U4LA 5LMUK 4YOVA 4BRDA 4AH9A 1NK5A 4H5TA 4OPJA 2IIRA 1DTTA 1T7PA 3OS2A 4CEQA 3HT3A 4ILHA 4B1ZA 4FPBA 3DRPA 4LF9K 5C42A 2OTJN 2I5JA 1U2VA 5FPEA 1QSLA 5M1FA 5T7BA 1EX4A 2GUPA 3TTFA 1IKYA 3S3OA 2CGLA 2VQEK 2GBZA 3SAHA 3BF3A 3OYDA 4LFCK 4J2BA 3NF8A 3DAWA 1VSMA 3AO1A 3AAQA 4YDUA 2J4RA 2KHOA 5ADXA 1BO5O 3O4NA 4FJHA 5M1OA 4WF9L 3IKMA 1ASUA 4E89A 1TV6A 2X6SA 4YY3K 4H0XB 4H5RA 4KPYA 3NVKA 3CCUN 4E1MA 1HPZA 2YHXA 3F9KA 3SUOA 4JI0K 3AGKA 5AQSA 2DTUA 1E4GT 2GELA 2VG5A 3KK7A 4CGGA 2GV9A 3V9ZA 4CESA 2YJEA 1RTJA 1RDDA 3HYFA 5AQQA 1BA1A 1MWMA 3BGRA 2G8IA 2NRVA 4DB3A 3CHWA 4X62K 4NO7A 4KTZA 2GWJA 5AQRA 5AQTA 1X9MA 4E19A 3KWGA 1NOYA 4WYBA 1NMDA 3J80O 3P38A 5AQIA 3AVMA 3TABA 2QKKA 1C0UA 3QEIA 5FRMA 1QHAA 4KH4A 3VERA 4X64K 3RTVA 2HSTA 4I2QA 4DR5K 4E1JA 4JV5K 5KTQA 3SBGA 4ISGA 4OO1J 3VEWA 1TKTA 4YDUC 2HBKA 4OVLA 4C8KA 1EWRA 4H0OA 3MK6A 3K5MA 4HVJA 3WNEA 4ZHRA 5AQWA 3VESA 3PX6A 3VA3A 4BRFA 4DTNA 2EX3A 4CJQA 4LF8K 2JWLA 3O3HA 3DLBA 3D2EB 3VF4A 3OA9A 2NNWA 1YTAA 1EWQA 1SKWA 1JCEA 3KK1A 3EKUA 3O8MA 4IXCA 3K5OA 2PZSA 4KH6A 4M3TA 4CJLA 3TAMA 3ZSOA 4DHYA 4EFHA 4JYAK 2V7YA 4BWJA 1W0HA 3KLIA 4WE1A 3QEXA 1JJ2M 2G8VA 1ILYA 4F3OA 3MMVA 2QWMA 3ULEA 1YJNN 4CVNE 2GEMA 3NVMA 3QNNA 4BWMA 3V9XA 4DR6K 2IGIA 3LALA 4NLBA 5HLFA 4BE2A 3LDLA 4WFNL 1N33K 3DXKB 3J7ZO 3IUCA 1VQNN 4BRKA 4JHDA 4JI8K 5K14A 3MDQA 3E9PA 3VEVA 1ASWA 3DYAA 1U45A 2P9PB 1FKOA 4FWPA 4O55A 3HK2A 2O8CB 3MWTA 4CI6A 1K9MO 5FPDA 1YUWA 1FXXA 3AVIA 3O6WA 1DEJA 3S3MA 2UUCK 3ITHA 4CECA 2XY6A 2KTQA 4B3SK 1KFSA 3CI5A 4AM7A 3PX0A 3F2KA 1YT3A 1VHXA 2YV0X 3H45C 4FO0A 2OTLN 3NF9A 3QEWA 1TUYA 3AARA 1TUUA 4FPAA 4FK4A 4JKDA 3CCMN 1REVA 4GV3A 2RPIA 5HRSA 2HB5A 4Q5VA 2E20A 3KD5E 4MDBA 1HNZK 4F4KA 3FZKA 4FLYA 3D2FA 1C0MA 1BHLA 3NH0A 4IFVA 2QEXN 2VWKA 3W3DA 1X9WA 3EEQA 2A5XA 4JS5A 3VPZA 3J81O 2XRIA 3G6EN 4JK9A 4JKBA 1VSHA 2ZE2A 4IKFA 5E84A 3CD6N 1G99A 1RILA 4FZZA 2G8HA 3HXMA 4IOXA 5FRNA 4BRIA 1KXPA 4DTMA 1O1WA 3T3FA 4M3ZA 5AFUH 4CFDA 2RF2A 3PV8A 4YNQA 4JNEA 3O9SA 4QCLA 3NH2A 2WFBA 3KK2A 3WXKA 1LOTB 4HHTA 2ATQA 1P8ZA 1WN7A 3WUHA 2YI1A 1ITGA 5AQZA 3MN7A 5F1XA 3LPTA 1XMQK 2ZJPL 3HL8A 3QMLA 3K58A 4QAGA 1FJGK 5BN9A 1RDBA 2VG6A 1O13A 3H46O 1WAFA 4BREA 1NG9A 3VTIA 4BC2A 4B9TA 4CJEA 2PYLA 1NGFA 1S1TA 4DLEA 4CEOA 3TU5A 3RSEB 1T03A 1RDWX 2V7ZA 4FLZA 5DMRA 4F9OA 4PY5A 3CIPA 3TAQA 4DSLA 4I6MB 2A6AA 4QS7A 4CJ4A 1OKJA 1XNRK 1KVAA 1J9AA 1LCUA 4ZTFA 1ZBHA 3KD1E 4CF1A 3HI0A 3DOKA 4BRLA 3DLLL 2FC0A 4AHSA 1NWKA 2IVNA 1G15A 1GLJO 1OH6A 3O4QA 2UXCK 3DI6A 4KHPK 4JRQA 4KHSA 2FXUA 1A5XA 2HBJA 3T1HK 3L4QA 4FK2A 4KI4A 4I9QA 2KQ2A 3CCLN 1LW0A 1VSIA 2V52B 1YITN 4CD3A 1NGJA 4DV2K 5AQUA 2P9IA 3VTHA 3ZSQA 2Q31A 1RT6A 4RCHA 2O8EA 3ENHA 3I0RA 4BQZA 4PHTX 3HM8A 4CGDA 4IFEA 2FBYA 1QQMA 5BRFA 3DOLA 2WTUA 4MLEA 3TAFA 1QE1A 3ZT0A 4IOCL 1KRPA 4ID5A 1RDAA 5AQPA 3O9QA 1GOAA 3HRGA 3MEEA 3SLCA 1BCOA 4DSKA 4IFYA 4N47A 1EXQA 1XQSC 4O5BA 3SZ2A 4BDYA 3VQ4A 2AJQA 3NGZA 1L5UA 4HTLA 2O8DB 2IDOA 2QW9A 3K2PA 3OYKA 1LWFA 2E2QA 4XH5A 4FLUA 4BGAA 2OZSA 4EAHD 3B8AX 3QEVA 4DSJA 5EX5A 4HWIA 3NGYA 3TARA 1VSLA 4BQLA 3AVNA 4BE0A 2OANA 4B9NA 4FZYA 3AVAA 2CH5A 3ZSXA 4ILJA 3AAPA 4AHVA 5TKWA 2O8BA 2NLXA 2RHKA 4BR5A 1R0AA 5AQJA 2E2NA 2O8FA 4X65K 3SAFA 3I8DA 1TKZA 1XWLA 3RMAA 4DSEA 4O8KA 3NFAA 5LJWA 5CZ1A 4DCHA 3C6UA 4DLGA 2G8WA 5JLFA 4K42A 2FSNA 3VGMA 2ZGYA 3ZT3A 2ASMA 1HYZA 5IT9O 5C2DA 5AQMA 4UY8O 1VRUA 1U49A 3G71N 3CJAA 3SYZA 4CFBA 1OVYA 3M3ZA 1EKEA 3S41A 3QFUA 1D5AA 3SUPA 1J5OA 1RT4A 5FROA 4CZHA 2ITMA 1KAXA 1BUPA 1BG3A 4YFUA 1QQOA 3MN5A 2W41A 2Q1NA 4CJ7A 4JKAA 4CEBA 1S6PA 3NE6A 5EY4A 2B5JA 4DV6K 3CQ8A 1JCGA 4JN4A 3U3GA 2HMIA 3AY9A 2NRTA 4FWMA 5AQFA 3CJ1A 1JLQA 3NF7A 3C94A 5AFUA 3DRRA 3VQBA 1SKSA 1JL2A 3SQ2A 3ZYYX 2JWKA 3JYTA 2ASPA 3K57A 1HNWK 1DTQA 1KFDA 4CBWA 2LSNA 1XHXA 2HNZA 1A5WA 1NM1A 4BDPA 4HCBA 3CC7N 1L3UA 5CR4A 1D9FA 3LDPA 1RTIA 2P9UB 3AVBA 4WQ5A 2P9LB 5KGXA 1F21A 2R7YA 3IFRA 1K8KA 3IMXA 4DU3A 1VSJA 4C8LA 1NKBA 4ISEA 3MECA 4LC9B 2IS3A 3OBWA 2HF4A 4DV0K 2D0BA 1KCFA 4MO5A 4KHYA 3M6GA 4IJAA 4AHCA 4BR9A 2ZWHA 1SQKA 4BRCA 4E7LA 1KLNA 4B9LA 2HOEA 4JD2A 5DM6L 2F9WA 4AHRA 2DFFA 4NCGA 3FZFA 4FCYA 2ZM6K 4DTUA 5EU7A 3EYZA 1JLCA 1NGGA 2UUBK 4OKKA 4JI1K 4B3RK 3A8YA 3I33A 4I2PA 4OPKA 1TK8A 1T3VA 2HHTA 2W40A 2E5LK 1NK8A 1NGHA 2WC9A 3QLHA 3SMSA 4M45A 1LV5A 3GL1A 5I9EB 3TWHA 1C0FA 1QSSA 3P83D 4DSFA 4FJ7A 2BGGA 5GADP 5BRDA 2QWQA 3MX2A 1IBLK 4EP4A 5SZTA 2E8AA 4N5SA 3ZX3A 4DR3K 3F73A 1NLVA 4LFBK 2FF6A 2D0OA 2VYPA 1U47A 2YNGA 3OS1A 4B1VA 1NMNA 1BQNA 4JKGA 3ZSZA 2HMPA 3OY9A 3F9MA 4QOZB 1RBVA 2QWOA 5GAHP 4YHHK 3CCEN 3PIPL 4BC5A 1JCFA 4CBUA 3VQ8A 3SCXA 1A5VA 4CEZA 4B1XB 3KLFA 1N34K 1LWEA 2PAVA 3ZT1A 1IG8A 3DM2A 4H5NA 3AVCA 4C8NA 1QS4A 2VWBA 3O4WA 3OS0A 4FXDA 3N4QA 3S9HA 3PY8A 3U3YA 2AA4A 3KZBA 1QSYA 4CHYA 2ZQBA 2FF3B 1XI1A 1VQMN 3ZSYA 3O5BA 4DS4A 1IG9A 2E2PA 1VSDA 4KFBA 1RDCA 3P4IA 2ZGZA 4FM0A 5BR9A 4DQRA 1NGBA 4CGFA 4CGIA 4CJPA 3O1WA 3VETA 3EE9A 1R59O 4CJTA 3SNNA 1N8RO 3KLGA 4BC4A 4HCCA 3OYLA 1ZC6A 3FZMA 4FLVA 3RWUA 2WOMA 3ULEB 3VOVA 3L3UA 3TAEA 2YHAA 1ZBUA 2QWNA 4ICLA 1Z25A 1RGIA 4DFKA 4PWDA 3HJFA 2X74A 2VCPA 4CJWA 4NYFA 3OYCA 1RBRA 1SAZA 2X78A 4KV8A 4U67L 3L2RA 3VQ9A 4DQ8A 4M3XA 4LD0A 1TAQA 4JI7K 3U6FA 1S72N 4QS8A 4M7XA 3O3GA 4LF7K 3WNFA 4DV4K 4CJSA 3QBWA 3AVJA 1L3SA 1XNQK 2KZMA 4GKJK 1BISA 2HNDA 2DPNA 3SJHA 3L2VA 3OJSA 4C1NI 4E0DA 1TKXA 3T7ZA 5AZIA 3EE8A 1DGKN 3KVGA 2RE2A 4M42A 1WOQA 3ZT4A 4BDZA 2VQFK 5FPMA 1NJWA 4J2AA 5AZJB 3AA5X 3VEXA 3WNHA 4WFBL 1M1KO 3QETA 4B8AB 1BL3A 3DLKA 1QTMA 3QIPA 1HQUA 4CZIA 2HVHA 1C1BA 2FLOA 3OYIA 3UIQA 2OPSA 2Q97A 4H4OA 4O0IA 2D1KA 1BQMA 3AVHA 3IRXA 3D2FB 2P9SA 4AILC 3CPEA 3LP3A 4MQ3A 5M1NA 2HHVA 4KH5A 1BI4A 3R9PA 1HKCA 3L0QA
chains in the Genus database with same CATH topology
4DF4A 3HL8A 3K58A 4JS4A 4QAGA 3AVFA 1D8YA 1RDBA 1WSGA 3VN5A 2NUBA 1CXUA 1VK0A 4JLHA 4CF9A 2VG6A 2ETJA 5HBMA 1WAFA 4W5NA 3VQQA 3VQAA 2Y1JA 1NJYA 4B9TA 4HTUA 4CJEA 2PYLA 2XY7A 1S1TA 3QO9A 5FDLA 4DLEA 4CEOA 4W5QA 1NOZA 3L3VA 4FJGA 4KB1A 4RW8A 3HVTA 1S1XA 4CIGA 4CHQA 1T03A 3E01A 3NDKA 3AO2A 4CERA 4FLZA 5DMRA 3V9SA 3SQ4A 1Q8IA 1Y97A 3TAQA 3NCIA 4PY5A 5JS1A 4DSLA 3D45A 3TAPA 1RT2A 2Z1JA 4CJ4A 1QQCA 1EP4A 4Y1CA 5DK5A 1NJXA 1IO2A 4CK2A 1KVAA 1J9AA 4OLAA 1RT3A 4F2SA 3LWLA 2BE2A 3LZIA 3NHGA 4E3SA 1GOCA 1BGXT 3B6PA 3RMCA 2YNIA 1U04A 4CF1A 4ZTFA 3KD1E 1ZBHA 3DOKA 3NF6A 2HW3A 3VQDA 2FC0A 4AHSA 4N41A 4KRFA 1G15A 2HHSA 1TVRA 4H8KA 2A1RA 1ZBLA 4PA1A 1SL1A 3RMBA 2KZZA 2HHXA 5KI6A 3AVLA 3M8RA 2IC3A 2Z1IA 4IDKA 4CJ3A 4CK1A 4DMNA 1BI4B 1IKVA 2F96A 3O4QA 2HVIA 1TAUA 4CEDA 3C95A 3DI6A 1SL0A 4Z4EA 2RN2A 1S1UA 2ITGA 4JRQA 4KHSA 1A5XA 2D0AA 3OVNA 3VQCA 4FK2A 3KLHA 1J54A 1HMVA 1RTDA 4I9QA 4KI4A 1S1WA 2KQ2A 5CYMA 1RBSA 4XIUA 1U48A 1S5JA 1LW0A 4CHPA 3TANA 4FJMA 1VSIA 3IAYA 4W5OA 5J2MA 4KHWA 3HP6A 2XY8A 4DFJA 3VQ7A 3HPGA 1NKEA 1TKDA 3WNGA 5J2PA 3QINA 2W42A 2G8UA 4KB0A 3K5NA 1TGOA 3SV3A 4OJRA 3ZSQA 1RT6A 4GMJB 4BE1A 2D5RA 3MXMA 1ZBIA 4KAZA 4Z4IA 3SJJA 3I0RA 3V1RA 4FJIA 4CGDA 4DG1A 5J1EA 2FBYA 3HPOA 2E6LA 3PUFA 3DOLA 4Z4CA 4F2RA 4UQGA 2E6MA 1HYVA 3OYFA 4LH5A 4E7KA 4Z4GA 3CM5A 3ZSRA 3TAFA 2BDPA 1RT7A 2OA8A 1B9FA 4KTWA 1QE1A 3ZT0A 1KRPA 4CJRA 4ID5A 1L3VA 1WSJA 3HP9A 1RDAA 4EP5A 3KK3A 1ZBFA 2Q3SA 4PQUA 1GOAA 3I0SA 4KO0A 3MEEA 5SWMA 2OZMA 4CIEA 1WSFA 1Q9YA 3OYEA 4ELUA 3OYAA 1FKPA 1BCOA 3ASMA 3LP2A 2YNHA 4Z4HA 4DSKA 4IFYA 3RR7A 5D3GA 1JKHA 3TI0A 4N47A 3FFIA 1EXQA 4O5BA 4W5TA 3SZ2A 4FW1A 2FBTA 3VQ4A 4BDYA 2AJQA 4ID1A 1RT1A 5CY4A 3NGZA 1L5UA 2KW4A 4MFBA 4DTRA 4CEEA 5HP1A 1JXBA 1RT5A 2IDOA 3AV9A 3K2PA 1YVUA 3OYKA 1LWFA 3V6DA 3AO3A 3V4IA 2VWJA 4FLUA 4CF2A 2OZSA 1Q9XA 2HHQA 1VRTA 3QEVA 4KHNA 1D9DA 4DSJA 4AHUA 3NGYA 2BANA 4DF8A 1VSLA 3TARA 1B9DA 3AVNA 4BE0A 4B9NA 4FZYA 3AVAA 4OLBA 3L2UA 4M3TA 3ZSXA 4FLWA 4O4GA 1UOCA 3V1QA 4AHVA 4ELVA 1LAWA 3ALYA 4CJKA 4RW9A 2XO7A 1C1CA 5KRTA 4GVMA 1X1PA 3K5LA 3NGIA 1TL3A 1UWBA 4DTSA 1XHZA 3ZCMA 4CFCA 1R0AA 4JRPA 2OPRA 4LSNA 2HHUA 1SUQA 3SI6A 3LPUA 3KKSA 2B6AA 3DRSA 3I8DA 1SKRA 3C6TA 1TKZA 2FBXA 2Z1HA 1XWLA 3RMAA 4DSEA 1NK7A 3DMJA 4ZTJA 4B9MA 3NFAA 1BIUA 5CZ1A 3V81A 3KLEA 4FM1A 4DU4A 3C6UA 4DLGA 2G8WA 3IS9A 1C1AA 4O0JA 4Z4FA 4CJVA 4EZ9A 1LW2A 1NK9A 3VQ5A 3ZT3A 3LAKA 2VG7A 1HYZA 4RW4A 4EZ6A 1JL1A 3A2FA 3TAGA 4KHQA 1VRUA 4RW7A 1U49A 2X6NA 1HNVA 5HRPA 3OYNA 2DY4A 1ASVA 3OJUA 4OKEA 3SYZA 4B9UA 4CFBA 4E7HA 1EKEA 3KJVA 3QEPA 3CFRA 1D5AA 3SUPA 1LWCA 3P5JA 1J5OA 4GW6A 1RT4A 4M3RA 1JLEA 1I39A 3EY1A 4DS5A 5HROA 1SL2A 5FROA 2HNYA 4FJNA 2XY5A 3G10A 4B3OA 4Z0UA 2PY5A 4DQPA 3LP0A 1KTQA 4AH9A 1NK5A 4YFUA 1SV5A 4OPJA 1DLOA 4I9LA 1DTTA 4NYNA 1T7PA 4CEBA 1S6PA 4CEQA 3OS2A 3HT3A 3NE6A 3DRPA 4CE9A 2B5JA 5C42A 2I5JA 1QSLA 3QERA 3CQ8A 3BDPA 3THVA 3PO4A 3U3GA 2OPQA 5T7BA 2HMIA 4B9SA 1EX4A 1IKYA 3S3OA 3VQEA 1JLQA 1NK6A 1N6QA 1UAXA 3NF7A 3C94A 4LSLA 3V1OA 3S3NA 2Z1GA 3DRRA 3VQBA 4FM2A 3SQ1A 2F8SA 2GBZA 1JL2A 1SKSA 3OYDA 3SQ2A 4J2BA 1C6VA 3NF8A 3JYTA 1VSMA 3K57A 1DTQA 3AO1A 1KFDA 1WSEA 2LSNA 1WSIA 1XHXA 2HNZA 4DFMA 1A5WA 1HRHA 3O4NA 4F8RA 4FJHA 4BACA 1VSEA 1J53A 3M8PA 4BDPA 1VSFA 4HCBA 5HRNA 1JLBA 5C24A 1L3UA 1ASUA 4E89A 1TV6A 4E7JA 2X6SA 1D9FA 3AA4A 1RTIA 3OYHA 2G8FA 4RG8A 4J2EA 2QK9A 3AVBA 4KPYA 1K6YA 1B92A 4E1MA 5KGXA 1HPZA 3F9KA 3CM6A 1F21A 3SUOA 3CG7A 2R7YA 2YNFA 1S9GA 2DTUA 2VG5A 1JXEA 4CGGA 2GV9A 3V9ZA 4CESA 3HYFA 1RTJA 1RDDA 3LZJA 1X9SA 4NCAA 4KREA 4E1NA 4Y1DA 4DU3A 1VSJA 4B8CA 3BGRA 4C8LA 1NKBA 2G8KA 2G8IA 1QHTA 3MECA 1CLQA 4H4MA 5I42A 2IS3A 2P5OA 2D0BA 1KCFA 4CFAA 4KTZA 4KHYA 3LDSA 3RR8A 4N56A 4AHCA 4K8ZA 5J2NA 1X9MA 2KFZA 4E7LA 1CZBA 5CYQA 4E19A 1KLNA 3VQPA 4B9LA 1NOYA 1BCMA 4AHRA 2DFFA 4NCGA 4NCBA 1YTUA 3LAMA 4FVMA 4FCYA 3LWMA 3AVMA 4DTUA 3TABA 2QKKA 1C0UA 5EU7A 3ZSWA 3QEIA 5FRMA 3EYZA 1JLCA 5I3UA 2EHGA 3RTVA 4OKKA 3JSMA 3LANA 4I2PA 4OPKA 4I2QA 1T8EA 1TK8A 2HHTA 5KTQA 4HUFA 1TKTA 1S6QA 3T19A 4OVLA 3ULDA 1NK8A 1N5YA 4C8KA 2YKMA 4B08A 1CZ9A 4FJ5A 3ZSVA 3K5MA 4HVJA 3HSTB 1S9EA 3QLHA 3WNEA 4N76A 5KRSA 4ZHRA 4M45A 2B4JA 1LV5A 3PX6A 1KFSA 3VA3A 3TWHA 4DTNA 2EX3A 1QSSA 3P83D 4CJQA 3OYGA 4DQSA 4DSFA 4I7FA 3KIOA 3K59A 3SPYA 1ZYQA 4FJ7A 4IG0A 2BGGA 2O4IA 3O3HA 3DLBA 1BIZA 1UA0A 2GUIA 4PUOA 4EP4A 5SZTA 1VSKA 4CCHA 1YTAA 3AA2A 2DFEA 4N5SA 3RRHA 1SKWA 2E4LA 2P1JA 3F73A 3KK1A 1JLAA 3HM9A 4CIFA 1KLMA 4RW6A 4CGJA 3SQ0A 3H08A 1U47A 3K5OA 4ELTA 4OKJA 2YNGA 2PZSA 3OS1A 4CJLA 3TAMA 3ZSOA 3OYMA 4HUGA 1RCHA 4DQQA 4DFPA 3QESA 1L3TA 2FBVA 4CEAA 2OPPA 1BQNA 4BWJA 3ZSZA 1UA1A 3PO5A 3OY9A 1W0HA 4QOZB 3KLIA 1RBVA 2XHBA 2RKIA 4WE1A 3QEXA 1RNHA 3P1GA 1I3AA 2G8VA 1HJRA 5JS2A 3VQ8A 1TK5A 4F3OA 4CJ5A 1A5VA 3SCXA 4CEZA 3KLFA 3SUQA 1IKXA 1GOBA 3MEGA 1LWEA 1FK9A 3ZT1A 3ISNC 4KI6A 5C25A 4FJ9A 2D0CA 3QNNA 3DM2A 3L2QA 3AVCA 3L8BA 4BWMA 3V9XA 4C8NA 2IGIA 3LALA 4C8MA 1HNIA 3QNOA 2OYQA 1RTHA 4CHOA 5HLFA 4BE2A 1QS4A 1NJZA 1IH7A 3OS0A 4KTQA 4KHUA 2JLEA 3L2WA 4FXDA 3S9HA 3PY8A 3U3YA 3NH1A 3HO1A 1WLJA 2F8TA 1JLFA 3DLHA 4E7IA 1QSYA 4CHYA 2ZQBA 3MEDA 3DLRA 1XI1A 3ZSYA 4CJUA 4DS4A 1IG9A 4M3WA 1VSDA 5K14A 4KFBA 5E41A 1RDCA 1ASWA 4KKOA 3DYAA 3AO5A 4CF0A 3CFPA 1U45A 4FM0A 4B9VA 3VQ6A 3SV4A 3MAQA 2DFHA 4DQRA 4CGFA 1C0TA 4CGIA 4CJPA 4CF8A 1FKOA 4O55A 3HK2A 5KGWA 4R5PA 3ZT2A 4CJTA 3AVKA 3SNNA 3KLGA 3IG1A 1EETA 3MXIA 3M8QA 4HCCA 3OYLA 1FXXA 1NK4A 3AVIA 2YKNA 4DQIA 4AHTA 4FLVA 3MXJA 3RWUA 3S3MA 2WOMA 3ITHA 2IAJA 3L3UA 4O44A 4TSXA 4CECA 2XY6A 2KTQA 3TAEA 2YHAA 1W9HA 1WSHA 1ZBUA 1WAJA 4W5RA 4ICLA 3OYJA 3PX0A 1Z25A 3B6OA 1MU2A 3M8SA 4K8XA 1YT3A 3TR8A 4DFKA 1HYSA 4PWDA 4LH4A 2P5GA 3HJFA 2YV0X 2X74A 4CJWA 4NYFA 3OYCA 1RBRA 3NF9A 3EZ5A 4FLXA 3QEWA 1U4BA 2PYJA 4FYDA 3AA3A 4FK4A 2X78A 1IKWA 4IG3A 4KV8A 3L2RA 3VQ9A 4IBNA 4OGCA 4DSIA 4DTXA 4G1QA 1REVA 1KSPA 4M3XA 4LD0A 1TAQA 2RPIA 4M3YA 3DLEA 3U6FA 4CEFA 1TK0A 5HRSA 3O3GA 2HB5A 1KVCA 4Q5VA 3G0ZA 1NKCA 3KTQA 3KD5E 1HQEA 3WNFA 4F3TA 4CJSA 3AVJA 2A1SA 1WNSA 4FLTA 3T1AA 1L3SA 4J2DA 2KZMA 1BISA 4F4KA 4L8RB 2HNDA 3V9WA 3L2VA 4FLYA 3OJSA 4E0DA 1C0MA 1BHLA 1LAVA 1TKXA 3AO4A 3NH0A 4FJ8A 3V9UA 1CXQA 3PX4A 4FZXC 4DTPA 4DU1A 4IFVA 4DTOA 3DLGA 2ZD1A 2VWKA 1T05A 2JGUA 3KKRA 1X9WA 4M42A 2WONA 3CYMA 2KFNA 3CFOA 4LY7A 2Y1IA 3ZT4A 1S1VA 4OGEA 4JS5A 2XRIA 4Q0BA 4CHNA 3NAEA 3D0PA 4BDZA 1VSHA 2ZE2A 5HRRA 4IKFA 1RBTA 1NJWA 1RILA 4J2AA 2QXFA 4FZZA 3LP1A 3AVGA 3HVRA 3HXMA 2G8HA 4FW2A 2O4GA 3AA5X 4DWIA 4FJJA 3WNHA 4CJFA 4FJXA 5FRNA 3QIOA 4B8AB 4DTMA 3QETA 1O1WA 3OYBA 3T3FA 3RRGA 4FJKA 4M3ZA 1BL3A 4CFDA 2RF2A 2P51A 3HPHA 3DLKA 4YNQA 3PV8A 3QIPA 1QTMA 4FJLA 1HQUA 4DTJA 4C8OA 1KVBA 2HVHA 1C1BA 1JLGA 1Z26A 3OYIA 4CK3A 4QCLA 3NH2A 1XC9A 4CHZA 4HUEA 3UIQA 3KK2A 3SUNA 2OPSA 3NBPA 4H4OA 4HHTA 2ATQA 4O0IA 3VA0A 4M3UA 1BQMA 3AVHA 4M41A 3SPZA 4FK0A 3IRXA 1TL1A 5CZ2A 2IOCA 2HHWA 4CGHA 2YHBA 1RBUA 1WN7A 4AILC 3RMDA 1ITGA 2QKBA 3O3FA 3LP3A 4MQ3A 2HHVA 1BI4A 5J2QA 3LPTA 1NK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DF4 A;  3HL8 A;  3K58 A;  4JS4 A;  4QAG A;  3AVF A;  1D8Y A;  1RDB A;  1WSG A;  3VN5 A;  2NUB A;  1CXU A;  1VK0 A;  4JLH A;  4CF9 A;  2VG6 A;  2ETJ A;  5HBM A;  1WAF A;  4W5N A;  3VQQ A;  3VQA A;  2Y1J A;  1NJY A;  4B9T A;  4HTU A;  4CJE A;  2PYL A;  2XY7 A;  1S1T A;  3QO9 A;  5FDL A;  4DLE A;  4CEO A;  4W5Q A;  1NOZ A;  3L3V A;  4FJG A;  4KB1 A;  4RW8 A;  3HVT A;  1S1X A;  4CIG A;  4CHQ A;  1T03 A;  3E01 A;  3NDK A;  3AO2 A;  4CER A;  4FLZ A;  5DMR A;  3V9S A;  3SQ4 A;  1Q8I A;  1Y97 A;  3TAQ A;  3NCI A;  4PY5 A;  5JS1 A;  4DSL A;  3D45 A;  3TAP A;  1RT2 A;  2Z1J A;  4CJ4 A;  1QQC A;  1EP4 A;  4Y1C A;  5DK5 A;  1NJX A;  1IO2 A;  4CK2 A;  1KVA A;  1J9A A;  4OLA A;  1RT3 A;  4F2S A;  3LWL A;  2BE2 A;  3LZI A;  3NHG A;  4E3S A;  1GOC A;  1BGX T;  3B6P A;  3RMC A;  2YNI A;  1U04 A;  4CF1 A;  4ZTF A;  3KD1 E;  1ZBH A;  3DOK A;  3NF6 A;  2HW3 A;  3VQD A;  2FC0 A;  4AHS A;  4N41 A;  4KRF A;  1G15 A;  2HHS A;  1TVR A;  4H8K A;  2A1R A;  1ZBL A;  4PA1 A;  1SL1 A;  3RMB A;  2KZZ A;  2HHX A;  5KI6 A;  3AVL A;  3M8R A;  2IC3 A;  2Z1I A;  4IDK A;  4CJ3 A;  4CK1 A;  4DMN A;  1BI4 B;  1IKV A;  2F96 A;  3O4Q A;  2HVI A;  1TAU A;  4CED A;  3C95 A;  3DI6 A;  1SL0 A;  4Z4E A;  2RN2 A;  1S1U A;  2ITG A;  4JRQ A;  4KHS A;  1A5X A;  2D0A A;  3OVN A;  3VQC A;  4FK2 A;  3KLH A;  1J54 A;  1HMV A;  1RTD A;  4I9Q A;  4KI4 A;  1S1W A;  2KQ2 A;  5CYM A;  1RBS A;  4XIU A;  1U48 A;  1S5J A;  1LW0 A;  4CHP A;  3TAN A;  4FJM A;  1VSI A;  3IAY A;  4W5O A;  5J2M A;  4KHW A;  3HP6 A;  2XY8 A;  4DFJ A;  3VQ7 A;  3HPG A;  1NKE A;  1TKD A;  3WNG A;  5J2P A;  3QIN A;  2W42 A;  2G8U A;  4KB0 A;  3K5N A;  1TGO A;  3SV3 A;  4OJR A;  3ZSQ A;  1RT6 A;  4GMJ B;  4BE1 A;  2D5R A;  3MXM A;  1ZBI A;  4KAZ A;  4Z4I A;  3SJJ A;  3I0R A;  3V1R A;  4FJI A;  4CGD A;  4DG1 A;  5J1E A;  2FBY A;  3HPO A;  2E6L A;  3PUF A;  3DOL A;  4Z4C A;  4F2R A;  4UQG A;  2E6M A;  1HYV A;  3OYF A;  4LH5 A;  4E7K A;  4Z4G A;  3CM5 A;  3ZSR A;  3TAF A;  2BDP A;  1RT7 A;  2OA8 A;  1B9F A;  4KTW A;  1QE1 A;  3ZT0 A;  1KRP A;  4CJR A;  4ID5 A;  1L3V A;  1WSJ A;  3HP9 A;  1RDA A;  4EP5 A;  3KK3 A;  1ZBF A;  2Q3S A;  4PQU A;  1GOA A;  3I0S A;  4KO0 A;  3MEE A;  5SWM A;  2OZM A;  4CIE A;  1WSF A;  1Q9Y A;  3OYE A;  4ELU A;  3OYA A;  1FKP A;  1BCO A;  3ASM A;  3LP2 A;  2YNH A;  4Z4H A;  4DSK A;  4IFY A;  3RR7 A;  5D3G A;  1JKH A;  3TI0 A;  4N47 A;  3FFI A;  1EXQ A;  4O5B A;  4W5T A;  3SZ2 A;  4FW1 A;  2FBT A;  3VQ4 A;  4BDY A;  2AJQ A;  4ID1 A;  1RT1 A;  5CY4 A;  3NGZ A;  1L5U A;  2KW4 A;  4MFB A;  4DTR A;  4CEE A;  5HP1 A;  1JXB A;  1RT5 A;  2IDO A;  3AV9 A;  3K2P A;  1YVU A;  3OYK A;  1LWF A;  3V6D A;  3AO3 A;  3V4I A;  2VWJ A;  4FLU A;  4CF2 A;  2OZS A;  1Q9X A;  2HHQ A;  1VRT A;  3QEV A;  4KHN A;  1D9D A;  4DSJ A;  4AHU A;  3NGY A;  2BAN A;  4DF8 A;  1VSL A;  3TAR A;  1B9D A;  3AVN A;  4BE0 A;  4B9N A;  4FZY A;  3AVA A;  4OLB A;  3L2U A;  4M3T A;  3ZSX A;  4FLW A;  4O4G A;  1UOC A;  3V1Q A;  4AHV A;  4ELV A;  1LAW A;  3ALY A;  4CJK A;  4RW9 A;  2XO7 A;  1C1C A;  5KRT A;  4GVM A;  1X1P A;  3K5L A;  3NGI A;  1TL3 A;  1UWB A;  4DTS A;  1XHZ A;  3ZCM A;  4CFC A;  1R0A A;  4JRP A;  2OPR A;  4LSN A;  2HHU A;  1SUQ A;  3SI6 A;  3LPU A;  3KKS A;  2B6A A;  3DRS A;  3I8D A;  1SKR A;  3C6T A;  1TKZ A;  2FBX A;  2Z1H A;  1XWL A;  3RMA A;  4DSE A;  1NK7 A;  3DMJ A;  4ZTJ A;  4B9M A;  3NFA A;  1BIU A;  5CZ1 A;  3V81 A;  3KLE A;  4FM1 A;  4DU4 A;  3C6U A;  4DLG A;  2G8W A;  3IS9 A;  1C1A A;  4O0J A;  4Z4F A;  4CJV A;  4EZ9 A;  1LW2 A;  1NK9 A;  3VQ5 A;  3ZT3 A;  3LAK A;  2VG7 A;  1HYZ A;  4RW4 A;  4EZ6 A;  1JL1 A;  3A2F A;  3TAG A;  4KHQ A;  1VRU A;  4RW7 A;  1U49 A;  2X6N A;  1HNV A;  5HRP A;  3OYN A;  2DY4 A;  1ASV A;  3OJU A;  4OKE A;  3SYZ A;  4B9U A;  4CFB A;  4E7H A;  1EKE A;  3KJV A;  3QEP A;  3CFR A;  1D5A A;  3SUP A;  1LWC A;  3P5J A;  1J5O A;  4GW6 A;  1RT4 A;  4M3R A;  1JLE A;  1I39 A;  3EY1 A;  4DS5 A;  5HRO A;  1SL2 A;  5FRO A;  2HNY A;  4FJN A;  2XY5 A;  3G10 A;  4B3O A;  4Z0U A;  2PY5 A;  4DQP A;  3LP0 A;  1KTQ A;  4AH9 A;  1NK5 A;  4YFU A;  1SV5 A;  4OPJ A;  1DLO A;  4I9L A;  1DTT A;  4NYN A;  1T7P A;  4CEB A;  1S6P A;  4CEQ A;  3OS2 A;  3HT3 A;  3NE6 A;  3DRP A;  4CE9 A;  2B5J A;  5C42 A;  2I5J A;  1QSL A;  3QER A;  3CQ8 A;  3BDP A;  3THV A;  3PO4 A;  3U3G A;  2OPQ A;  5T7B A;  2HMI A;  4B9S A;  1EX4 A;  1IKY A;  3S3O A;  3VQE A;  1JLQ A;  1NK6 A;  1N6Q A;  1UAX A;  3NF7 A;  3C94 A;  4LSL A;  3V1O A;  3S3N A;  2Z1G A;  3DRR A;  3VQB A;  4FM2 A;  3SQ1 A;  2F8S A;  2GBZ A;  1JL2 A;  1SKS A;  3OYD A;  3SQ2 A;  4J2B A;  1C6V A;  3NF8 A;  3JYT A;  1VSM A;  3K57 A;  1DTQ A;  3AO1 A;  1KFD A;  1WSE A;  2LSN A;  1WSI A;  1XHX A;  2HNZ A;  4DFM A;  1A5W A;  1HRH A;  3O4N A;  4F8R A;  4FJH A;  4BAC A;  1VSE A;  1J53 A;  3M8P A;  4BDP A;  1VSF A;  4HCB A;  5HRN A;  1JLB A;  5C24 A;  1L3U A;  1ASU A;  4E89 A;  1TV6 A;  4E7J A;  2X6S A;  1D9F A;  3AA4 A;  1RTI A;  3OYH A;  2G8F A;  4RG8 A;  4J2E A;  2QK9 A;  3AVB A;  4KPY A;  1K6Y A;  1B92 A;  4E1M A;  5KGX A;  1HPZ A;  3F9K A;  3CM6 A;  1F21 A;  3SUO A;  3CG7 A;  2R7Y A;  2YNF A;  1S9G A;  2DTU A;  2VG5 A;  1JXE A;  4CGG A;  2GV9 A;  3V9Z A;  4CES A;  3HYF A;  1RTJ A;  1RDD A;  3LZJ A;  1X9S A;  4NCA A;  4KRE A;  4E1N A;  4Y1D A;  4DU3 A;  1VSJ A;  4B8C A;  3BGR A;  4C8L A;  1NKB A;  2G8K A;  2G8I A;  1QHT A;  3MEC A;  1CLQ A;  4H4M A;  5I42 A;  2IS3 A;  2P5O A;  2D0B A;  1KCF A;  4CFA A;  4KTZ A;  4KHY A;  3LDS A;  3RR8 A;  4N56 A;  4AHC A;  4K8Z A;  5J2N A;  1X9M A;  2KFZ A;  4E7L A;  1CZB A;  5CYQ A;  4E19 A;  1KLN A;  3VQP A;  4B9L A;  1NOY A;  1BCM A;  4AHR A;  2DFF A;  4NCG A;  4NCB A;  1YTU A;  3LAM A;  4FVM A;  4FCY A;  3LWM A;  3AVM A;  4DTU A;  3TAB A;  2QKK A;  1C0U A;  5EU7 A;  3ZSW A;  3QEI A;  5FRM A;  3EYZ A;  1JLC A;  5I3U A;  2EHG A;  3RTV A;  4OKK A;  3JSM A;  3LAN A;  4I2P A;  4OPK A;  4I2Q A;  1T8E A;  1TK8 A;  2HHT A;  5KTQ A;  4HUF A;  1TKT A;  1S6Q A;  3T19 A;  4OVL A;  3ULD A;  1NK8 A;  1N5Y A;  4C8K A;  2YKM A;  4B08 A;  1CZ9 A;  4FJ5 A;  3ZSV A;  3K5M A;  4HVJ A;  3HST B;  1S9E A;  3QLH A;  3WNE A;  4N76 A;  5KRS A;  4ZHR A;  4M45 A;  2B4J A;  1LV5 A;  3PX6 A;  1KFS A;  3VA3 A;  3TWH A;  4DTN A;  2EX3 A;  1QSS A;  3P83 D;  4CJQ A;  3OYG A;  4DQS A;  4DSF A;  4I7F A;  3KIO A;  3K59 A;  3SPY A;  1ZYQ A;  4FJ7 A;  4IG0 A;  2BGG A;  2O4I A;  3O3H A;  3DLB A;  1BIZ A;  1UA0 A;  2GUI A;  4PUO A;  4EP4 A;  5SZT A;  1VSK A;  4CCH A;  1YTA A;  3AA2 A;  2DFE A;  4N5S A;  3RRH A;  1SKW A;  2E4L A;  2P1J A;  3F73 A;  3KK1 A;  1JLA A;  3HM9 A;  4CIF A;  1KLM A;  4RW6 A;  4CGJ A;  3SQ0 A;  3H08 A;  1U47 A;  3K5O A;  4ELT A;  4OKJ A;  2YNG A;  2PZS A;  3OS1 A;  4CJL A;  3TAM A;  3ZSO A;  3OYM A;  4HUG A;  1RCH A;  4DQQ A;  4DFP A;  3QES A;  1L3T A;  2FBV A;  4CEA A;  2OPP A;  1BQN A;  4BWJ A;  3ZSZ A;  1UA1 A;  3PO5 A;  3OY9 A;  1W0H A;  4QOZ B;  3KLI A;  1RBV A;  2XHB A;  2RKI A;  4WE1 A;  3QEX A;  1RNH A;  3P1G A;  1I3A A;  2G8V A;  1HJR A;  5JS2 A;  3VQ8 A;  1TK5 A;  4F3O A;  4CJ5 A;  1A5V A;  3SCX A;  4CEZ A;  3KLF A;  3SUQ A;  1IKX A;  1GOB A;  3MEG A;  1LWE A;  1FK9 A;  3ZT1 A;  3ISN C;  4KI6 A;  5C25 A;  4FJ9 A;  2D0C A;  3QNN A;  3DM2 A;  3L2Q A;  3AVC A;  3L8B A;  4BWM A;  3V9X A;  4C8N A;  2IGI A;  3LAL A;  4C8M A;  1HNI A;  3QNO A;  2OYQ A;  1RTH A;  4CHO A;  5HLF A;  4BE2 A;  1QS4 A;  1NJZ A;  1IH7 A;  3OS0 A;  4KTQ A;  4KHU A;  2JLE A;  3L2W A;  4FXD A;  3S9H A;  3PY8 A;  3U3Y A;  3NH1 A;  3HO1 A;  1WLJ A;  2F8T A;  1JLF A;  3DLH A;  4E7I A;  1QSY A;  4CHY A;  2ZQB A;  3MED A;  3DLR A;  1XI1 A;  3ZSY A;  4CJU A;  4DS4 A;  1IG9 A;  4M3W A;  1VSD A;  5K14 A;  4KFB A;  5E41 A;  1RDC A;  1ASW A;  4KKO A;  3DYA A;  3AO5 A;  4CF0 A;  3CFP A;  1U45 A;  4FM0 A;  4B9V A;  3VQ6 A;  3SV4 A;  3MAQ A;  2DFH A;  4DQR A;  4CGF A;  1C0T A;  4CGI A;  4CJP A;  4CF8 A;  1FKO A;  4O55 A;  3HK2 A;  5KGW A;  4R5P A;  3ZT2 A;  4CJT A;  3AVK A;  3SNN A;  3KLG A;  3IG1 A;  1EET A;  3MXI A;  3M8Q A;  4HCC A;  3OYL A;  1FXX A;  1NK4 A;  3AVI A;  2YKN A;  4DQI A;  4AHT A;  4FLV A;  3MXJ A;  3RWU A;  3S3M A;  2WOM A;  3ITH A;  2IAJ A;  3L3U A;  4O44 A;  4TSX A;  4CEC A;  2XY6 A;  2KTQ A;  3TAE A;  2YHA A;  1W9H A;  1WSH A;  1ZBU A;  1WAJ A;  4W5R A;  4ICL A;  3OYJ A;  3PX0 A;  1Z25 A;  3B6O A;  1MU2 A;  3M8S A;  4K8X A;  1YT3 A;  3TR8 A;  4DFK A;  1HYS A;  4PWD A;  4LH4 A;  2P5G A;  3HJF A;  2YV0 X;  2X74 A;  4CJW A;  4NYF A;  3OYC A;  1RBR A;  3NF9 A;  3EZ5 A;  4FLX A;  3QEW A;  1U4B A;  2PYJ A;  4FYD A;  3AA3 A;  4FK4 A;  2X78 A;  1IKW A;  4IG3 A;  4KV8 A;  3L2R A;  3VQ9 A;  4IBN A;  4OGC A;  4DSI A;  4DTX A;  4G1Q A;  1REV A;  1KSP A;  4M3X A;  4LD0 A;  1TAQ A;  2RPI A;  4M3Y A;  3DLE A;  3U6F A;  4CEF A;  1TK0 A;  5HRS A;  3O3G A;  2HB5 A;  1KVC A;  4Q5V A;  3G0Z A;  1NKC A;  3KTQ A;  3KD5 E;  1HQE A;  3WNF A;  4F3T A;  4CJS A;  3AVJ A;  2A1S A;  1WNS A;  4FLT A;  3T1A A;  1L3S A;  4J2D A;  2KZM A;  1BIS A;  4F4K A;  4L8R B;  2HND A;  3V9W A;  3L2V A;  4FLY A;  3OJS A;  4E0D A;  1C0M A;  1BHL A;  1LAV A;  1TKX A;  3AO4 A;  3NH0 A;  4FJ8 A;  3V9U A;  1CXQ A;  3PX4 A;  4FZX C;  4DTP A;  4DU1 A;  4IFV A;  4DTO A;  3DLG A;  2ZD1 A;  2VWK A;  1T05 A;  2JGU A;  3KKR A;  1X9W A;  4M42 A;  2WON A;  3CYM A;  2KFN A;  3CFO A;  4LY7 A;  2Y1I A;  3ZT4 A;  1S1V A;  4OGE A;  4JS5 A;  2XRI A;  4Q0B A;  4CHN A;  3NAE A;  3D0P A;  4BDZ A;  1VSH A;  2ZE2 A;  5HRR A;  4IKF A;  1RBT A;  1NJW A;  1RIL A;  4J2A A;  2QXF A;  4FZZ A;  3LP1 A;  3AVG A;  3HVR A;  3HXM A;  2G8H A;  4FW2 A;  2O4G A;  3AA5 X;  4DWI A;  4FJJ A;  3WNH A;  4CJF A;  4FJX A;  5FRN A;  3QIO A;  4B8A B;  4DTM A;  3QET A;  1O1W A;  3OYB A;  3T3F A;  3RRG A;  4FJK A;  4M3Z A;  1BL3 A;  4CFD A;  2RF2 A;  2P51 A;  3HPH A;  3DLK A;  4YNQ A;  3PV8 A;  3QIP A;  1QTM A;  4FJL A;  1HQU A;  4DTJ A;  4C8O A;  1KVB A;  2HVH A;  1C1B A;  1JLG A;  1Z26 A;  3OYI A;  4CK3 A;  4QCL A;  3NH2 A;  1XC9 A;  4CHZ A;  4HUE A;  3UIQ A;  3KK2 A;  3SUN A;  2OPS A;  3NBP A;  4H4O A;  4HHT A;  2ATQ A;  4O0I A;  3VA0 A;  4M3U A;  1BQM A;  3AVH A;  4M41 A;  3SPZ A;  4FK0 A;  3IRX A;  1TL1 A;  5CZ2 A;  2IOC A;  2HHW A;  4CGH A;  2YHB A;  1RBU A;  1WN7 A;  4AIL C;  3RMD A;  1ITG A;  2QKB A;  3O3F A;  3LP3 A;  4MQ3 A;  2HHV A;  1BI4 A;  5J2Q A;  3LPT A;  1NK0 A; 
#chains in the Genus database with same CATH topology
 4XH4 A;  3MCA B;  3VN5 A;  2NUB A;  1CXU A;  3J7Y P;  2UXB K;  4CF9 A;  4GNI A;  5HBM A;  1X3N A;  2GX9 A;  2H3G X;  1OVQ A;  2ZJQ L;  5FDL A;  1NOZ A;  3L3V A;  4FVU A;  3VF6 A;  4CIG A;  4CHQ A;  3NDK A;  4KBO A;  1D4X A;  3SQ4 A;  1Q8I A;  3NCI A;  5JS1 A;  3BUZ B;  3UKR B;  1QQC A;  1EP4 A;  1HNX K;  1IO2 A;  2NRH A;  4CK2 A;  4DUY K;  3U9Z A;  3LZI A;  2BE2 A;  4E3S A;  3UE5 A;  3B6P A;  1U04 A;  5LJV A;  3NF6 A;  4GY2 B;  1N32 K;  2HHS A;  1SL1 A;  3CC2 N;  5KI6 A;  3AVL A;  5KRS A;  4C23 A;  4IDK A;  2QKB A;  3DWL A;  5BPN A;  2HVI A;  1SL0 A;  1GLD G;  1S1U A;  3OVN A;  3VQC A;  4NB4 A;  4C1N K;  1J54 A;  4H0Y B;  3LDQ A;  1Q82 O;  4K43 A;  4FJM A;  1YJ9 N;  3IAY A;  5J2M A;  5AQO A;  2E1Z A;  3CJ9 A;  3HP6 A;  4PKI A;  3VQ7 A;  2F4V K;  1YIJ N;  4KB0 A;  3K5N A;  1TGO A;  2D0P A;  4OJR A;  3BP8 A;  4BE1 A;  1CZA N;  3MXM A;  5M1K A;  4KAZ A;  3SJJ A;  4FJI A;  1SZ2 A;  1YAG A;  5EXW A;  3SAG A;  3HPO A;  4NXN K;  1VQ6 N;  4F2R A;  4K25 A;  2IVO A;  2E6M A;  4UQG A;  4E7K A;  4LH5 A;  3I56 N;  3UB5 A;  1V4S A;  2BDP A;  5LMN K;  3UKU A;  4G9Z A;  4PQU A;  1L3V A;  4EP5 A;  2Q3S A;  3HBT A;  3OYE A;  3G4S N;  3H6E A;  4Z4H A;  1VQ5 N;  4XH1 A;  3WXM B;  3RR7 A;  4AQY K;  1TYQ B;  4A5A A;  5KQ8 A;  4ILG B;  5CY4 A;  2OCE A;  4MFB A;  3FZL A;  4DTR A;  1RT5 A;  2KLA A;  1YVU A;  3V6D A;  2W6K A;  4CF2 A;  3THX B;  1T6C A;  2HHQ A;  1VRT A;  3TSQ A;  5BPM A;  1D9D A;  2ZF5 O;  5GAG P;  2BAN A;  3DXM B;  1B9D A;  3THY B;  1XC3 A;  4FLW A;  4O4G A;  2P9K A;  1U6Z A;  4DV3 K;  3ALY A;  4ELV A;  4CJK A;  1C1C A;  1X1P A;  4JKH A;  3K5L A;  1TL3 A;  1HKB A;  3CF5 L;  4CFC A;  1XHZ A;  2NRX A;  1Z6R A;  4H0T B;  3VGK A;  2Q0U A;  3CC4 N;  3GBT A;  3LPU A;  2B6A A;  3PIO L;  3DRS A;  3C6T A;  2FBX A;  1ZBS A;  3M5R A;  5C0Y A;  3DMJ A;  3BZC A;  3A5L C;  3ATU A;  4A2B A;  4JI2 K;  3KLE A;  4FM1 A;  3CJ7 A;  4DU4 A;  4IWV A;  2QI2 A;  5AQL A;  4Z4F A;  1NK9 A;  2YCH A;  1IJJ A;  1EO1 A;  2VG7 A;  1WB9 A;  4EZ6 A;  3T69 A;  5AQG A;  4KHQ A;  4RW7 A;  2X6N A;  1HNV A;  3CXC M;  3OJU A;  3QEP A;  3KJV A;  3D6R A;  1LWC A;  1GLE G;  4FWK A;  4DS5 A;  1KQS M;  1HR0 K;  2HNY A;  3VGL A;  5BRH A;  4B3O A;  2O8B B;  3GE1 A;  4OPH A;  1KAZ A;  5DM7 L;  1SV5 A;  1DLO A;  4I9L A;  2HBL A;  1MDU B;  2FSK A;  1YVN A;  4LF4 K;  3QER A;  3BDP A;  3PO4 A;  3C6H A;  2OPQ A;  4DR7 K;  3VQE A;  1NK6 A;  1N6Q A;  4LSL A;  3O9U A;  4FM2 A;  3ZX2 A;  1NJI O;  1WSE A;  3LL3 A;  4F8R A;  4BAC A;  1J53 A;  3M8P A;  1VSF A;  5HRN A;  1JLB A;  5TKY A;  2PFU A;  5AQN A;  4OPA A;  3WXJ A;  4YOW A;  3OYH A;  2G8F A;  4J2E A;  4RG8 A;  4CBX A;  1B92 A;  1ESV A;  4CZG A;  4BGB A;  3CG7 A;  4DUZ K;  1ATN A;  2YNF A;  1S9G A;  1JXE A;  4NCA A;  1X9S A;  1MA9 B;  4B8C A;  2G8K A;  1CLQ A;  1VQ7 N;  2P5O A;  4CFA A;  1Z05 A;  3MCP A;  3RR8 A;  2P9N B;  3J7A P;  2KFZ A;  1CZB A;  5CYQ A;  3VMF B;  1BCM A;  5BRE A;  4NCB A;  4EHU A;  3LAM A;  1BDG A;  5HL7 L;  5FLX O;  4FVM A;  3LWM A;  4IO8 A;  1YJW N;  3ZSW A;  3K9K A;  1NU0 A;  1Q81 O;  3VEZ A;  4Z94 A;  5BPL A;  3ZET A;  4HUF A;  5ELZ A;  3T19 A;  3OBY A;  1N5Y A;  4M63 C;  4B08 A;  3QB0 A;  5C2F A;  3HOS A;  3HST B;  1S9E A;  1K8K B;  3E1Y A;  4N76 A;  3OW2 M;  2QWP A;  4PKH A;  4PL8 A;  3RSE A;  4I7F A;  3K59 A;  3SPY A;  4V19 S;  2GUI A;  3CCS N;  1VSK A;  3J8A A;  5JVG L;  4BG8 A;  3A5N C;  4CCH A;  3AA2 A;  5ADX H;  2P1J A;  4FWR A;  1JLA A;  1OH7 A;  4CIF A;  3SQ0 A;  4JD2 B;  4OKJ A;  3OYM A;  4DQQ A;  4DFP A;  2FBV A;  3PO5 A;  1UA1 A;  4FWO A;  3KHY A;  3MN6 A;  1RNH A;  3U8X A;  1I3A A;  4O8U A;  4BR2 A;  1TK5 A;  3O08 A;  3SUQ A;  1IKX A;  1WBB A;  1GOB A;  1FK9 A;  4KI6 A;  1NGD A;  5C25 A;  4FJ9 A;  1RFQ A;  4YOT A;  3Q7C A;  3I55 N;  3L8B A;  2A40 A;  3QNO A;  2OYQ A;  1RTH A;  4KHU A;  3HTV A;  1IH7 A;  5JVH L;  4LF5 K;  2JLE A;  3L2W A;  1DKG D;  3NH1 A;  4JK7 A;  1N36 K;  1JLF A;  2YHW A;  1IV0 A;  4E7I A;  4A2A A;  3MED A;  3H3N O;  4H5V A;  5KPR A;  4M3W A;  5E41 A;  3EL2 A;  4A59 A;  4KKO A;  3M1F A;  4LFA K;  4JI4 K;  3VEN A;  4H5W A;  4Y0W A;  4JKG B;  5KGW A;  3ZT2 A;  2E1Y A;  3C0B A;  3M8Q A;  5LY3 A;  3MXJ A;  1VQP N;  3ID6 A;  4TSX A;  3CJB A;  3GDQ A;  3D7E O;  5GIO A;  1WSH A;  4W5R A;  1DT9 A;  1MU2 A;  4K8X A;  4YOR A;  4BVP A;  4WQ4 A;  5BN8 A;  2P5G A;  3EO3 A;  4EHT A;  5GAE P;  2PYJ A;  3AA3 A;  4YOU A;  1IKW A;  1U2V B;  2WBN A;  4JKF A;  4G1Q A;  4M3Y A;  4JEP A;  1NKC A;  4CZE A;  1HQE A;  2A1S A;  1WNS A;  4J2D A;  4L8R B;  2E88 A;  5AJ3 K;  3WQT A;  3V9W A;  3FGU A;  1X9J A;  1LAV A;  4FJ8 A;  1CXQ A;  3THW A;  3DLG A;  2ZD1 A;  1T05 A;  2JGU A;  4JK8 A;  3CQX A;  2WON A;  3CYM A;  2KFN A;  4LY7 A;  2QWR A;  4CZL A;  1S1V A;  5AQV A;  3OHR A;  2QXF A;  3LP1 A;  3AVG A;  3HVR A;  2O4G A;  4JKC A;  4FJX A;  3QIO A;  3RRG A;  3OYB A;  4FJL A;  1T44 A;  1QVG M;  1KVB A;  1JLG A;  1Z26 A;  4CD1 A;  4CK3 A;  3BEX A;  4WQ4 C;  4HUE A;  3FE1 A;  3CMA N;  3NBP A;  2UUA K;  4M3U A;  3QDK A;  1Q7Y O;  3QBX A;  4M41 A;  1TL1 A;  5CZ2 A;  3C7N A;  4CGH A;  3O3F A;  2NZT A;  5J2Q A;  4DTO A;  3DJC A;  1NK0 A;  3WXL A;  4JS4 A;  2NRZ A;  1IBM K;  1NGI A;  3AVF A;  3ZEU A;  1VK0 A;  4RWT A;  2ETJ A;  1Y64 A;  2Y1J A;  3QO9 A;  4H0P A;  4KB1 A;  3ZX0 A;  3MN9 A;  2F7T A;  4RW8 A;  3HVT A;  3EKS A;  5F0X A;  1VQ9 N;  2QM1 A;  1VAZ A;  3E01 A;  3V9S A;  1M90 O;  1Y97 A;  3U9D A;  2Z1J A;  4MDA A;  1NJX A;  1BOT O;  2P9L A;  1NBW A;  1RT3 A;  2UYT A;  3RMC A;  3VQD A;  4KRF A;  2P9S B;  1ZBL A;  4PA1 A;  3WEE A;  2KZZ A;  4RTF D;  2IC3 A;  2Z1I A;  4CK1 A;  4CJ3 A;  4DMN A;  1IKV A;  1BI4 B;  2F96 A;  3CCJ N;  3MWP A;  4B1U B;  4Z4E A;  2RN2 A;  2D0A A;  3KLH A;  1S1W A;  4K41 A;  3P39 A;  1RBS A;  4XIU A;  1S5J A;  4CHP A;  3TAN A;  3ATV A;  4DR4 K;  5KPT A;  4MLH A;  4W5O A;  4KHW A;  2XY8 A;  4DFJ A;  3CCR N;  1NKE A;  1SS6 A;  3WNG A;  5CHI A;  5J2P A;  2W42 A;  4CZM A;  4Z4I A;  4JHD B;  4DG1 A;  3PUF A;  4Z4G A;  5AQX A;  3CM5 A;  4EIA A;  2OA8 A;  1B9F A;  1ZBF A;  5SWM A;  4CIE A;  3CET A;  4BRN A;  5C10 A;  1FKP A;  3OYA A;  3LP2 A;  2YNH A;  4IEI A;  1GLF O;  1JKH A;  3TI0 A;  3FFI A;  4AM6 A;  4W5T A;  3CCQ N;  4CW7 B;  2FBT A;  3QFP A;  5FPN A;  2PBD A;  1ZXO A;  2CGJ A;  3AGR A;  3AO3 A;  4FSV A;  3JAM O;  5A2Q O;  2IVP A;  4BRP A;  4A61 A;  1KAY A;  4DV5 K;  3R3L A;  4GKK K;  3K0S A;  3L2U A;  5EVZ A;  1UOC A;  3V1Q A;  4RW9 A;  4J8F A;  4H0V B;  2XO7 A;  4GVM A;  4DTS A;  3CPW M;  3ZCM A;  3UKU B;  1IBK K;  5MLC Q;  2HHU A;  2V51 B;  3KKS A;  4NXM K;  4AF1 A;  2Z1H A;  3ID8 A;  5KQD A;  4B9M A;  3V81 A;  3IS9 A;  1C1A A;  4O0J A;  4EZ9 A;  1W2B M;  3VQ5 A;  3LAK A;  4BR0 A;  2KKZ A;  1C0G A;  3OYN A;  2DY4 A;  5IWA K;  4OKE A;  4E7H A;  3O80 A;  3CFR A;  1HX1 A;  2P9K B;  4GW6 A;  4M3R A;  1JLE A;  1I39 A;  1SL2 A;  2XY5 A;  3G10 A;  4Z0U A;  2PY5 A;  4DQP A;  3LP0 A;  1KTQ A;  3GOI A;  4QS9 A;  1NGE A;  1HLU A;  3G25 A;  4NYN A;  1NNE A;  1GLL O;  4CE9 A;  1VQL N;  5GIP A;  3THV A;  5HOO A;  4GV6 A;  4B9S A;  1UAX A;  3V1O A;  2ASO A;  3CJC A;  3KWI A;  2Z1G A;  2F8S A;  3SQ1 A;  2HBM A;  1XUP O;  3O9R A;  4JI3 K;  1C6V A;  1FW6 A;  4NLC A;  1WSI A;  3VEO A;  3OTO K;  4DFM A;  1HRH A;  4B3M K;  1VSE A;  1XMO K;  3HZ6 A;  1MWK A;  5C24 A;  4E7J A;  3AA4 A;  2QK9 A;  1ATR A;  1K6Y A;  2GWK A;  4FWN A;  3CM6 A;  2A42 A;  2YJF A;  1J5E K;  5AZJ A;  4KRE A;  3LZJ A;  4E1N A;  4Y1D A;  1QHT A;  4H4M A;  5I42 A;  3D2E A;  1S22 A;  2A41 A;  2YHY A;  3LDS A;  4N56 A;  4IDH A;  4K8Z A;  4JI5 K;  5J2N A;  1E4F T;  4B1Y B;  1YI2 N;  3VQP A;  4LF6 K;  4BRH A;  1YTU A;  3C65 A;  3TTD A;  1YXQ A;  4ISF A;  2P9I B;  4DR2 K;  5I3U A;  2EHG A;  3PLA A;  3E66 A;  3FFK B;  2O8E B;  3JSM A;  3LAN A;  1T8E A;  4U7B A;  1S6Q A;  3ULD A;  3HSC A;  2YKM A;  1CZ9 A;  4FJ5 A;  3ZSV A;  1HPM A;  1QZ5 A;  2B4J A;  3A0I X;  4BRG A;  3OYG A;  4DQS A;  1ZYQ A;  3DXK A;  3KIO A;  4IG0 A;  2O4I A;  4WFA L;  1BIZ A;  1UA0 A;  4CZF A;  4PUO A;  3BZK A;  3IDH A;  3UKR A;  2DFE A;  3RRH A;  2E4L A;  4R79 A;  5JMV A;  3JS6 A;  3PSF A;  3HM9 A;  1KLM A;  4RW6 A;  2EWS A;  4CGJ A;  3H08 A;  2CGK A;  5AQY A;  4BR4 A;  4ELT A;  2HHH K;  4HUG A;  3QES A;  1RCH A;  3P31 A;  1L3T A;  2P9P A;  1OH5 A;  2O8C A;  2OPP A;  2BUP A;  4B9Q A;  2XHB A;  2RKI A;  4M7Y A;  3P1G A;  3LDO A;  1HJR A;  5JS2 A;  5B8H A;  4CJ5 A;  3RVC A;  3ZET B;  3MEG A;  3ISN C;  1K8A O;  5F2R A;  4DV7 K;  2D0C A;  1GLA G;  4PL7 A;  3L2Q A;  3C6A A;  4C8M A;  1HNI A;  4CHO A;  1NJZ A;  4KTQ A;  2O8F B;  3HO1 A;  4BRM A;  1WLJ A;  2F8T A;  3DLH A;  2NRW A;  3WQU A;  3DLR A;  4CJU A;  4CZJ A;  4CF0 A;  3AO5 A;  5E26 A;  3CFP A;  4B9V A;  3VQ6 A;  3SV4 A;  4X66 K;  2DFH A;  3R8E A;  3MAQ A;  2I7P A;  1VQ8 N;  1ATS A;  1C0T A;  4CF8 A;  4R5P A;  4XEI A;  3AVK A;  3MXI A;  3IG1 A;  1EET A;  4FWS A;  2UU9 K;  2GTD A;  5GIN A;  1NK4 A;  1TYQ A;  4B1W B;  2YKN A;  4DQI A;  4AHT A;  2NRR A;  4IJN A;  2IAJ A;  4O44 A;  1YHQ N;  3BY5 A;  3OYJ A;  1W9H A;  1WAJ A;  1OH8 A;  1YF5 L;  3B6O A;  3M8S A;  3MX5 A;  3TR8 A;  1HYS A;  3A5M C;  4LH4 A;  4FWQ A;  1HKG A;  3THX A;  4IEE A;  4FYD A;  3EZ5 A;  4FLX A;  1U4B A;  4IO9 L;  3DXM A;  4IG3 A;  4IBN A;  5H1S Q;  4OGC A;  4DSI A;  4DTX A;  3THY A;  1KSP A;  3DLE A;  4CEF A;  3LM9 A;  1TK0 A;  1KVC A;  3G0Z A;  3KTQ A;  1Q18 A;  4F3T A;  4FLT A;  3T1A A;  3A5O C;  4IZ9 A;  3QIC A;  3R6M A;  5JIC A;  3AO4 A;  2YX6 A;  2BH1 A;  3V9U A;  3PX4 A;  4FZX C;  4DTP A;  1I94 K;  4DU1 A;  3E9L A;  3FZH A;  3KKR A;  3CFO A;  2Y1I A;  4OGE A;  4IOA L;  3JXU A;  4DR1 K;  4Q0B A;  3ENO A;  4CHN A;  3NAE A;  3D0P A;  5HRR A;  3HOT A;  1RBT A;  4DWI A;  4FJJ A;  4FW2 A;  4CJF A;  1QZ6 A;  4FJK A;  2W6L A;  3H1V X;  2I7N A;  4DV1 K;  1HJO A;  2P51 A;  1NGC A;  3HPH A;  4BRA A;  4H03 B;  4K0K K;  5CE3 A;  4DTJ A;  4C8O A;  1VQ4 N;  3EZW A;  4I6M A;  1VQO N;  1KC8 O;  1XC9 A;  4CHZ A;  3T1Y K;  5M1Q A;  3E9O A;  3SUN A;  3VA0 A;  5AQK A;  3TSP A;  3FLC O;  3SPZ A;  4FK0 A;  2IOC A;  2HHW A;  2YHB A;  1RBU A;  2E2O A;  3RMD A;  4JI6 K;  4BC3 A;  3THW B;  4CEA A;  5KPZ A;  4O5F A;  1WBD A;  4DF4 A;  1NGA A;  1D8Y A;  1WSG A;  4JLH A;  4YOX A;  4A5B A;  3SK3 A;  4W5N A;  3VQQ A;  3VQA A;  1NJY A;  1Q86 O;  4HTU A;  2XY7 A;  4FJG A;  4DKW A;  4W5Q A;  3L4I A;  5C12 A;  4GV9 A;  1BWF O;  1S1X A;  3K9J A;  1E3M A;  3CME N;  2AP1 A;  3AO2 A;  4CER A;  3R1X A;  3L6Q A;  3D45 A;  3TAP A;  1RT2 A;  4Y1C A;  3CQY A;  5DK5 A;  2VGN A;  4OLA A;  4F2S A;  3Q7B A;  5JLH A;  3LWL A;  3S3N A;  3NHG A;  1GOC A;  1BGX T;  3PSI A;  2YNI A;  1X3M A;  4BY9 C;  4JAX A;  2HW3 A;  2BTF A;  4N41 A;  3C7N B;  1TVR A;  4H8K A;  3O1B A;  2QWL A;  2A1R A;  3RMB A;  2HHX A;  4BRQ A;  1P90 A;  5C15 A;  3M8R A;  1VQK N;  1TAU A;  4CED A;  3C95 A;  2ITG A;  3VEY A;  3ZEU B;  1J6Z A;  2QTD A;  2P9N A;  1RTD A;  1HMV A;  5CYM A;  4FOE A;  2O8D A;  1U48 A;  5BR8 K;  1GLB G;  2QA4 N;  3SMP A;  1T6D A;  4BVO A;  5M1P A;  2HF3 A;  3HPG A;  1TKD A;  3QIN A;  2G8U A;  3H1Q A;  3VF2 A;  3SV3 A;  4GMJ B;  2D5R A;  3LDN A;  2Q36 A;  3BF1 A;  1ZBI A;  3V1R A;  5J1E A;  2E6L A;  2FSJ A;  4Z4C A;  1HYV A;  3OYF A;  3ZSR A;  1RT7 A;  4KTW A;  4CJR A;  1WSJ A;  3HP9 A;  3KK3 A;  1EQY A;  2Q2R A;  3I0S A;  4KO0 A;  2OZM A;  3LM2 A;  4JKE A;  1WSF A;  3WEE B;  4YOY A;  1Q9Y A;  4BRO A;  4ELU A;  3TPQ A;  3ASM A;  4CZK A;  5D3G A;  4B3T K;  1BA0 A;  4FW1 A;  3WT0 A;  1W97 L;  4ID1 A;  1RT1 A;  3GG4 A;  1S3X A;  4BR7 A;  2KW4 A;  5HP1 A;  4GVE A;  4A62 A;  1JXB A;  3O9T A;  4A57 A;  4CEE A;  3AV9 A;  3NMU A;  2A3Z A;  2F9T A;  1H1V A;  3V4I A;  2VWJ A;  2WUS A;  3CCV N;  1Q9X A;  4KHN A;  4AHU A;  2ZJR L;  4DF8 A;  4OX9 K;  4PKG A;  5LL6 Z;  1GLC G;  1QVF M;  4FL9 A;  4MO4 A;  4OLB A;  1BU6 O;  2Q0R A;  3TTC A;  1LAW A;  3ENB A;  5KRT A;  3NGI A;  1UWB A;  4FOI A;  3W0L A;  1V4T A;  4JRP A;  2OPR A;  4LSN A;  3WXI A;  5AZI B;  2VGM A;  1SUQ A;  3SI6 A;  1HUX A;  4WQ5 C;  1K73 O;  3F5T A;  1SKR A;  2CH6 A;  4BG9 A;  3N4P A;  1WUA A;  1QQN A;  1NK7 A;  4ZTJ A;  3FR0 A;  2D4W A;  5AR0 A;  1BIU A;  2QXL A;  3ZLJ A;  5EOY A;  1RDU A;  2UXD K;  4CJV A;  1LW2 A;  5AQH A;  1W7A A;  4RW4 A;  3TSU A;  4L3Q A;  1JL1 A;  3A2F A;  3TAG A;  4FWL A;  5HRP A;  1ASV A;  4B9U A;  3H3O B;  4WCE L;  3CER A;  3EN9 A;  3P5J A;  2P9U A;  3EY1 A;  5HRO A;  3SBT A;  3I8B A;  1KD1 O;  4FJN A;  3U4L A;  5LMU K;  4YOV A;  4BRD A;  4AH9 A;  1NK5 A;  4H5T A;  4OPJ A;  2IIR A;  1DTT A;  1T7P A;  3OS2 A;  4CEQ A;  3HT3 A;  4ILH A;  4B1Z A;  4FPB A;  3DRP A;  4LF9 K;  5C42 A;  2OTJ N;  2I5J A;  1U2V A;  5FPE A;  1QSL A;  5M1F A;  5T7B A;  1EX4 A;  2GUP A;  3TTF A;  1IKY A;  3S3O A;  2CGL A;  2VQE K;  2GBZ A;  3SAH A;  3BF3 A;  3OYD A;  4LFC K;  4J2B A;  3NF8 A;  3DAW A;  1VSM A;  3AO1 A;  3AAQ A;  4YDU A;  2J4R A;  2KHO A;  5ADX A;  1BO5 O;  3O4N A;  4FJH A;  5M1O A;  4WF9 L;  3IKM A;  1ASU A;  4E89 A;  1TV6 A;  2X6S A;  4YY3 K;  4H0X B;  4H5R A;  4KPY A;  3NVK A;  3CCU N;  4E1M A;  1HPZ A;  2YHX A;  3F9K A;  3SUO A;  4JI0 K;  3AGK A;  5AQS A;  2DTU A;  1E4G T;  2GEL A;  2VG5 A;  3KK7 A;  4CGG A;  2GV9 A;  3V9Z A;  4CES A;  2YJE A;  1RTJ A;  1RDD A;  3HYF A;  5AQQ A;  1BA1 A;  1MWM A;  3BGR A;  2G8I A;  2NRV A;  4DB3 A;  3CHW A;  4X62 K;  4NO7 A;  4KTZ A;  2GWJ A;  5AQR A;  5AQT A;  1X9M A;  4E19 A;  3KWG A;  1NOY A;  4WYB A;  1NMD A;  3J80 O;  3P38 A;  5AQI A;  3AVM A;  3TAB A;  2QKK A;  1C0U A;  3QEI A;  5FRM A;  1QHA A;  4KH4 A;  3VER A;  4X64 K;  3RTV A;  2HST A;  4I2Q A;  4DR5 K;  4E1J A;  4JV5 K;  5KTQ A;  3SBG A;  4ISG A;  4OO1 J;  3VEW A;  1TKT A;  4YDU C;  2HBK A;  4OVL A;  4C8K A;  1EWR A;  4H0O A;  3MK6 A;  3K5M A;  4HVJ A;  3WNE A;  4ZHR A;  5AQW A;  3VES A;  3PX6 A;  3VA3 A;  4BRF A;  4DTN A;  2EX3 A;  4CJQ A;  4LF8 K;  2JWL A;  3O3H A;  3DLB A;  3D2E B;  3VF4 A;  3OA9 A;  2NNW A;  1YTA A;  1EWQ A;  1SKW A;  1JCE A;  3KK1 A;  3EKU A;  3O8M A;  4IXC A;  3K5O A;  2PZS A;  4KH6 A;  4M3T A;  4CJL A;  3TAM A;  3ZSO A;  4DHY A;  4EFH A;  4JYA K;  2V7Y A;  4BWJ A;  1W0H A;  3KLI A;  4WE1 A;  3QEX A;  1JJ2 M;  2G8V A;  1ILY A;  4F3O A;  3MMV A;  2QWM A;  3ULE A;  1YJN N;  4CVN E;  2GEM A;  3NVM A;  3QNN A;  4BWM A;  3V9X A;  4DR6 K;  2IGI A;  3LAL A;  4NLB A;  5HLF A;  4BE2 A;  3LDL A;  4WFN L;  1N33 K;  3DXK B;  3J7Z O;  3IUC A;  1VQN N;  4BRK A;  4JHD A;  4JI8 K;  5K14 A;  3MDQ A;  3E9P A;  3VEV A;  1ASW A;  3DYA A;  1U45 A;  2P9P B;  1FKO A;  4FWP A;  4O55 A;  3HK2 A;  2O8C B;  3MWT A;  4CI6 A;  1K9M O;  5FPD A;  1YUW A;  1FXX A;  3AVI A;  3O6W A;  1DEJ A;  3S3M A;  2UUC K;  3ITH A;  4CEC A;  2XY6 A;  2KTQ A;  4B3S K;  1KFS A;  3CI5 A;  4AM7 A;  3PX0 A;  3F2K A;  1YT3 A;  1VHX A;  2YV0 X;  3H45 C;  4FO0 A;  2OTL N;  3NF9 A;  3QEW A;  1TUY A;  3AAR A;  1TUU A;  4FPA A;  4FK4 A;  4JKD A;  3CCM N;  1REV A;  4GV3 A;  2RPI A;  5HRS A;  2HB5 A;  4Q5V A;  2E20 A;  3KD5 E;  4MDB A;  1HNZ K;  4F4K A;  3FZK A;  4FLY A;  3D2F A;  1C0M A;  1BHL A;  3NH0 A;  4IFV A;  2QEX N;  2VWK A;  3W3D A;  1X9W A;  3EEQ A;  2A5X A;  4JS5 A;  3VPZ A;  3J81 O;  2XRI A;  3G6E N;  4JK9 A;  4JKB A;  1VSH A;  2ZE2 A;  4IKF A;  5E84 A;  3CD6 N;  1G99 A;  1RIL A;  4FZZ A;  2G8H A;  3HXM A;  4IOX A;  5FRN A;  4BRI A;  1KXP A;  4DTM A;  1O1W A;  3T3F A;  4M3Z A;  5AFU H;  4CFD A;  2RF2 A;  3PV8 A;  4YNQ A;  4JNE A;  3O9S A;  4QCL A;  3NH2 A;  2WFB A;  3KK2 A;  3WXK A;  1LOT B;  4HHT A;  2ATQ A;  1P8Z A;  1WN7 A;  3WUH A;  2YI1 A;  1ITG A;  5AQZ A;  3MN7 A;  5F1X A;  3LPT A;  1XMQ K;  2ZJP L;  3HL8 A;  3QML A;  3K58 A;  4QAG A;  1FJG K;  5BN9 A;  1RDB A;  2VG6 A;  1O13 A;  3H46 O;  1WAF A;  4BRE A;  1NG9 A;  3VTI A;  4BC2 A;  4B9T A;  4CJE A;  2PYL A;  1NGF A;  1S1T A;  4DLE A;  4CEO A;  3TU5 A;  3RSE B;  1T03 A;  1RDW X;  2V7Z A;  4FLZ A;  5DMR A;  4F9O A;  4PY5 A;  3CIP A;  3TAQ A;  4DSL A;  4I6M B;  2A6A A;  4QS7 A;  4CJ4 A;  1OKJ A;  1XNR K;  1KVA A;  1J9A A;  1LCU A;  4ZTF A;  1ZBH A;  3KD1 E;  4CF1 A;  3HI0 A;  3DOK A;  4BRL A;  3DLL L;  2FC0 A;  4AHS A;  1NWK A;  2IVN A;  1G15 A;  1GLJ O;  1OH6 A;  3O4Q A;  2UXC K;  3DI6 A;  4KHP K;  4JRQ A;  4KHS A;  2FXU A;  1A5X A;  2HBJ A;  3T1H K;  3L4Q A;  4FK2 A;  4KI4 A;  4I9Q A;  2KQ2 A;  3CCL N;  1LW0 A;  1VSI A;  2V52 B;  1YIT N;  4CD3 A;  1NGJ A;  4DV2 K;  5AQU A;  2P9I A;  3VTH A;  3ZSQ A;  2Q31 A;  1RT6 A;  4RCH A;  2O8E A;  3ENH A;  3I0R A;  4BQZ A;  4PHT X;  3HM8 A;  4CGD A;  4IFE A;  2FBY A;  1QQM A;  5BRF A;  3DOL A;  2WTU A;  4MLE A;  3TAF A;  1QE1 A;  3ZT0 A;  4IOC L;  1KRP A;  4ID5 A;  1RDA A;  5AQP A;  3O9Q A;  1GOA A;  3HRG A;  3MEE A;  3SLC A;  1BCO A;  4DSK A;  4IFY A;  4N47 A;  1EXQ A;  1XQS C;  4O5B A;  3SZ2 A;  4BDY A;  3VQ4 A;  2AJQ A;  3NGZ A;  1L5U A;  4HTL A;  2O8D B;  2IDO A;  2QW9 A;  3K2P A;  3OYK A;  1LWF A;  2E2Q A;  4XH5 A;  4FLU A;  4BGA A;  2OZS A;  4EAH D;  3B8A X;  3QEV A;  4DSJ A;  5EX5 A;  4HWI A;  3NGY A;  3TAR A;  1VSL A;  4BQL A;  3AVN A;  4BE0 A;  2OAN A;  4B9N A;  4FZY A;  3AVA A;  2CH5 A;  3ZSX A;  4ILJ A;  3AAP A;  4AHV A;  5TKW A;  2O8B A;  2NLX A;  2RHK A;  4BR5 A;  1R0A A;  5AQJ A;  2E2N A;  2O8F A;  4X65 K;  3SAF A;  3I8D A;  1TKZ A;  1XWL A;  3RMA A;  4DSE A;  4O8K A;  3NFA A;  5LJW A;  5CZ1 A;  4DCH A;  3C6U A;  4DLG A;  2G8W A;  5JLF A;  4K42 A;  2FSN A;  3VGM A;  2ZGY A;  3ZT3 A;  2ASM A;  1HYZ A;  5IT9 O;  5C2D A;  5AQM A;  4UY8 O;  1VRU A;  1U49 A;  3G71 N;  3CJA A;  3SYZ A;  4CFB A;  1OVY A;  3M3Z A;  1EKE A;  3S41 A;  3QFU A;  1D5A A;  3SUP A;  1J5O A;  1RT4 A;  5FRO A;  4CZH A;  2ITM A;  1KAX A;  1BUP A;  1BG3 A;  4YFU A;  1QQO A;  3MN5 A;  2W41 A;  2Q1N A;  4CJ7 A;  4JKA A;  4CEB A;  1S6P A;  3NE6 A;  5EY4 A;  2B5J A;  4DV6 K;  3CQ8 A;  1JCG A;  4JN4 A;  3U3G A;  2HMI A;  3AY9 A;  2NRT A;  4FWM A;  5AQF A;  3CJ1 A;  1JLQ A;  3NF7 A;  3C94 A;  5AFU A;  3DRR A;  3VQB A;  1SKS A;  1JL2 A;  3SQ2 A;  3ZYY X;  2JWK A;  3JYT A;  2ASP A;  3K57 A;  1HNW K;  1DTQ A;  1KFD A;  4CBW A;  2LSN A;  1XHX A;  2HNZ A;  1A5W A;  1NM1 A;  4BDP A;  4HCB A;  3CC7 N;  1L3U A;  5CR4 A;  1D9F A;  3LDP A;  1RTI A;  2P9U B;  3AVB A;  4WQ5 A;  2P9L B;  5KGX A;  1F21 A;  2R7Y A;  3IFR A;  1K8K A;  3IMX A;  4DU3 A;  1VSJ A;  4C8L A;  1NKB A;  4ISE A;  3MEC A;  4LC9 B;  2IS3 A;  3OBW A;  2HF4 A;  4DV0 K;  2D0B A;  1KCF A;  4MO5 A;  4KHY A;  3M6G A;  4IJA A;  4AHC A;  4BR9 A;  2ZWH A;  1SQK A;  4BRC A;  4E7L A;  1KLN A;  4B9L A;  2HOE A;  4JD2 A;  5DM6 L;  2F9W A;  4AHR A;  2DFF A;  4NCG A;  3FZF A;  4FCY A;  2ZM6 K;  4DTU A;  5EU7 A;  3EYZ A;  1JLC A;  1NGG A;  2UUB K;  4OKK A;  4JI1 K;  4B3R K;  3A8Y A;  3I33 A;  4I2P A;  4OPK A;  1TK8 A;  1T3V A;  2HHT A;  2W40 A;  2E5L K;  1NK8 A;  1NGH A;  2WC9 A;  3QLH A;  3SMS A;  4M45 A;  1LV5 A;  3GL1 A;  5I9E B;  3TWH A;  1C0F A;  1QSS A;  3P83 D;  4DSF A;  4FJ7 A;  2BGG A;  5GAD P;  5BRD A;  2QWQ A;  3MX2 A;  1IBL K;  4EP4 A;  5SZT A;  2E8A A;  4N5S A;  3ZX3 A;  4DR3 K;  3F73 A;  1NLV A;  4LFB K;  2FF6 A;  2D0O A;  2VYP A;  1U47 A;  2YNG A;  3OS1 A;  4B1V A;  1NMN A;  1BQN A;  4JKG A;  3ZSZ A;  2HMP A;  3OY9 A;  3F9M A;  4QOZ B;  1RBV A;  2QWO A;  5GAH P;  4YHH K;  3CCE N;  3PIP L;  4BC5 A;  1JCF A;  4CBU A;  3VQ8 A;  3SCX A;  1A5V A;  4CEZ A;  4B1X B;  3KLF A;  1N34 K;  1LWE A;  2PAV A;  3ZT1 A;  1IG8 A;  3DM2 A;  4H5N A;  3AVC A;  4C8N A;  1QS4 A;  2VWB A;  3O4W A;  3OS0 A;  4FXD A;  3N4Q A;  3S9H A;  3PY8 A;  3U3Y A;  2AA4 A;  3KZB A;  1QSY A;  4CHY A;  2ZQB A;  2FF3 B;  1XI1 A;  1VQM N;  3ZSY A;  3O5B A;  4DS4 A;  1IG9 A;  2E2P A;  1VSD A;  4KFB A;  1RDC A;  3P4I A;  2ZGZ A;  4FM0 A;  5BR9 A;  4DQR A;  1NGB A;  4CGF A;  4CGI A;  4CJP A;  3O1W A;  3VET A;  3EE9 A;  1R59 O;  4CJT A;  3SNN A;  1N8R O;  3KLG A;  4BC4 A;  4HCC A;  3OYL A;  1ZC6 A;  3FZM A;  4FLV A;  3RWU A;  2WOM A;  3ULE B;  3VOV A;  3L3U A;  3TAE A;  2YHA A;  1ZBU A;  2QWN A;  4ICL A;  1Z25 A;  1RGI A;  4DFK A;  4PWD A;  3HJF A;  2X74 A;  2VCP A;  4CJW A;  4NYF A;  3OYC A;  1RBR A;  1SAZ A;  2X78 A;  4KV8 A;  4U67 L;  3L2R A;  3VQ9 A;  4DQ8 A;  4M3X A;  4LD0 A;  1TAQ A;  4JI7 K;  3U6F A;  1S72 N;  4QS8 A;  4M7X A;  3O3G A;  4LF7 K;  3WNF A;  4DV4 K;  4CJS A;  3QBW A;  3AVJ A;  1L3S A;  1XNQ K;  2KZM A;  4GKJ K;  1BIS A;  2HND A;  2DPN A;  3SJH A;  3L2V A;  3OJS A;  4C1N I;  4E0D A;  1TKX A;  3T7Z A;  5AZI A;  3EE8 A;  1DGK N;  3KVG A;  2RE2 A;  4M42 A;  1WOQ A;  3ZT4 A;  4BDZ A;  2VQF K;  5FPM A;  1NJW A;  4J2A A;  5AZJ B;  3AA5 X;  3VEX A;  3WNH A;  4WFB L;  1M1K O;  3QET A;  4B8A B;  1BL3 A;  3DLK A;  1QTM A;  3QIP A;  1HQU A;  4CZI A;  2HVH A;  1C1B A;  2FLO A;  3OYI A;  3UIQ A;  2OPS A;  2Q97 A;  4H4O A;  4O0I A;  2D1K A;  1BQM A;  3AVH A;  3IRX A;  3D2F B;  2P9S A;  4AIL C;  3CPE A;  3LP3 A;  4MQ3 A;  5M1N A;  2HHV A;  4KH5 A;  1BI4 A;  3R9P A;  1HKC A;  3L0Q A; 
#chains in the Genus database with same CATH homology
 4DF4 A;  3HL8 A;  3K58 A;  4JS4 A;  4QAG A;  3AVF A;  1D8Y A;  1RDB A;  1WSG A;  3VN5 A;  2NUB A;  1CXU A;  1VK0 A;  4JLH A;  4CF9 A;  2VG6 A;  2ETJ A;  5HBM A;  1WAF A;  4W5N A;  3VQQ A;  3VQA A;  2Y1J A;  1NJY A;  4B9T A;  4HTU A;  4CJE A;  2PYL A;  2XY7 A;  1S1T A;  3QO9 A;  5FDL A;  4DLE A;  4CEO A;  4W5Q A;  1NOZ A;  3L3V A;  4FJG A;  4KB1 A;  4RW8 A;  3HVT A;  1S1X A;  4CIG A;  4CHQ A;  1T03 A;  3E01 A;  3NDK A;  3AO2 A;  4CER A;  4FLZ A;  5DMR A;  3V9S A;  3SQ4 A;  1Q8I A;  1Y97 A;  3TAQ A;  3NCI A;  4PY5 A;  5JS1 A;  4DSL A;  3D45 A;  3TAP A;  1RT2 A;  2Z1J A;  4CJ4 A;  1QQC A;  1EP4 A;  4Y1C A;  5DK5 A;  1NJX A;  1IO2 A;  4CK2 A;  1KVA A;  1J9A A;  4OLA A;  1RT3 A;  4F2S A;  3LWL A;  2BE2 A;  3LZI A;  3NHG A;  4E3S A;  1GOC A;  1BGX T;  3B6P A;  3RMC A;  2YNI A;  1U04 A;  4CF1 A;  4ZTF A;  3KD1 E;  1ZBH A;  3DOK A;  3NF6 A;  2HW3 A;  3VQD A;  2FC0 A;  4AHS A;  4N41 A;  4KRF A;  1G15 A;  2HHS A;  1TVR A;  4H8K A;  2A1R A;  1ZBL A;  4PA1 A;  1SL1 A;  3RMB A;  2KZZ A;  2HHX A;  5KI6 A;  3AVL A;  3M8R A;  2IC3 A;  2Z1I A;  4IDK A;  4CJ3 A;  4CK1 A;  4DMN A;  1BI4 B;  1IKV A;  2F96 A;  3O4Q A;  2HVI A;  1TAU A;  4CED A;  3C95 A;  3DI6 A;  1SL0 A;  4Z4E A;  2RN2 A;  1S1U A;  2ITG A;  4JRQ A;  4KHS A;  1A5X A;  2D0A A;  3OVN A;  3VQC A;  4FK2 A;  3KLH A;  1J54 A;  1HMV A;  1RTD A;  4I9Q A;  4KI4 A;  1S1W A;  2KQ2 A;  5CYM A;  1RBS A;  4XIU A;  1U48 A;  1S5J A;  1LW0 A;  4CHP A;  3TAN A;  4FJM A;  1VSI A;  3IAY A;  4W5O A;  5J2M A;  4KHW A;  3HP6 A;  2XY8 A;  4DFJ A;  3VQ7 A;  3HPG A;  1NKE A;  1TKD A;  3WNG A;  5J2P A;  3QIN A;  2W42 A;  2G8U A;  4KB0 A;  3K5N A;  1TGO A;  3SV3 A;  4OJR A;  3ZSQ A;  1RT6 A;  4GMJ B;  4BE1 A;  2D5R A;  3MXM A;  1ZBI A;  4KAZ A;  4Z4I A;  3SJJ A;  3I0R A;  3V1R A;  4FJI A;  4CGD A;  4DG1 A;  5J1E A;  2FBY A;  3HPO A;  2E6L A;  3PUF A;  3DOL A;  4Z4C A;  4F2R A;  4UQG A;  2E6M A;  1HYV A;  3OYF A;  4LH5 A;  4E7K A;  4Z4G A;  3CM5 A;  3ZSR A;  3TAF A;  2BDP A;  1RT7 A;  2OA8 A;  1B9F A;  4KTW A;  1QE1 A;  3ZT0 A;  1KRP A;  4CJR A;  4ID5 A;  1L3V A;  1WSJ A;  3HP9 A;  1RDA A;  4EP5 A;  3KK3 A;  1ZBF A;  2Q3S A;  4PQU A;  1GOA A;  3I0S A;  4KO0 A;  3MEE A;  5SWM A;  2OZM A;  4CIE A;  1WSF A;  1Q9Y A;  3OYE A;  4ELU A;  3OYA A;  1FKP A;  1BCO A;  3ASM A;  3LP2 A;  2YNH A;  4Z4H A;  4DSK A;  4IFY A;  3RR7 A;  5D3G A;  1JKH A;  3TI0 A;  4N47 A;  3FFI A;  1EXQ A;  4O5B A;  4W5T A;  3SZ2 A;  4FW1 A;  2FBT A;  3VQ4 A;  4BDY A;  2AJQ A;  4ID1 A;  1RT1 A;  5CY4 A;  3NGZ A;  1L5U A;  2KW4 A;  4MFB A;  4DTR A;  4CEE A;  5HP1 A;  1JXB A;  1RT5 A;  2IDO A;  3AV9 A;  3K2P A;  1YVU A;  3OYK A;  1LWF A;  3V6D A;  3AO3 A;  3V4I A;  2VWJ A;  4FLU A;  4CF2 A;  2OZS A;  1Q9X A;  2HHQ A;  1VRT A;  3QEV A;  4KHN A;  1D9D A;  4DSJ A;  4AHU A;  3NGY A;  2BAN A;  4DF8 A;  1VSL A;  3TAR A;  1B9D A;  3AVN A;  4BE0 A;  4B9N A;  4FZY A;  3AVA A;  4OLB A;  3L2U A;  4M3T A;  3ZSX A;  4FLW A;  4O4G A;  1UOC A;  3V1Q A;  4AHV A;  4ELV A;  1LAW A;  3ALY A;  4CJK A;  4RW9 A;  2XO7 A;  1C1C A;  5KRT A;  4GVM A;  1X1P A;  3K5L A;  3NGI A;  1TL3 A;  1UWB A;  4DTS A;  1XHZ A;  3ZCM A;  4CFC A;  1R0A A;  4JRP A;  2OPR A;  4LSN A;  2HHU A;  1SUQ A;  3SI6 A;  3LPU A;  3KKS A;  2B6A A;  3DRS A;  3I8D A;  1SKR A;  3C6T A;  1TKZ A;  2FBX A;  2Z1H A;  1XWL A;  3RMA A;  4DSE A;  1NK7 A;  3DMJ A;  4ZTJ A;  4B9M A;  3NFA A;  1BIU A;  5CZ1 A;  3V81 A;  3KLE A;  4FM1 A;  4DU4 A;  3C6U A;  4DLG A;  2G8W A;  3IS9 A;  1C1A A;  4O0J A;  4Z4F A;  4CJV A;  4EZ9 A;  1LW2 A;  1NK9 A;  3VQ5 A;  3ZT3 A;  3LAK A;  2VG7 A;  1HYZ A;  4RW4 A;  4EZ6 A;  1JL1 A;  3A2F A;  3TAG A;  4KHQ A;  1VRU A;  4RW7 A;  1U49 A;  2X6N A;  1HNV A;  5HRP A;  3OYN A;  2DY4 A;  1ASV A;  3OJU A;  4OKE A;  3SYZ A;  4B9U A;  4CFB A;  4E7H A;  1EKE A;  3KJV A;  3QEP A;  3CFR A;  1D5A A;  3SUP A;  1LWC A;  3P5J A;  1J5O A;  4GW6 A;  1RT4 A;  4M3R A;  1JLE A;  1I39 A;  3EY1 A;  4DS5 A;  5HRO A;  1SL2 A;  5FRO A;  2HNY A;  4FJN A;  2XY5 A;  3G10 A;  4B3O A;  4Z0U A;  2PY5 A;  4DQP A;  3LP0 A;  1KTQ A;  4AH9 A;  1NK5 A;  4YFU A;  1SV5 A;  4OPJ A;  1DLO A;  4I9L A;  1DTT A;  4NYN A;  1T7P A;  4CEB A;  1S6P A;  4CEQ A;  3OS2 A;  3HT3 A;  3NE6 A;  3DRP A;  4CE9 A;  2B5J A;  5C42 A;  2I5J A;  1QSL A;  3QER A;  3CQ8 A;  3BDP A;  3THV A;  3PO4 A;  3U3G A;  2OPQ A;  5T7B A;  2HMI A;  4B9S A;  1EX4 A;  1IKY A;  3S3O A;  3VQE A;  1JLQ A;  1NK6 A;  1N6Q A;  1UAX A;  3NF7 A;  3C94 A;  4LSL A;  3V1O A;  3S3N A;  2Z1G A;  3DRR A;  3VQB A;  4FM2 A;  3SQ1 A;  2F8S A;  2GBZ A;  1JL2 A;  1SKS A;  3OYD A;  3SQ2 A;  4J2B A;  1C6V A;  3NF8 A;  3JYT A;  1VSM A;  3K57 A;  1DTQ A;  3AO1 A;  1KFD A;  1WSE A;  2LSN A;  1WSI A;  1XHX A;  2HNZ A;  4DFM A;  1A5W A;  1HRH A;  3O4N A;  4F8R A;  4FJH A;  4BAC A;  1VSE A;  1J53 A;  3M8P A;  4BDP A;  1VSF A;  4HCB A;  5HRN A;  1JLB A;  5C24 A;  1L3U A;  1ASU A;  4E89 A;  1TV6 A;  4E7J A;  2X6S A;  1D9F A;  3AA4 A;  1RTI A;  3OYH A;  2G8F A;  4RG8 A;  4J2E A;  2QK9 A;  3AVB A;  4KPY A;  1K6Y A;  1B92 A;  4E1M A;  5KGX A;  1HPZ A;  3F9K A;  3CM6 A;  1F21 A;  3SUO A;  3CG7 A;  2R7Y A;  2YNF A;  1S9G A;  2DTU A;  2VG5 A;  1JXE A;  4CGG A;  2GV9 A;  3V9Z A;  4CES A;  3HYF A;  1RTJ A;  1RDD A;  3LZJ A;  1X9S A;  4NCA A;  4KRE A;  4E1N A;  4Y1D A;  4DU3 A;  1VSJ A;  4B8C A;  3BGR A;  4C8L A;  1NKB A;  2G8K A;  2G8I A;  1QHT A;  3MEC A;  1CLQ A;  4H4M A;  5I42 A;  2IS3 A;  2P5O A;  2D0B A;  1KCF A;  4CFA A;  4KTZ A;  4KHY A;  3LDS A;  3RR8 A;  4N56 A;  4AHC A;  4K8Z A;  5J2N A;  1X9M A;  2KFZ A;  4E7L A;  1CZB A;  5CYQ A;  4E19 A;  1KLN A;  3VQP A;  4B9L A;  1NOY A;  1BCM A;  4AHR A;  2DFF A;  4NCG A;  4NCB A;  1YTU A;  3LAM A;  4FVM A;  4FCY A;  3LWM A;  3AVM A;  4DTU A;  3TAB A;  2QKK A;  1C0U A;  5EU7 A;  3ZSW A;  3QEI A;  5FRM A;  3EYZ A;  1JLC A;  5I3U A;  2EHG A;  3RTV A;  4OKK A;  3JSM A;  3LAN A;  4I2P A;  4OPK A;  4I2Q A;  1T8E A;  1TK8 A;  2HHT A;  5KTQ A;  4HUF A;  1TKT A;  1S6Q A;  3T19 A;  4OVL A;  3ULD A;  1NK8 A;  1N5Y A;  4C8K A;  2YKM A;  4B08 A;  1CZ9 A;  4FJ5 A;  3ZSV A;  3K5M A;  4HVJ A;  3HST B;  1S9E A;  3QLH A;  3WNE A;  4N76 A;  5KRS A;  4ZHR A;  4M45 A;  2B4J A;  1LV5 A;  3PX6 A;  1KFS A;  3VA3 A;  3TWH A;  4DTN A;  2EX3 A;  1QSS A;  3P83 D;  4CJQ A;  3OYG A;  4DQS A;  4DSF A;  4I7F A;  3KIO A;  3K59 A;  3SPY A;  1ZYQ A;  4FJ7 A;  4IG0 A;  2BGG A;  2O4I A;  3O3H A;  3DLB A;  1BIZ A;  1UA0 A;  2GUI A;  4PUO A;  4EP4 A;  5SZT A;  1VSK A;  4CCH A;  1YTA A;  3AA2 A;  2DFE A;  4N5S A;  3RRH A;  1SKW A;  2E4L A;  2P1J A;  3F73 A;  3KK1 A;  1JLA A;  3HM9 A;  4CIF A;  1KLM A;  4RW6 A;  4CGJ A;  3SQ0 A;  3H08 A;  1U47 A;  3K5O A;  4ELT A;  4OKJ A;  2YNG A;  2PZS A;  3OS1 A;  4CJL A;  3TAM A;  3ZSO A;  3OYM A;  4HUG A;  1RCH A;  4DQQ A;  4DFP A;  3QES A;  1L3T A;  2FBV A;  4CEA A;  2OPP A;  1BQN A;  4BWJ A;  3ZSZ A;  1UA1 A;  3PO5 A;  3OY9 A;  1W0H A;  4QOZ B;  3KLI A;  1RBV A;  2XHB A;  2RKI A;  4WE1 A;  3QEX A;  1RNH A;  3P1G A;  1I3A A;  2G8V A;  1HJR A;  5JS2 A;  3VQ8 A;  1TK5 A;  4F3O A;  4CJ5 A;  1A5V A;  3SCX A;  4CEZ A;  3KLF A;  3SUQ A;  1IKX A;  1GOB A;  3MEG A;  1LWE A;  1FK9 A;  3ZT1 A;  3ISN C;  4KI6 A;  5C25 A;  4FJ9 A;  2D0C A;  3QNN A;  3DM2 A;  3L2Q A;  3AVC A;  3L8B A;  4BWM A;  3V9X A;  4C8N A;  2IGI A;  3LAL A;  4C8M A;  1HNI A;  3QNO A;  2OYQ A;  1RTH A;  4CHO A;  5HLF A;  4BE2 A;  1QS4 A;  1NJZ A;  1IH7 A;  3OS0 A;  4KTQ A;  4KHU A;  2JLE A;  3L2W A;  4FXD A;  3S9H A;  3PY8 A;  3U3Y A;  3NH1 A;  3HO1 A;  1WLJ A;  2F8T A;  1JLF A;  3DLH A;  4E7I A;  1QSY A;  4CHY A;  2ZQB A;  3MED A;  3DLR A;  1XI1 A;  3ZSY A;  4CJU A;  4DS4 A;  1IG9 A;  4M3W A;  1VSD A;  5K14 A;  4KFB A;  5E41 A;  1RDC A;  1ASW A;  4KKO A;  3DYA A;  3AO5 A;  4CF0 A;  3CFP A;  1U45 A;  4FM0 A;  4B9V A;  3VQ6 A;  3SV4 A;  3MAQ A;  2DFH A;  4DQR A;  4CGF A;  1C0T A;  4CGI A;  4CJP A;  4CF8 A;  1FKO A;  4O55 A;  3HK2 A;  5KGW A;  4R5P A;  3ZT2 A;  4CJT A;  3AVK A;  3SNN A;  3KLG A;  3IG1 A;  1EET A;  3MXI A;  3M8Q A;  4HCC A;  3OYL A;  1FXX A;  1NK4 A;  3AVI A;  2YKN A;  4DQI A;  4AHT A;  4FLV A;  3MXJ A;  3RWU A;  3S3M A;  2WOM A;  3ITH A;  2IAJ A;  3L3U A;  4O44 A;  4TSX A;  4CEC A;  2XY6 A;  2KTQ A;  3TAE A;  2YHA A;  1W9H A;  1WSH A;  1ZBU A;  1WAJ A;  4W5R A;  4ICL A;  3OYJ A;  3PX0 A;  1Z25 A;  3B6O A;  1MU2 A;  3M8S A;  4K8X A;  1YT3 A;  3TR8 A;  4DFK A;  1HYS A;  4PWD A;  4LH4 A;  2P5G A;  3HJF A;  2YV0 X;  2X74 A;  4CJW A;  4NYF A;  3OYC A;  1RBR A;  3NF9 A;  3EZ5 A;  4FLX A;  3QEW A;  1U4B A;  2PYJ A;  4FYD A;  3AA3 A;  4FK4 A;  2X78 A;  1IKW A;  4IG3 A;  4KV8 A;  3L2R A;  3VQ9 A;  4IBN A;  4OGC A;  4DSI A;  4DTX A;  4G1Q A;  1REV A;  1KSP A;  4M3X A;  4LD0 A;  1TAQ A;  2RPI A;  4M3Y A;  3DLE A;  3U6F A;  4CEF A;  1TK0 A;  5HRS A;  3O3G A;  2HB5 A;  1KVC A;  4Q5V A;  3G0Z A;  1NKC A;  3KTQ A;  3KD5 E;  1HQE A;  3WNF A;  4F3T A;  4CJS A;  3AVJ A;  2A1S A;  1WNS A;  4FLT A;  3T1A A;  1L3S A;  4J2D A;  2KZM A;  1BIS A;  4F4K A;  4L8R B;  2HND A;  3V9W A;  3L2V A;  4FLY A;  3OJS A;  4E0D A;  1C0M A;  1BHL A;  1LAV A;  1TKX A;  3AO4 A;  3NH0 A;  4FJ8 A;  3V9U A;  1CXQ A;  3PX4 A;  4FZX C;  4DTP A;  4DU1 A;  4IFV A;  4DTO A;  3DLG A;  2ZD1 A;  2VWK A;  1T05 A;  2JGU A;  3KKR A;  1X9W A;  4M42 A;  2WON A;  3CYM A;  2KFN A;  3CFO A;  4LY7 A;  2Y1I A;  3ZT4 A;  1S1V A;  4OGE A;  4JS5 A;  2XRI A;  4Q0B A;  4CHN A;  3NAE A;  3D0P A;  4BDZ A;  1VSH A;  2ZE2 A;  5HRR A;  4IKF A;  1RBT A;  1NJW A;  1RIL A;  4J2A A;  2QXF A;  4FZZ A;  3LP1 A;  3AVG A;  3HVR A;  3HXM A;  2G8H A;  4FW2 A;  2O4G A;  3AA5 X;  4DWI A;  4FJJ A;  3WNH A;  4CJF A;  4FJX A;  5FRN A;  3QIO A;  4B8A B;  4DTM A;  3QET A;  1O1W A;  3OYB A;  3T3F A;  3RRG A;  4FJK A;  4M3Z A;  1BL3 A;  4CFD A;  2RF2 A;  2P51 A;  3HPH A;  3DLK A;  4YNQ A;  3PV8 A;  3QIP A;  1QTM A;  4FJL A;  1HQU A;  4DTJ A;  4C8O A;  1KVB A;  2HVH A;  1C1B A;  1JLG A;  1Z26 A;  3OYI A;  4CK3 A;  4QCL A;  3NH2 A;  1XC9 A;  4CHZ A;  4HUE A;  3UIQ A;  3KK2 A;  3SUN A;  2OPS A;  3NBP A;  4H4O A;  4HHT A;  2ATQ A;  4O0I A;  3VA0 A;  4M3U A;  1BQM A;  3AVH A;  4M41 A;  3SPZ A;  4FK0 A;  3IRX A;  1TL1 A;  5CZ2 A;  2IOC A;  2HHW A;  4CGH A;  2YHB A;  1RBU A;  1WN7 A;  4AIL C;  3RMD A;  1ITG A;  2QKB A;  3O3F A;  3LP3 A;  4MQ3 A;  2HHV A;  1BI4 A;  5J2Q A;  3LPT A;  1NK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...