3VQPA

Hiv-1 in core domain in complex with 2,3-dihydro-1,4-benzodioxin-5-ylmethanol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
141
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 50
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqpA00
1TK5A 4CHYA 1J53A 4DF8A 5SZTA 4E7JA 1TKXA 4RW4A 4ELTA 3P5JA 3QNNA 4BWJA 4MQ3A 3ZCMA 4I2PA 4CJSA 4O55A 4CESA 4KRFA 3TAEA 3SUNA 2PY5A 3ASMA 4NCBA 3ITHA 1LAVA 1Q9YA 2F8SA 3NCIA 3V6DA 2QK9A 3ZSVA 3NGIA 3TAFA 4EZ6A 3DLRA 4N76A 3ISNC 2OYQA 2OPQA 4J2BA 4KPYA 4FJ9A 4KHUA 2XY8A 3KKRA 4E1NA 1NK4A 1U47A 1NK6A 4M45A 1S1XA 1TKDA 5KGXA 5KRSA 5HRNA 3PX0A 5D3GA 1HQEA 4ELUA 4FW1A 3TAGA 4FM0A 1KSPA 3VA3A 1UA1A 2KZMA 2HNYA 1FXXA 3SCXA 2Z1IA 4FLWA 1YT3A 4FVMA 3PY8A 4OKJA 4BDYA 4G1QA 3QESA 1HNVA 1ITGA 2D5RA 4OGCA 1RDCA 3PO5A 3G10A 2F8TA 1LWCA 1UOCA 1BGXT 5J2NA 3TAMA 4FLTA 4H8KA 4F8RA 1YTAA 1VSJA 4DTXA 3NF7A 1HMVA 1BCOA 5C42A 4CHQA 3K57A 3TR8A 3RR8A 1BIUA 1CLQA 1EXQA 1U49A 2HVIA 1DTTA 2B5JA 3TANA 2ZQBA 1NK7A 3K2PA 4DQSA 4LH4A 3CFPA 4FXDA 3WNGA 1JLAA 5J1EA 1UA0A 4ZTJA 1JL1A 1NOZA 2IAJA 4LSNA 1TK0A 3IS9A 1WAJA 4CHPA 3K58A 4O5BA 4E7HA 1BL3A 4KHSA 3NGYA 4BDPA 4BE0A 4M42A 2QXFA 5KGWA 4CJVA 3EZ5A 2X74A 4IKFA 4OKKA 1TGOA 4NCAA 4O4GA 3DRRA 2PZSA 3KTQA 1CXQA 4KTZA 1C0UA 4OPJA 4DQPA 1QE1A 2G8WA 1S9GA 4FK2A 4RW8A 3AVIA 1ZYQA 3OYNA 3JYTA 4DTJA 4FYDA 4FCYA 4YNQA 1RT1A 3G0ZA 4DU3A 4DTRA 1ASVA 4DFJA 3CQ8A 3KLFA 3LDSA 4F3OA 4FJGA 4JS5A 3KLIA 1LW2A 3KK1A 3L8BA 3I8DA 4KHQA 2FBYA 3KD1E 1D9FA 4FW2A 1XC9A 1HRHA 3RWUA 4ZTFA 3AVHA 4KTQA 3LAKA 1ASWA 3ZSYA 4W5TA 3NGZA 3AVJA 2YHAA 4B9MA 4ELVA 2HHTA 3ZT1A 3TABA 2ATQA 3AO1A 4KV8A 3AVBA 3C94A 4L8RB 1L3VA 3LAMA 1IKWA 4BACA 4DG1A 5T7BA 3V9ZA 3HJFA 1VRUA 4J2AA 1IKVA 4AHRA 4QCLA 2XY7A 4DTUA 1C6VA 4B8AB 4DMNA 3HP6A 3O4QA 3CM5A 4XIUA 3L2WA 1L3SA 1KTQA 3SUQA 3NAEA 4AILC 2QKBA 1RDBA 3D45A 4KB0A 3O3HA 1SKRA 1RILA 4B9UA 4HHTA 1WSHA 2XY6A 2LSNA 3AVFA 4AHCA 4E7KA 1FKPA 4C8OA 5HRPA 1UAXA 4F2SA 3C6UA 1WAFA 3H08A 3RTVA 1EX4A 3KLHA 3P83D 3QIPA 5CZ1A 2HNDA 4CGFA 5DMRA 4LH5A 2B4JA 2P5OA 3IRXA 3NF8A 2P5GA 1GOBA 3VQPA 1TAUA 3VQ7A 4FLZA 1NK5A 4K8XA 5J2PA 3AVGA 4HVJA 3THVA 2HHSA 4CJ4A 3RMAA 1TL3A 2HHWA 1X9MA 1VSDA 3OYLA 3I0SA 2BE2A 4M41A 3U6FA 1Z25A 2RN2A 3V9UA 3K5LA 3DYAA 2Q3SA 3WNHA 3QEPA 4FJJA 1VSLA 5CYQA 3KKSA 1G15A 4HUEA 4ZHRA 4Z4FA 3PV8A 1IG9A 1RBUA 2KQ2A 1WSIA 1BCMA 4CJ3A 3TWHA 4CIEA 4CFAA 3SI6A 1QQCA 3QEVA 4MFBA 4KHWA 4PUOA 3SV3A 2G8IA 4ICLA 3SUPA 3L3UA 1VSHA 4CHOA 5KI6A 4GMJB 1X1PA 3AVKA 3QO9A 3SQ0A 4C8KA 3EY1A 1EKEA 4TSXA 3DMJA 3HPOA 2ITGA 3L3VA 4OVLA 3NFAA 3LP3A 2Z1JA 1TVRA 4ID5A 4DTOA 3TAQA 3OYMA 3KLEA 2G8VA 1KRPA 2E6MA 4DU1A 1C1AA 4DFMA 4LSLA 1HYSA 2EX3A 1JXBA 1JXEA 1WNSA 3V1OA 3VN5A 5KTQA 4FZZA 4CEQA 4HCBA 4W5NA 2BANA 1L3UA 4E19A 3AA4A 2YNFA 1RTDA 4JRQA 3AVNA 3DLEA 4Y1CA 5CY4A 3E01A 4N5SA 3VQDA 5DK5A 3U3YA 2G8KA 1B9FA 1WSEA 4CF0A 4FJIA 4CERA 3S3OA 3M8SA 4CCHA 3SNNA 4HCCA 3OYIA 1N6QA 4KHNA 3VQ9A 2XRIA 4B08A 2DFEA 2FBXA 3SJJA 4C8LA 2BGGA 3V1QA 3ZSRA 4CHZA 4AHUA 1KFSA 4KHYA 3PX6A 4Z4EA 3MEGA 3VQ8A 3HPHA 1VSFA 1RT2A 3ZT0A 3JSMA 2GV9A 4H4OA 1S5JA 1RTIA 3FFIA 4PA1A 1L3TA 3RRGA 3SPZA 3MXMA 4KO0A 3VQCA 1X9WA 2OZSA 3NF9A 1LV5A 3DLGA 4NYNA 3V81A 3HXMA 4Y1DA 1D5AA 1QSSA 3DLBA 4B9SA 4I9QA 4EP4A 1JLGA 2IS3A 3P1GA 3RR7A 4CEOA 3CG7A 3LWMA 1WLJA 1F21A 3ZSZA 2Z1GA 2NUBA 4C8NA 3ZSOA 3EYZA 4FJ8A 4F3TA 3K5OA 1HYZA 2VG5A 4J2DA 2P1JA 4J2EA 1RT4A 4OJRA 1IKXA 4DLGA 1YTUA 4DS4A 1Q9XA 5J2MA 1FKOA 1WSGA 2XY5A 3LALA 1Z26A 2R7YA 2VWJA 4RG8A 1KVBA 2PYJA 3VA0A 4M3TA 3V4IA 2IGIA 3VQBA 3SQ2A 2OPPA 3HVTA 1C1BA 4FLYA 3AA3A 3QEXA 3CYMA 1RCHA 1VRTA 2P51A 3LWLA 4I7FA 1TV6A 2Y1JA 2XHBA 2XO7A 4B9NA 1B9DA 3KK2A 2HW3A 2DFFA 1KVAA 3HL8A 3QIOA 2ZE2A 4CGJA 3HT3A 4FJHA 2D0AA 5JS2A 4AHSA 1U45A 4KAZA 5HP1A 5JS1A 3OS1A 4DS5A 4DTSA 1XHZA 1VK0A 4E0DA 1J9AA 2YV0X 2HVHA 4M3UA 4Z0UA 4CJFA 3DM2A 3PUFA 4RW6A 4CHNA 1SL0A 2WOMA 4OPKA 4IFYA 3TI0A 2KFZA 5FRNA 3O3FA 3KD5E 3V9SA 1N5YA 1C1CA 3MEEA 1NK0A 3M8PA 3PX4A 4K8ZA 4N41A 3HVRA 1T8EA 3L2QA 4RW7A 1GOCA 3SZ2A 3DOLA 1CZBA 2KFNA 3MEDA 4CFDA 5HRSA 3D0PA 1NKEA 1L5UA 1SV5A 2YHBA 1JLQA 3AO4A 3KLGA 4CK2A 2HB5A 4KTWA 3QERA 1IKYA 3HP9A 4DQIA 2A1RA 1D8YA 4CJTA 4CK3A 1RT3A 1W9HA 2FC0A 4FJ7A 2FBVA 4KFBA 1J54A 2X6SA 3CM6A 3LANA 3OVNA 4Z4HA 1RT6A 2Y1IA 3LP1A 2DFHA 2G8UA 3QINA 2X6NA 3OY9A 3I0RA 4IFVA 1T05A 4FLVA 1C0MA 1S1VA 4FLUA 1NK9A 3VQQA 4CJPA 3MAQA 4DFPA 1TAQA 1R0AA 4FJMA 1C0TA 4Q0BA 4FK4A 4E3SA 1IO2A 3AO5A 3A2FA 3AVLA 4DSIA 4DSKA 4CJWA 1WSJA 5J2QA 3OJSA 4PY5A 4CF8A 4CJ5A 4CJKA 3B6PA 4NYFA 1NOYA 1REVA 1XHXA 4KREA 1LWEA 2IDOA 3KJVA 3SQ4A 2YKNA 2O4GA 4CEBA 3HK2A 3TAPA 1QSYA 4W5OA 3LPTA 1O1WA 4JS4A 1QSLA 3HPGA 1TL1A 2HHXA 4DU4A 1NJZA 3NH0A 2ZD1A 1LWFA 3AA2A 1MU2A 1RT7A 5FRMA 4JRPA 4CGHA 1EETA 1EP4A 3ZSQA 3SPYA 5C24A 3NF6A 3UIQA 1SL1A 4F4KA 2AJQA 3T1AA 1JLEA 3NH1A 3M8QA 3LP0A 1ASUA 3KK3A 3OYDA 4KKOA 3TARA 3MXJA 4PQUA 1KLMA 2GBZA 4H4MA 4BE1A 1TK8A 1A5XA 3QEIA 3SV4A 4E7LA 1ZBFA 1BHLA 1S6QA 1VSIA 1CXUA 1YVUA 3DI6A 3U3GA 4CJUA 5SWMA 4W5RA 2OA8A 4DFKA 1XWLA 3AO2A 4CJQA 4IG0A 2BDPA 1RBRA 2E6LA 3V1RA 4FJLA 3QETA 4R5PA 1T7PA 1LW0A 4JLHA 2QKKA 1HJRA 4IDKA 3K5MA 1UWBA 2E4LA 1S6PA 3OS0A 5K14A 1WN7A 4CIGA 4FLXA 4YFUA 3S9HA 4DLEA 1SKSA 2I5JA 3PO4A 1QTMA 3HM9A 4OLBA 2EHGA 2Z1HA 3OYFA 4QOZB 1ZBUA 1DTQA 4O44A 3DRSA 3IG1A 1TKZA 2YKMA 3VQ5A 4M3ZA 4IG3A 1X9SA 4CF9A 4CGIA 4GVMA 4FJKA 1A5WA 1HPZA 1BI4A 4AHTA 3K5NA 4FJ5A 5I42A 4KI6A 3OYJA 4LD0A 4CF1A 4UQGA 2ETJA 4I2QA 4PWDA 4DSEA 5HROA 3ZSXA 4DF4A 4Z4GA 4O0JA 2YNHA 4CE9A 1ZBLA 1RBVA 2HMIA 2PYLA 4EZ9A 1VSEA 3OS2A 3M8RA 4F2RA 3CFOA 2O4IA 4CF2A 1U4BA 2RF2A 1RDAA 1W0HA 3AVCA 3S3MA 1FK9A 1Q8IA 2G8FA 2HHQA 4AHVA 1U04A 2X78A 4HUGA 3QEWA 4FM2A 1QS4A 4DTPA 1S1WA 4CJLA 1HYVA 4KB1A 2A1SA 4E89A 1GOAA 2D0CA 3VQ4A 3WNFA 3AVAA 4AH9A 1IH7A 3AV9A 3BDPA 1BIZA 5FROA 4BE2A 1HQUA 4DSJA 3F9KA 2D0BA 5C25A 4DSFA 3ZT4A 4CJEA 1RTHA 1QHTA 1S9EA 4HTUA 4DSLA 2VWKA 4CEAA 4Q5VA 4CEFA 5E41A 1JLCA 1KVCA 1TKTA 5KRTA 2KW4A 1RDDA 3ZT3A 2WONA 1K6YA 4IBNA 5HRRA 3VQ6A 3ZT2A 4CFBA 3AA5X 3C95A 4WE1A 4CIFA 3K59A 3HYFA 4FZYA 4B9VA 1JLBA 4M3RA 4CEEA 3DLHA 4Z4IA 4RW9A 2YNIA 1NK8A 4OLAA 3NHGA 2IC3A 3L2VA 3OYKA 1HNIA 4EP5A 3IAYA 1BQMA 3V9XA 2KZZA 3RMDA 1D9DA 1BQNA 4FZXC 2JGUA 3VQAA 5FDLA 1DLOA 4GW6A 1KCFA 3DLKA 5I3UA 2VG6A 4BWMA 2OZMA 1RBSA 2RKIA 4M3XA 4B9LA 4N47A 1I39A 1RTJA 3VQEA 1NKBA 1ZBHA 2OPSA 4NCGA 4M3YA 1KFDA 4ID1A 4CGGA 4HUFA 3L2RA 1WSFA 2IOCA 2FBTA 2HNZA 4FK0A 5HBMA 2JLEA 3O3GA 1NJYA 4DQRA 4QAGA 4CECA 3OJUA 3S3NA 3F73A 2OPRA 4B8CA 2DY4A 2HHUA 3SQ1A 3OYEA 4B3OA 4FJXA 2HHVA 1KLNA 3B6OA 3NDKA 3L2UA 4E7IA 3O4NA 4DTNA 3RMCA 3ZSWA 3OYAA 4E1MA 4FM1A 3HSTB 1SUQA 5CYMA 4CEZA 3V9WA 3LZIA 1NJXA 3T19A 3HO1A 3SUOA 3MXIA 2B6AA 3AVMA 2RPIA 3KIOA 3SYZA 1SKWA 1Y97A 3C6TA 2VG7A 4M3WA 1B92A 1RT5A 5EU7A 4CK1A 3OYBA 2F96A 1NJWA 1I3AA 4B9TA 2DTUA 4OGEA 4O0IA 4LY7A 3LZJA 2G8HA 3ULDA 3DRPA 3MECA 1RNHA 3RMBA 2GUIA 3LPUA 4Z4CA 4C8MA 1JLFA 3NBPA 1VSKA 3OYGA 4CFCA 3DOKA 3QLHA 4KI4A 3NH2A 1T03A 3CFRA 4CGDA 2W42A 1CZ9A 1JL2A 3LP2A 3OYHA 1VSMA 1SL2A 1J5OA 3ALYA 3AO3A 3QNOA 1BISA 4N56A 2KTQA 1S1TA 1BI4B 1RBTA 3OYCA 4OKEA 1U48A 4CJRA 1ZBIA 4FJNA 1S1UA 3BGRA 4BDZA 4DTMA 3NE6A 1A5VA 5CZ2A 1XI1A 4DWIA 4CEDA 3RRHA 3T3FA 3WNEA 1JKHA 2YNGA 4W5QA 1LAWA 1NKCA 5HLFA 4I9LA 4DQQA
chains in the Genus database with same CATH superfamily
2P9PB 4CHYA 4DF8A 5SZTA 5FPEA 4ELTA 4V19S 3OBWA 2E1ZA 3THXB 4ILGB 4O8KA 3TAEA 3SUNA 4YOUA 5AQQA 4EIAA 4HTLA 1Q9YA 4WFBL 3ZSVA 3HOSA 3NGIA 4OPHA 3TAFA 1NNEA 2F4VK 4FJ9A 4YOXA 2Q36A 3FLCO 4FW1A 3T1YK 4DV7K 3TAGA 3VA3A 2O8BA 2YJFA 3O08A 3QESA 4G9ZA 3TAMA 4BRCA 1YTAA 1VSJA 3RR8A 1C0GA 1CLQA 2VYPA 4UY8O 2HVIA 1DTTA 3SMPA 3OTOK 2B5JA 1JLAA 1LOTB 4XH5A 5BPLA 1NOZA 3K58A 1RDWX 4E7HA 1K8KB 4A2BA 3IUCA 5GAEP 5KGWA 3EZ5A 1TGOA 1CXQA 4JKGB 1C0UA 4OPJA 4EHTA 2P9SB 1S9GA 1VQLN 1RT1A 3MWPA 3LL3A 2HBMA 4F3OA 3F9MA 4JS5A 1LW2A 4KHQA 2FBYA 2FXUA 1D9FA 3MN7A 1HRHA 3G71N 3AVHA 3LAKA 1ASWA 1HKGA 3AAPA 4B9MA 2GX9A 4ELVA 2HHTA 3ZT1A 3TABA 3LAMA 4EFHA 3C65A 4DCHA 4YOTA 3V9ZA 4QCLA 2XY7A 4DTUA 5C2FA 3O4QA 4YOYA 4B1YB 3ENHA 2ZJQL 3SUQA 3NAEA 2A40A 3DLLL 1RDBA 3D45A 4JI5K 1GLCG 4FO0A 1EWQA 2HBJA 1FKPA 3PIOL 5IWAK 4B3MK 4C8OA 1WAFA 3H08A 3RTVA 4DV2K 3QIPA 4LH5A 4RWTA 2P5GA 3KVGA 3VQ7A 1NK5A 4K8XA 1ZBSA 4HVJA 3THVA 1VSDA 3OYLA 4M41A 3QEPA 2RN2A 4ZHRA 1Z05A 4A61A 3PV8A 1EO1A 4DR6K 3WXJA 1BCMA 3CJBA 3VF6A 4CJ3A 3TWHA 1NJIO 3SUPA 3L3UA 4J8FA 4BGAA 3SQ0A 4C8KA 1NG9A 5F0XA 4AQYK 1N32K 4TSXA 3HPOA 2ITGA 4OVLA 1YJ9N 1TVRA 4WFAL 3TAQA 3O9SA 3WXLA 2G8VA 1C1AA 3GBTA 4LSLA 1JXBA 5GINA 4MO5A 3SJHA 3QDKA 3LDLA 4FWMA 4L3QA 3DLEA 4Y1CA 5CY4A 1W7AA 5AZIA 3VQDA 5DK5A 3U3YA 1B9FA 4CZJA 3S3OA 3UE5A 3SNNA 5LL6Z 2XRIA 3SJJA 4JKBA 2HOEA 3J7ZO 2BTFA 1KFSA 3PX6A 4KBOA 3HPHA 4BRQA 1VSFA 3ZT0A 3UKUB 1OH7A 1T44A 1L3TA 3RRGA 1VQKN 2OZSA 3WXKA 3DLGA 1NGGA 4BRDA 1LV5A 3HXMA 1QSSA 4B9SA 3MN9A 4EP4A 1JLGA 3RR7A 1F21A 2Z1GA 5EX5A 4J2DA 2QWLA 4OJRA 1E3MA 1DEJA 1QZ6A 1WBDA 2AP1A 4WYBA 3AA3A 5AQTA 3CYMA 3KWGA 1TV6A 2Y1JA 2FSNA 2DPNA 4OO1J 2DFFA 3HOTA 3R1XA 4H0XB 4KAZA 3KK7A 4DTSA 1XHZA 2HVHA 5AQSA 3G25A 3PUFA 4LF5K 2WOMA 3TI0A 3MN5A 3KD5E 3MEEA 2GTDA 1QQOA 2NRXA 2F7TA 3SZ2A 1CZBA 3VENA 3MEDA 5HRSA 3A8YA 3FFKB 3D0PA 3THYA 3HI0A 1IKYA 3BF3A 2QEXN 1D8YA 3CI5A 4JV5K 2FC0A 3VMFB 2HHHK 1HLUA 5BR8K 2I7PA 5E26A 3O9TA 2O8FB 4IOAL 4CJPA 3MAQA 3BUZB 4FJMA 3UKRA 4E3SA 3M5RA 2JWLA 3G4SN 3OHRA 3EEQA 4DSKA 3ZEUA 2OANA 4PY5A 4CF8A 3B6PA 1ATSA 2BUPA 4CZEA 3TAPA 1QSYA 4JS4A 3ENOA 1TL1A 4DU4A 2ZD1A 1LWFA 3AA2A 4BC3A 3ZSQA 5BRHA 3NF6A 4C1NI 4F4KA 1JLEA 3NH1A 4BR4A 3KK3A 1KAZA 3VGKA 1XQSC 5ADXH 4PQUA 4BE1A 4BRFA 5KQ8A 3O1BA 2FF3B 2ASMA 1CZAN 1CXUA 1X3NA 2WBNA 1XWLA 4CJQA 4JNEA 3E1YA 4QS8A 2Q0RA 3DXKA 4R5PA 1J5EK 4IDKA 4JHDA 4QS7A 5AFUH 4YFUA 1DKGD 3JS6A 4DLEA 2I5JA 3S9HA 3PO4A 2NNWA 4OLBA 2EHGA 3MX5A 4O44A 3S41A 1TKZA 2YKMA 2HMPA 4CF9A 1HPZA 3K5NA 1OH6A 4XH1A 4FJ5A 3OYJA 4BRPA 4CW7B 1HYSA 1ZBLA 2P9PA 1VSEA 1BWFO 1NGFA 4CVNE 4A57A 3AVCA 3THXA 1QS4A 2CH6A 4DTPA 4DQ8A 5F2RA 2OTJN 4AH9A 3ATVA 3AVAA 3AV9A 3BDPA 1BIZA 4BE2A 1HQUA 3UB5A 5C25A 1XNQK 3VTHA 4GV9A 3ZT4A 4DSLA 1S9EA 3F5TA 4HTUA 3I56N 2YI1A 2KW4A 4Z94A 4YDUC 5HRRA 5M1OA 3C6AA 3M1FA 1O13A 2QI2A 2YHWA 3C95A 4RW9A 3DJCA 1GLBG 3OYKA 4H5WA 3RMDA 1NMDA 4EHUA 5FDLA 3VEZA 5I3UA 3MDQA 4BC2A 1OVQA 2VG6A 1RBSA 2RKIA 4N47A 1I39A 1RTJA 2OPSA 4CGGA 4PKIA 4EAHD 4WFNL 1W97L 3L2RA 1IBLK 2IOCA 5CHIA 3O3GA 1VQ9N 3MWTA 4BVPA 3S3NA 1IV0A 2HHUA 2ZJPL 3SQ1A 2D1KA 3OYEA 3AGKA 3KZBA 1KLNA 3QB0A 1K8KA 3O4NA 4PHTX 3THWB 1HUXA 3ZSWA 4R79A 2FF6A 4RCHA 3SUOA 1T6CA 3KIOA 3SYZA 3P31A 3WT0A 2VG7A 1B92A 4JKGA 1RT5A 5EU7A 1NJWA 2P9SA 2G8HA 2CGJA 4LY7A 3LZJA 3MN6A 3MECA 4U7BA 3RMBA 3LPUA 3O8MA 3CCQN 5BN9A 4BR0A 3HRGA 1JL2A 1SL2A 3IFRA 3ALYA 1LCUA 2KTQA 4NLBA 3EE9A 1RBTA 4OKEA 4GKKK 4CJRA 4YDUA 1YTUA 4DWIA 1XI1A 3RRHA 1NKCA 1ZBHA 2P9UB 4KREA 4DQQA 3SBTA 1TYQB 4E7JA 1BA0A 4IJNA 3P5JA 3QNNA 4MQ3A 3ZCMA 1WBBA 4O55A 3LDPA 3CETA 3IKMA 3ASMA 3V6DA 2QK9A 1NGEA 3OA9A 2OYQA 2XY8A 1NK6A 1KXPA 4X65K 1VQMN 4JAXA 2UU9K 5KRSA 1QVFM 2CGKA 1WUAA 1T6DA 3OW2M 2HNYA 2O8EB 3WQUA 4FLWA 4FVMA 1MWMA 4OGCA 3PO5A 3VERA 3P4IA 1BGXT 5J2NA 4FLTA 4JYAK 4DTXA 4IOXA 4CHQA 4I6MB 4LFAK 4FWPA 3FZFA 3K2PA 5J1EA 2NLXA 4IXCA 2IAJA 4LSNA 4CHPA 4O5BA 1BL3A 4KHSA 4XEIA 4BE0A 3VGMA 4IKFA 4LFCK 4OKKA 3KTQA 1NGIA 4KTZA 1P90A 2G8WA 4RW8A 2QA4N 3SBGA 4DU3A 5DM7L 3LDOA 3AARA 2O8CB 3CQ8A 2NRHA 2V7ZA 4CI6A 1SQKA 3KK1A 3I8DA 3RSEB 2UYTA 3SAHA 1KD1O 4JI3K 4WF9L 3NGZA 3AVJA 2YHAA 3AGRA 4DR4K 2V7YA 3C6HA 3UKUA 4KV8A 1D4XA 5AQXA 4BACA 4DG1A 4AHRA 5F1XA 1ESVA 4B8AB 3CCSN 1L3SA 3O80A 1KTQA 1OVYA 1NWKA 3SK3A 4BRMA 2QKBA 5M1NA 3A5NC 4B9UA 2UXBK 4HHTA 3KLHA 3P83D 3T1HK 1NBWA 2B4JA 2ZWHA 3NF8A 4FLZA 5AQLA 3CCRN 2HHWA 1X9MA 4DV1K 2BE2A 2Q3SA 4FJJA 4DR3K 5CYQA 4BRAA 1G15A 1V4TA 4Z4FA 1IG9A 4GKJK 3CCVN 4CFAA 3SI6A 5M1QA 3QFUA 4MFBA 3QBXA 4KHWA 4DR5K 4B1UB 1HKBA 3U9ZA 1QQMA 3CQXA 5KI6A 3CXCM 3QO9A 2OTLN 4H0YB 2F9WA 1BUPA 3CJCA 2D0PA 4MDAA 3LP3A 2Z1JA 2WUSA 4DTOA 3HTVA 3OYMA 5HL7L 3KLEA 1GLLO 1KRPA 2E6MA 4DU1A 3LDNA 4IDHA 5KTQA 2P9KB 2O8FA 1L3UA 3BZKA 3AA4A 5TKYA 3E01A 3CJ9A 1ILYA 2G8KA 3M6GA 3OYIA 4C8LA 4B08A 2QWOA 2IVPA 5LJWA 4AHUA 3LDQA 4Z4EA 4BG8A 4B1VA 4A59A 1V4SA 1K8AO 1S5JA 5AQZA 3L4IA 3V81A 5IT9O 1P8ZA 4Y1DA 3DLBA 3P1GA 4JI7K 4F3TA 2NUBA 3EYZA 3K5OA 5BPMA 1HYZA 1FJGK 2P1JA 4J2EA 1RT4A 1FKOA 1WSGA 2R7YA 2PAVA 1VQ5N 2IGIA 3VQBA 4BR5A 3HVTA 4FLYA 1C1BA 3ZYYX 5JMVA 1J6ZA 1VRTA 3D2FB 4KHPK 1S3XA 3TTFA 2XO7A 2A42A 3EE8A 1W2BM 3HL8A 4B1ZA 4CGJA 2ZE2A 1OH8A 1U45A 5HP1A 4DS5A 2ZJRL 4E0DA 4BC5A 2E2OA 4CJFA 3ZETB 1SL0A 4CHNA 1U2VB 3GOIA 3O3FA 1N5YA 1C1CA 1NK0A 4K8ZA 3VGLA 3J8AA 3HVRA 1T8EA 3L2QA 4RW7A 1GOCA 5GAGP 2KFNA 3KWIA 1NKEA 5AQWA 1RFQA 1L5UA 1SV5A 1JLQA 3CMAN 1C0FA 4CK2A 2VGMA 3HP9A 4PKGA 2FBVA 4H0PA 4H5VA 1J54A 5AQRA 3F2KA 2X6SA 5EY4A 3I8BA 2DFHA 2WTUA 1S1VA 4FLUA 1NK9A 5H1SQ 1YUWA 1C0TA 2A5XA 3A2FA 3AVLA 4YHHK 3WEEB 4JI4K 3OJSA 4CJ5A 3CD6N 4CJ7A 4NYFA 3FZKA 3ULEB 1REVA 2IDOA 3TU5A 4W5OA 2E2QA 3LPTA 1O1WA 3HPGA 1MU2A 4BRLA 3FZHA 4JRPA 4CGHA 1EP4A 3UIQA 3T1AA 3M8QA 3LP0A 1YIJN 3OYDA 2UUAK 3MXJA 1KLMA 4H4MA 1A5XA 3THWA 3SV4A 3QBWA 4E7LA 1ZBFA 5GADP 1VSIA 1YVUA 3U3GA 3BZCA 2BGGA 1X9JA 4CJUA 4OX9K 4DFKA 5BREA 1X3MA 2WC9A 1XNRK 3H1QA 1LW0A 4JLHA 1BU6O 2Q0UA 2E4LA 4E1JA 1WN7A 1ZXOA 4FLXA 3HM9A 4QOZB 3VQ5A 3DWLA 4OPAA 4IG3A 1X9SA 4FJKA 3ZX2A 1A5WA 3EN9A 4DB3A 4CF1A 4UQGA 4I2QA 3VEXA 4PWDA 4FWKA 1K9MO 3ZSXA 4Z4GA 2P9UA 2HMIA 4JK9A 4KHNA 4MLHA 3OS2A 4BG9A 1TYQA 4JKEA 2NRVA 1RGIA 1XC3A 2PFUA 4CF2A 3CPWM 3S3MA 1U04A 4B9QA 1VQNN 1NM1A 1ATNA 2A1SA 4E89A 1GOAA 2D0CA 3VQ4A 5KPZA 5FROA 2VCPA 3VETA 1XUPO 3SAGA 1IJJA 4K42A 5E41A 1JLCA 4H0TB 5B8HA 1TKTA 5TKWA 5KRTA 4B3RK 1RDDA 2WONA 4IBNA 1JCGA 3VQ6A 4JD2B 1S22A 4CIFA 3K59A 4WE1A 1N34K 2HF3A 3HYFA 5BR9A 4FZYA 4CEEA 1NK8A 1BO5O 5KQDA 2O8EA 3L2VA 1HNIA 2I7NA 3IAYA 1K73O 4MLEA 1BQNA 2YCHA 4FZXC 3VQAA 4GW6A 3O5BA 3DLKA 1YF5L 3CJAA 2GELA 5C12A 1Q18A 4IO8A 1KFDA 4M3YA 4I6MA 2D4WA 1WSFA 2FBTA 2JLEA 4B1WB 4QAGA 5AQGA 4FOIA 4CECA 4BRNA 3N4PA 4B3OA 5AQFA 3FGUA 3B6OA 4YOWA 3L2UA 4DUYK 2WFBA 4E1MA 5CYMA 3V9WA 3R3LA 3AVMA 5AQNA 2RPIA 1VQON 1Y97A 3FE1A 4M3WA 3OYBA 5ADXA 4CK1A 4B9TA 4WQ5C 1M90O 2DTUA 4O0IA 4LF9K 2UUCK 1RNHA 4C8MA 1GLEG 3D2EB 1VSKA 1N33K 2O8CA 3VEWA 2RHKA 4WQ4C 4IOCL 1CZ9A 1ATRA 3RSEA 4N56A 5AFUA 1S1TA 1BI4B 3OYCA 1U48A 1G99A 3W3DA 3BGRA 1QHAA 1GLJO 1GLDG 3T3FA 1HNWK 1LAWA 4CCHA 5HLFA 4I9LA 1J53A 3J80O 1TKXA 4FOEA 2AA4A 4BWJA 1Q81O 4I2PA 4CJSA 1RDUA 1Z6RA 4CESA 4KRFA 3VPZA 1N8RO 1SAZA 4FVUA 4A62A 2ZGZA 4NCBA 1LAVA 4FWLA 2YHXA 4NB4A 1U47A 1S1XA 1TKDA 5D3GA 1HQEA 4ELUA 3Q7CA 2YJEA 1JJ2M 1UA1A 1FXXA 3SCXA 4NO7A 2Z1IA 3C0BA 3PY8A 3ZLJA 4OKJA 2JWKA 1KAYA 3GE1A 4WQ5A 1RDCA 3G10A 1LWCA 4H8KA 4YY3K 2VQFK 5C42A 1N36K 1BIUA 4WQ4A 1EXQA 1U49A 3TANA 2ZQBA 1NK7A 4AM6A 4DQSA 3WNGA 1UA0A 4ZTJA 1TK0A 3IS9A 1WAJA 3M3ZA 2KHOA 3R9PA 4DUZK 2W40A 3NGYA 2P9NB 4BDPA 4M42A 4CJVA 4LF4K 4KH4A 1KC8O 4O4GA 3DRRA 2P9KA 2PZSA 1QE1A 4FK2A 4K43A 3AVIA 1ZYQA 3OYNA 3JYTA 4YNQA 4DV3K 3G0ZA 4FWOA 1ASVA 4DFJA 4JKCA 1HPMA 4ISEA 2GUPA 2Q31A 3KLFA 5GIOA 4FJGA 3KLIA 3L8BA 3PSFA 5M1PA 3GL1A 3RWUA 1XC9A 2QWQA 3ZSYA 4W5TA 4DR1K 3WQTA 4QS9A 3AVBA 3C94A 1L3VA 4BRHA 2QTDA 1HNZK 3HJFA 1VRUA 1IKVA 1S72N 3FR0A 3J7YP 1C6VA 3HP6A 3CM5A 5GAHP 1IG8A 3L2WA 2H3GX 2Q2RA 3CCEN 3HSCA 1U6ZA 4KB0A 4H0VB 3O3HA 1SKRA 1RILA 2LSNA 3TSUA 4JKHA 4AM7A 3AVFA 4AHCA 1UAXA 3L4QA 3C6UA 4CD1A 4X62K 2GWKA 5CZ1A 3D2FA 2HNDA 4CGFA 2P5OA 3IRXA 2IIRA 1GOBA 4CJ4A 5DM6L 1Z25A 3U6FA 3K5LA 1YAGA 5LMNK 1U2VA 1BDGA 4FWSA 1SZ2A 2A41A 1RBUA 2KQ2A 1WSIA 3CJ1A 3DXMB 4CIEA 5AQOA 3TSPA 2FSKA 4H0OA 3QEVA 4FWQA 4CZIA 4PUOA 4IO9L 2G8IA 1Q7YO 4CZKA 4ICLA 2QWNA 1HJOA 1VSHA 1X1PA 3AVKA 4DV4K 3DMJA 4M7YA 2Q97A 3A5MC 3T69A 4JKFA 2VQEK 4DFMA 3SLCA 4B3TK 2EX3A 1E4FT 1JXEA 1WNSA 3V1OA 3VN5A 4CEQA 4HCBA 2BANA 4JI1K 3C7NB 4E19A 2YNFA 3RVCA 3WEEA 3AVNA 5AQHA 1GLFO 5BPNA 1WSEA 3ULEA 4MO4A 4CF0A 4FJIA 4CERA 3M8SA 1N6QA 3VQ9A 2DFEA 4B1XB 2E8AA 1XMOK 4CHZA 4KHYA 4ISGA 3MEGA 5AQPA 3JSMA 2GV9A 3QMLA 4PA1A 5HOOA 4WCEL 3VQCA 1YITN 3NF9A 4NYNA 1YJNN 2HSTA 2P9LB 1D5AA 3TTCA 4I9QA 4RTFD 2IS3A 4CEOA 3CG7A 3LWMA 1WLJA 1VQ4N 4FJ8A 4YOVA 2VG5A 2HBKA 1IKXA 1Q9XA 5J2MA 5AJ3K 3CERA 3LALA 1Z26A 3DAWA 3ID6A 2VWJA 4RG8A 1KVBA 2PYJA 3V4IA 2NZTA 4HWIA 5AQVA 5A2QO 2ASPA 2XHBA 4B9NA 1B9DA 2HW3A 1KVAA 4GNIA 3HT3A 4FJHA 2D0AA 2QWRA 3BP8A 5JS2A 4AHSA 3OS1A 5CE3A 4JN4A 1HKCA 1VK0A 2VGNA 1VQ7N 3O9UA 2KFZA 3TSQA 5LMUK 4N41A 1EQYA 3DOLA 5I9EB 3VF4A 3KLGA 3ZX3A 2IVNA 2A1RA 4CK3A 2E2PA 4M7XA 4FJ7A 3H45C 4DV5K 3CC4N 5JICA 3LP1A 2G8UA 3QINA 2X6NA 3QICA 3OY9A 4IFVA 1T05A 2NRTA 4FLVA 5C10A 3H1VX 4JD2A 4DFPA 1TAQA 4Q0BA 2E1YA 4FK4A 3AO5A 4GVEA 1IBKK 3QFPA 1TUUA 4CJKA 5M1KA 1NOYA 1XHXA 3MK6A 1BOTO 2YKNA 3CJ7A 1E4GT 2O4GA 1YXQA 5LJVA 3HK2A 4DR7K 3CF5L 1VQPN 1QSLA 3NMUA 4FWNA 1NJZA 3NH0A 1RT7A 5FRMA 1DT9A 4DV0K 2HBLA 3CCMN 4GY2B 1EETA 5C24A 1SL1A 3E9LA 1BG3A 1ASUA 1BA1A 4M63C 4KKOA 4CD3A 3O4WA 4NXNK 4BR2A 2OA8A 4IFEA 2BDPA 2E6LA 3V1RA 5JVGL 4FJLA 3QETA 2QKKA 3CCUN 1HJRA 3D7EO 1MWKA 4IJAA 3G6EN 4AF1A 1UWBA 3OS0A 4K41A 4CIGA 3I55N 2E5LK 3D2EA 3MCAB 4CZLA 2Z1HA 3OYFA 1DTQA 3LM2A 3IG1A 4M3ZA 1JCFA 2O8DB 4CGIA 4GVMA 1BI4A 4KI6A 3Q7BA 5I42A 2VWBA 2ETJA 2RE2A 4CE9A 2PYLA 4EZ9A 3M8RA 5BRFA 3H6EA 4A5AA 5AQKA 2RF2A 1RDAA 1W0HA 4C1NK 1FK9A 2G8FA 2HHQA 3QEWA 4HUGA 3VEOA 3L0QA 4FM2A 4CJLA 1HYVA 4C23A 4KB1A 3WNFA 1IH7A 3A5LC 4DSFA 4CJEA 4IWVA 3ZX0A 2KLAA 4LF8K 2VWKA 4CEAA 1NGHA 1KVCA 3ZT3A 4JKDA 4CFBA 2UXCK 4B9VA 4MDBA 4NXMK 4CZHA 3DLHA 3NHGA 2W6KA 4ILJA 4EP5A 3CMEN 2KZZA 3V9XA 1D9DA 3PIPL 2JGUA 2FLOA 5FPMA 4CBUA 1OH5A 2E20A 2A3ZA 2OZMA 3T7ZA 4M3XA 4B9LA 4IEEA 3VQEA 2YX6A 3WUHA 5E84A 5AQIA 3IDHA 4CZMA 1MDUB 1M1KO 2ASOA 2HHVA 3NDKA 1HNXK 2FSJA 3OYAA 2GWJA 3HO1A 4CEZA 2P9NA 2P9IB 5EOYA 3LZIA 1NJXA 3T19A 3SAFA 1YVNA 4X64K 1NGCA 2B6AA 1SKWA 1I3AA 3U4LA 4OGEA 4BQZA 3ULDA 1EWRA 2GUIA 4CBWA 4Z4CA 3NBPA 2W41A 3OYGA 3DOKA 2ZF5O 5AZJB 3WXMB 4JI8K 3NH2A 4KI4A 5C0YA 1T03A 3CFRA 5EXWA 4CGDA 2W42A 3LP2A 3J81O 3VESA 1BISA 1OKJA 2HF4A 4BVOA 4JKAA 1ZBIA 5FPNA 1S1UA 2QWPA 4FPAA 4DTMA 3CQYA 5CZ2A 3NE6A 4ISFA 2PBDA 2UXDK 1TK5A 1NMNA 3HBTA 4RW4A 2PY5A 3ITHA 2F8SA 3E66A 1ZC6A 3NCIA 3A0IX 4JEPA 4EZ6A 5KPRA 3DLRA 4N76A 3ISNC 2OPQA 4J2BA 4KPYA 4KHUA 3KKRA 4E1NA 1NK4A 4FL9A 4M45A 3CIPA 5KGXA 2F9TA 4A5BA 5HRNA 3PX0A 4FM0A 1KSPA 3KHYA 3I33A 3PSIA 1GLAG 2KZMA 1YT3A 4BDYA 4G1QA 3EKSA 1HNVA 3K0SA 1ITGA 2D5RA 2F8TA 1QZ5A 3AY9A 3DXMA 1UOCA 4F8RA 2YHYA 4H5RA 3H3NO 1YI2N 5AQUA 3ID8A 1HMVA 1BCOA 3NF7A 4CZGA 3K57A 3TR8A 5CR4A 3EKUA 4DR2K 4LH4A 3CFPA 4FXDA 2ZGYA 1JL1A 4F9OA 2W6LA 5BRDA 5M1FA 3H46O 2QXFA 5GIPA 2X74A 4NCAA 3E9PA 2IVOA 1FW6A 4PL7A 4DQPA 3C7NA 1YHQN 4DTJA 4FYDA 4FCYA 4JI2K 3L6QA 4DTRA 3LDSA 2V52B 2EWSA 3KD1E 4FW2A 2ITMA 4ZTFA 4KTQA 5C2DA 2ZM6K 3PLAA 2ATQA 3VEVA 3AO1A 1Q82O 4L8RB 3NVMA 1IKWA 5T7BA 4J2AA 4O8UA 2P9LA 1SS6A 4FWRA 1QVGM 4DMNA 4BY9C 4H5TA 2NRRA 3GG4A 4XIUA 2NRZA 3R6MA 4Y0WA 1R59O 4AILC 3BEXA 3CHWA 3O9RA 3BF1A 1WSHA 2OCEA 3LM9A 2XY6A 5AQMA 5AQJA 4E7KA 5HRPA 4F2SA 1Y64A 2GEMA 3K9JA 1EX4A 3EZWA 4BGBA 3MX2A 2V51B 4IEIA 2CGLA 5DMRA 5KPTA 1TAUA 3VQPA 5J2PA 3AVGA 2HHSA 4DKWA 3RMAA 1TL3A 4PL8A 3I0SA 3V9UA 3DYAA 3WNHA 1NLVA 1VSLA 2O8BB 4JI0K 3KKSA 3O6WA 4HUEA 4NLCA 3P38A 1I94K 3AAQA 1QQCA 2QW9A 3SV3A 3D6RA 4FPBA 3BY5A 4LFBK 4CHOA 5FPDA 4GMJB 4K0KK 3TPQA 3EY1A 4CZFA 1EKEA 1Q86O 4BQLA 3P39A 3L3VA 3NFAA 4ID5A 2KKZA 5ELZA 1KAXA 4BRIA 4FZZA 3VTIA 4W5NA 4BREA 3W0LA 1VHXA 1WB9A 3CPEA 1RTDA 4JRQA 5LY3A 1QQNA 4N5SA 1YJWN 5AQYA 4DV6K 2J4RA 4HCCA 4JK8A 2FBXA 1IBMK 3V1QA 3ZSRA 3VQ8A 5JVHL 1RT2A 4H4OA 1RTIA 3FFIA 4BRKA 3SPZA 4KO0A 3MXMA 1X9WA 4BR7A 3ZSZA 3ZSOA 4C8NA 4LF6K 3IMXA 2A6AA 4DLGA 4DS4A 3MCPA 2XY5A 4X66K 3VA0A 4M3TA 3SQ2A 2OPPA 3QEXA 3EL2A 1RCHA 2P51A 4KH5A 3LWLA 4I7FA 3H3OB 3KK2A 5AR0A 3QIOA 2O8DA 1MA9B 2Q1NA 3ATUA 5JS1A 2BH1A 3O9QA 1J9AA 2YV0X 2QM1A 4M3UA 4Z0UA 3DM2A 4RW6A 4OPKA 4IFYA 5FRNA 3V9SA 3M8PA 3PX4A 4BRGA 4H03B 4CFDA 2YHBA 3AO4A 3SMSA 2HB5A 4KTWA 3QERA 4DQIA 4YORA 4CJTA 1RT3A 1W9HA 3MMVA 4KFBA 3CM6A 3LANA 3OVNA 4Z4HA 1RT6A 5C15A 2Y1IA 3I0RA 1C0MA 3VQQA 1R0AA 1IO2A 3GDQA 4DSIA 4KH6A 4DHYA 3CCLN 3ZETA 4CJWA 2QXLA 1WSJA 5AZIB 5J2QA 3EO3A 3FZLA 1LWEA 3JAMO 3KJVA 3SQ4A 4CEBA 3O1WA 3JXUA 2HHXA 2E88A 1NGBA 4IZ9A 3SPYA 2AJQA 5EVZA 3TARA 1WOQA 2GBZA 1TK8A 4PKHA 3QEIA 4CBXA 1BHLA 1S6QA 2P9IA 3DI6A 5SWMA 4W5RA 3AO2A 4IG0A 1RBRA 3HZ6A 1T7PA 3K5MA 3OBYA 1S6PA 5K14A 4LF7K 3FZMA 3WXIA 4BROA 3TTDA 1QTMA 5AZJA 1KQSM 1ZBUA 3DRSA 3CC7N 1HX1A 4GV3A 1H1VA 4B3SK 4AHTA 4JI6K 4LD0A 1HR0K 1DGKN 4DSEA 3U9DA 2QWMA 5HROA 4DF4A 4ILHA 3E9OA 2YNHA 4O0JA 1RBVA 4F2RA 2O4IA 3CFOA 3U8XA 4O5FA 1U4BA 1Q8IA 5JLFA 3THYB 4AHVA 2X78A 3A5OC 1S1WA 4U67L 1VQ6N 4DSJA 3F9KA 2D0BA 1RTHA 4K25A 1QHTA 2E2NA 4CEFA 4Q5VA 4H5NA 4JK7A 1VQ8N 1K6YA 3ZT2A 3AA5X 2UUBK 4BC4A 3UKRB 1NU0A 3VOVA 1JLBA 4M3RA 4Z4IA 2YNIA 4OLAA 4FSVA 3ZEUB 3R8EA 2IC3A 3CCJN 3N4QA 3NVKA 1BQMA 3B8AX 5BN8A 1DLOA 1KCFA 1T3VA 4LC9B 4BWMA 1NGJA 1NKBA 4NCGA 4ID1A 4HUFA 2HNZA 3VEYA 4FK0A 5HBMA 1NJYA 4DQRA 2DY4A 3OJUA 3F73A 2OPRA 4B8CA 1NGDA 4FJXA 1XMQK 1JCEA 3VF2A 4E7IA 4DTNA 3RMCA 1SKSA 4FM1A 2NRWA 3HSTB 1SUQA 3HM8A 3MXIA 3C6TA 3DXKB 2F96A 4JHDB 4A2AA 3ENBA 1TUYA 3DRPA 4BR9A 3J7AP 1JLFA 2D0OA 5JLHA 1NGAA 4CFCA 3QLHA 2CH5A 4GV6A 5MLCQ 3OYHA 1J5OA 1VSMA 4XH4A 3K9KA 3AO3A 3QNOA 3CC2N 4FJNA 4BDZA 1A5VA 5FLXO 4CEDA 3WNEA 1JKHA 2YNGA 4W5QA 1VAZA
chains in the Genus database with same CATH topology
1TK5A 4CHYA 1J53A 4DF8A 5SZTA 4E7JA 1TKXA 4RW4A 4ELTA 3P5JA 3QNNA 4BWJA 4MQ3A 3ZCMA 4I2PA 4CJSA 4O55A 4CESA 4KRFA 3TAEA 3SUNA 2PY5A 3ASMA 4NCBA 3ITHA 1LAVA 1Q9YA 2F8SA 3NCIA 3V6DA 2QK9A 3ZSVA 3NGIA 3TAFA 4EZ6A 3DLRA 4N76A 3ISNC 2OYQA 2OPQA 4J2BA 4KPYA 4FJ9A 4KHUA 2XY8A 3KKRA 4E1NA 1NK4A 1U47A 1NK6A 4M45A 1S1XA 1TKDA 5KGXA 5KRSA 5HRNA 3PX0A 5D3GA 1HQEA 4ELUA 4FW1A 3TAGA 4FM0A 1KSPA 3VA3A 1UA1A 2KZMA 2HNYA 1FXXA 3SCXA 2Z1IA 4FLWA 1YT3A 4FVMA 3PY8A 4OKJA 4BDYA 4G1QA 3QESA 1HNVA 1ITGA 2D5RA 4OGCA 1RDCA 3PO5A 3G10A 2F8TA 1LWCA 1UOCA 1BGXT 5J2NA 3TAMA 4FLTA 4H8KA 4F8RA 1YTAA 1VSJA 4DTXA 3NF7A 1HMVA 1BCOA 5C42A 4CHQA 3K57A 3TR8A 3RR8A 1BIUA 1CLQA 1EXQA 1U49A 2HVIA 1DTTA 2B5JA 3TANA 2ZQBA 1NK7A 3K2PA 4DQSA 4LH4A 3CFPA 4FXDA 3WNGA 1JLAA 5J1EA 1UA0A 4ZTJA 1JL1A 1NOZA 2IAJA 4LSNA 1TK0A 3IS9A 1WAJA 4CHPA 3K58A 4O5BA 4E7HA 1BL3A 4KHSA 3NGYA 4BDPA 4BE0A 4M42A 2QXFA 5KGWA 4CJVA 3EZ5A 2X74A 4IKFA 4OKKA 1TGOA 4NCAA 4O4GA 3DRRA 2PZSA 3KTQA 1CXQA 4KTZA 1C0UA 4OPJA 4DQPA 1QE1A 2G8WA 1S9GA 4FK2A 4RW8A 3AVIA 1ZYQA 3OYNA 3JYTA 4DTJA 4FYDA 4FCYA 4YNQA 1RT1A 3G0ZA 4DU3A 4DTRA 1ASVA 4DFJA 3CQ8A 3KLFA 3LDSA 4F3OA 4FJGA 4JS5A 3KLIA 1LW2A 3KK1A 3L8BA 3I8DA 4KHQA 2FBYA 3KD1E 1D9FA 4FW2A 1XC9A 1HRHA 3RWUA 4ZTFA 3AVHA 4KTQA 3LAKA 1ASWA 3ZSYA 4W5TA 3NGZA 3AVJA 2YHAA 4B9MA 4ELVA 2HHTA 3ZT1A 3TABA 2ATQA 3AO1A 4KV8A 3AVBA 3C94A 4L8RB 1L3VA 3LAMA 1IKWA 4BACA 4DG1A 5T7BA 3V9ZA 3HJFA 1VRUA 4J2AA 1IKVA 4AHRA 4QCLA 2XY7A 4DTUA 1C6VA 4B8AB 4DMNA 3HP6A 3O4QA 3CM5A 4XIUA 3L2WA 1L3SA 1KTQA 3SUQA 3NAEA 4AILC 2QKBA 1RDBA 3D45A 4KB0A 3O3HA 1SKRA 1RILA 4B9UA 4HHTA 1WSHA 2XY6A 2LSNA 3AVFA 4AHCA 4E7KA 1FKPA 4C8OA 5HRPA 1UAXA 4F2SA 3C6UA 1WAFA 3H08A 3RTVA 1EX4A 3KLHA 3P83D 3QIPA 5CZ1A 2HNDA 4CGFA 5DMRA 4LH5A 2B4JA 2P5OA 3IRXA 3NF8A 2P5GA 1GOBA 3VQPA 1TAUA 3VQ7A 4FLZA 1NK5A 4K8XA 5J2PA 3AVGA 4HVJA 3THVA 2HHSA 4CJ4A 3RMAA 1TL3A 2HHWA 1X9MA 1VSDA 3OYLA 3I0SA 2BE2A 4M41A 3U6FA 1Z25A 2RN2A 3V9UA 3K5LA 3DYAA 2Q3SA 3WNHA 3QEPA 4FJJA 1VSLA 5CYQA 3KKSA 1G15A 4HUEA 4ZHRA 4Z4FA 3PV8A 1IG9A 1RBUA 2KQ2A 1WSIA 1BCMA 4CJ3A 3TWHA 4CIEA 4CFAA 3SI6A 1QQCA 3QEVA 4MFBA 4KHWA 4PUOA 3SV3A 2G8IA 4ICLA 3SUPA 3L3UA 1VSHA 4CHOA 5KI6A 4GMJB 1X1PA 3AVKA 3QO9A 3SQ0A 4C8KA 3EY1A 1EKEA 4TSXA 3DMJA 3HPOA 2ITGA 3L3VA 4OVLA 3NFAA 3LP3A 2Z1JA 1TVRA 4ID5A 4DTOA 3TAQA 3OYMA 3KLEA 2G8VA 1KRPA 2E6MA 4DU1A 1C1AA 4DFMA 4LSLA 1HYSA 2EX3A 1JXBA 1JXEA 1WNSA 3V1OA 3VN5A 5KTQA 4FZZA 4CEQA 4HCBA 4W5NA 2BANA 1L3UA 4E19A 3AA4A 2YNFA 1RTDA 4JRQA 3AVNA 3DLEA 4Y1CA 5CY4A 3E01A 4N5SA 3VQDA 5DK5A 3U3YA 2G8KA 1B9FA 1WSEA 4CF0A 4FJIA 4CERA 3S3OA 3M8SA 4CCHA 3SNNA 4HCCA 3OYIA 1N6QA 4KHNA 3VQ9A 2XRIA 4B08A 2DFEA 2FBXA 3SJJA 4C8LA 2BGGA 3V1QA 3ZSRA 4CHZA 4AHUA 1KFSA 4KHYA 3PX6A 4Z4EA 3MEGA 3VQ8A 3HPHA 1VSFA 1RT2A 3ZT0A 3JSMA 2GV9A 4H4OA 1S5JA 1RTIA 3FFIA 4PA1A 1L3TA 3RRGA 3SPZA 3MXMA 4KO0A 3VQCA 1X9WA 2OZSA 3NF9A 1LV5A 3DLGA 4NYNA 3V81A 3HXMA 4Y1DA 1D5AA 1QSSA 3DLBA 4B9SA 4I9QA 4EP4A 1JLGA 2IS3A 3P1GA 3RR7A 4CEOA 3CG7A 3LWMA 1WLJA 1F21A 3ZSZA 2Z1GA 2NUBA 4C8NA 3ZSOA 3EYZA 4FJ8A 4F3TA 3K5OA 1HYZA 2VG5A 4J2DA 2P1JA 4J2EA 1RT4A 4OJRA 1IKXA 4DLGA 1YTUA 4DS4A 1Q9XA 5J2MA 1FKOA 1WSGA 2XY5A 3LALA 1Z26A 2R7YA 2VWJA 4RG8A 1KVBA 2PYJA 3VA0A 4M3TA 3V4IA 2IGIA 3VQBA 3SQ2A 2OPPA 3HVTA 1C1BA 4FLYA 3AA3A 3QEXA 3CYMA 1RCHA 1VRTA 2P51A 3LWLA 4I7FA 1TV6A 2Y1JA 2XHBA 2XO7A 4B9NA 1B9DA 3KK2A 2HW3A 2DFFA 1KVAA 3HL8A 3QIOA 2ZE2A 4CGJA 3HT3A 4FJHA 2D0AA 5JS2A 4AHSA 1U45A 4KAZA 5HP1A 5JS1A 3OS1A 4DS5A 4DTSA 1XHZA 1VK0A 4E0DA 1J9AA 2YV0X 2HVHA 4M3UA 4Z0UA 4CJFA 3DM2A 3PUFA 4RW6A 4CHNA 1SL0A 2WOMA 4OPKA 4IFYA 3TI0A 2KFZA 5FRNA 3O3FA 3KD5E 3V9SA 1N5YA 1C1CA 3MEEA 1NK0A 3M8PA 3PX4A 4K8ZA 4N41A 3HVRA 1T8EA 3L2QA 4RW7A 1GOCA 3SZ2A 3DOLA 1CZBA 2KFNA 3MEDA 4CFDA 5HRSA 3D0PA 1NKEA 1L5UA 1SV5A 2YHBA 1JLQA 3AO4A 3KLGA 4CK2A 2HB5A 4KTWA 3QERA 1IKYA 3HP9A 4DQIA 2A1RA 1D8YA 4CJTA 4CK3A 1RT3A 1W9HA 2FC0A 4FJ7A 2FBVA 4KFBA 1J54A 2X6SA 3CM6A 3LANA 3OVNA 4Z4HA 1RT6A 2Y1IA 3LP1A 2DFHA 2G8UA 3QINA 2X6NA 3OY9A 3I0RA 4IFVA 1T05A 4FLVA 1C0MA 1S1VA 4FLUA 1NK9A 3VQQA 4CJPA 3MAQA 4DFPA 1TAQA 1R0AA 4FJMA 1C0TA 4Q0BA 4FK4A 4E3SA 1IO2A 3AO5A 3A2FA 3AVLA 4DSIA 4DSKA 4CJWA 1WSJA 5J2QA 3OJSA 4PY5A 4CF8A 4CJ5A 4CJKA 3B6PA 4NYFA 1NOYA 1REVA 1XHXA 4KREA 1LWEA 2IDOA 3KJVA 3SQ4A 2YKNA 2O4GA 4CEBA 3HK2A 3TAPA 1QSYA 4W5OA 3LPTA 1O1WA 4JS4A 1QSLA 3HPGA 1TL1A 2HHXA 4DU4A 1NJZA 3NH0A 2ZD1A 1LWFA 3AA2A 1MU2A 1RT7A 5FRMA 4JRPA 4CGHA 1EETA 1EP4A 3ZSQA 3SPYA 5C24A 3NF6A 3UIQA 1SL1A 4F4KA 2AJQA 3T1AA 1JLEA 3NH1A 3M8QA 3LP0A 1ASUA 3KK3A 3OYDA 4KKOA 3TARA 3MXJA 4PQUA 1KLMA 2GBZA 4H4MA 4BE1A 1TK8A 1A5XA 3QEIA 3SV4A 4E7LA 1ZBFA 1BHLA 1S6QA 1VSIA 1CXUA 1YVUA 3DI6A 3U3GA 4CJUA 5SWMA 4W5RA 2OA8A 4DFKA 1XWLA 3AO2A 4CJQA 4IG0A 2BDPA 1RBRA 2E6LA 3V1RA 4FJLA 3QETA 4R5PA 1T7PA 1LW0A 4JLHA 2QKKA 1HJRA 4IDKA 3K5MA 1UWBA 2E4LA 1S6PA 3OS0A 5K14A 1WN7A 4CIGA 4FLXA 4YFUA 3S9HA 4DLEA 1SKSA 2I5JA 3PO4A 1QTMA 3HM9A 4OLBA 2EHGA 2Z1HA 3OYFA 4QOZB 1ZBUA 1DTQA 4O44A 3DRSA 3IG1A 1TKZA 2YKMA 3VQ5A 4M3ZA 4IG3A 1X9SA 4CF9A 4CGIA 4GVMA 4FJKA 1A5WA 1HPZA 1BI4A 4AHTA 3K5NA 4FJ5A 5I42A 4KI6A 3OYJA 4LD0A 4CF1A 4UQGA 2ETJA 4I2QA 4PWDA 4DSEA 5HROA 3ZSXA 4DF4A 4Z4GA 4O0JA 2YNHA 4CE9A 1ZBLA 1RBVA 2HMIA 2PYLA 4EZ9A 1VSEA 3OS2A 3M8RA 4F2RA 3CFOA 2O4IA 4CF2A 1U4BA 2RF2A 1RDAA 1W0HA 3AVCA 3S3MA 1FK9A 1Q8IA 2G8FA 2HHQA 4AHVA 1U04A 2X78A 4HUGA 3QEWA 4FM2A 1QS4A 4DTPA 1S1WA 4CJLA 1HYVA 4KB1A 2A1SA 4E89A 1GOAA 2D0CA 3VQ4A 3WNFA 3AVAA 4AH9A 1IH7A 3AV9A 3BDPA 1BIZA 5FROA 4BE2A 1HQUA 4DSJA 3F9KA 2D0BA 5C25A 4DSFA 3ZT4A 4CJEA 1RTHA 1QHTA 1S9EA 4HTUA 4DSLA 2VWKA 4CEAA 4Q5VA 4CEFA 5E41A 1JLCA 1KVCA 1TKTA 5KRTA 2KW4A 1RDDA 3ZT3A 2WONA 1K6YA 4IBNA 5HRRA 3VQ6A 3ZT2A 4CFBA 3AA5X 3C95A 4WE1A 4CIFA 3K59A 3HYFA 4FZYA 4B9VA 1JLBA 4M3RA 4CEEA 3DLHA 4Z4IA 4RW9A 2YNIA 1NK8A 4OLAA 3NHGA 2IC3A 3L2VA 3OYKA 1HNIA 4EP5A 3IAYA 1BQMA 3V9XA 2KZZA 3RMDA 1D9DA 1BQNA 4FZXC 2JGUA 3VQAA 5FDLA 1DLOA 4GW6A 1KCFA 3DLKA 5I3UA 2VG6A 4BWMA 2OZMA 1RBSA 2RKIA 4M3XA 4B9LA 4N47A 1I39A 1RTJA 3VQEA 1NKBA 1ZBHA 2OPSA 4NCGA 4M3YA 1KFDA 4ID1A 4CGGA 4HUFA 3L2RA 1WSFA 2IOCA 2FBTA 2HNZA 4FK0A 5HBMA 2JLEA 3O3GA 1NJYA 4DQRA 4QAGA 4CECA 3OJUA 3S3NA 3F73A 2OPRA 4B8CA 2DY4A 2HHUA 3SQ1A 3OYEA 4B3OA 4FJXA 2HHVA 1KLNA 3B6OA 3NDKA 3L2UA 4E7IA 3O4NA 4DTNA 3RMCA 3ZSWA 3OYAA 4E1MA 4FM1A 3HSTB 1SUQA 5CYMA 4CEZA 3V9WA 3LZIA 1NJXA 3T19A 3HO1A 3SUOA 3MXIA 2B6AA 3AVMA 2RPIA 3KIOA 3SYZA 1SKWA 1Y97A 3C6TA 2VG7A 4M3WA 1B92A 1RT5A 5EU7A 4CK1A 3OYBA 2F96A 1NJWA 1I3AA 4B9TA 2DTUA 4OGEA 4O0IA 4LY7A 3LZJA 2G8HA 3ULDA 3DRPA 3MECA 1RNHA 3RMBA 2GUIA 3LPUA 4Z4CA 4C8MA 1JLFA 3NBPA 1VSKA 3OYGA 4CFCA 3DOKA 3QLHA 4KI4A 3NH2A 1T03A 3CFRA 4CGDA 2W42A 1CZ9A 1JL2A 3LP2A 3OYHA 1VSMA 1SL2A 1J5OA 3ALYA 3AO3A 3QNOA 1BISA 4N56A 2KTQA 1S1TA 1BI4B 1RBTA 3OYCA 4OKEA 1U48A 4CJRA 1ZBIA 4FJNA 1S1UA 3BGRA 4BDZA 4DTMA 3NE6A 1A5VA 5CZ2A 1XI1A 4DWIA 4CEDA 3RRHA 3T3FA 3WNEA 1JKHA 2YNGA 4W5QA 1LAWA 1NKCA 5HLFA 4I9LA 4DQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TK5 A;  4CHY A;  1J53 A;  4DF8 A;  5SZT A;  4E7J A;  1TKX A;  4RW4 A;  4ELT A;  3P5J A;  3QNN A;  4BWJ A;  4MQ3 A;  3ZCM A;  4I2P A;  4CJS A;  4O55 A;  4CES A;  4KRF A;  3TAE A;  3SUN A;  2PY5 A;  3ASM A;  4NCB A;  3ITH A;  1LAV A;  1Q9Y A;  2F8S A;  3NCI A;  3V6D A;  2QK9 A;  3ZSV A;  3NGI A;  3TAF A;  4EZ6 A;  3DLR A;  4N76 A;  3ISN C;  2OYQ A;  2OPQ A;  4J2B A;  4KPY A;  4FJ9 A;  4KHU A;  2XY8 A;  3KKR A;  4E1N A;  1NK4 A;  1U47 A;  1NK6 A;  4M45 A;  1S1X A;  1TKD A;  5KGX A;  5KRS A;  5HRN A;  3PX0 A;  5D3G A;  1HQE A;  4ELU A;  4FW1 A;  3TAG A;  4FM0 A;  1KSP A;  3VA3 A;  1UA1 A;  2KZM A;  2HNY A;  1FXX A;  3SCX A;  2Z1I A;  4FLW A;  1YT3 A;  4FVM A;  3PY8 A;  4OKJ A;  4BDY A;  4G1Q A;  3QES A;  1HNV A;  1ITG A;  2D5R A;  4OGC A;  1RDC A;  3PO5 A;  3G10 A;  2F8T A;  1LWC A;  1UOC A;  1BGX T;  5J2N A;  3TAM A;  4FLT A;  4H8K A;  4F8R A;  1YTA A;  1VSJ A;  4DTX A;  3NF7 A;  1HMV A;  1BCO A;  5C42 A;  4CHQ A;  3K57 A;  3TR8 A;  3RR8 A;  1BIU A;  1CLQ A;  1EXQ A;  1U49 A;  2HVI A;  1DTT A;  2B5J A;  3TAN A;  2ZQB A;  1NK7 A;  3K2P A;  4DQS A;  4LH4 A;  3CFP A;  4FXD A;  3WNG A;  1JLA A;  5J1E A;  1UA0 A;  4ZTJ A;  1JL1 A;  1NOZ A;  2IAJ A;  4LSN A;  1TK0 A;  3IS9 A;  1WAJ A;  4CHP A;  3K58 A;  4O5B A;  4E7H A;  1BL3 A;  4KHS A;  3NGY A;  4BDP A;  4BE0 A;  4M42 A;  2QXF A;  5KGW A;  4CJV A;  3EZ5 A;  2X74 A;  4IKF A;  4OKK A;  1TGO A;  4NCA A;  4O4G A;  3DRR A;  2PZS A;  3KTQ A;  1CXQ A;  4KTZ A;  1C0U A;  4OPJ A;  4DQP A;  1QE1 A;  2G8W A;  1S9G A;  4FK2 A;  4RW8 A;  3AVI A;  1ZYQ A;  3OYN A;  3JYT A;  4DTJ A;  4FYD A;  4FCY A;  4YNQ A;  1RT1 A;  3G0Z A;  4DU3 A;  4DTR A;  1ASV A;  4DFJ A;  3CQ8 A;  3KLF A;  3LDS A;  4F3O A;  4FJG A;  4JS5 A;  3KLI A;  1LW2 A;  3KK1 A;  3L8B A;  3I8D A;  4KHQ A;  2FBY A;  3KD1 E;  1D9F A;  4FW2 A;  1XC9 A;  1HRH A;  3RWU A;  4ZTF A;  3AVH A;  4KTQ A;  3LAK A;  1ASW A;  3ZSY A;  4W5T A;  3NGZ A;  3AVJ A;  2YHA A;  4B9M A;  4ELV A;  2HHT A;  3ZT1 A;  3TAB A;  2ATQ A;  3AO1 A;  4KV8 A;  3AVB A;  3C94 A;  4L8R B;  1L3V A;  3LAM A;  1IKW A;  4BAC A;  4DG1 A;  5T7B A;  3V9Z A;  3HJF A;  1VRU A;  4J2A A;  1IKV A;  4AHR A;  4QCL A;  2XY7 A;  4DTU A;  1C6V A;  4B8A B;  4DMN A;  3HP6 A;  3O4Q A;  3CM5 A;  4XIU A;  3L2W A;  1L3S A;  1KTQ A;  3SUQ A;  3NAE A;  4AIL C;  2QKB A;  1RDB A;  3D45 A;  4KB0 A;  3O3H A;  1SKR A;  1RIL A;  4B9U A;  4HHT A;  1WSH A;  2XY6 A;  2LSN A;  3AVF A;  4AHC A;  4E7K A;  1FKP A;  4C8O A;  5HRP A;  1UAX A;  4F2S A;  3C6U A;  1WAF A;  3H08 A;  3RTV A;  1EX4 A;  3KLH A;  3P83 D;  3QIP A;  5CZ1 A;  2HND A;  4CGF A;  5DMR A;  4LH5 A;  2B4J A;  2P5O A;  3IRX A;  3NF8 A;  2P5G A;  1GOB A;  3VQP A;  1TAU A;  3VQ7 A;  4FLZ A;  1NK5 A;  4K8X A;  5J2P A;  3AVG A;  4HVJ A;  3THV A;  2HHS A;  4CJ4 A;  3RMA A;  1TL3 A;  2HHW A;  1X9M A;  1VSD A;  3OYL A;  3I0S A;  2BE2 A;  4M41 A;  3U6F A;  1Z25 A;  2RN2 A;  3V9U A;  3K5L A;  3DYA A;  2Q3S A;  3WNH A;  3QEP A;  4FJJ A;  1VSL A;  5CYQ A;  3KKS A;  1G15 A;  4HUE A;  4ZHR A;  4Z4F A;  3PV8 A;  1IG9 A;  1RBU A;  2KQ2 A;  1WSI A;  1BCM A;  4CJ3 A;  3TWH A;  4CIE A;  4CFA A;  3SI6 A;  1QQC A;  3QEV A;  4MFB A;  4KHW A;  4PUO A;  3SV3 A;  2G8I A;  4ICL A;  3SUP A;  3L3U A;  1VSH A;  4CHO A;  5KI6 A;  4GMJ B;  1X1P A;  3AVK A;  3QO9 A;  3SQ0 A;  4C8K A;  3EY1 A;  1EKE A;  4TSX A;  3DMJ A;  3HPO A;  2ITG A;  3L3V A;  4OVL A;  3NFA A;  3LP3 A;  2Z1J A;  1TVR A;  4ID5 A;  4DTO A;  3TAQ A;  3OYM A;  3KLE A;  2G8V A;  1KRP A;  2E6M A;  4DU1 A;  1C1A A;  4DFM A;  4LSL A;  1HYS A;  2EX3 A;  1JXB A;  1JXE A;  1WNS A;  3V1O A;  3VN5 A;  5KTQ A;  4FZZ A;  4CEQ A;  4HCB A;  4W5N A;  2BAN A;  1L3U A;  4E19 A;  3AA4 A;  2YNF A;  1RTD A;  4JRQ A;  3AVN A;  3DLE A;  4Y1C A;  5CY4 A;  3E01 A;  4N5S A;  3VQD A;  5DK5 A;  3U3Y A;  2G8K A;  1B9F A;  1WSE A;  4CF0 A;  4FJI A;  4CER A;  3S3O A;  3M8S A;  4CCH A;  3SNN A;  4HCC A;  3OYI A;  1N6Q A;  4KHN A;  3VQ9 A;  2XRI A;  4B08 A;  2DFE A;  2FBX A;  3SJJ A;  4C8L A;  2BGG A;  3V1Q A;  3ZSR A;  4CHZ A;  4AHU A;  1KFS A;  4KHY A;  3PX6 A;  4Z4E A;  3MEG A;  3VQ8 A;  3HPH A;  1VSF A;  1RT2 A;  3ZT0 A;  3JSM A;  2GV9 A;  4H4O A;  1S5J A;  1RTI A;  3FFI A;  4PA1 A;  1L3T A;  3RRG A;  3SPZ A;  3MXM A;  4KO0 A;  3VQC A;  1X9W A;  2OZS A;  3NF9 A;  1LV5 A;  3DLG A;  4NYN A;  3V81 A;  3HXM A;  4Y1D A;  1D5A A;  1QSS A;  3DLB A;  4B9S A;  4I9Q A;  4EP4 A;  1JLG A;  2IS3 A;  3P1G A;  3RR7 A;  4CEO A;  3CG7 A;  3LWM A;  1WLJ A;  1F21 A;  3ZSZ A;  2Z1G A;  2NUB A;  4C8N A;  3ZSO A;  3EYZ A;  4FJ8 A;  4F3T A;  3K5O A;  1HYZ A;  2VG5 A;  4J2D A;  2P1J A;  4J2E A;  1RT4 A;  4OJR A;  1IKX A;  4DLG A;  1YTU A;  4DS4 A;  1Q9X A;  5J2M A;  1FKO A;  1WSG A;  2XY5 A;  3LAL A;  1Z26 A;  2R7Y A;  2VWJ A;  4RG8 A;  1KVB A;  2PYJ A;  3VA0 A;  4M3T A;  3V4I A;  2IGI A;  3VQB A;  3SQ2 A;  2OPP A;  3HVT A;  1C1B A;  4FLY A;  3AA3 A;  3QEX A;  3CYM A;  1RCH A;  1VRT A;  2P51 A;  3LWL A;  4I7F A;  1TV6 A;  2Y1J A;  2XHB A;  2XO7 A;  4B9N A;  1B9D A;  3KK2 A;  2HW3 A;  2DFF A;  1KVA A;  3HL8 A;  3QIO A;  2ZE2 A;  4CGJ A;  3HT3 A;  4FJH A;  2D0A A;  5JS2 A;  4AHS A;  1U45 A;  4KAZ A;  5HP1 A;  5JS1 A;  3OS1 A;  4DS5 A;  4DTS A;  1XHZ A;  1VK0 A;  4E0D A;  1J9A A;  2YV0 X;  2HVH A;  4M3U A;  4Z0U A;  4CJF A;  3DM2 A;  3PUF A;  4RW6 A;  4CHN A;  1SL0 A;  2WOM A;  4OPK A;  4IFY A;  3TI0 A;  2KFZ A;  5FRN A;  3O3F A;  3KD5 E;  3V9S A;  1N5Y A;  1C1C A;  3MEE A;  1NK0 A;  3M8P A;  3PX4 A;  4K8Z A;  4N41 A;  3HVR A;  1T8E A;  3L2Q A;  4RW7 A;  1GOC A;  3SZ2 A;  3DOL A;  1CZB A;  2KFN A;  3MED A;  4CFD A;  5HRS A;  3D0P A;  1NKE A;  1L5U A;  1SV5 A;  2YHB A;  1JLQ A;  3AO4 A;  3KLG A;  4CK2 A;  2HB5 A;  4KTW A;  3QER A;  1IKY A;  3HP9 A;  4DQI A;  2A1R A;  1D8Y A;  4CJT A;  4CK3 A;  1RT3 A;  1W9H A;  2FC0 A;  4FJ7 A;  2FBV A;  4KFB A;  1J54 A;  2X6S A;  3CM6 A;  3LAN A;  3OVN A;  4Z4H A;  1RT6 A;  2Y1I A;  3LP1 A;  2DFH A;  2G8U A;  3QIN A;  2X6N A;  3OY9 A;  3I0R A;  4IFV A;  1T05 A;  4FLV A;  1C0M A;  1S1V A;  4FLU A;  1NK9 A;  3VQQ A;  4CJP A;  3MAQ A;  4DFP A;  1TAQ A;  1R0A A;  4FJM A;  1C0T A;  4Q0B A;  4FK4 A;  4E3S A;  1IO2 A;  3AO5 A;  3A2F A;  3AVL A;  4DSI A;  4DSK A;  4CJW A;  1WSJ A;  5J2Q A;  3OJS A;  4PY5 A;  4CF8 A;  4CJ5 A;  4CJK A;  3B6P A;  4NYF A;  1NOY A;  1REV A;  1XHX A;  4KRE A;  1LWE A;  2IDO A;  3KJV A;  3SQ4 A;  2YKN A;  2O4G A;  4CEB A;  3HK2 A;  3TAP A;  1QSY A;  4W5O A;  3LPT A;  1O1W A;  4JS4 A;  1QSL A;  3HPG A;  1TL1 A;  2HHX A;  4DU4 A;  1NJZ A;  3NH0 A;  2ZD1 A;  1LWF A;  3AA2 A;  1MU2 A;  1RT7 A;  5FRM A;  4JRP A;  4CGH A;  1EET A;  1EP4 A;  3ZSQ A;  3SPY A;  5C24 A;  3NF6 A;  3UIQ A;  1SL1 A;  4F4K A;  2AJQ A;  3T1A A;  1JLE A;  3NH1 A;  3M8Q A;  3LP0 A;  1ASU A;  3KK3 A;  3OYD A;  4KKO A;  3TAR A;  3MXJ A;  4PQU A;  1KLM A;  2GBZ A;  4H4M A;  4BE1 A;  1TK8 A;  1A5X A;  3QEI A;  3SV4 A;  4E7L A;  1ZBF A;  1BHL A;  1S6Q A;  1VSI A;  1CXU A;  1YVU A;  3DI6 A;  3U3G A;  4CJU A;  5SWM A;  4W5R A;  2OA8 A;  4DFK A;  1XWL A;  3AO2 A;  4CJQ A;  4IG0 A;  2BDP A;  1RBR A;  2E6L A;  3V1R A;  4FJL A;  3QET A;  4R5P A;  1T7P A;  1LW0 A;  4JLH A;  2QKK A;  1HJR A;  4IDK A;  3K5M A;  1UWB A;  2E4L A;  1S6P A;  3OS0 A;  5K14 A;  1WN7 A;  4CIG A;  4FLX A;  4YFU A;  3S9H A;  4DLE A;  1SKS A;  2I5J A;  3PO4 A;  1QTM A;  3HM9 A;  4OLB A;  2EHG A;  2Z1H A;  3OYF A;  4QOZ B;  1ZBU A;  1DTQ A;  4O44 A;  3DRS A;  3IG1 A;  1TKZ A;  2YKM A;  3VQ5 A;  4M3Z A;  4IG3 A;  1X9S A;  4CF9 A;  4CGI A;  4GVM A;  4FJK A;  1A5W A;  1HPZ A;  1BI4 A;  4AHT A;  3K5N A;  4FJ5 A;  5I42 A;  4KI6 A;  3OYJ A;  4LD0 A;  4CF1 A;  4UQG A;  2ETJ A;  4I2Q A;  4PWD A;  4DSE A;  5HRO A;  3ZSX A;  4DF4 A;  4Z4G A;  4O0J A;  2YNH A;  4CE9 A;  1ZBL A;  1RBV A;  2HMI A;  2PYL A;  4EZ9 A;  1VSE A;  3OS2 A;  3M8R A;  4F2R A;  3CFO A;  2O4I A;  4CF2 A;  1U4B A;  2RF2 A;  1RDA A;  1W0H A;  3AVC A;  3S3M A;  1FK9 A;  1Q8I A;  2G8F A;  2HHQ A;  4AHV A;  1U04 A;  2X78 A;  4HUG A;  3QEW A;  4FM2 A;  1QS4 A;  4DTP A;  1S1W A;  4CJL A;  1HYV A;  4KB1 A;  2A1S A;  4E89 A;  1GOA A;  2D0C A;  3VQ4 A;  3WNF A;  3AVA A;  4AH9 A;  1IH7 A;  3AV9 A;  3BDP A;  1BIZ A;  5FRO A;  4BE2 A;  1HQU A;  4DSJ A;  3F9K A;  2D0B A;  5C25 A;  4DSF A;  3ZT4 A;  4CJE A;  1RTH A;  1QHT A;  1S9E A;  4HTU A;  4DSL A;  2VWK A;  4CEA A;  4Q5V A;  4CEF A;  5E41 A;  1JLC A;  1KVC A;  1TKT A;  5KRT A;  2KW4 A;  1RDD A;  3ZT3 A;  2WON A;  1K6Y A;  4IBN A;  5HRR A;  3VQ6 A;  3ZT2 A;  4CFB A;  3AA5 X;  3C95 A;  4WE1 A;  4CIF A;  3K59 A;  3HYF A;  4FZY A;  4B9V A;  1JLB A;  4M3R A;  4CEE A;  3DLH A;  4Z4I A;  4RW9 A;  2YNI A;  1NK8 A;  4OLA A;  3NHG A;  2IC3 A;  3L2V A;  3OYK A;  1HNI A;  4EP5 A;  3IAY A;  1BQM A;  3V9X A;  2KZZ A;  3RMD A;  1D9D A;  1BQN A;  4FZX C;  2JGU A;  3VQA A;  5FDL A;  1DLO A;  4GW6 A;  1KCF A;  3DLK A;  5I3U A;  2VG6 A;  4BWM A;  2OZM A;  1RBS A;  2RKI A;  4M3X A;  4B9L A;  4N47 A;  1I39 A;  1RTJ A;  3VQE A;  1NKB A;  1ZBH A;  2OPS A;  4NCG A;  4M3Y A;  1KFD A;  4ID1 A;  4CGG A;  4HUF A;  3L2R A;  1WSF A;  2IOC A;  2FBT A;  2HNZ A;  4FK0 A;  5HBM A;  2JLE A;  3O3G A;  1NJY A;  4DQR A;  4QAG A;  4CEC A;  3OJU A;  3S3N A;  3F73 A;  2OPR A;  4B8C A;  2DY4 A;  2HHU A;  3SQ1 A;  3OYE A;  4B3O A;  4FJX A;  2HHV A;  1KLN A;  3B6O A;  3NDK A;  3L2U A;  4E7I A;  3O4N A;  4DTN A;  3RMC A;  3ZSW A;  3OYA A;  4E1M A;  4FM1 A;  3HST B;  1SUQ A;  5CYM A;  4CEZ A;  3V9W A;  3LZI A;  1NJX A;  3T19 A;  3HO1 A;  3SUO A;  3MXI A;  2B6A A;  3AVM A;  2RPI A;  3KIO A;  3SYZ A;  1SKW A;  1Y97 A;  3C6T A;  2VG7 A;  4M3W A;  1B92 A;  1RT5 A;  5EU7 A;  4CK1 A;  3OYB A;  2F96 A;  1NJW A;  1I3A A;  4B9T A;  2DTU A;  4OGE A;  4O0I A;  4LY7 A;  3LZJ A;  2G8H A;  3ULD A;  3DRP A;  3MEC A;  1RNH A;  3RMB A;  2GUI A;  3LPU A;  4Z4C A;  4C8M A;  1JLF A;  3NBP A;  1VSK A;  3OYG A;  4CFC A;  3DOK A;  3QLH A;  4KI4 A;  3NH2 A;  1T03 A;  3CFR A;  4CGD A;  2W42 A;  1CZ9 A;  1JL2 A;  3LP2 A;  3OYH A;  1VSM A;  1SL2 A;  1J5O A;  3ALY A;  3AO3 A;  3QNO A;  1BIS A;  4N56 A;  2KTQ A;  1S1T A;  1BI4 B;  1RBT A;  3OYC A;  4OKE A;  1U48 A;  4CJR A;  1ZBI A;  4FJN A;  1S1U A;  3BGR A;  4BDZ A;  4DTM A;  3NE6 A;  1A5V A;  5CZ2 A;  1XI1 A;  4DWI A;  4CED A;  3RRH A;  3T3F A;  3WNE A;  1JKH A;  2YNG A;  4W5Q A;  1LAW A;  1NKC A;  5HLF A;  4I9L A;  4DQQ A; 
#chains in the Genus database with same CATH topology
 2P9P B;  4CHY A;  4DF8 A;  5SZT A;  5FPE A;  4ELT A;  4V19 S;  3OBW A;  2E1Z A;  3THX B;  4ILG B;  4O8K A;  3TAE A;  3SUN A;  4YOU A;  5AQQ A;  4EIA A;  4HTL A;  1Q9Y A;  4WFB L;  3ZSV A;  3HOS A;  3NGI A;  4OPH A;  3TAF A;  1NNE A;  2F4V K;  4FJ9 A;  4YOX A;  2Q36 A;  3FLC O;  4FW1 A;  3T1Y K;  4DV7 K;  3TAG A;  3VA3 A;  2O8B A;  2YJF A;  3O08 A;  3QES A;  4G9Z A;  3TAM A;  4BRC A;  1YTA A;  1VSJ A;  3RR8 A;  1C0G A;  1CLQ A;  2VYP A;  4UY8 O;  2HVI A;  1DTT A;  3SMP A;  3OTO K;  2B5J A;  1JLA A;  1LOT B;  4XH5 A;  5BPL A;  1NOZ A;  3K58 A;  1RDW X;  4E7H A;  1K8K B;  4A2B A;  3IUC A;  5GAE P;  5KGW A;  3EZ5 A;  1TGO A;  1CXQ A;  4JKG B;  1C0U A;  4OPJ A;  4EHT A;  2P9S B;  1S9G A;  1VQL N;  1RT1 A;  3MWP A;  3LL3 A;  2HBM A;  4F3O A;  3F9M A;  4JS5 A;  1LW2 A;  4KHQ A;  2FBY A;  2FXU A;  1D9F A;  3MN7 A;  1HRH A;  3G71 N;  3AVH A;  3LAK A;  1ASW A;  1HKG A;  3AAP A;  4B9M A;  2GX9 A;  4ELV A;  2HHT A;  3ZT1 A;  3TAB A;  3LAM A;  4EFH A;  3C65 A;  4DCH A;  4YOT A;  3V9Z A;  4QCL A;  2XY7 A;  4DTU A;  5C2F A;  3O4Q A;  4YOY A;  4B1Y B;  3ENH A;  2ZJQ L;  3SUQ A;  3NAE A;  2A40 A;  3DLL L;  1RDB A;  3D45 A;  4JI5 K;  1GLC G;  4FO0 A;  1EWQ A;  2HBJ A;  1FKP A;  3PIO L;  5IWA K;  4B3M K;  4C8O A;  1WAF A;  3H08 A;  3RTV A;  4DV2 K;  3QIP A;  4LH5 A;  4RWT A;  2P5G A;  3KVG A;  3VQ7 A;  1NK5 A;  4K8X A;  1ZBS A;  4HVJ A;  3THV A;  1VSD A;  3OYL A;  4M41 A;  3QEP A;  2RN2 A;  4ZHR A;  1Z05 A;  4A61 A;  3PV8 A;  1EO1 A;  4DR6 K;  3WXJ A;  1BCM A;  3CJB A;  3VF6 A;  4CJ3 A;  3TWH A;  1NJI O;  3SUP A;  3L3U A;  4J8F A;  4BGA A;  3SQ0 A;  4C8K A;  1NG9 A;  5F0X A;  4AQY K;  1N32 K;  4TSX A;  3HPO A;  2ITG A;  4OVL A;  1YJ9 N;  1TVR A;  4WFA L;  3TAQ A;  3O9S A;  3WXL A;  2G8V A;  1C1A A;  3GBT A;  4LSL A;  1JXB A;  5GIN A;  4MO5 A;  3SJH A;  3QDK A;  3LDL A;  4FWM A;  4L3Q A;  3DLE A;  4Y1C A;  5CY4 A;  1W7A A;  5AZI A;  3VQD A;  5DK5 A;  3U3Y A;  1B9F A;  4CZJ A;  3S3O A;  3UE5 A;  3SNN A;  5LL6 Z;  2XRI A;  3SJJ A;  4JKB A;  2HOE A;  3J7Z O;  2BTF A;  1KFS A;  3PX6 A;  4KBO A;  3HPH A;  4BRQ A;  1VSF A;  3ZT0 A;  3UKU B;  1OH7 A;  1T44 A;  1L3T A;  3RRG A;  1VQK N;  2OZS A;  3WXK A;  3DLG A;  1NGG A;  4BRD A;  1LV5 A;  3HXM A;  1QSS A;  4B9S A;  3MN9 A;  4EP4 A;  1JLG A;  3RR7 A;  1F21 A;  2Z1G A;  5EX5 A;  4J2D A;  2QWL A;  4OJR A;  1E3M A;  1DEJ A;  1QZ6 A;  1WBD A;  2AP1 A;  4WYB A;  3AA3 A;  5AQT A;  3CYM A;  3KWG A;  1TV6 A;  2Y1J A;  2FSN A;  2DPN A;  4OO1 J;  2DFF A;  3HOT A;  3R1X A;  4H0X B;  4KAZ A;  3KK7 A;  4DTS A;  1XHZ A;  2HVH A;  5AQS A;  3G25 A;  3PUF A;  4LF5 K;  2WOM A;  3TI0 A;  3MN5 A;  3KD5 E;  3MEE A;  2GTD A;  1QQO A;  2NRX A;  2F7T A;  3SZ2 A;  1CZB A;  3VEN A;  3MED A;  5HRS A;  3A8Y A;  3FFK B;  3D0P A;  3THY A;  3HI0 A;  1IKY A;  3BF3 A;  2QEX N;  1D8Y A;  3CI5 A;  4JV5 K;  2FC0 A;  3VMF B;  2HHH K;  1HLU A;  5BR8 K;  2I7P A;  5E26 A;  3O9T A;  2O8F B;  4IOA L;  4CJP A;  3MAQ A;  3BUZ B;  4FJM A;  3UKR A;  4E3S A;  3M5R A;  2JWL A;  3G4S N;  3OHR A;  3EEQ A;  4DSK A;  3ZEU A;  2OAN A;  4PY5 A;  4CF8 A;  3B6P A;  1ATS A;  2BUP A;  4CZE A;  3TAP A;  1QSY A;  4JS4 A;  3ENO A;  1TL1 A;  4DU4 A;  2ZD1 A;  1LWF A;  3AA2 A;  4BC3 A;  3ZSQ A;  5BRH A;  3NF6 A;  4C1N I;  4F4K A;  1JLE A;  3NH1 A;  4BR4 A;  3KK3 A;  1KAZ A;  3VGK A;  1XQS C;  5ADX H;  4PQU A;  4BE1 A;  4BRF A;  5KQ8 A;  3O1B A;  2FF3 B;  2ASM A;  1CZA N;  1CXU A;  1X3N A;  2WBN A;  1XWL A;  4CJQ A;  4JNE A;  3E1Y A;  4QS8 A;  2Q0R A;  3DXK A;  4R5P A;  1J5E K;  4IDK A;  4JHD A;  4QS7 A;  5AFU H;  4YFU A;  1DKG D;  3JS6 A;  4DLE A;  2I5J A;  3S9H A;  3PO4 A;  2NNW A;  4OLB A;  2EHG A;  3MX5 A;  4O44 A;  3S41 A;  1TKZ A;  2YKM A;  2HMP A;  4CF9 A;  1HPZ A;  3K5N A;  1OH6 A;  4XH1 A;  4FJ5 A;  3OYJ A;  4BRP A;  4CW7 B;  1HYS A;  1ZBL A;  2P9P A;  1VSE A;  1BWF O;  1NGF A;  4CVN E;  4A57 A;  3AVC A;  3THX A;  1QS4 A;  2CH6 A;  4DTP A;  4DQ8 A;  5F2R A;  2OTJ N;  4AH9 A;  3ATV A;  3AVA A;  3AV9 A;  3BDP A;  1BIZ A;  4BE2 A;  1HQU A;  3UB5 A;  5C25 A;  1XNQ K;  3VTH A;  4GV9 A;  3ZT4 A;  4DSL A;  1S9E A;  3F5T A;  4HTU A;  3I56 N;  2YI1 A;  2KW4 A;  4Z94 A;  4YDU C;  5HRR A;  5M1O A;  3C6A A;  3M1F A;  1O13 A;  2QI2 A;  2YHW A;  3C95 A;  4RW9 A;  3DJC A;  1GLB G;  3OYK A;  4H5W A;  3RMD A;  1NMD A;  4EHU A;  5FDL A;  3VEZ A;  5I3U A;  3MDQ A;  4BC2 A;  1OVQ A;  2VG6 A;  1RBS A;  2RKI A;  4N47 A;  1I39 A;  1RTJ A;  2OPS A;  4CGG A;  4PKI A;  4EAH D;  4WFN L;  1W97 L;  3L2R A;  1IBL K;  2IOC A;  5CHI A;  3O3G A;  1VQ9 N;  3MWT A;  4BVP A;  3S3N A;  1IV0 A;  2HHU A;  2ZJP L;  3SQ1 A;  2D1K A;  3OYE A;  3AGK A;  3KZB A;  1KLN A;  3QB0 A;  1K8K A;  3O4N A;  4PHT X;  3THW B;  1HUX A;  3ZSW A;  4R79 A;  2FF6 A;  4RCH A;  3SUO A;  1T6C A;  3KIO A;  3SYZ A;  3P31 A;  3WT0 A;  2VG7 A;  1B92 A;  4JKG A;  1RT5 A;  5EU7 A;  1NJW A;  2P9S A;  2G8H A;  2CGJ A;  4LY7 A;  3LZJ A;  3MN6 A;  3MEC A;  4U7B A;  3RMB A;  3LPU A;  3O8M A;  3CCQ N;  5BN9 A;  4BR0 A;  3HRG A;  1JL2 A;  1SL2 A;  3IFR A;  3ALY A;  1LCU A;  2KTQ A;  4NLB A;  3EE9 A;  1RBT A;  4OKE A;  4GKK K;  4CJR A;  4YDU A;  1YTU A;  4DWI A;  1XI1 A;  3RRH A;  1NKC A;  1ZBH A;  2P9U B;  4KRE A;  4DQQ A;  3SBT A;  1TYQ B;  4E7J A;  1BA0 A;  4IJN A;  3P5J A;  3QNN A;  4MQ3 A;  3ZCM A;  1WBB A;  4O55 A;  3LDP A;  3CET A;  3IKM A;  3ASM A;  3V6D A;  2QK9 A;  1NGE A;  3OA9 A;  2OYQ A;  2XY8 A;  1NK6 A;  1KXP A;  4X65 K;  1VQM N;  4JAX A;  2UU9 K;  5KRS A;  1QVF M;  2CGK A;  1WUA A;  1T6D A;  3OW2 M;  2HNY A;  2O8E B;  3WQU A;  4FLW A;  4FVM A;  1MWM A;  4OGC A;  3PO5 A;  3VER A;  3P4I A;  1BGX T;  5J2N A;  4FLT A;  4JYA K;  4DTX A;  4IOX A;  4CHQ A;  4I6M B;  4LFA K;  4FWP A;  3FZF A;  3K2P A;  5J1E A;  2NLX A;  4IXC A;  2IAJ A;  4LSN A;  4CHP A;  4O5B A;  1BL3 A;  4KHS A;  4XEI A;  4BE0 A;  3VGM A;  4IKF A;  4LFC K;  4OKK A;  3KTQ A;  1NGI A;  4KTZ A;  1P90 A;  2G8W A;  4RW8 A;  2QA4 N;  3SBG A;  4DU3 A;  5DM7 L;  3LDO A;  3AAR A;  2O8C B;  3CQ8 A;  2NRH A;  2V7Z A;  4CI6 A;  1SQK A;  3KK1 A;  3I8D A;  3RSE B;  2UYT A;  3SAH A;  1KD1 O;  4JI3 K;  4WF9 L;  3NGZ A;  3AVJ A;  2YHA A;  3AGR A;  4DR4 K;  2V7Y A;  3C6H A;  3UKU A;  4KV8 A;  1D4X A;  5AQX A;  4BAC A;  4DG1 A;  4AHR A;  5F1X A;  1ESV A;  4B8A B;  3CCS N;  1L3S A;  3O80 A;  1KTQ A;  1OVY A;  1NWK A;  3SK3 A;  4BRM A;  2QKB A;  5M1N A;  3A5N C;  4B9U A;  2UXB K;  4HHT A;  3KLH A;  3P83 D;  3T1H K;  1NBW A;  2B4J A;  2ZWH A;  3NF8 A;  4FLZ A;  5AQL A;  3CCR N;  2HHW A;  1X9M A;  4DV1 K;  2BE2 A;  2Q3S A;  4FJJ A;  4DR3 K;  5CYQ A;  4BRA A;  1G15 A;  1V4T A;  4Z4F A;  1IG9 A;  4GKJ K;  3CCV N;  4CFA A;  3SI6 A;  5M1Q A;  3QFU A;  4MFB A;  3QBX A;  4KHW A;  4DR5 K;  4B1U B;  1HKB A;  3U9Z A;  1QQM A;  3CQX A;  5KI6 A;  3CXC M;  3QO9 A;  2OTL N;  4H0Y B;  2F9W A;  1BUP A;  3CJC A;  2D0P A;  4MDA A;  3LP3 A;  2Z1J A;  2WUS A;  4DTO A;  3HTV A;  3OYM A;  5HL7 L;  3KLE A;  1GLL O;  1KRP A;  2E6M A;  4DU1 A;  3LDN A;  4IDH A;  5KTQ A;  2P9K B;  2O8F A;  1L3U A;  3BZK A;  3AA4 A;  5TKY A;  3E01 A;  3CJ9 A;  1ILY A;  2G8K A;  3M6G A;  3OYI A;  4C8L A;  4B08 A;  2QWO A;  2IVP A;  5LJW A;  4AHU A;  3LDQ A;  4Z4E A;  4BG8 A;  4B1V A;  4A59 A;  1V4S A;  1K8A O;  1S5J A;  5AQZ A;  3L4I A;  3V81 A;  5IT9 O;  1P8Z A;  4Y1D A;  3DLB A;  3P1G A;  4JI7 K;  4F3T A;  2NUB A;  3EYZ A;  3K5O A;  5BPM A;  1HYZ A;  1FJG K;  2P1J A;  4J2E A;  1RT4 A;  1FKO A;  1WSG A;  2R7Y A;  2PAV A;  1VQ5 N;  2IGI A;  3VQB A;  4BR5 A;  3HVT A;  4FLY A;  1C1B A;  3ZYY X;  5JMV A;  1J6Z A;  1VRT A;  3D2F B;  4KHP K;  1S3X A;  3TTF A;  2XO7 A;  2A42 A;  3EE8 A;  1W2B M;  3HL8 A;  4B1Z A;  4CGJ A;  2ZE2 A;  1OH8 A;  1U45 A;  5HP1 A;  4DS5 A;  2ZJR L;  4E0D A;  4BC5 A;  2E2O A;  4CJF A;  3ZET B;  1SL0 A;  4CHN A;  1U2V B;  3GOI A;  3O3F A;  1N5Y A;  1C1C A;  1NK0 A;  4K8Z A;  3VGL A;  3J8A A;  3HVR A;  1T8E A;  3L2Q A;  4RW7 A;  1GOC A;  5GAG P;  2KFN A;  3KWI A;  1NKE A;  5AQW A;  1RFQ A;  1L5U A;  1SV5 A;  1JLQ A;  3CMA N;  1C0F A;  4CK2 A;  2VGM A;  3HP9 A;  4PKG A;  2FBV A;  4H0P A;  4H5V A;  1J54 A;  5AQR A;  3F2K A;  2X6S A;  5EY4 A;  3I8B A;  2DFH A;  2WTU A;  1S1V A;  4FLU A;  1NK9 A;  5H1S Q;  1YUW A;  1C0T A;  2A5X A;  3A2F A;  3AVL A;  4YHH K;  3WEE B;  4JI4 K;  3OJS A;  4CJ5 A;  3CD6 N;  4CJ7 A;  4NYF A;  3FZK A;  3ULE B;  1REV A;  2IDO A;  3TU5 A;  4W5O A;  2E2Q A;  3LPT A;  1O1W A;  3HPG A;  1MU2 A;  4BRL A;  3FZH A;  4JRP A;  4CGH A;  1EP4 A;  3UIQ A;  3T1A A;  3M8Q A;  3LP0 A;  1YIJ N;  3OYD A;  2UUA K;  3MXJ A;  1KLM A;  4H4M A;  1A5X A;  3THW A;  3SV4 A;  3QBW A;  4E7L A;  1ZBF A;  5GAD P;  1VSI A;  1YVU A;  3U3G A;  3BZC A;  2BGG A;  1X9J A;  4CJU A;  4OX9 K;  4DFK A;  5BRE A;  1X3M A;  2WC9 A;  1XNR K;  3H1Q A;  1LW0 A;  4JLH A;  1BU6 O;  2Q0U A;  2E4L A;  4E1J A;  1WN7 A;  1ZXO A;  4FLX A;  3HM9 A;  4QOZ B;  3VQ5 A;  3DWL A;  4OPA A;  4IG3 A;  1X9S A;  4FJK A;  3ZX2 A;  1A5W A;  3EN9 A;  4DB3 A;  4CF1 A;  4UQG A;  4I2Q A;  3VEX A;  4PWD A;  4FWK A;  1K9M O;  3ZSX A;  4Z4G A;  2P9U A;  2HMI A;  4JK9 A;  4KHN A;  4MLH A;  3OS2 A;  4BG9 A;  1TYQ A;  4JKE A;  2NRV A;  1RGI A;  1XC3 A;  2PFU A;  4CF2 A;  3CPW M;  3S3M A;  1U04 A;  4B9Q A;  1VQN N;  1NM1 A;  1ATN A;  2A1S A;  4E89 A;  1GOA A;  2D0C A;  3VQ4 A;  5KPZ A;  5FRO A;  2VCP A;  3VET A;  1XUP O;  3SAG A;  1IJJ A;  4K42 A;  5E41 A;  1JLC A;  4H0T B;  5B8H A;  1TKT A;  5TKW A;  5KRT A;  4B3R K;  1RDD A;  2WON A;  4IBN A;  1JCG A;  3VQ6 A;  4JD2 B;  1S22 A;  4CIF A;  3K59 A;  4WE1 A;  1N34 K;  2HF3 A;  3HYF A;  5BR9 A;  4FZY A;  4CEE A;  1NK8 A;  1BO5 O;  5KQD A;  2O8E A;  3L2V A;  1HNI A;  2I7N A;  3IAY A;  1K73 O;  4MLE A;  1BQN A;  2YCH A;  4FZX C;  3VQA A;  4GW6 A;  3O5B A;  3DLK A;  1YF5 L;  3CJA A;  2GEL A;  5C12 A;  1Q18 A;  4IO8 A;  1KFD A;  4M3Y A;  4I6M A;  2D4W A;  1WSF A;  2FBT A;  2JLE A;  4B1W B;  4QAG A;  5AQG A;  4FOI A;  4CEC A;  4BRN A;  3N4P A;  4B3O A;  5AQF A;  3FGU A;  3B6O A;  4YOW A;  3L2U A;  4DUY K;  2WFB A;  4E1M A;  5CYM A;  3V9W A;  3R3L A;  3AVM A;  5AQN A;  2RPI A;  1VQO N;  1Y97 A;  3FE1 A;  4M3W A;  3OYB A;  5ADX A;  4CK1 A;  4B9T A;  4WQ5 C;  1M90 O;  2DTU A;  4O0I A;  4LF9 K;  2UUC K;  1RNH A;  4C8M A;  1GLE G;  3D2E B;  1VSK A;  1N33 K;  2O8C A;  3VEW A;  2RHK A;  4WQ4 C;  4IOC L;  1CZ9 A;  1ATR A;  3RSE A;  4N56 A;  5AFU A;  1S1T A;  1BI4 B;  3OYC A;  1U48 A;  1G99 A;  3W3D A;  3BGR A;  1QHA A;  1GLJ O;  1GLD G;  3T3F A;  1HNW K;  1LAW A;  4CCH A;  5HLF A;  4I9L A;  1J53 A;  3J80 O;  1TKX A;  4FOE A;  2AA4 A;  4BWJ A;  1Q81 O;  4I2P A;  4CJS A;  1RDU A;  1Z6R A;  4CES A;  4KRF A;  3VPZ A;  1N8R O;  1SAZ A;  4FVU A;  4A62 A;  2ZGZ A;  4NCB A;  1LAV A;  4FWL A;  2YHX A;  4NB4 A;  1U47 A;  1S1X A;  1TKD A;  5D3G A;  1HQE A;  4ELU A;  3Q7C A;  2YJE A;  1JJ2 M;  1UA1 A;  1FXX A;  3SCX A;  4NO7 A;  2Z1I A;  3C0B A;  3PY8 A;  3ZLJ A;  4OKJ A;  2JWK A;  1KAY A;  3GE1 A;  4WQ5 A;  1RDC A;  3G10 A;  1LWC A;  4H8K A;  4YY3 K;  2VQF K;  5C42 A;  1N36 K;  1BIU A;  4WQ4 A;  1EXQ A;  1U49 A;  3TAN A;  2ZQB A;  1NK7 A;  4AM6 A;  4DQS A;  3WNG A;  1UA0 A;  4ZTJ A;  1TK0 A;  3IS9 A;  1WAJ A;  3M3Z A;  2KHO A;  3R9P A;  4DUZ K;  2W40 A;  3NGY A;  2P9N B;  4BDP A;  4M42 A;  4CJV A;  4LF4 K;  4KH4 A;  1KC8 O;  4O4G A;  3DRR A;  2P9K A;  2PZS A;  1QE1 A;  4FK2 A;  4K43 A;  3AVI A;  1ZYQ A;  3OYN A;  3JYT A;  4YNQ A;  4DV3 K;  3G0Z A;  4FWO A;  1ASV A;  4DFJ A;  4JKC A;  1HPM A;  4ISE A;  2GUP A;  2Q31 A;  3KLF A;  5GIO A;  4FJG A;  3KLI A;  3L8B A;  3PSF A;  5M1P A;  3GL1 A;  3RWU A;  1XC9 A;  2QWQ A;  3ZSY A;  4W5T A;  4DR1 K;  3WQT A;  4QS9 A;  3AVB A;  3C94 A;  1L3V A;  4BRH A;  2QTD A;  1HNZ K;  3HJF A;  1VRU A;  1IKV A;  1S72 N;  3FR0 A;  3J7Y P;  1C6V A;  3HP6 A;  3CM5 A;  5GAH P;  1IG8 A;  3L2W A;  2H3G X;  2Q2R A;  3CCE N;  3HSC A;  1U6Z A;  4KB0 A;  4H0V B;  3O3H A;  1SKR A;  1RIL A;  2LSN A;  3TSU A;  4JKH A;  4AM7 A;  3AVF A;  4AHC A;  1UAX A;  3L4Q A;  3C6U A;  4CD1 A;  4X62 K;  2GWK A;  5CZ1 A;  3D2F A;  2HND A;  4CGF A;  2P5O A;  3IRX A;  2IIR A;  1GOB A;  4CJ4 A;  5DM6 L;  1Z25 A;  3U6F A;  3K5L A;  1YAG A;  5LMN K;  1U2V A;  1BDG A;  4FWS A;  1SZ2 A;  2A41 A;  1RBU A;  2KQ2 A;  1WSI A;  3CJ1 A;  3DXM B;  4CIE A;  5AQO A;  3TSP A;  2FSK A;  4H0O A;  3QEV A;  4FWQ A;  4CZI A;  4PUO A;  4IO9 L;  2G8I A;  1Q7Y O;  4CZK A;  4ICL A;  2QWN A;  1HJO A;  1VSH A;  1X1P A;  3AVK A;  4DV4 K;  3DMJ A;  4M7Y A;  2Q97 A;  3A5M C;  3T69 A;  4JKF A;  2VQE K;  4DFM A;  3SLC A;  4B3T K;  2EX3 A;  1E4F T;  1JXE A;  1WNS A;  3V1O A;  3VN5 A;  4CEQ A;  4HCB A;  2BAN A;  4JI1 K;  3C7N B;  4E19 A;  2YNF A;  3RVC A;  3WEE A;  3AVN A;  5AQH A;  1GLF O;  5BPN A;  1WSE A;  3ULE A;  4MO4 A;  4CF0 A;  4FJI A;  4CER A;  3M8S A;  1N6Q A;  3VQ9 A;  2DFE A;  4B1X B;  2E8A A;  1XMO K;  4CHZ A;  4KHY A;  4ISG A;  3MEG A;  5AQP A;  3JSM A;  2GV9 A;  3QML A;  4PA1 A;  5HOO A;  4WCE L;  3VQC A;  1YIT N;  3NF9 A;  4NYN A;  1YJN N;  2HST A;  2P9L B;  1D5A A;  3TTC A;  4I9Q A;  4RTF D;  2IS3 A;  4CEO A;  3CG7 A;  3LWM A;  1WLJ A;  1VQ4 N;  4FJ8 A;  4YOV A;  2VG5 A;  2HBK A;  1IKX A;  1Q9X A;  5J2M A;  5AJ3 K;  3CER A;  3LAL A;  1Z26 A;  3DAW A;  3ID6 A;  2VWJ A;  4RG8 A;  1KVB A;  2PYJ A;  3V4I A;  2NZT A;  4HWI A;  5AQV A;  5A2Q O;  2ASP A;  2XHB A;  4B9N A;  1B9D A;  2HW3 A;  1KVA A;  4GNI A;  3HT3 A;  4FJH A;  2D0A A;  2QWR A;  3BP8 A;  5JS2 A;  4AHS A;  3OS1 A;  5CE3 A;  4JN4 A;  1HKC A;  1VK0 A;  2VGN A;  1VQ7 N;  3O9U A;  2KFZ A;  3TSQ A;  5LMU K;  4N41 A;  1EQY A;  3DOL A;  5I9E B;  3VF4 A;  3KLG A;  3ZX3 A;  2IVN A;  2A1R A;  4CK3 A;  2E2P A;  4M7X A;  4FJ7 A;  3H45 C;  4DV5 K;  3CC4 N;  5JIC A;  3LP1 A;  2G8U A;  3QIN A;  2X6N A;  3QIC A;  3OY9 A;  4IFV A;  1T05 A;  2NRT A;  4FLV A;  5C10 A;  3H1V X;  4JD2 A;  4DFP A;  1TAQ A;  4Q0B A;  2E1Y A;  4FK4 A;  3AO5 A;  4GVE A;  1IBK K;  3QFP A;  1TUU A;  4CJK A;  5M1K A;  1NOY A;  1XHX A;  3MK6 A;  1BOT O;  2YKN A;  3CJ7 A;  1E4G T;  2O4G A;  1YXQ A;  5LJV A;  3HK2 A;  4DR7 K;  3CF5 L;  1VQP N;  1QSL A;  3NMU A;  4FWN A;  1NJZ A;  3NH0 A;  1RT7 A;  5FRM A;  1DT9 A;  4DV0 K;  2HBL A;  3CCM N;  4GY2 B;  1EET A;  5C24 A;  1SL1 A;  3E9L A;  1BG3 A;  1ASU A;  1BA1 A;  4M63 C;  4KKO A;  4CD3 A;  3O4W A;  4NXN K;  4BR2 A;  2OA8 A;  4IFE A;  2BDP A;  2E6L A;  3V1R A;  5JVG L;  4FJL A;  3QET A;  2QKK A;  3CCU N;  1HJR A;  3D7E O;  1MWK A;  4IJA A;  3G6E N;  4AF1 A;  1UWB A;  3OS0 A;  4K41 A;  4CIG A;  3I55 N;  2E5L K;  3D2E A;  3MCA B;  4CZL A;  2Z1H A;  3OYF A;  1DTQ A;  3LM2 A;  3IG1 A;  4M3Z A;  1JCF A;  2O8D B;  4CGI A;  4GVM A;  1BI4 A;  4KI6 A;  3Q7B A;  5I42 A;  2VWB A;  2ETJ A;  2RE2 A;  4CE9 A;  2PYL A;  4EZ9 A;  3M8R A;  5BRF A;  3H6E A;  4A5A A;  5AQK A;  2RF2 A;  1RDA A;  1W0H A;  4C1N K;  1FK9 A;  2G8F A;  2HHQ A;  3QEW A;  4HUG A;  3VEO A;  3L0Q A;  4FM2 A;  4CJL A;  1HYV A;  4C23 A;  4KB1 A;  3WNF A;  1IH7 A;  3A5L C;  4DSF A;  4CJE A;  4IWV A;  3ZX0 A;  2KLA A;  4LF8 K;  2VWK A;  4CEA A;  1NGH A;  1KVC A;  3ZT3 A;  4JKD A;  4CFB A;  2UXC K;  4B9V A;  4MDB A;  4NXM K;  4CZH A;  3DLH A;  3NHG A;  2W6K A;  4ILJ A;  4EP5 A;  3CME N;  2KZZ A;  3V9X A;  1D9D A;  3PIP L;  2JGU A;  2FLO A;  5FPM A;  4CBU A;  1OH5 A;  2E20 A;  2A3Z A;  2OZM A;  3T7Z A;  4M3X A;  4B9L A;  4IEE A;  3VQE A;  2YX6 A;  3WUH A;  5E84 A;  5AQI A;  3IDH A;  4CZM A;  1MDU B;  1M1K O;  2ASO A;  2HHV A;  3NDK A;  1HNX K;  2FSJ A;  3OYA A;  2GWJ A;  3HO1 A;  4CEZ A;  2P9N A;  2P9I B;  5EOY A;  3LZI A;  1NJX A;  3T19 A;  3SAF A;  1YVN A;  4X64 K;  1NGC A;  2B6A A;  1SKW A;  1I3A A;  3U4L A;  4OGE A;  4BQZ A;  3ULD A;  1EWR A;  2GUI A;  4CBW A;  4Z4C A;  3NBP A;  2W41 A;  3OYG A;  3DOK A;  2ZF5 O;  5AZJ B;  3WXM B;  4JI8 K;  3NH2 A;  4KI4 A;  5C0Y A;  1T03 A;  3CFR A;  5EXW A;  4CGD A;  2W42 A;  3LP2 A;  3J81 O;  3VES A;  1BIS A;  1OKJ A;  2HF4 A;  4BVO A;  4JKA A;  1ZBI A;  5FPN A;  1S1U A;  2QWP A;  4FPA A;  4DTM A;  3CQY A;  5CZ2 A;  3NE6 A;  4ISF A;  2PBD A;  2UXD K;  1TK5 A;  1NMN A;  3HBT A;  4RW4 A;  2PY5 A;  3ITH A;  2F8S A;  3E66 A;  1ZC6 A;  3NCI A;  3A0I X;  4JEP A;  4EZ6 A;  5KPR A;  3DLR A;  4N76 A;  3ISN C;  2OPQ A;  4J2B A;  4KPY A;  4KHU A;  3KKR A;  4E1N A;  1NK4 A;  4FL9 A;  4M45 A;  3CIP A;  5KGX A;  2F9T A;  4A5B A;  5HRN A;  3PX0 A;  4FM0 A;  1KSP A;  3KHY A;  3I33 A;  3PSI A;  1GLA G;  2KZM A;  1YT3 A;  4BDY A;  4G1Q A;  3EKS A;  1HNV A;  3K0S A;  1ITG A;  2D5R A;  2F8T A;  1QZ5 A;  3AY9 A;  3DXM A;  1UOC A;  4F8R A;  2YHY A;  4H5R A;  3H3N O;  1YI2 N;  5AQU A;  3ID8 A;  1HMV A;  1BCO A;  3NF7 A;  4CZG A;  3K57 A;  3TR8 A;  5CR4 A;  3EKU A;  4DR2 K;  4LH4 A;  3CFP A;  4FXD A;  2ZGY A;  1JL1 A;  4F9O A;  2W6L A;  5BRD A;  5M1F A;  3H46 O;  2QXF A;  5GIP A;  2X74 A;  4NCA A;  3E9P A;  2IVO A;  1FW6 A;  4PL7 A;  4DQP A;  3C7N A;  1YHQ N;  4DTJ A;  4FYD A;  4FCY A;  4JI2 K;  3L6Q A;  4DTR A;  3LDS A;  2V52 B;  2EWS A;  3KD1 E;  4FW2 A;  2ITM A;  4ZTF A;  4KTQ A;  5C2D A;  2ZM6 K;  3PLA A;  2ATQ A;  3VEV A;  3AO1 A;  1Q82 O;  4L8R B;  3NVM A;  1IKW A;  5T7B A;  4J2A A;  4O8U A;  2P9L A;  1SS6 A;  4FWR A;  1QVG M;  4DMN A;  4BY9 C;  4H5T A;  2NRR A;  3GG4 A;  4XIU A;  2NRZ A;  3R6M A;  4Y0W A;  1R59 O;  4AIL C;  3BEX A;  3CHW A;  3O9R A;  3BF1 A;  1WSH A;  2OCE A;  3LM9 A;  2XY6 A;  5AQM A;  5AQJ A;  4E7K A;  5HRP A;  4F2S A;  1Y64 A;  2GEM A;  3K9J A;  1EX4 A;  3EZW A;  4BGB A;  3MX2 A;  2V51 B;  4IEI A;  2CGL A;  5DMR A;  5KPT A;  1TAU A;  3VQP A;  5J2P A;  3AVG A;  2HHS A;  4DKW A;  3RMA A;  1TL3 A;  4PL8 A;  3I0S A;  3V9U A;  3DYA A;  3WNH A;  1NLV A;  1VSL A;  2O8B B;  4JI0 K;  3KKS A;  3O6W A;  4HUE A;  4NLC A;  3P38 A;  1I94 K;  3AAQ A;  1QQC A;  2QW9 A;  3SV3 A;  3D6R A;  4FPB A;  3BY5 A;  4LFB K;  4CHO A;  5FPD A;  4GMJ B;  4K0K K;  3TPQ A;  3EY1 A;  4CZF A;  1EKE A;  1Q86 O;  4BQL A;  3P39 A;  3L3V A;  3NFA A;  4ID5 A;  2KKZ A;  5ELZ A;  1KAX A;  4BRI A;  4FZZ A;  3VTI A;  4W5N A;  4BRE A;  3W0L A;  1VHX A;  1WB9 A;  3CPE A;  1RTD A;  4JRQ A;  5LY3 A;  1QQN A;  4N5S A;  1YJW N;  5AQY A;  4DV6 K;  2J4R A;  4HCC A;  4JK8 A;  2FBX A;  1IBM K;  3V1Q A;  3ZSR A;  3VQ8 A;  5JVH L;  1RT2 A;  4H4O A;  1RTI A;  3FFI A;  4BRK A;  3SPZ A;  4KO0 A;  3MXM A;  1X9W A;  4BR7 A;  3ZSZ A;  3ZSO A;  4C8N A;  4LF6 K;  3IMX A;  2A6A A;  4DLG A;  4DS4 A;  3MCP A;  2XY5 A;  4X66 K;  3VA0 A;  4M3T A;  3SQ2 A;  2OPP A;  3QEX A;  3EL2 A;  1RCH A;  2P51 A;  4KH5 A;  3LWL A;  4I7F A;  3H3O B;  3KK2 A;  5AR0 A;  3QIO A;  2O8D A;  1MA9 B;  2Q1N A;  3ATU A;  5JS1 A;  2BH1 A;  3O9Q A;  1J9A A;  2YV0 X;  2QM1 A;  4M3U A;  4Z0U A;  3DM2 A;  4RW6 A;  4OPK A;  4IFY A;  5FRN A;  3V9S A;  3M8P A;  3PX4 A;  4BRG A;  4H03 B;  4CFD A;  2YHB A;  3AO4 A;  3SMS A;  2HB5 A;  4KTW A;  3QER A;  4DQI A;  4YOR A;  4CJT A;  1RT3 A;  1W9H A;  3MMV A;  4KFB A;  3CM6 A;  3LAN A;  3OVN A;  4Z4H A;  1RT6 A;  5C15 A;  2Y1I A;  3I0R A;  1C0M A;  3VQQ A;  1R0A A;  1IO2 A;  3GDQ A;  4DSI A;  4KH6 A;  4DHY A;  3CCL N;  3ZET A;  4CJW A;  2QXL A;  1WSJ A;  5AZI B;  5J2Q A;  3EO3 A;  3FZL A;  1LWE A;  3JAM O;  3KJV A;  3SQ4 A;  4CEB A;  3O1W A;  3JXU A;  2HHX A;  2E88 A;  1NGB A;  4IZ9 A;  3SPY A;  2AJQ A;  5EVZ A;  3TAR A;  1WOQ A;  2GBZ A;  1TK8 A;  4PKH A;  3QEI A;  4CBX A;  1BHL A;  1S6Q A;  2P9I A;  3DI6 A;  5SWM A;  4W5R A;  3AO2 A;  4IG0 A;  1RBR A;  3HZ6 A;  1T7P A;  3K5M A;  3OBY A;  1S6P A;  5K14 A;  4LF7 K;  3FZM A;  3WXI A;  4BRO A;  3TTD A;  1QTM A;  5AZJ A;  1KQS M;  1ZBU A;  3DRS A;  3CC7 N;  1HX1 A;  4GV3 A;  1H1V A;  4B3S K;  4AHT A;  4JI6 K;  4LD0 A;  1HR0 K;  1DGK N;  4DSE A;  3U9D A;  2QWM A;  5HRO A;  4DF4 A;  4ILH A;  3E9O A;  2YNH A;  4O0J A;  1RBV A;  4F2R A;  2O4I A;  3CFO A;  3U8X A;  4O5F A;  1U4B A;  1Q8I A;  5JLF A;  3THY B;  4AHV A;  2X78 A;  3A5O C;  1S1W A;  4U67 L;  1VQ6 N;  4DSJ A;  3F9K A;  2D0B A;  1RTH A;  4K25 A;  1QHT A;  2E2N A;  4CEF A;  4Q5V A;  4H5N A;  4JK7 A;  1VQ8 N;  1K6Y A;  3ZT2 A;  3AA5 X;  2UUB K;  4BC4 A;  3UKR B;  1NU0 A;  3VOV A;  1JLB A;  4M3R A;  4Z4I A;  2YNI A;  4OLA A;  4FSV A;  3ZEU B;  3R8E A;  2IC3 A;  3CCJ N;  3N4Q A;  3NVK A;  1BQM A;  3B8A X;  5BN8 A;  1DLO A;  1KCF A;  1T3V A;  4LC9 B;  4BWM A;  1NGJ A;  1NKB A;  4NCG A;  4ID1 A;  4HUF A;  2HNZ A;  3VEY A;  4FK0 A;  5HBM A;  1NJY A;  4DQR A;  2DY4 A;  3OJU A;  3F73 A;  2OPR A;  4B8C A;  1NGD A;  4FJX A;  1XMQ K;  1JCE A;  3VF2 A;  4E7I A;  4DTN A;  3RMC A;  1SKS A;  4FM1 A;  2NRW A;  3HST B;  1SUQ A;  3HM8 A;  3MXI A;  3C6T A;  3DXK B;  2F96 A;  4JHD B;  4A2A A;  3ENB A;  1TUY A;  3DRP A;  4BR9 A;  3J7A P;  1JLF A;  2D0O A;  5JLH A;  1NGA A;  4CFC A;  3QLH A;  2CH5 A;  4GV6 A;  5MLC Q;  3OYH A;  1J5O A;  1VSM A;  4XH4 A;  3K9K A;  3AO3 A;  3QNO A;  3CC2 N;  4FJN A;  4BDZ A;  1A5V A;  5FLX O;  4CED A;  3WNE A;  1JKH A;  2YNG A;  4W5Q A;  1VAZ A; 
#chains in the Genus database with same CATH homology
 1TK5 A;  4CHY A;  1J53 A;  4DF8 A;  5SZT A;  4E7J A;  1TKX A;  4RW4 A;  4ELT A;  3P5J A;  3QNN A;  4BWJ A;  4MQ3 A;  3ZCM A;  4I2P A;  4CJS A;  4O55 A;  4CES A;  4KRF A;  3TAE A;  3SUN A;  2PY5 A;  3ASM A;  4NCB A;  3ITH A;  1LAV A;  1Q9Y A;  2F8S A;  3NCI A;  3V6D A;  2QK9 A;  3ZSV A;  3NGI A;  3TAF A;  4EZ6 A;  3DLR A;  4N76 A;  3ISN C;  2OYQ A;  2OPQ A;  4J2B A;  4KPY A;  4FJ9 A;  4KHU A;  2XY8 A;  3KKR A;  4E1N A;  1NK4 A;  1U47 A;  1NK6 A;  4M45 A;  1S1X A;  1TKD A;  5KGX A;  5KRS A;  5HRN A;  3PX0 A;  5D3G A;  1HQE A;  4ELU A;  4FW1 A;  3TAG A;  4FM0 A;  1KSP A;  3VA3 A;  1UA1 A;  2KZM A;  2HNY A;  1FXX A;  3SCX A;  2Z1I A;  4FLW A;  1YT3 A;  4FVM A;  3PY8 A;  4OKJ A;  4BDY A;  4G1Q A;  3QES A;  1HNV A;  1ITG A;  2D5R A;  4OGC A;  1RDC A;  3PO5 A;  3G10 A;  2F8T A;  1LWC A;  1UOC A;  1BGX T;  5J2N A;  3TAM A;  4FLT A;  4H8K A;  4F8R A;  1YTA A;  1VSJ A;  4DTX A;  3NF7 A;  1HMV A;  1BCO A;  5C42 A;  4CHQ A;  3K57 A;  3TR8 A;  3RR8 A;  1BIU A;  1CLQ A;  1EXQ A;  1U49 A;  2HVI A;  1DTT A;  2B5J A;  3TAN A;  2ZQB A;  1NK7 A;  3K2P A;  4DQS A;  4LH4 A;  3CFP A;  4FXD A;  3WNG A;  1JLA A;  5J1E A;  1UA0 A;  4ZTJ A;  1JL1 A;  1NOZ A;  2IAJ A;  4LSN A;  1TK0 A;  3IS9 A;  1WAJ A;  4CHP A;  3K58 A;  4O5B A;  4E7H A;  1BL3 A;  4KHS A;  3NGY A;  4BDP A;  4BE0 A;  4M42 A;  2QXF A;  5KGW A;  4CJV A;  3EZ5 A;  2X74 A;  4IKF A;  4OKK A;  1TGO A;  4NCA A;  4O4G A;  3DRR A;  2PZS A;  3KTQ A;  1CXQ A;  4KTZ A;  1C0U A;  4OPJ A;  4DQP A;  1QE1 A;  2G8W A;  1S9G A;  4FK2 A;  4RW8 A;  3AVI A;  1ZYQ A;  3OYN A;  3JYT A;  4DTJ A;  4FYD A;  4FCY A;  4YNQ A;  1RT1 A;  3G0Z A;  4DU3 A;  4DTR A;  1ASV A;  4DFJ A;  3CQ8 A;  3KLF A;  3LDS A;  4F3O A;  4FJG A;  4JS5 A;  3KLI A;  1LW2 A;  3KK1 A;  3L8B A;  3I8D A;  4KHQ A;  2FBY A;  3KD1 E;  1D9F A;  4FW2 A;  1XC9 A;  1HRH A;  3RWU A;  4ZTF A;  3AVH A;  4KTQ A;  3LAK A;  1ASW A;  3ZSY A;  4W5T A;  3NGZ A;  3AVJ A;  2YHA A;  4B9M A;  4ELV A;  2HHT A;  3ZT1 A;  3TAB A;  2ATQ A;  3AO1 A;  4KV8 A;  3AVB A;  3C94 A;  4L8R B;  1L3V A;  3LAM A;  1IKW A;  4BAC A;  4DG1 A;  5T7B A;  3V9Z A;  3HJF A;  1VRU A;  4J2A A;  1IKV A;  4AHR A;  4QCL A;  2XY7 A;  4DTU A;  1C6V A;  4B8A B;  4DMN A;  3HP6 A;  3O4Q A;  3CM5 A;  4XIU A;  3L2W A;  1L3S A;  1KTQ A;  3SUQ A;  3NAE A;  4AIL C;  2QKB A;  1RDB A;  3D45 A;  4KB0 A;  3O3H A;  1SKR A;  1RIL A;  4B9U A;  4HHT A;  1WSH A;  2XY6 A;  2LSN A;  3AVF A;  4AHC A;  4E7K A;  1FKP A;  4C8O A;  5HRP A;  1UAX A;  4F2S A;  3C6U A;  1WAF A;  3H08 A;  3RTV A;  1EX4 A;  3KLH A;  3P83 D;  3QIP A;  5CZ1 A;  2HND A;  4CGF A;  5DMR A;  4LH5 A;  2B4J A;  2P5O A;  3IRX A;  3NF8 A;  2P5G A;  1GOB A;  3VQP A;  1TAU A;  3VQ7 A;  4FLZ A;  1NK5 A;  4K8X A;  5J2P A;  3AVG A;  4HVJ A;  3THV A;  2HHS A;  4CJ4 A;  3RMA A;  1TL3 A;  2HHW A;  1X9M A;  1VSD A;  3OYL A;  3I0S A;  2BE2 A;  4M41 A;  3U6F A;  1Z25 A;  2RN2 A;  3V9U A;  3K5L A;  3DYA A;  2Q3S A;  3WNH A;  3QEP A;  4FJJ A;  1VSL A;  5CYQ A;  3KKS A;  1G15 A;  4HUE A;  4ZHR A;  4Z4F A;  3PV8 A;  1IG9 A;  1RBU A;  2KQ2 A;  1WSI A;  1BCM A;  4CJ3 A;  3TWH A;  4CIE A;  4CFA A;  3SI6 A;  1QQC A;  3QEV A;  4MFB A;  4KHW A;  4PUO A;  3SV3 A;  2G8I A;  4ICL A;  3SUP A;  3L3U A;  1VSH A;  4CHO A;  5KI6 A;  4GMJ B;  1X1P A;  3AVK A;  3QO9 A;  3SQ0 A;  4C8K A;  3EY1 A;  1EKE A;  4TSX A;  3DMJ A;  3HPO A;  2ITG A;  3L3V A;  4OVL A;  3NFA A;  3LP3 A;  2Z1J A;  1TVR A;  4ID5 A;  4DTO A;  3TAQ A;  3OYM A;  3KLE A;  2G8V A;  1KRP A;  2E6M A;  4DU1 A;  1C1A A;  4DFM A;  4LSL A;  1HYS A;  2EX3 A;  1JXB A;  1JXE A;  1WNS A;  3V1O A;  3VN5 A;  5KTQ A;  4FZZ A;  4CEQ A;  4HCB A;  4W5N A;  2BAN A;  1L3U A;  4E19 A;  3AA4 A;  2YNF A;  1RTD A;  4JRQ A;  3AVN A;  3DLE A;  4Y1C A;  5CY4 A;  3E01 A;  4N5S A;  3VQD A;  5DK5 A;  3U3Y A;  2G8K A;  1B9F A;  1WSE A;  4CF0 A;  4FJI A;  4CER A;  3S3O A;  3M8S A;  4CCH A;  3SNN A;  4HCC A;  3OYI A;  1N6Q A;  4KHN A;  3VQ9 A;  2XRI A;  4B08 A;  2DFE A;  2FBX A;  3SJJ A;  4C8L A;  2BGG A;  3V1Q A;  3ZSR A;  4CHZ A;  4AHU A;  1KFS A;  4KHY A;  3PX6 A;  4Z4E A;  3MEG A;  3VQ8 A;  3HPH A;  1VSF A;  1RT2 A;  3ZT0 A;  3JSM A;  2GV9 A;  4H4O A;  1S5J A;  1RTI A;  3FFI A;  4PA1 A;  1L3T A;  3RRG A;  3SPZ A;  3MXM A;  4KO0 A;  3VQC A;  1X9W A;  2OZS A;  3NF9 A;  1LV5 A;  3DLG A;  4NYN A;  3V81 A;  3HXM A;  4Y1D A;  1D5A A;  1QSS A;  3DLB A;  4B9S A;  4I9Q A;  4EP4 A;  1JLG A;  2IS3 A;  3P1G A;  3RR7 A;  4CEO A;  3CG7 A;  3LWM A;  1WLJ A;  1F21 A;  3ZSZ A;  2Z1G A;  2NUB A;  4C8N A;  3ZSO A;  3EYZ A;  4FJ8 A;  4F3T A;  3K5O A;  1HYZ A;  2VG5 A;  4J2D A;  2P1J A;  4J2E A;  1RT4 A;  4OJR A;  1IKX A;  4DLG A;  1YTU A;  4DS4 A;  1Q9X A;  5J2M A;  1FKO A;  1WSG A;  2XY5 A;  3LAL A;  1Z26 A;  2R7Y A;  2VWJ A;  4RG8 A;  1KVB A;  2PYJ A;  3VA0 A;  4M3T A;  3V4I A;  2IGI A;  3VQB A;  3SQ2 A;  2OPP A;  3HVT A;  1C1B A;  4FLY A;  3AA3 A;  3QEX A;  3CYM A;  1RCH A;  1VRT A;  2P51 A;  3LWL A;  4I7F A;  1TV6 A;  2Y1J A;  2XHB A;  2XO7 A;  4B9N A;  1B9D A;  3KK2 A;  2HW3 A;  2DFF A;  1KVA A;  3HL8 A;  3QIO A;  2ZE2 A;  4CGJ A;  3HT3 A;  4FJH A;  2D0A A;  5JS2 A;  4AHS A;  1U45 A;  4KAZ A;  5HP1 A;  5JS1 A;  3OS1 A;  4DS5 A;  4DTS A;  1XHZ A;  1VK0 A;  4E0D A;  1J9A A;  2YV0 X;  2HVH A;  4M3U A;  4Z0U A;  4CJF A;  3DM2 A;  3PUF A;  4RW6 A;  4CHN A;  1SL0 A;  2WOM A;  4OPK A;  4IFY A;  3TI0 A;  2KFZ A;  5FRN A;  3O3F A;  3KD5 E;  3V9S A;  1N5Y A;  1C1C A;  3MEE A;  1NK0 A;  3M8P A;  3PX4 A;  4K8Z A;  4N41 A;  3HVR A;  1T8E A;  3L2Q A;  4RW7 A;  1GOC A;  3SZ2 A;  3DOL A;  1CZB A;  2KFN A;  3MED A;  4CFD A;  5HRS A;  3D0P A;  1NKE A;  1L5U A;  1SV5 A;  2YHB A;  1JLQ A;  3AO4 A;  3KLG A;  4CK2 A;  2HB5 A;  4KTW A;  3QER A;  1IKY A;  3HP9 A;  4DQI A;  2A1R A;  1D8Y A;  4CJT A;  4CK3 A;  1RT3 A;  1W9H A;  2FC0 A;  4FJ7 A;  2FBV A;  4KFB A;  1J54 A;  2X6S A;  3CM6 A;  3LAN A;  3OVN A;  4Z4H A;  1RT6 A;  2Y1I A;  3LP1 A;  2DFH A;  2G8U A;  3QIN A;  2X6N A;  3OY9 A;  3I0R A;  4IFV A;  1T05 A;  4FLV A;  1C0M A;  1S1V A;  4FLU A;  1NK9 A;  3VQQ A;  4CJP A;  3MAQ A;  4DFP A;  1TAQ A;  1R0A A;  4FJM A;  1C0T A;  4Q0B A;  4FK4 A;  4E3S A;  1IO2 A;  3AO5 A;  3A2F A;  3AVL A;  4DSI A;  4DSK A;  4CJW A;  1WSJ A;  5J2Q A;  3OJS A;  4PY5 A;  4CF8 A;  4CJ5 A;  4CJK A;  3B6P A;  4NYF A;  1NOY A;  1REV A;  1XHX A;  4KRE A;  1LWE A;  2IDO A;  3KJV A;  3SQ4 A;  2YKN A;  2O4G A;  4CEB A;  3HK2 A;  3TAP A;  1QSY A;  4W5O A;  3LPT A;  1O1W A;  4JS4 A;  1QSL A;  3HPG A;  1TL1 A;  2HHX A;  4DU4 A;  1NJZ A;  3NH0 A;  2ZD1 A;  1LWF A;  3AA2 A;  1MU2 A;  1RT7 A;  5FRM A;  4JRP A;  4CGH A;  1EET A;  1EP4 A;  3ZSQ A;  3SPY A;  5C24 A;  3NF6 A;  3UIQ A;  1SL1 A;  4F4K A;  2AJQ A;  3T1A A;  1JLE A;  3NH1 A;  3M8Q A;  3LP0 A;  1ASU A;  3KK3 A;  3OYD A;  4KKO A;  3TAR A;  3MXJ A;  4PQU A;  1KLM A;  2GBZ A;  4H4M A;  4BE1 A;  1TK8 A;  1A5X A;  3QEI A;  3SV4 A;  4E7L A;  1ZBF A;  1BHL A;  1S6Q A;  1VSI A;  1CXU A;  1YVU A;  3DI6 A;  3U3G A;  4CJU A;  5SWM A;  4W5R A;  2OA8 A;  4DFK A;  1XWL A;  3AO2 A;  4CJQ A;  4IG0 A;  2BDP A;  1RBR A;  2E6L A;  3V1R A;  4FJL A;  3QET A;  4R5P A;  1T7P A;  1LW0 A;  4JLH A;  2QKK A;  1HJR A;  4IDK A;  3K5M A;  1UWB A;  2E4L A;  1S6P A;  3OS0 A;  5K14 A;  1WN7 A;  4CIG A;  4FLX A;  4YFU A;  3S9H A;  4DLE A;  1SKS A;  2I5J A;  3PO4 A;  1QTM A;  3HM9 A;  4OLB A;  2EHG A;  2Z1H A;  3OYF A;  4QOZ B;  1ZBU A;  1DTQ A;  4O44 A;  3DRS A;  3IG1 A;  1TKZ A;  2YKM A;  3VQ5 A;  4M3Z A;  4IG3 A;  1X9S A;  4CF9 A;  4CGI A;  4GVM A;  4FJK A;  1A5W A;  1HPZ A;  1BI4 A;  4AHT A;  3K5N A;  4FJ5 A;  5I42 A;  4KI6 A;  3OYJ A;  4LD0 A;  4CF1 A;  4UQG A;  2ETJ A;  4I2Q A;  4PWD A;  4DSE A;  5HRO A;  3ZSX A;  4DF4 A;  4Z4G A;  4O0J A;  2YNH A;  4CE9 A;  1ZBL A;  1RBV A;  2HMI A;  2PYL A;  4EZ9 A;  1VSE A;  3OS2 A;  3M8R A;  4F2R A;  3CFO A;  2O4I A;  4CF2 A;  1U4B A;  2RF2 A;  1RDA A;  1W0H A;  3AVC A;  3S3M A;  1FK9 A;  1Q8I A;  2G8F A;  2HHQ A;  4AHV A;  1U04 A;  2X78 A;  4HUG A;  3QEW A;  4FM2 A;  1QS4 A;  4DTP A;  1S1W A;  4CJL A;  1HYV A;  4KB1 A;  2A1S A;  4E89 A;  1GOA A;  2D0C A;  3VQ4 A;  3WNF A;  3AVA A;  4AH9 A;  1IH7 A;  3AV9 A;  3BDP A;  1BIZ A;  5FRO A;  4BE2 A;  1HQU A;  4DSJ A;  3F9K A;  2D0B A;  5C25 A;  4DSF A;  3ZT4 A;  4CJE A;  1RTH A;  1QHT A;  1S9E A;  4HTU A;  4DSL A;  2VWK A;  4CEA A;  4Q5V A;  4CEF A;  5E41 A;  1JLC A;  1KVC A;  1TKT A;  5KRT A;  2KW4 A;  1RDD A;  3ZT3 A;  2WON A;  1K6Y A;  4IBN A;  5HRR A;  3VQ6 A;  3ZT2 A;  4CFB A;  3AA5 X;  3C95 A;  4WE1 A;  4CIF A;  3K59 A;  3HYF A;  4FZY A;  4B9V A;  1JLB A;  4M3R A;  4CEE A;  3DLH A;  4Z4I A;  4RW9 A;  2YNI A;  1NK8 A;  4OLA A;  3NHG A;  2IC3 A;  3L2V A;  3OYK A;  1HNI A;  4EP5 A;  3IAY A;  1BQM A;  3V9X A;  2KZZ A;  3RMD A;  1D9D A;  1BQN A;  4FZX C;  2JGU A;  3VQA A;  5FDL A;  1DLO A;  4GW6 A;  1KCF A;  3DLK A;  5I3U A;  2VG6 A;  4BWM A;  2OZM A;  1RBS A;  2RKI A;  4M3X A;  4B9L A;  4N47 A;  1I39 A;  1RTJ A;  3VQE A;  1NKB A;  1ZBH A;  2OPS A;  4NCG A;  4M3Y A;  1KFD A;  4ID1 A;  4CGG A;  4HUF A;  3L2R A;  1WSF A;  2IOC A;  2FBT A;  2HNZ A;  4FK0 A;  5HBM A;  2JLE A;  3O3G A;  1NJY A;  4DQR A;  4QAG A;  4CEC A;  3OJU A;  3S3N A;  3F73 A;  2OPR A;  4B8C A;  2DY4 A;  2HHU A;  3SQ1 A;  3OYE A;  4B3O A;  4FJX A;  2HHV A;  1KLN A;  3B6O A;  3NDK A;  3L2U A;  4E7I A;  3O4N A;  4DTN A;  3RMC A;  3ZSW A;  3OYA A;  4E1M A;  4FM1 A;  3HST B;  1SUQ A;  5CYM A;  4CEZ A;  3V9W A;  3LZI A;  1NJX A;  3T19 A;  3HO1 A;  3SUO A;  3MXI A;  2B6A A;  3AVM A;  2RPI A;  3KIO A;  3SYZ A;  1SKW A;  1Y97 A;  3C6T A;  2VG7 A;  4M3W A;  1B92 A;  1RT5 A;  5EU7 A;  4CK1 A;  3OYB A;  2F96 A;  1NJW A;  1I3A A;  4B9T A;  2DTU A;  4OGE A;  4O0I A;  4LY7 A;  3LZJ A;  2G8H A;  3ULD A;  3DRP A;  3MEC A;  1RNH A;  3RMB A;  2GUI A;  3LPU A;  4Z4C A;  4C8M A;  1JLF A;  3NBP A;  1VSK A;  3OYG A;  4CFC A;  3DOK A;  3QLH A;  4KI4 A;  3NH2 A;  1T03 A;  3CFR A;  4CGD A;  2W42 A;  1CZ9 A;  1JL2 A;  3LP2 A;  3OYH A;  1VSM A;  1SL2 A;  1J5O A;  3ALY A;  3AO3 A;  3QNO A;  1BIS A;  4N56 A;  2KTQ A;  1S1T A;  1BI4 B;  1RBT A;  3OYC A;  4OKE A;  1U48 A;  4CJR A;  1ZBI A;  4FJN A;  1S1U A;  3BGR A;  4BDZ A;  4DTM A;  3NE6 A;  1A5V A;  5CZ2 A;  1XI1 A;  4DWI A;  4CED A;  3RRH A;  3T3F A;  3WNE A;  1JKH A;  2YNG A;  4W5Q A;  1LAW A;  1NKC A;  5HLF A;  4I9L A;  4DQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...