3VQPA

Hiv-1 in core domain in complex with 2,3-dihydro-1,4-benzodioxin-5-ylmethanol
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
152
structure length
141
Chain Sequence
SSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 50
structure length 141
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqpA00
4I2PA 4DU1A 2RPIA 1QE1A 2D0AA 4CJUA 1X9SA 4ICLA 1HYVA 4FVMA 3AVAA 4KI4A 4FJGA 1LAVA 1LV5A 4KV8A 5CYMA 1NJYA 2VG5A 3OS1A 1S9EA 1HQEA 1CLQA 2D0CA 3V81A 4GW6A 3TAPA 3LZIA 3I8DA 4DU4A 4CK3A 1WSHA 3OYGA 3EZ5A 3HO1A 3HL8A 3QIOA 2YNGA 3RRHA 2HNYA 3WNEA 3F73A 1GOAA 3MEEA 3OYAA 3P83D 3SV4A 4DSEA 3ZSYA 4CJVA 3SV3A 4E19A 3SUQA 4DFMA 2PYLA 4GMJB 4KPYA 1QHTA 4O4GA 3ZT2A 2ATQA 3RR7A 2E6LA 3AVNA 2DFHA 3L3VA 1U45A 4I9LA 3KLIA 3P1GA 4H8KA 3HM9A 3K5NA 1FXXA 3HK2A 1SL1A 3VQCA 2ITGA 4CF1A 3PO5A 3ASMA 4DFJA 3DRPA 4O0IA 2A1RA 4LH5A 3QEWA 2OA8A 2YNFA 3AVBA 3K2PA 3HT3A 1NK6A 2PZSA 4W5QA 3EY1A 4E7KA 3O4QA 3VQ6A 3PV8A 2OYQA 1HYSA 3TWHA 1GOBA 1HYZA 1RDCA 2O4GA 5C42A 4BE0A 4DMNA 1Z26A 3U3YA 2G8HA 3ZT1A 2F8SA 4KAZA 5T7BA 3C6TA 3VQPA 2Z1HA 3KLFA 4I7FA 2OPPA 4CJFA 1A5VA 4CGJA 3VQQA 1LWFA 4FLXA 4DQSA 1WN7A 4N76A 4CEOA 1RDDA 2OPQA 3AO4A 1T8EA 4O0JA 1N5YA 4OJRA 3AO2A 3NGIA 1Q8IA 5I42A 4J2BA 1WSJA 2BANA 4CF2A 3OYMA 5FRNA 5C24A 3ZT4A 3HPGA 4FW2A 3JYTA 4FJMA 1VSFA 3HP9A 4FLZA 2Z1GA 3HSTB 1W0HA 1FKPA 2HHQA 3OYNA 2Z1IA 3ZT0A 1BIZA 4CHZA 3UIQA 2G8IA 4CJRA 1BGXT 3LDSA 3KLHA 3AA5X 1U49A 2BDPA 1ZBIA 4B9TA 3IS9A 4DSJA 2KZMA 4B8AB 4ID5A 3KTQA 4FLYA 1J5OA 2VG6A 3SZ2A 3LAKA 1XHZA 3RTVA 1W9HA 3SQ1A 4E7LA 2FC0A 3SYZA 1HQUA 4FJ7A 3DMJA 5DK5A 1VSMA 4BWMA 3O3FA 1JLQA 4H4MA 2HVIA 1VSEA 3RR8A 4EZ9A 1QSYA 3EYZA 5KGWA 4FJ8A 2ETJA 4M45A 3VQ5A 1CXUA 1BHLA 3V1RA 1L3SA 2HB5A 4OKEA 4CEBA 4HUFA 4YNQA 1TL1A 3HYFA 3ZSXA 3OYIA 2EHGA 4CHNA 3NAEA 3TAQA 3SNNA 3MEDA 3B6OA 2DFFA 4HTUA 5SWMA 4FYDA 3O4NA 4E89A 1T03A 2O4IA 3DOLA 3PUFA 3VQ9A 4DU3A 4AH9A 4CHQA 2VWJA 4N56A 4W5NA 3T3FA 1XI1A 2FBXA 4NCAA 1S6PA 4JRPA 3OS2A 3CFOA 1X9WA 3HPHA 4Z4HA 4LSLA 4DSIA 3VQ7A 3F9KA 3AO1A 1QS4A 5CZ1A 2G8VA 1WSFA 1RBUA 5J2PA 3OYFA 5KRTA 1YT3A 2F96A 3QERA 1WSGA 1SL2A 1WSIA 4FZXC 2IS3A 5HP1A 4Q0BA 1KVCA 3L2WA 1IG9A 3VQAA 5J2NA 5CZ2A 3LAMA 2YKMA 4B9LA 3VQDA 3THVA 3ALYA 3ZCMA 1J53A 4KRFA 1HJRA 2IAJA 2OZMA 4XIUA 1EKEA 3VA3A 3V1OA 3HVTA 2P51A 2HNDA 3OJSA 3HXMA 1NK4A 4G1QA 2HHXA 2OPRA 3AVLA 3LPTA 4O55A 2YV0X 2X78A 3C6UA 4CFDA 4HVJA 3QLHA 1NK9A 4N47A 1S1XA 4KHUA 4QCLA 5FROA 3QNOA 1WSEA 2YHAA 1QSSA 1VSJA 4B08A 2ZD1A 4B9SA 4FZZA 4CGHA 3OYHA 4KB1A 5HROA 4CHOA 4AHVA 3V1QA 3ZSWA 3PO4A 1LW2A 4CGIA 3ZSOA 4R5PA 1JL2A 1UOCA 3LZJA 4DFPA 3S9HA 1U47A 4J2DA 2XRIA 3LP1A 4FK4A 4F3TA 3OYBA 4DQPA 3JSMA 3DM2A 1YTAA 4HUEA 2P5GA 2X6SA 3QO9A 3TANA 2DTUA 4CF0A 2XY5A 4FZYA 4FJXA 1T05A 1RBTA 3DLGA 3SQ4A 3QIPA 3AA2A 3D45A 1TKZA 3TR8A 1IH7A 3NF6A 4C8NA 4DTPA 3BGRA 4BE2A 4CHYA 2KZZA 4OVLA 1NK5A 4IBNA 2DFEA 4Z0UA 2G8UA 4BE1A 1TKXA 3C95A 3AVJA 3K59A 4KREA 4CEDA 3RWUA 3KD1E 3NH2A 1NK0A 4KHQA 2OZSA 1TV6A 3K5MA 1HNIA 3PX0A 1UWBA 2AJQA 5K14A 4OLBA 1ASWA 3M8SA 1KFSA 3V6DA 1KVAA 2KW4A 4LSNA 4M42A 1IKVA 4KHNA 3O3GA 2D0BA 3NE6A 3MAQA 1HRHA 4E3SA 3V9XA 3SUPA 3KLEA 1C0TA 5KRSA 4ID1A 3QEXA 2OPSA 4DLGA 3AVGA 5CYQA 4DQRA 3NH1A 3DYAA 1U48A 4KB0A 1C1BA 3PY8A 4K8XA 4J2EA 4DTUA 1XC9A 4OGCA 3O3HA 1ASVA 4NCBA 1EXQA 3U3GA 5KGXA 3WNGA 1L3TA 2HNZA 4CFBA 1JXBA 4M3XA 2B6AA 1NJZA 4HUGA 2PY5A 3LALA 1RT5A 2GV9A 3AA3A 4E7JA 3MEGA 1U04A 3TAMA 3PX4A 4NYFA 1B9DA 4AILC 3QEVA 1YTUA 3IG1A 3D0PA 4FLTA 1X9MA 4FJNA 5FRMA 3NFAA 3KJVA 4CEAA 1RCHA 3DLBA 1SL0A 4BACA 4CE9A 2WOMA 4DQQA 1JL1A 4F3OA 4JS5A 1KLNA 2KFNA 4PQUA 2RF2A 1TL3A 1G15A 3KLGA 1T7PA 4FJ5A 4OPJA 4FM0A 4N5SA 4ELVA 4F4KA 2B4JA 3E01A 1NOYA 4I2QA 4B9NA 1NKCA 4CEEA 4DTOA 3NF7A 1NKBA 4IKFA 4CJQA 4DF8A 2P5OA 4CJEA 3OYDA 2FBYA 4ELTA 2HHTA 1S6QA 4CGDA 4FJKA 4NCGA 3LWMA 4W5OA 1A5WA 3AVMA 4RG8A 1TVRA 1F21A 1RDAA 1WAFA 4M41A 1JLFA 1RT4A 1S1TA 1IKYA 1JLGA 4K8ZA 4PA1A 3S3OA 1S1VA 1JLCA 4M3RA 1KSPA 1LW0A 3V9WA 5HLFA 3V9ZA 1ZBHA 3QETA 3V9UA 2Y1JA 3L8BA 4JLHA 4CCHA 1QTMA 4DG1A 4F2RA 2KTQA 3VA0A 3KD5E 1WLJA 4KTWA 3AO5A 2RKIA 4E1MA 2X6NA 1BISA 4OPKA 3KK2A 4FJJA 1RDBA 3A2FA 1B92A 4Y1CA 4AHSA 4CEQA 3IAYA 3B6PA 3TAGA 3VQBA 2P1JA 3DOKA 3V9SA 2QKKA 4FJHA 4FXDA 5D3GA 4Z4EA 1SV5A 1S5JA 1LWEA 1UAXA 1VRUA 4DTJA 1KFDA 4CK2A 4HHTA 4EZ6A 2IGIA 3L2RA 1I39A 1HNVA 4FLWA 3DLRA 2HMIA 4H4OA 3CM6A 3IRXA 5HRPA 1QSLA 4DQIA 4Z4FA 2F8TA 3MXJA 2KFZA 1NK8A 3TARA 5CY4A 4BWJA 4FW1A 4CF9A 1CZ9A 3V4IA 3CFPA 4CGGA 3I0RA 2R7YA 2ZQBA 3NBPA 2YKNA 3DI6A 4MFBA 2W42A 1NJWA 2QXFA 4IFYA 1Q9YA 4M3TA 1KTQA 3MXIA 3TAFA 4AHTA 4CIGA 3L2QA 1BL3A 1TK5A 4KHYA 1RTHA 1JLBA 3NGYA 3KK3A 3U6FA 3KK1A 4W5RA 2GBZA 3WNFA 4GVMA 5HBMA 5E41A 3KIOA 1SKRA 4RW6A 3G0ZA 1S9GA 2RN2A 3LP0A 3VN5A 4ZTJA 1MU2A 3LANA 4KI6A 4N41A 4ZHRA 3AVKA 4KO0A 4CJ5A 3OYCA 1DLOA 4FK2A 1CXQA 1B9FA 4RW8A 4FJ9A 1BI4A 3K5OA 5FDLA 3TI0A 1J54A 3S3NA 2G8WA 1D5AA 2LSNA 3CQ8A 4E7IA 4IG3A 4W5TA 1ZYQA 1VSIA 3AVFA 3DLKA 3AV9A 4BDYA 4CJWA 4CK1A 5EU7A 3OYKA 1I3AA 4OLAA 1BQMA 1HPZA 3S3MA 1L5UA 2EX3A 3RRGA 1LAWA 3LWLA 4DSFA 1RBRA 3SCXA 4LY7A 2HHSA 2HHWA 4F8RA 1L3UA 4QOZB 1ASUA 1RNHA 2JGUA 4DS4A 4B9MA 1KCFA 1EETA 2NUBA 2ZE2A 1TGOA 3ISNC 4IG0A 3QEPA 2HW3A 1TAQA 3OVNA 1VK0A 1C6VA 2XY7A 2HHVA 4KHWA 3HP6A 4FCYA 4OGEA 3OYJA 3SUNA 3NF8A 4BDPA 4L8RB 2I5JA 4UQGA 4AHRA 4KTZA 2FBTA 3KKSA 1BCOA 1RBSA 3HVRA 1FK9A 2YHBA 1X1PA 1RTJA 4MQ3A 4CJKA 4PUOA 4DTNA 4CIEA 1NKEA 4LD0A 4M3YA 1RTIA 2E6MA 2BE2A 3NF9A 1BCMA 2GUIA 2A1SA 1QQCA 4DFKA 1Z25A 1D8YA 5JS1A 5KTQA 3K58A 1R0AA 1Q9XA 1EX4A 1XHXA 1VRTA 5HRNA 2G8KA 4CHPA 4M3ZA 4FLUA 4E0DA 1JXEA 1S1UA 2VG7A 1YVUA 4CEZA 4DTSA 3CG7A 2XY8A 3M8QA 3OYEA 4B3OA 4CGFA 3LP2A 4M3WA 3NDKA 3MXMA 1L3VA 2DY4A 1TKTA 1BQNA 3H08A 3L3UA 4RW9A 2IOCA 5JS2A 4EP4A 1Y97A 1JLAA 2E4LA 3AVCA 2Z1JA 4I9QA 4FK0A 1FKOA 3DLEA 1SUQA 4EP5A 1NOZA 1SKWA 1GOCA 3ZSVA 4BDZA 4B9VA 1HMVA 2XO7A 4CFAA 3HJFA 5J2QA 1BI4B 2WONA 1C1AA 3DRSA 4C8MA 4Z4CA 4CF8A 1RTDA 3RMAA 4E7HA 1UA1A 4Y1DA 4C8KA 3CM5A 3G10A 3AVIA 1VSHA 1D9FA 4AHUA 4FLVA 4DWIA 3WNHA 4OKKA 3K57A 3QNNA 1RT6A 4HCBA 3C94A 1ITGA 4O44A 4FM2A 3SJJA 2X74A 4RW4A 4IFVA 4C8LA 5HRRA 3OY9A 1SKSA 2G8FA 3ITHA 2PYJA 4ELUA 1C0MA 1S1WA 4CJ4A 4DTRA 1D9DA 3NHGA 4WE1A 3NGZA 1N6QA 1C0UA 3KKRA 4O5BA 1UA0A 2YNIA 3BDPA 3L2VA 4DTMA 1RT2A 3ZT3A 3DLHA 5HRSA 2FBVA 3OYLA 3DRRA 4DSKA 3PX6A 1VSDA 4DSLA 3SI6A 1XWLA 4HCCA 4J2AA 1TAUA 1KVBA 4KHSA 5SZTA 1J9AA 1U4BA 1IKXA 2QKBA 3NCIA 4IDKA 4LH4A 1DTTA 4QAGA 4Q5VA 1JKHA 3L2UA 2XHBA 3SQ2A 4RW7A 3AVHA 4PY5A 4NYNA 3CYMA 3OS0A 3RMCA 4CERA 3SPZA 1RT7A 2KQ2A 4F2SA 2Q3SA 1ZBUA 2HVHA 4OKJA 1BIUA 1REVA 2JLEA 4CESA 1RT3A 4E1NA 4CJ3A 1KLMA 1TKDA 2IDOA 1EP4A 1ZBLA 1RILA 3VQ8A 1IKWA 3I0SA 3ZSZA 1VSKA 1KRPA 1RT1A 3HPOA 4FM1A 4DTXA 4PWDA 1C1CA 4ZTFA 1TK0A 3SUOA 3ULDA 2B5JA 2D5RA 3TABA 1TK8A 1JLEA 3QESA 4JRQA 1DTQA 2VWKA 5J2MA 3VQEA 2QK9A 3VQ4A 1A5XA 4KKOA 4CFCA 3MECA 3TAEA 4AHCA 1ZBFA 3LPUA 4TSXA 3SPYA 4KTQA 4DF4A 5C25A 4C8OA 4CEFA 5J1EA 4FJLA 3AO3A 3T19A 2XY6A 4B9UA 3T1AA 4FJIA 4Z4IA 2Y1IA 1LWCA 4B8CA 3ZSRA 4CJSA 3M8RA 4YFUA 1RBVA 4DLEA 2YNHA 3CFRA 1CZBA 3SQ0A 1K6YA 4DS5A 4CECA 5I3UA 1NK7A 3FFIA 4CJPA 3RMDA 3RMBA 3ZSQA 2HHUA 1NJXA 3P5JA 3K5LA 4KFBA 3QEIA 1O1WA 1VSLA 1IO2A 3M8PA 4CJLA 3QINA 3NH0A 3OJUA 4CJTA 4Z4GA 4CIFA 1WAJA 3LP3A 4M3UA 2BGGA 2IC3A 5DMRA 4JS4A 5KI6A 3AA4A 1WNSA
chains in the Genus database with same CATH superfamily
3MN7A 2ZJPL 1X9SA 1HYVA 3T1HK 4KI4A 5MLCQ 4GV3A 1RFQA 5CYMA 2GELA 4DHYA 1CLQA 3PIOL 1IG8A 3OYGA 3EZ5A 3QIOA 3RRHA 1GOAA 5AFUH 3VGMA 3P83D 4H5NA 3SV3A 1KD1O 3SAFA 4DFMA 2PYLA 3ZT2A 4A59A 2ATQA 2E6LA 2DFHA 3HK2A 3K5NA 3A5NC 4CF1A 1NBWA 1BUPA 3ASMA 4O0IA 3QEWA 2PZSA 3UKRA 5BRFA 3K0SA 3CC4N 5BPLA 1Z26A 3U3YA 2OCEA 4KAZA 4XH1A 1A5VA 4DV7K 1LWFA 4AF1A 2PAVA 3WXIA 3ZETA 2Q2RA 1SQKA 4J2BA 2NLXA 2A40A 5FRNA 3ZT4A 4B3TK 4X64K 3JYTA 4FJMA 3GDQA 3J7YP 5CE3A 4CZEA 4LFAK 2E2QA 3UIQA 1BGXT 3LDSA 1U49A 3AA5X 2BDPA 3CXCM 3VERA 3SZ2A 3LAKA 3BUZB 1N34K 3MN9A 3CJCA 3DMJA 1VSMA 1JLQA 4H4MA 2HVIA 3VEOA 3CMEN 5JVHL 4RTFD 1BU6O 4OKEA 3DLLL 3HYFA 3OYIA 3TAQA 1WOQA 2DFFA 1BG3A 3AGKA 3LDLA 3DOLA 2O4IA 3VQ9A 4DU3A 4AH9A 4CHQA 4BVPA 4NCAA 1S6PA 4ISFA 3F5TA 3F9KA 4K41A 4FWOA 3OYFA 5KRTA 3EN9A 4B1XB 5KQ8A 4LF4K 4DR4K 3S41A 3LAMA 5LMUK 4BC3A 4PKIA 3ZEUB 2OZMA 1EKEA 5M1OA 3V1OA 3OJSA 2NRWA 2HHXA 2OPRA 3C6UA 3VF6A 1S1XA 3MDQA 3MX2A 4AM6A 1QSSA 4FZZA 4CGHA 4KB1A 1QQNA 4BC2A 3PO4A 4DFPA 1UOCA 2A42A 1JCGA 2XRIA 3C65A 1HLUA 4HUEA 4CF0A 1RBTA 5ADXA 1EWQA 3DLGA 4PHTX 3SQ4A 1YUWA 4B3SK 3A8YA 3AA2A 3D45A 1TKZA 3E66A 3H1VX 4EAHD 1TYQB 2KZZA 3MK6A 1BA0A 4OVLA 2VYPA 1IBMK 4IBNA 2P9LB 4BE1A 3FZMA 4KREA 3RWUA 3NH2A 3K5MA 2E1ZA 3M8SA 1KFSA 3KHYA 4M42A 4H5VA 1IKVA 4E3SA 1VQKN 2Q0UA 3V9XA 1C0TA 3AVGA 1U48A 3DYAA 1C1BA 4FOEA 5AQLA 3WNGA 4CFBA 1JXBA 4BR2A 1NJZA 2PY5A 3MWTA 3MEGA 1U04A 4PL8A 3TAMA 3PX4A 1B9DA 4BRLA 1QQOA 3NMUA 3D0PA 4DV2K 4FLTA 4FJNA 3NFAA 3VEWA 4CEAA 5GIOA 4PKGA 1RCHA 3DLBA 1NMDA 4DQQA 3K9KA 4JS5A 1KLNA 4PQUA 3ENOA 3J7AP 4XH5A 4OX9K 1OH7A 1T7PA 4JKAA 4U7BA 4LC9B 4FM0A 3KK7A 1XNRK 2IIRA 3QDKA 4BRQA 4DTOA 1YITN 1YAGA 4ELTA 2O8FA 4W5OA 2EWSA 1TVRA 3WXKA 4PA1A 3S3OA 1S1VA 1JLCA 1LW0A 1K73O 3V9UA 2P9PB 2Y1JA 3L8BA 4JLHA 1QTMA 2A3ZA 4DG1A 3KD5E 2QWPA 4E1MA 4KTWA 2RKIA 4FJJA 2X6NA 3P39A 3A2FA 4AHSA 4CEQA 2DPNA 3VQBA 2P1JA 4DV1K 5AQQA 3V9SA 4FJHA 3HBTA 5D3GA 3I55N 3CCEN 1LWEA 1UAXA 4DTJA 4M7XA 4HHTA 3KWGA 3IFRA 1I39A 1HNVA 3CM6A 1QSLA 1HNWK 3ZX0A 3GE1A 1MWMA 2NRXA 1Q81O 1D4XA 2O8EA 1N36K 1HNZK 2ASPA 3DI6A 3Q7BA 4MFBA 2W42A 3TSPA 4KHYA 1BL3A 3P4IA 4GVMA 5HBMA 1VQLN 3KIOA 1QVGM 3FE1A 4KI6A 3WXMB 2BTFA 4CJ5A 4FK2A 1B9FA 3TI0A 3K5OA 5FDLA 4W5TA 3CCLN 3FLCO 1GLEG 5C0YA 4BDYA 4CJWA 1T6CA 2HHSA 2EX3A 4WYBA 4LY7A 2HHWA 3O80A 3RSEA 4DV0K 1ASUA 4BRHA 1KCFA 1VQ7N 3ISNC 1TGOA 2HF3A 3OVNA 1C6VA 2HHVA 4KHWA 1NGBA 2KKZA 2I5JA 5CHIA 4UQGA 2FBTA 3E9PA 1OH5A 3GG4A 4MQ3A 1X1PA 1RTJA 4DTNA 4HWIA 1NKEA 4ISGA 4LD0A 3FR0A 2W6KA 5LMNK 3H45C 1O13A 1Z25A 3AAPA 5AQOA 3CCSN 1R0AA 4B1YB 5HRNA 1VRTA 4CEZA 1HX1A 4H0TB 2V52B 4GKKK 1IBKK 1T3VA 2E4LA 3AVCA 4B3MK 1FKOA 1WBDA 1NOZA 4B1ZA 4BDZA 1S3XA 2QI2A 5J2QA 1C1AA 4CF8A 2A5XA 2O8BB 3MWPA 4IOAL 4AHUA 4DWIA 3WNHA 3K57A 4HCBA 1RT6A 3C94A 3K9JA 3SJJA 2X74A 3OY9A 4NLCA 3O08A 3EKSA 4MO4A 1C0UA 1UA0A 4JI8K 2P9UA 3L2VA 1VSDA 4HCCA 1TAUA 1DEJA 2WC9A 5SZTA 1ILYA 1YF5L 1U4BA 5M1NA 1HUXA 3H1QA 3U9ZA 1JKHA 1GLLO 5CR4A 5IWAK 1JCFA 3RMCA 3SPZA 2HVHA 3SMSA 2KQ2A 1ZBUA 1NWKA 2QW9A 2JLEA 1Q86O 2F9WA 4CJ3A 1HNXK 3FGUA 1RILA 1IKWA 3HPOA 4PWDA 3O9TA 3OHRA 4JRQA 2P9UB 2E88A 2NRRA 5LY3A 5M1KA 1NGEA 3TAEA 4TSXA 1K8AO 4BREA 3R1XA 1VQ8N 3JAMO 5AQMA 4YFUA 5IT9O 1MWKA 1W97L 3O5BA 3K5LA 3ULEA 1K8KB 3QINA 4YOXA 4Z4GA 1WAJA 2I7PA 4M3UA 2WFBA 2IC3A 3J80O 5KI6A 2V7YA 4DU1A 1QE1A 4CJUA 2QWQA 1NGJA 3AVAA 2VG5A 3V81A 4GW6A 3I8DA 3C7NB 4CK3A 1WSHA 4DKWA 3WEEA 4FWPA 3ENBA 5LL6Z 1NGHA 2HNYA 1Q7YO 3MEEA 4KH4A 3OYAA 4DSEA 2ZJQL 3SUQA 4GMJB 1QHTA 4O4GA 1YHQN 3RR7A 3QICA 3L3VA 3CD6N 4YOTA 1U45A 2KFNA 4I9LA 3KLIA 4WQ5C 1SL1A 3VQCA 3PO5A 4LH5A 3EE8A 2YNFA 3AVBA 4W5QA 3PV8A 1C0GA 3QBWA 3TWHA 3RSEB 1HYZA 4LF5K 1HYSA 3G25A 4NB4A 1HKBA 2G8HA 4FO0A 5AQRA 3VQPA 2Z1HA 4I7FA 4CJFA 1WN7A 5KPRA 3CCQN 1RDDA 1T8EA 4OJRA 1YI2N 4BR5A 5I42A 4K43A 3ZETB 1FKPA 1S72N 1Z6RA 5GAEP 3OYNA 4CJRA 4DV6K 3SLCA 4DCHA 2OTLN 2KZMA 2Q31A 2H3GX 1DGKN 2BUPA 1XHZA 3RTVA 1W9HA 5BN8A 4E7LA 2FC0A 3BEXA 4LF8K 1HQUA 5DK5A 4BWMA 3THYA 5AQWA 1VSEA 3ULEB 3M3ZA 3RR8A 4EZ9A 5KGWA 2ETJA 3VQ5A 2HB5A 4CEBA 3D7EO 4YNQA 3ZSXA 4O5FA 3SNNA 5SWMA 1T03A 2A41A 5AR0A 3TTDA 4CBXA 4X65K 4I6MB 3T1YK 3TSUA 4W5NA 4EHUA 3T3FA 3IKMA 3CCUN 1X9WA 3OS2A 1NLVA 1NU0A 3HPHA 3HM8A 4JKGB 4ILHA 5J2PA 5A2QO 3BP8A 4FZXC 2IS3A 4J8FA 4IEIA 4JV5K 1KVCA 1IG9A 4DR2K 5CZ2A 5KPTA 2ASOA 4XIUA 3TPQA 3HVTA 1NK4A 3HXMA 2E1YA 5GIPA 3LDPA 4O55A 2E2OA 2X78A 4KHUA 3D6RA 1VQ6N 4QCLA 4YOYA 3FZHA 5AQJA 1WSEA 2YHAA 3I33A 2UU9K 2HMPA 4CHOA 2O8DA 4DQ8A 4JKFA 1LW2A 4R5PA 3LZJA 4B9QA 4FK4A 3LP1A 1NGFA 4F3TA 2F7TA 3OYBA 3JSMA 3DM2A 3QO9A 3DXKA 3F9MA 3C6AA 5FPEA 2IVPA 1IH7A 4C8NA 5AZJA 4FWMA 4BRIA 1X3MA 3ZYYX 3H3NO 4JK9A 4Z94A 1NK0A 5TKYA 2E5LK 2OZSA 3PX0A 1UWBA 5K14A 3BZKA 3AGRA 1EWRA 4A5BA 2NNWA 2QXLA 1KXPA 3O6WA 3CPEA 3SUPA 3KLEA 2YHYA 3CERA 1XMQK 4DQRA 4KB0A 3OBWA 2P9KB 1ASVA 1EXQA 3U3GA 3ZX3A 2B6AA 4HUGA 3LALA 2IVNA 3AA3A 4E7JA 3J8AA 5FRMA 5AQYA 4CD1A 1GLFO 4WQ5A 1ATRA 1SL0A 1K9MO 2RF2A 4FL9A 1TL3A 3L6QA 5C2DA 3VEZA 4ISEA 2E2PA 4N5SA 4ELVA 2B4JA 4I2QA 1MA9B 2V51B 3C6HA 4YOUA 4JN4A 2P5OA 2UXBK 1P8ZA 4CGDA 4JHDB 4NCGA 4IWVA 2QWOA 1RDAA 1RT4A 3VEXA 1U2VB 4GY2B 2QEXN 4CCHA 4H03B 4F2RA 3VA0A 2KTQA 1WLJA 1NG9A 1BISA 5AQUA 1RDBA 2I7NA 3TAGA 2ASMA 4DR6K 1SV5A 1S5JA 4BRMA 4CK2A 4EZ6A 2IGIA 2HMIA 4H4OA 5HRPA 4DQIA 3SAHA 4DR3K 2KFZA 4WQ4A 3TARA 3O9UA 4FW1A 3B8AX 4IFEA 4CF9A 3V4IA 1ZC6A 3AAQA 3CFPA 2V7ZA 4CGGA 3I0RA 2FSJA 2E2NA 2YKNA 1KTQA 4CIGA 3D2FA 5JICA 3NGYA 3U6FA 4B1VA 2GBZA 4BQZA 3QBXA 1QZ6A 4CVNE 2O8FB 1S9GA 3VN5A 4DR7K 4IJAA 4N41A 4ZHRA 3AVKA 4OPHA 4RW8A 4FJ9A 1BI4A 2UUBK 1T6DA 3ATUA 3R8EA 1D5AA 2LSNA 3VOVA 4JHDA 1HKGA 4BG9A 1VSIA 3AVFA 3DLKA 1I3AA 4KHPK 2FXUA 1BQMA 3S3MA 1LAWA 4A2BA 4DSFA 1NGCA 1L3UA 1RNHA 2JGUA 4B9MA 4XH4A 1EETA 4BQLA 5I9EB 4IG0A 4A5AA 4F9OA 2UXCK 1VK0A 2VQFK 3OYJA 3NF8A 4BDPA 4MDAA 4AHRA 4E1JA 3KKSA 4CJKA 4JKEA 3CJ9A 4PUOA 1X9JA 1BCMA 3THXB 5JVGL 2GUIA 3BF1A 2A1SA 4CZIA 2VWBA 1D8YA 4CBUA 1HR0K 4CHPA 4BRFA 4FLUA 4JD2B 3M5RA 4MLHA 2ZJRL 3G71N 3CCRN 3HRGA 1M1KO 1L3VA 4Y0WA 2DY4A 3CF5L 1TKTA 3H08A 4RW9A 2IOCA 2YI1A 3THWA 1JLAA 5AQGA 4EP5A 1SKWA 2HBMA 3ZSVA 2PFUA 4B9VA 1HMVA 2HBLA 4QS7A 5FPDA 4LFBK 2HOEA 1RTDA 2GWJA 3RMAA 4E7HA 1UA1A 1P90A 3TTCA 1OH6A 3G10A 3AVIA 1VSHA 5AZJB 3QNNA 3GBTA 3MN5A 4O44A 4IDHA 4RW4A 4IFVA 4MDBA 1SKSA 4C8LA 3ITHA 2PYJA 4ELUA 3SBTA 1C0MA 1S1WA 1D9DA 3NHGA 4WE1A 4OO1J 1N6QA 4BGAA 4JAXA 1VQON 5KQDA 3BDPA 4DTMA 4A62A 1RT2A 3OYLA 4DSLA 3SI6A 3LM2A 4JKDA 2P9IB 2QKBA 3W0LA 4QAGA 4LH4A 1DTTA 4Q5VA 3L2UA 4CZHA 3AVHA 3LL3A 1VQ4N 3A5OC 4NYNA 4JK8A 4GV9A 3CQYA 3JXUA 4OKJA 4JI5K 1BIUA 1REVA 5EOYA 1QZ5A 1EP4A 3F2KA 2CGJA 3ZSZA 1KRPA 1C1CA 4FWQA 4ZTFA 1TK0A 3J81O 1XUPO 3O9RA 1DTQA 2YHWA 2NZTA 2QM1A 5J2MA 1NGAA 3VQEA 1TUUA 4KKOA 3VQ4A 1I94K 1ZBFA 3HOSA 1C0FA 4R79A 3LDOA 4CEFA 5J1EA 4FJLA 4FJIA 4B9UA 3CJAA 3DXMB 3T1AA 4Z4IA 1LWCA 3ID6A 1RBVA 4DLEA 2YNHA 3CFRA 3CHWA 1CZBA 3SQ0A 1K6YA 1NK7A 5GAGP 3ZSQA 2HHUA 3P5JA 4AQYK 1VSLA 1IO2A 4CJLA 3OJUA 4CIFA 3NVMA 3FZFA 4DR1K 4C1NI 4JS4A 3AA4A 2RPIA 4FWRA 3G6EN 3SBGA 4OPAA 3NVKA 1S9EA 1HQEA 2D0CA 3VTIA 1EO1A 3TAPA 1FJGK 4DU4A 3HO1A 3I8BA 3WNEA 2CH6A 5JMVA 4O8KA 4CJVA 1Q18A 4BRCA 1FW6A 4ILJA 5EY4A 3AVNA 3HM9A 2GUPA 2OA8A 2YX6A 4FWKA 3K2PA 1NK6A 3HT3A 3TTFA 3SMPA 3VQ6A 2W6LA 5C42A 4BE0A 4IOCL 2F8SA 3U8XA 5T7BA 2AA4A 3C6TA 2OPPA 3A5MC 4DQSA 3VQQA 1W7AA 5GAHP 3WUHA 4H0XB 5JLFA 4N76A 4O0JA 1LOTB 3AO2A 3NGIA 1WSJA 4NXMK 3OYMA 4DV5K 2BH1A 1J5EK 5C24A 4FW2A 1VSFA 3HP9A 3JS6A 3HSTB 5H1SQ 4FLZA 1KC8O 2HHQA 3L4QA 4CHZA 1BIZA 3TU5A 3KLHA 1ZBIA 4YDUA 3P38A 4B9TA 4B8AB 4ID5A 4GNIA 3KTQA 3CC7N 1CZAN 1J5OA 4BRPA 3QFUA 3SQ1A 3SYZA 3O3FA 1NGIA 4K0KK 4DUZK 4FJ8A 4M45A 4BRGA 1L3SA 4CD3A 4HUFA 4O8UA 1K8KA 4IZ9A 3HOTA 4CW7B 3B6OA 4HTUA 3VEVA 3H6EA 2J4RA 2VWJA 1WUAA 3O1BA 4WFNL 1XI1A 2FBXA 4DV3K 1NNEA 4JRPA 2ZF5O 3G4SN 4Z4HA 4LSLA 4H0YB 1W2BM 5CZ1A 4IO8A 1EQYA 1WSFA 1ESVA 2ZGZA 5BPMA 2F96A 3QERA 1WSGA 4Q0BA 3DWLA 5HP1A 3L2WA 3VQAA 2YKMA 3VQDA 3ALYA 4YOVA 3L0QA 1HJRA 2IAJA 3M6GA 3CI5A 4KRFA 2P51A 2HNDA 3U9DA 4HVJA 4Z4EA 2UUAK 2YV0X 5LJVA 3QLHA 4N47A 5FROA 4JKCA 3UE5A 1VSJA 4B08A 3OYHA 3V1QA 3ZSWA 4JD2A 4DR5K 3ZSOA 1JL2A 4BC4A 3CJBA 1ATSA 1NGGA 4DQPA 2P5GA 2X6SA 4C23A 2A6AA 2DTUA 4FJXA 3SK3A 3QIPA 3GL1A 4DTPA 3NF6A 4M7YA 3BGRA 1S22A 4BE2A 5E84A 4A2AA 4EFHA 2DFEA 3IDHA 4Z0UA 1JCEA 4JI3K 4LF7K 5HOOA 3THYB 4KHQA 1HNIA 2AJQA 4OLBA 1ASWA 3V6DA 3MCAB 4KHNA 3O3GA 3VGKA 3NE6A 3EKUA 4NXNK 5KRSA 4DLGA 5CYQA 2UUCK 4CZMA 4H5RA 5BPNA 3PY8A 1RDUA 4J2EA 1XC9A 4FWSA 3O3HA 4NCBA 1L3TA 4WFBL 1NJIO 2GV9A 3R9PA 4KBOA 4NYFA 1YTUA 3IG1A 1X9MA 3KJVA 4BRDA 1QQMA 3OW2M 4CE9A 1YJ9N 1JL1A 4FWNA 5BR9A 3MCPA 4FJ5A 4H0OA 1N33K 4KH5A 3WQUA 4F4KA 3E01A 4B9NA 1NKCA 1NKBA 4JI7K 4CJQA 4CJEA 2FBYA 2HHTA 1S6QA 3MX5A 4CZKA 3PSFA 2HF4A 3R6MA 1A5WA 3LWMA 4JNEA 3CETA 4RG8A 2CH5A 2NRHA 1F21A 1WAFA 4M41A 1JLFA 1S1TA 4FPAA 1JLGA 2ZM6K 1KSPA 4MO5A 5HLFA 1ZBHA 3QETA 1BWFO 3KK2A 4Y1CA 3L4IA 5BN9A 3Q7CA 1OKJA 2QKKA 3PLAA 4FXDA 2NRTA 5KPZA 1KFDA 3WQTA 4XEIA 1V4SA 4B1UB 3L2RA 4Z4FA 3IRXA 3P31A 1NMNA 3HI0A 5M1PA 3O8MA 5CY4A 1NK8A 1Q82O 1CZ9A 3BY5A 4A57A 3SAGA 3I56N 2R7YA 2ZQBA 4M3TA 1NJWA 2QXFA 4IFYA 1Q9YA 4UY8O 3WXLA 3TAFA 4AHTA 1TK5A 3KK3A 3KK1A 2D1KA 4W5RA 1YIJN 1SAZA 5E41A 2O8CA 3E9OA 4RW6A 3G0ZA 3SJHA 1VQ5N 2RN2A 1MU2A 4KO0A 2Q0RA 1KQSM 1WB9A 1J54A 3S3NA 2P9KA 4E7IA 1HJOA 1M90O 5C2FA 4BROA 4OLAA 4CK1A 5EU7A 5EX5A 3RRGA 3SCXA 1RBRA 2OANA 2HBKA 4QOZB 5AQNA 1BOTO 1VQ9N 3QEPA 5E26A 5B8HA 1XMOK 3HP6A 2NRZA 2HHHK 4L8RB 3MMVA 3THXA 3UB5A 4KTZA 1KAYA 1FK9A 3U4LA 3MN6A 4CIEA 2Q36A 1RTIA 3W3DA 4M3YA 3EE9A 4U67L 1E4GT 1QQCA 5FPNA 1VQMN 3O9QA 5JS1A 1NM1A 5KTQA 1Q9XA 1EX4A 1XHXA 3A0IX 4E0DA 1HPMA 3ATVA 1JXEA 1S1UA 2GTDA 3OYEA 4B3OA 4M3WA 3NDKA 5TKWA 5JS2A 3D2EA 1Y97A 1GLJO 4HTLA 1SUQA 2XO7A 3HJFA 1BI4B 2WONA 3DRSA 4C8MA 4Z4CA 1IV0A 2P9LA 2CGLA 4Y1DA 3CM5A 4CZFA 3VF4A 1TYQA 3QB0A 5HRRA 2WUSA 1TUYA 3D2FB 2G8FA 2ITMA 2JWKA 2IVOA 4CJ4A 3T7ZA 3NGZA 4O5BA 2YNIA 2D4WA 3ZT3A 4DSKA 3N4QA 4NO7A 1KVBA 2YJEA 4KHSA 1J9AA 5AZIB 1IKXA 1SZ2A 4KH6A 3SQ2A 4RW7A 3OTOK 1BA1A 3E9LA 4CERA 1ATNA 3ZEUA 4CESA 1KLMA 2IDOA 3H3OB 3I0SA 4BR7A 2OTJN 5AZIA 1RT1A 4CZLA 3SUOA 3ULDA 3TABA 1JLEA 1XQSC 4IEEA 3QESA 2QK9A 1QVFM 3VPZA 3MECA 2UXDK 4AHCA 4KTQA 4DF4A 5C25A 1GLAG 4L3QA 3AO3A 2XY6A 5ELZA 2Y1IA 4CJSA 1BO5O 3DJCA 3VETA 2O8EB 4DS5A 5I3UA 3FFIA 3RMDA 4H0PA 3QEIA 2D0OA 1O1WA 4K25A 3NH0A 2YHXA 5DMRA 4FLWA 1WNSA 3LDQA 4I2PA 2D0AA 4ICLA 3ZLJA 1IJJA 4C1NK 4FVMA 4FJGA 1LAVA 2KHOA 5C12A 1LV5A 4KV8A 1R59O 1NJYA 1GLCG 3OS1A 4FOIA 3LZIA 3LDNA 1KAXA 2QWRA 5JLHA 3HL8A 4YY3K 2YNGA 5BREA 3F73A 3SV4A 3GOIA 3ZSYA 3LM9A 4E19A 5AQKA 4KPYA 2FF6A 2F4VK 3FFKB 3P1GA 4H8KA 1FXXA 3QFPA 4FSVA 2ITGA 2WBNA 2E8AA 4DFJA 3DRPA 2A1RA 5M1FA 3IUCA 3EY1A 4E7KA 3O4QA 4BG8A 2OYQA 5F2RA 1GOBA 2QA4N 4YDUC 1RDCA 2O4GA 5F1XA 3IMXA 3UKRB 4DMNA 1VHXA 3ZT1A 2W41A 3KLFA 4CGJA 4IO9L 1JJ2M 4FLXA 4BGBA 5AQTA 4NLBA 2OPQA 3AO4A 3N4PA 1N5YA 1Q8IA 4WCEL 5GINA 1Y64A 2BANA 4CF2A 2HSTA 3HPGA 2Z1GA 1W0HA 4DUYK 2Z1IA 3ZT0A 2G8IA 4CBWA 2O8DB 3IS9A 4DSJA 5BRHA 4FLYA 4CZJA 2VG6A 2RE2A 4WF9L 4G9ZA 4DV4K 4BR4A 4FJ7A 4B1WB 1QSYA 3EYZA 1CXUA 1BHLA 4JKHA 3V1RA 5BRDA 2UYTA 1TL1A 2EHGA 4CHNA 3NAEA 3PIPL 3MEDA 5AFUA 1E3MA 3BZCA 3ENHA 4FYDA 4BRAA 3O4NA 4E89A 3PUFA 4IXCA 3WXJA 4N56A 4X62K 1BDGA 3CFOA 4DSIA 3KZBA 5FLXO 4MLEA 3VQ7A 1WBBA 2YJFA 3AO1A 1QS4A 4I6MA 2G8VA 3M1FA 1RBUA 3FZKA 1YT3A 1SL2A 1WSIA 1J6ZA 3KWIA 4BR9A 5AQXA 3O1WA 3CCMN 5J2NA 1V4TA 4B9LA 4GKJK 3THVA 3ZCMA 4AM7A 4YHHK 1J53A 3VA3A 4FPBA 3HSCA 4G1QA 3AVLA 3LPTA 4CFDA 3DXMA 1NK9A 2FSKA 4X66K 3QNOA 4IJNA 4B9SA 2ZD1A 3VESA 4EHTA 5HROA 4AHVA 4CJ7A 4CGIA 1U47A 3S9HA 4J2DA 3HTVA 2GEMA 1YTAA 3KVGA 2D0PA 3TANA 1U2VA 2XY5A 4FZYA 3CIPA 1T05A 4PL7A 4JI4K 3TR8A 5AQVA 1VAZA 4CHYA 4LF6K 3D2EB 1NK5A 2RHKA 3T69A 2G8UA 1TKXA 3C95A 2P9IA 3AVJA 3K59A 5FPMA 3ZX2A 4CEDA 2CGKA 3KD1E 5EXWA 1TV6A 1T44A 1KVAA 2KW4A 4LSNA 2D0BA 1OH8A 3MAQA 1HRHA 1VQPN 3QEXA 4ID1A 5DM7L 2OPSA 3NH1A 4K8XA 3FZLA 3WEEB 4DTUA 2P9NA 1YJWN 4OGCA 4QS8A 1H1VA 5KGXA 4JKBA 3EZWA 2HNZA 4M3XA 1XNQK 1RT5A 5AQSA 1YJNN 5C15A 4AILC 3QEVA 3THWB 1GLDG 4BACA 4F3OA 2WOMA 3ID8A 1G15A 1RDWX 3KLGA 4OPJA 1NOYA 3AY9A 5GADP 1SS6A 3CCJN 4CEEA 3NF7A 4IKFA 4DF8A 3OYDA 4BVOA 2GX9A 4YOWA 4FJKA 5AJ3K 3AVMA 2O8CB 3TSQA 4JEPA 3O9SA 1IKYA 4K8ZA 3DXKB 2QWMA 4M3RA 3V9WA 2ZGYA 3V9ZA 1HKCA 2P9PA 1OVYA 2GWKA 3AO5A 4OPKA 3E1YA 1N8RO 1B92A 3IAYA 3B6PA 4V19S 3H46O 5AQZA 3DOKA 4BRKA 2P9SA 1VRUA 3VENA 1ZBSA 3DLRA 2F8TA 3MXJA 4JI2K 1RGIA 1Z05A 4BWJA 4B3RK 3CC2N 1MDUB 3NBPA 3VEYA 1X3NA 3MXIA 5EVZA 3L2QA 1RTHA 1JLBA 3WNFA 3EEQA 4CZGA 4JKGA 2QTDA 1DKGD 1SKRA 4IOXA 3LP0A 4ZTJA 4H5WA 1LCUA 3R3LA 3A5LC 3LANA 4WQ4C 4A61A 2O8BA 3OYCA 1DLOA 1CXQA 4GVEA 3CCVN 3AARA 3UKUB 2G8WA 3CQ8A 2E20A 4IG3A 1ZYQA 2Q97A 1KAZA 3AV9A 5AQFA 3OYKA 4QS9A 3J7ZO 2AP1A 1HPZA 1L5UA 3LWLA 4F8RA 4JYAK 5M1QA 1YXQA 4DS4A 4BR0A 2NUBA 2ZE2A 4YORA 2YCHA 2HW3A 1TAQA 3DAWA 3CQXA 2XY7A 4FCYA 4OGEA 3SUNA 4ILGB 4JI0K 2QWNA 1BCOA 1RBSA 2W40A 5AQHA 3HVRA 2YHBA 5AQPA 2E6MA 1VQNN 4BC5A 2BE2A 3NF9A 4DFKA 2P9NB 3K58A 4M3ZA 2G8KA 3BF3A 1DT9A 2VG7A 1YVUA 2ZWHA 4DTSA 3CG7A 5AQIA 2XY8A 2FLOA 3M8QA 3VMFB 3LP2A 4CGFA 3MXMA 1E4FT 2VGNA 3WT0A 4EP4A 1BQNA 1NGDA 3L3UA 5C10A 2Z1JA 2JWLA 4I9QA 4FK0A 3DLEA 1GOCA 1QHAA 4CFAA 3C0BA 4C8KA 3O4WA 1D9FA 1GLBG 1OVQA 4FLVA 4OKKA 2NRVA 4JI1K 4JI6K 4H0VB 1ITGA 3RVCA 4FM2A 2FF3B 2PBDA 4FWLA 2VGMA 3C7NA 3VTHA 4DTRA 4BY9C 3VF2A 3KKRA 3CMAN 3CJ1A 4WFAL 4JK7A 4H5TA 3DLHA 5HRSA 2FBVA 3DRRA 3CJ7A 3PX6A 3OBYA 1XWLA 3VGLA 4J2AA 4LF9K 3EL2A 3EO3A 2KLAA 2Q1NA 4RCHA 3NCIA 4IDKA 2HBJA 2XHBA 1N32K 4PY5A 3CYMA 3OS0A 4F2SA 1RT7A 2VQEK 3OA9A 2Q3SA 4GV6A 2WTUA 1YVNA 3UKUA 1RT3A 4E1NA 1TKDA 4DB3A 1ZBLA 3VQ8A 1VSKA 4DTXA 4FM1A 1U6ZA 3QMLA 4EIAA 2B5JA 2D5RA 2VCPA 1G99A 1TK8A 1IBLK 2VWKA 1A5XA 1ZXOA 4CFCA 5F0XA 5DM6L 3LPUA 3SPYA 5BR8K 4C8OA 3T19A 2FSNA 4BRNA 4M63C 4B8CA 3PSIA 3ZSRA 3M8RA 2F9TA 4PKHA 5ADXH 5LJWA 4LFCK 4CECA 5HL7L 1XC3A 4CJPA 3CPWM 3RMBA 1NJXA 4KFBA 4RWTA 4FVUA 3M8PA 4CI6A 2QWLA 4CJTA 2P9SB 3LP3A 2BGGA 3HZ6A 4CEOA 4K42A
chains in the Genus database with same CATH topology
4I2PA 4DU1A 2RPIA 1QE1A 2D0AA 4CJUA 1X9SA 4ICLA 1HYVA 4FVMA 3AVAA 4KI4A 4FJGA 1LAVA 1LV5A 4KV8A 5CYMA 1NJYA 2VG5A 3OS1A 1S9EA 1HQEA 1CLQA 2D0CA 3V81A 4GW6A 3TAPA 3LZIA 3I8DA 4DU4A 4CK3A 1WSHA 3OYGA 3EZ5A 3HO1A 3HL8A 3QIOA 2YNGA 3RRHA 2HNYA 3WNEA 3F73A 1GOAA 3MEEA 3OYAA 3P83D 3SV4A 4DSEA 3ZSYA 4CJVA 3SV3A 4E19A 3SUQA 4DFMA 2PYLA 4GMJB 4KPYA 1QHTA 4O4GA 3ZT2A 2ATQA 3RR7A 2E6LA 3AVNA 2DFHA 3L3VA 1U45A 4I9LA 3KLIA 3P1GA 4H8KA 3HM9A 3K5NA 1FXXA 3HK2A 1SL1A 3VQCA 2ITGA 4CF1A 3PO5A 3ASMA 4DFJA 3DRPA 4O0IA 2A1RA 4LH5A 3QEWA 2OA8A 2YNFA 3AVBA 3K2PA 3HT3A 1NK6A 2PZSA 4W5QA 3EY1A 4E7KA 3O4QA 3VQ6A 3PV8A 2OYQA 1HYSA 3TWHA 1GOBA 1HYZA 1RDCA 2O4GA 5C42A 4BE0A 4DMNA 1Z26A 3U3YA 2G8HA 3ZT1A 2F8SA 4KAZA 5T7BA 3C6TA 3VQPA 2Z1HA 3KLFA 4I7FA 2OPPA 4CJFA 1A5VA 4CGJA 3VQQA 1LWFA 4FLXA 4DQSA 1WN7A 4N76A 4CEOA 1RDDA 2OPQA 3AO4A 1T8EA 4O0JA 1N5YA 4OJRA 3AO2A 3NGIA 1Q8IA 5I42A 4J2BA 1WSJA 2BANA 4CF2A 3OYMA 5FRNA 5C24A 3ZT4A 3HPGA 4FW2A 3JYTA 4FJMA 1VSFA 3HP9A 4FLZA 2Z1GA 3HSTB 1W0HA 1FKPA 2HHQA 3OYNA 2Z1IA 3ZT0A 1BIZA 4CHZA 3UIQA 2G8IA 4CJRA 1BGXT 3LDSA 3KLHA 3AA5X 1U49A 2BDPA 1ZBIA 4B9TA 3IS9A 4DSJA 2KZMA 4B8AB 4ID5A 3KTQA 4FLYA 1J5OA 2VG6A 3SZ2A 3LAKA 1XHZA 3RTVA 1W9HA 3SQ1A 4E7LA 2FC0A 3SYZA 1HQUA 4FJ7A 3DMJA 5DK5A 1VSMA 4BWMA 3O3FA 1JLQA 4H4MA 2HVIA 1VSEA 3RR8A 4EZ9A 1QSYA 3EYZA 5KGWA 4FJ8A 2ETJA 4M45A 3VQ5A 1CXUA 1BHLA 3V1RA 1L3SA 2HB5A 4OKEA 4CEBA 4HUFA 4YNQA 1TL1A 3HYFA 3ZSXA 3OYIA 2EHGA 4CHNA 3NAEA 3TAQA 3SNNA 3MEDA 3B6OA 2DFFA 4HTUA 5SWMA 4FYDA 3O4NA 4E89A 1T03A 2O4IA 3DOLA 3PUFA 3VQ9A 4DU3A 4AH9A 4CHQA 2VWJA 4N56A 4W5NA 3T3FA 1XI1A 2FBXA 4NCAA 1S6PA 4JRPA 3OS2A 3CFOA 1X9WA 3HPHA 4Z4HA 4LSLA 4DSIA 3VQ7A 3F9KA 3AO1A 1QS4A 5CZ1A 2G8VA 1WSFA 1RBUA 5J2PA 3OYFA 5KRTA 1YT3A 2F96A 3QERA 1WSGA 1SL2A 1WSIA 4FZXC 2IS3A 5HP1A 4Q0BA 1KVCA 3L2WA 1IG9A 3VQAA 5J2NA 5CZ2A 3LAMA 2YKMA 4B9LA 3VQDA 3THVA 3ALYA 3ZCMA 1J53A 4KRFA 1HJRA 2IAJA 2OZMA 4XIUA 1EKEA 3VA3A 3V1OA 3HVTA 2P51A 2HNDA 3OJSA 3HXMA 1NK4A 4G1QA 2HHXA 2OPRA 3AVLA 3LPTA 4O55A 2YV0X 2X78A 3C6UA 4CFDA 4HVJA 3QLHA 1NK9A 4N47A 1S1XA 4KHUA 4QCLA 5FROA 3QNOA 1WSEA 2YHAA 1QSSA 1VSJA 4B08A 2ZD1A 4B9SA 4FZZA 4CGHA 3OYHA 4KB1A 5HROA 4CHOA 4AHVA 3V1QA 3ZSWA 3PO4A 1LW2A 4CGIA 3ZSOA 4R5PA 1JL2A 1UOCA 3LZJA 4DFPA 3S9HA 1U47A 4J2DA 2XRIA 3LP1A 4FK4A 4F3TA 3OYBA 4DQPA 3JSMA 3DM2A 1YTAA 4HUEA 2P5GA 2X6SA 3QO9A 3TANA 2DTUA 4CF0A 2XY5A 4FZYA 4FJXA 1T05A 1RBTA 3DLGA 3SQ4A 3QIPA 3AA2A 3D45A 1TKZA 3TR8A 1IH7A 3NF6A 4C8NA 4DTPA 3BGRA 4BE2A 4CHYA 2KZZA 4OVLA 1NK5A 4IBNA 2DFEA 4Z0UA 2G8UA 4BE1A 1TKXA 3C95A 3AVJA 3K59A 4KREA 4CEDA 3RWUA 3KD1E 3NH2A 1NK0A 4KHQA 2OZSA 1TV6A 3K5MA 1HNIA 3PX0A 1UWBA 2AJQA 5K14A 4OLBA 1ASWA 3M8SA 1KFSA 3V6DA 1KVAA 2KW4A 4LSNA 4M42A 1IKVA 4KHNA 3O3GA 2D0BA 3NE6A 3MAQA 1HRHA 4E3SA 3V9XA 3SUPA 3KLEA 1C0TA 5KRSA 4ID1A 3QEXA 2OPSA 4DLGA 3AVGA 5CYQA 4DQRA 3NH1A 3DYAA 1U48A 4KB0A 1C1BA 3PY8A 4K8XA 4J2EA 4DTUA 1XC9A 4OGCA 3O3HA 1ASVA 4NCBA 1EXQA 3U3GA 5KGXA 3WNGA 1L3TA 2HNZA 4CFBA 1JXBA 4M3XA 2B6AA 1NJZA 4HUGA 2PY5A 3LALA 1RT5A 2GV9A 3AA3A 4E7JA 3MEGA 1U04A 3TAMA 3PX4A 4NYFA 1B9DA 4AILC 3QEVA 1YTUA 3IG1A 3D0PA 4FLTA 1X9MA 4FJNA 5FRMA 3NFAA 3KJVA 4CEAA 1RCHA 3DLBA 1SL0A 4BACA 4CE9A 2WOMA 4DQQA 1JL1A 4F3OA 4JS5A 1KLNA 2KFNA 4PQUA 2RF2A 1TL3A 1G15A 3KLGA 1T7PA 4FJ5A 4OPJA 4FM0A 4N5SA 4ELVA 4F4KA 2B4JA 3E01A 1NOYA 4I2QA 4B9NA 1NKCA 4CEEA 4DTOA 3NF7A 1NKBA 4IKFA 4CJQA 4DF8A 2P5OA 4CJEA 3OYDA 2FBYA 4ELTA 2HHTA 1S6QA 4CGDA 4FJKA 4NCGA 3LWMA 4W5OA 1A5WA 3AVMA 4RG8A 1TVRA 1F21A 1RDAA 1WAFA 4M41A 1JLFA 1RT4A 1S1TA 1IKYA 1JLGA 4K8ZA 4PA1A 3S3OA 1S1VA 1JLCA 4M3RA 1KSPA 1LW0A 3V9WA 5HLFA 3V9ZA 1ZBHA 3QETA 3V9UA 2Y1JA 3L8BA 4JLHA 4CCHA 1QTMA 4DG1A 4F2RA 2KTQA 3VA0A 3KD5E 1WLJA 4KTWA 3AO5A 2RKIA 4E1MA 2X6NA 1BISA 4OPKA 3KK2A 4FJJA 1RDBA 3A2FA 1B92A 4Y1CA 4AHSA 4CEQA 3IAYA 3B6PA 3TAGA 3VQBA 2P1JA 3DOKA 3V9SA 2QKKA 4FJHA 4FXDA 5D3GA 4Z4EA 1SV5A 1S5JA 1LWEA 1UAXA 1VRUA 4DTJA 1KFDA 4CK2A 4HHTA 4EZ6A 2IGIA 3L2RA 1I39A 1HNVA 4FLWA 3DLRA 2HMIA 4H4OA 3CM6A 3IRXA 5HRPA 1QSLA 4DQIA 4Z4FA 2F8TA 3MXJA 2KFZA 1NK8A 3TARA 5CY4A 4BWJA 4FW1A 4CF9A 1CZ9A 3V4IA 3CFPA 4CGGA 3I0RA 2R7YA 2ZQBA 3NBPA 2YKNA 3DI6A 4MFBA 2W42A 1NJWA 2QXFA 4IFYA 1Q9YA 4M3TA 1KTQA 3MXIA 3TAFA 4AHTA 4CIGA 3L2QA 1BL3A 1TK5A 4KHYA 1RTHA 1JLBA 3NGYA 3KK3A 3U6FA 3KK1A 4W5RA 2GBZA 3WNFA 4GVMA 5HBMA 5E41A 3KIOA 1SKRA 4RW6A 3G0ZA 1S9GA 2RN2A 3LP0A 3VN5A 4ZTJA 1MU2A 3LANA 4KI6A 4N41A 4ZHRA 3AVKA 4KO0A 4CJ5A 3OYCA 1DLOA 4FK2A 1CXQA 1B9FA 4RW8A 4FJ9A 1BI4A 3K5OA 5FDLA 3TI0A 1J54A 3S3NA 2G8WA 1D5AA 2LSNA 3CQ8A 4E7IA 4IG3A 4W5TA 1ZYQA 1VSIA 3AVFA 3DLKA 3AV9A 4BDYA 4CJWA 4CK1A 5EU7A 3OYKA 1I3AA 4OLAA 1BQMA 1HPZA 3S3MA 1L5UA 2EX3A 3RRGA 1LAWA 3LWLA 4DSFA 1RBRA 3SCXA 4LY7A 2HHSA 2HHWA 4F8RA 1L3UA 4QOZB 1ASUA 1RNHA 2JGUA 4DS4A 4B9MA 1KCFA 1EETA 2NUBA 2ZE2A 1TGOA 3ISNC 4IG0A 3QEPA 2HW3A 1TAQA 3OVNA 1VK0A 1C6VA 2XY7A 2HHVA 4KHWA 3HP6A 4FCYA 4OGEA 3OYJA 3SUNA 3NF8A 4BDPA 4L8RB 2I5JA 4UQGA 4AHRA 4KTZA 2FBTA 3KKSA 1BCOA 1RBSA 3HVRA 1FK9A 2YHBA 1X1PA 1RTJA 4MQ3A 4CJKA 4PUOA 4DTNA 4CIEA 1NKEA 4LD0A 4M3YA 1RTIA 2E6MA 2BE2A 3NF9A 1BCMA 2GUIA 2A1SA 1QQCA 4DFKA 1Z25A 1D8YA 5JS1A 5KTQA 3K58A 1R0AA 1Q9XA 1EX4A 1XHXA 1VRTA 5HRNA 2G8KA 4CHPA 4M3ZA 4FLUA 4E0DA 1JXEA 1S1UA 2VG7A 1YVUA 4CEZA 4DTSA 3CG7A 2XY8A 3M8QA 3OYEA 4B3OA 4CGFA 3LP2A 4M3WA 3NDKA 3MXMA 1L3VA 2DY4A 1TKTA 1BQNA 3H08A 3L3UA 4RW9A 2IOCA 5JS2A 4EP4A 1Y97A 1JLAA 2E4LA 3AVCA 2Z1JA 4I9QA 4FK0A 1FKOA 3DLEA 1SUQA 4EP5A 1NOZA 1SKWA 1GOCA 3ZSVA 4BDZA 4B9VA 1HMVA 2XO7A 4CFAA 3HJFA 5J2QA 1BI4B 2WONA 1C1AA 3DRSA 4C8MA 4Z4CA 4CF8A 1RTDA 3RMAA 4E7HA 1UA1A 4Y1DA 4C8KA 3CM5A 3G10A 3AVIA 1VSHA 1D9FA 4AHUA 4FLVA 4DWIA 3WNHA 4OKKA 3K57A 3QNNA 1RT6A 4HCBA 3C94A 1ITGA 4O44A 4FM2A 3SJJA 2X74A 4RW4A 4IFVA 4C8LA 5HRRA 3OY9A 1SKSA 2G8FA 3ITHA 2PYJA 4ELUA 1C0MA 1S1WA 4CJ4A 4DTRA 1D9DA 3NHGA 4WE1A 3NGZA 1N6QA 1C0UA 3KKRA 4O5BA 1UA0A 2YNIA 3BDPA 3L2VA 4DTMA 1RT2A 3ZT3A 3DLHA 5HRSA 2FBVA 3OYLA 3DRRA 4DSKA 3PX6A 1VSDA 4DSLA 3SI6A 1XWLA 4HCCA 4J2AA 1TAUA 1KVBA 4KHSA 5SZTA 1J9AA 1U4BA 1IKXA 2QKBA 3NCIA 4IDKA 4LH4A 1DTTA 4QAGA 4Q5VA 1JKHA 3L2UA 2XHBA 3SQ2A 4RW7A 3AVHA 4PY5A 4NYNA 3CYMA 3OS0A 3RMCA 4CERA 3SPZA 1RT7A 2KQ2A 4F2SA 2Q3SA 1ZBUA 2HVHA 4OKJA 1BIUA 1REVA 2JLEA 4CESA 1RT3A 4E1NA 4CJ3A 1KLMA 1TKDA 2IDOA 1EP4A 1ZBLA 1RILA 3VQ8A 1IKWA 3I0SA 3ZSZA 1VSKA 1KRPA 1RT1A 3HPOA 4FM1A 4DTXA 4PWDA 1C1CA 4ZTFA 1TK0A 3SUOA 3ULDA 2B5JA 2D5RA 3TABA 1TK8A 1JLEA 3QESA 4JRQA 1DTQA 2VWKA 5J2MA 3VQEA 2QK9A 3VQ4A 1A5XA 4KKOA 4CFCA 3MECA 3TAEA 4AHCA 1ZBFA 3LPUA 4TSXA 3SPYA 4KTQA 4DF4A 5C25A 4C8OA 4CEFA 5J1EA 4FJLA 3AO3A 3T19A 2XY6A 4B9UA 3T1AA 4FJIA 4Z4IA 2Y1IA 1LWCA 4B8CA 3ZSRA 4CJSA 3M8RA 4YFUA 1RBVA 4DLEA 2YNHA 3CFRA 1CZBA 3SQ0A 1K6YA 4DS5A 4CECA 5I3UA 1NK7A 3FFIA 4CJPA 3RMDA 3RMBA 3ZSQA 2HHUA 1NJXA 3P5JA 3K5LA 4KFBA 3QEIA 1O1WA 1VSLA 1IO2A 3M8PA 4CJLA 3QINA 3NH0A 3OJUA 4CJTA 4Z4GA 4CIFA 1WAJA 3LP3A 4M3UA 2BGGA 2IC3A 5DMRA 4JS4A 5KI6A 3AA4A 1WNSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I2P A;  4DU1 A;  2RPI A;  1QE1 A;  2D0A A;  4CJU A;  1X9S A;  4ICL A;  1HYV A;  4FVM A;  3AVA A;  4KI4 A;  4FJG A;  1LAV A;  1LV5 A;  4KV8 A;  5CYM A;  1NJY A;  2VG5 A;  3OS1 A;  1S9E A;  1HQE A;  1CLQ A;  2D0C A;  3V81 A;  4GW6 A;  3TAP A;  3LZI A;  3I8D A;  4DU4 A;  4CK3 A;  1WSH A;  3OYG A;  3EZ5 A;  3HO1 A;  3HL8 A;  3QIO A;  2YNG A;  3RRH A;  2HNY A;  3WNE A;  3F73 A;  1GOA A;  3MEE A;  3OYA A;  3P83 D;  3SV4 A;  4DSE A;  3ZSY A;  4CJV A;  3SV3 A;  4E19 A;  3SUQ A;  4DFM A;  2PYL A;  4GMJ B;  4KPY A;  1QHT A;  4O4G A;  3ZT2 A;  2ATQ A;  3RR7 A;  2E6L A;  3AVN A;  2DFH A;  3L3V A;  1U45 A;  4I9L A;  3KLI A;  3P1G A;  4H8K A;  3HM9 A;  3K5N A;  1FXX A;  3HK2 A;  1SL1 A;  3VQC A;  2ITG A;  4CF1 A;  3PO5 A;  3ASM A;  4DFJ A;  3DRP A;  4O0I A;  2A1R A;  4LH5 A;  3QEW A;  2OA8 A;  2YNF A;  3AVB A;  3K2P A;  3HT3 A;  1NK6 A;  2PZS A;  4W5Q A;  3EY1 A;  4E7K A;  3O4Q A;  3VQ6 A;  3PV8 A;  2OYQ A;  1HYS A;  3TWH A;  1GOB A;  1HYZ A;  1RDC A;  2O4G A;  5C42 A;  4BE0 A;  4DMN A;  1Z26 A;  3U3Y A;  2G8H A;  3ZT1 A;  2F8S A;  4KAZ A;  5T7B A;  3C6T A;  3VQP A;  2Z1H A;  3KLF A;  4I7F A;  2OPP A;  4CJF A;  1A5V A;  4CGJ A;  3VQQ A;  1LWF A;  4FLX A;  4DQS A;  1WN7 A;  4N76 A;  4CEO A;  1RDD A;  2OPQ A;  3AO4 A;  1T8E A;  4O0J A;  1N5Y A;  4OJR A;  3AO2 A;  3NGI A;  1Q8I A;  5I42 A;  4J2B A;  1WSJ A;  2BAN A;  4CF2 A;  3OYM A;  5FRN A;  5C24 A;  3ZT4 A;  3HPG A;  4FW2 A;  3JYT A;  4FJM A;  1VSF A;  3HP9 A;  4FLZ A;  2Z1G A;  3HST B;  1W0H A;  1FKP A;  2HHQ A;  3OYN A;  2Z1I A;  3ZT0 A;  1BIZ A;  4CHZ A;  3UIQ A;  2G8I A;  4CJR A;  1BGX T;  3LDS A;  3KLH A;  3AA5 X;  1U49 A;  2BDP A;  1ZBI A;  4B9T A;  3IS9 A;  4DSJ A;  2KZM A;  4B8A B;  4ID5 A;  3KTQ A;  4FLY A;  1J5O A;  2VG6 A;  3SZ2 A;  3LAK A;  1XHZ A;  3RTV A;  1W9H A;  3SQ1 A;  4E7L A;  2FC0 A;  3SYZ A;  1HQU A;  4FJ7 A;  3DMJ A;  5DK5 A;  1VSM A;  4BWM A;  3O3F A;  1JLQ A;  4H4M A;  2HVI A;  1VSE A;  3RR8 A;  4EZ9 A;  1QSY A;  3EYZ A;  5KGW A;  4FJ8 A;  2ETJ A;  4M45 A;  3VQ5 A;  1CXU A;  1BHL A;  3V1R A;  1L3S A;  2HB5 A;  4OKE A;  4CEB A;  4HUF A;  4YNQ A;  1TL1 A;  3HYF A;  3ZSX A;  3OYI A;  2EHG A;  4CHN A;  3NAE A;  3TAQ A;  3SNN A;  3MED A;  3B6O A;  2DFF A;  4HTU A;  5SWM A;  4FYD A;  3O4N A;  4E89 A;  1T03 A;  2O4I A;  3DOL A;  3PUF A;  3VQ9 A;  4DU3 A;  4AH9 A;  4CHQ A;  2VWJ A;  4N56 A;  4W5N A;  3T3F A;  1XI1 A;  2FBX A;  4NCA A;  1S6P A;  4JRP A;  3OS2 A;  3CFO A;  1X9W A;  3HPH A;  4Z4H A;  4LSL A;  4DSI A;  3VQ7 A;  3F9K A;  3AO1 A;  1QS4 A;  5CZ1 A;  2G8V A;  1WSF A;  1RBU A;  5J2P A;  3OYF A;  5KRT A;  1YT3 A;  2F96 A;  3QER A;  1WSG A;  1SL2 A;  1WSI A;  4FZX C;  2IS3 A;  5HP1 A;  4Q0B A;  1KVC A;  3L2W A;  1IG9 A;  3VQA A;  5J2N A;  5CZ2 A;  3LAM A;  2YKM A;  4B9L A;  3VQD A;  3THV A;  3ALY A;  3ZCM A;  1J53 A;  4KRF A;  1HJR A;  2IAJ A;  2OZM A;  4XIU A;  1EKE A;  3VA3 A;  3V1O A;  3HVT A;  2P51 A;  2HND A;  3OJS A;  3HXM A;  1NK4 A;  4G1Q A;  2HHX A;  2OPR A;  3AVL A;  3LPT A;  4O55 A;  2YV0 X;  2X78 A;  3C6U A;  4CFD A;  4HVJ A;  3QLH A;  1NK9 A;  4N47 A;  1S1X A;  4KHU A;  4QCL A;  5FRO A;  3QNO A;  1WSE A;  2YHA A;  1QSS A;  1VSJ A;  4B08 A;  2ZD1 A;  4B9S A;  4FZZ A;  4CGH A;  3OYH A;  4KB1 A;  5HRO A;  4CHO A;  4AHV A;  3V1Q A;  3ZSW A;  3PO4 A;  1LW2 A;  4CGI A;  3ZSO A;  4R5P A;  1JL2 A;  1UOC A;  3LZJ A;  4DFP A;  3S9H A;  1U47 A;  4J2D A;  2XRI A;  3LP1 A;  4FK4 A;  4F3T A;  3OYB A;  4DQP A;  3JSM A;  3DM2 A;  1YTA A;  4HUE A;  2P5G A;  2X6S A;  3QO9 A;  3TAN A;  2DTU A;  4CF0 A;  2XY5 A;  4FZY A;  4FJX A;  1T05 A;  1RBT A;  3DLG A;  3SQ4 A;  3QIP A;  3AA2 A;  3D45 A;  1TKZ A;  3TR8 A;  1IH7 A;  3NF6 A;  4C8N A;  4DTP A;  3BGR A;  4BE2 A;  4CHY A;  2KZZ A;  4OVL A;  1NK5 A;  4IBN A;  2DFE A;  4Z0U A;  2G8U A;  4BE1 A;  1TKX A;  3C95 A;  3AVJ A;  3K59 A;  4KRE A;  4CED A;  3RWU A;  3KD1 E;  3NH2 A;  1NK0 A;  4KHQ A;  2OZS A;  1TV6 A;  3K5M A;  1HNI A;  3PX0 A;  1UWB A;  2AJQ A;  5K14 A;  4OLB A;  1ASW A;  3M8S A;  1KFS A;  3V6D A;  1KVA A;  2KW4 A;  4LSN A;  4M42 A;  1IKV A;  4KHN A;  3O3G A;  2D0B A;  3NE6 A;  3MAQ A;  1HRH A;  4E3S A;  3V9X A;  3SUP A;  3KLE A;  1C0T A;  5KRS A;  4ID1 A;  3QEX A;  2OPS A;  4DLG A;  3AVG A;  5CYQ A;  4DQR A;  3NH1 A;  3DYA A;  1U48 A;  4KB0 A;  1C1B A;  3PY8 A;  4K8X A;  4J2E A;  4DTU A;  1XC9 A;  4OGC A;  3O3H A;  1ASV A;  4NCB A;  1EXQ A;  3U3G A;  5KGX A;  3WNG A;  1L3T A;  2HNZ A;  4CFB A;  1JXB A;  4M3X A;  2B6A A;  1NJZ A;  4HUG A;  2PY5 A;  3LAL A;  1RT5 A;  2GV9 A;  3AA3 A;  4E7J A;  3MEG A;  1U04 A;  3TAM A;  3PX4 A;  4NYF A;  1B9D A;  4AIL C;  3QEV A;  1YTU A;  3IG1 A;  3D0P A;  4FLT A;  1X9M A;  4FJN A;  5FRM A;  3NFA A;  3KJV A;  4CEA A;  1RCH A;  3DLB A;  1SL0 A;  4BAC A;  4CE9 A;  2WOM A;  4DQQ A;  1JL1 A;  4F3O A;  4JS5 A;  1KLN A;  2KFN A;  4PQU A;  2RF2 A;  1TL3 A;  1G15 A;  3KLG A;  1T7P A;  4FJ5 A;  4OPJ A;  4FM0 A;  4N5S A;  4ELV A;  4F4K A;  2B4J A;  3E01 A;  1NOY A;  4I2Q A;  4B9N A;  1NKC A;  4CEE A;  4DTO A;  3NF7 A;  1NKB A;  4IKF A;  4CJQ A;  4DF8 A;  2P5O A;  4CJE A;  3OYD A;  2FBY A;  4ELT A;  2HHT A;  1S6Q A;  4CGD A;  4FJK A;  4NCG A;  3LWM A;  4W5O A;  1A5W A;  3AVM A;  4RG8 A;  1TVR A;  1F21 A;  1RDA A;  1WAF A;  4M41 A;  1JLF A;  1RT4 A;  1S1T A;  1IKY A;  1JLG A;  4K8Z A;  4PA1 A;  3S3O A;  1S1V A;  1JLC A;  4M3R A;  1KSP A;  1LW0 A;  3V9W A;  5HLF A;  3V9Z A;  1ZBH A;  3QET A;  3V9U A;  2Y1J A;  3L8B A;  4JLH A;  4CCH A;  1QTM A;  4DG1 A;  4F2R A;  2KTQ A;  3VA0 A;  3KD5 E;  1WLJ A;  4KTW A;  3AO5 A;  2RKI A;  4E1M A;  2X6N A;  1BIS A;  4OPK A;  3KK2 A;  4FJJ A;  1RDB A;  3A2F A;  1B92 A;  4Y1C A;  4AHS A;  4CEQ A;  3IAY A;  3B6P A;  3TAG A;  3VQB A;  2P1J A;  3DOK A;  3V9S A;  2QKK A;  4FJH A;  4FXD A;  5D3G A;  4Z4E A;  1SV5 A;  1S5J A;  1LWE A;  1UAX A;  1VRU A;  4DTJ A;  1KFD A;  4CK2 A;  4HHT A;  4EZ6 A;  2IGI A;  3L2R A;  1I39 A;  1HNV A;  4FLW A;  3DLR A;  2HMI A;  4H4O A;  3CM6 A;  3IRX A;  5HRP A;  1QSL A;  4DQI A;  4Z4F A;  2F8T A;  3MXJ A;  2KFZ A;  1NK8 A;  3TAR A;  5CY4 A;  4BWJ A;  4FW1 A;  4CF9 A;  1CZ9 A;  3V4I A;  3CFP A;  4CGG A;  3I0R A;  2R7Y A;  2ZQB A;  3NBP A;  2YKN A;  3DI6 A;  4MFB A;  2W42 A;  1NJW A;  2QXF A;  4IFY A;  1Q9Y A;  4M3T A;  1KTQ A;  3MXI A;  3TAF A;  4AHT A;  4CIG A;  3L2Q A;  1BL3 A;  1TK5 A;  4KHY A;  1RTH A;  1JLB A;  3NGY A;  3KK3 A;  3U6F A;  3KK1 A;  4W5R A;  2GBZ A;  3WNF A;  4GVM A;  5HBM A;  5E41 A;  3KIO A;  1SKR A;  4RW6 A;  3G0Z A;  1S9G A;  2RN2 A;  3LP0 A;  3VN5 A;  4ZTJ A;  1MU2 A;  3LAN A;  4KI6 A;  4N41 A;  4ZHR A;  3AVK A;  4KO0 A;  4CJ5 A;  3OYC A;  1DLO A;  4FK2 A;  1CXQ A;  1B9F A;  4RW8 A;  4FJ9 A;  1BI4 A;  3K5O A;  5FDL A;  3TI0 A;  1J54 A;  3S3N A;  2G8W A;  1D5A A;  2LSN A;  3CQ8 A;  4E7I A;  4IG3 A;  4W5T A;  1ZYQ A;  1VSI A;  3AVF A;  3DLK A;  3AV9 A;  4BDY A;  4CJW A;  4CK1 A;  5EU7 A;  3OYK A;  1I3A A;  4OLA A;  1BQM A;  1HPZ A;  3S3M A;  1L5U A;  2EX3 A;  3RRG A;  1LAW A;  3LWL A;  4DSF A;  1RBR A;  3SCX A;  4LY7 A;  2HHS A;  2HHW A;  4F8R A;  1L3U A;  4QOZ B;  1ASU A;  1RNH A;  2JGU A;  4DS4 A;  4B9M A;  1KCF A;  1EET A;  2NUB A;  2ZE2 A;  1TGO A;  3ISN C;  4IG0 A;  3QEP A;  2HW3 A;  1TAQ A;  3OVN A;  1VK0 A;  1C6V A;  2XY7 A;  2HHV A;  4KHW A;  3HP6 A;  4FCY A;  4OGE A;  3OYJ A;  3SUN A;  3NF8 A;  4BDP A;  4L8R B;  2I5J A;  4UQG A;  4AHR A;  4KTZ A;  2FBT A;  3KKS A;  1BCO A;  1RBS A;  3HVR A;  1FK9 A;  2YHB A;  1X1P A;  1RTJ A;  4MQ3 A;  4CJK A;  4PUO A;  4DTN A;  4CIE A;  1NKE A;  4LD0 A;  4M3Y A;  1RTI A;  2E6M A;  2BE2 A;  3NF9 A;  1BCM A;  2GUI A;  2A1S A;  1QQC A;  4DFK A;  1Z25 A;  1D8Y A;  5JS1 A;  5KTQ A;  3K58 A;  1R0A A;  1Q9X A;  1EX4 A;  1XHX A;  1VRT A;  5HRN A;  2G8K A;  4CHP A;  4M3Z A;  4FLU A;  4E0D A;  1JXE A;  1S1U A;  2VG7 A;  1YVU A;  4CEZ A;  4DTS A;  3CG7 A;  2XY8 A;  3M8Q A;  3OYE A;  4B3O A;  4CGF A;  3LP2 A;  4M3W A;  3NDK A;  3MXM A;  1L3V A;  2DY4 A;  1TKT A;  1BQN A;  3H08 A;  3L3U A;  4RW9 A;  2IOC A;  5JS2 A;  4EP4 A;  1Y97 A;  1JLA A;  2E4L A;  3AVC A;  2Z1J A;  4I9Q A;  4FK0 A;  1FKO A;  3DLE A;  1SUQ A;  4EP5 A;  1NOZ A;  1SKW A;  1GOC A;  3ZSV A;  4BDZ A;  4B9V A;  1HMV A;  2XO7 A;  4CFA A;  3HJF A;  5J2Q A;  1BI4 B;  2WON A;  1C1A A;  3DRS A;  4C8M A;  4Z4C A;  4CF8 A;  1RTD A;  3RMA A;  4E7H A;  1UA1 A;  4Y1D A;  4C8K A;  3CM5 A;  3G10 A;  3AVI A;  1VSH A;  1D9F A;  4AHU A;  4FLV A;  4DWI A;  3WNH A;  4OKK A;  3K57 A;  3QNN A;  1RT6 A;  4HCB A;  3C94 A;  1ITG A;  4O44 A;  4FM2 A;  3SJJ A;  2X74 A;  4RW4 A;  4IFV A;  4C8L A;  5HRR A;  3OY9 A;  1SKS A;  2G8F A;  3ITH A;  2PYJ A;  4ELU A;  1C0M A;  1S1W A;  4CJ4 A;  4DTR A;  1D9D A;  3NHG A;  4WE1 A;  3NGZ A;  1N6Q A;  1C0U A;  3KKR A;  4O5B A;  1UA0 A;  2YNI A;  3BDP A;  3L2V A;  4DTM A;  1RT2 A;  3ZT3 A;  3DLH A;  5HRS A;  2FBV A;  3OYL A;  3DRR A;  4DSK A;  3PX6 A;  1VSD A;  4DSL A;  3SI6 A;  1XWL A;  4HCC A;  4J2A A;  1TAU A;  1KVB A;  4KHS A;  5SZT A;  1J9A A;  1U4B A;  1IKX A;  2QKB A;  3NCI A;  4IDK A;  4LH4 A;  1DTT A;  4QAG A;  4Q5V A;  1JKH A;  3L2U A;  2XHB A;  3SQ2 A;  4RW7 A;  3AVH A;  4PY5 A;  4NYN A;  3CYM A;  3OS0 A;  3RMC A;  4CER A;  3SPZ A;  1RT7 A;  2KQ2 A;  4F2S A;  2Q3S A;  1ZBU A;  2HVH A;  4OKJ A;  1BIU A;  1REV A;  2JLE A;  4CES A;  1RT3 A;  4E1N A;  4CJ3 A;  1KLM A;  1TKD A;  2IDO A;  1EP4 A;  1ZBL A;  1RIL A;  3VQ8 A;  1IKW A;  3I0S A;  3ZSZ A;  1VSK A;  1KRP A;  1RT1 A;  3HPO A;  4FM1 A;  4DTX A;  4PWD A;  1C1C A;  4ZTF A;  1TK0 A;  3SUO A;  3ULD A;  2B5J A;  2D5R A;  3TAB A;  1TK8 A;  1JLE A;  3QES A;  4JRQ A;  1DTQ A;  2VWK A;  5J2M A;  3VQE A;  2QK9 A;  3VQ4 A;  1A5X A;  4KKO A;  4CFC A;  3MEC A;  3TAE A;  4AHC A;  1ZBF A;  3LPU A;  4TSX A;  3SPY A;  4KTQ A;  4DF4 A;  5C25 A;  4C8O A;  4CEF A;  5J1E A;  4FJL A;  3AO3 A;  3T19 A;  2XY6 A;  4B9U A;  3T1A A;  4FJI A;  4Z4I A;  2Y1I A;  1LWC A;  4B8C A;  3ZSR A;  4CJS A;  3M8R A;  4YFU A;  1RBV A;  4DLE A;  2YNH A;  3CFR A;  1CZB A;  3SQ0 A;  1K6Y A;  4DS5 A;  4CEC A;  5I3U A;  1NK7 A;  3FFI A;  4CJP A;  3RMD A;  3RMB A;  3ZSQ A;  2HHU A;  1NJX A;  3P5J A;  3K5L A;  4KFB A;  3QEI A;  1O1W A;  1VSL A;  1IO2 A;  3M8P A;  4CJL A;  3QIN A;  3NH0 A;  3OJU A;  4CJT A;  4Z4G A;  4CIF A;  1WAJ A;  3LP3 A;  4M3U A;  2BGG A;  2IC3 A;  5DMR A;  4JS4 A;  5KI6 A;  3AA4 A;  1WNS A; 
#chains in the Genus database with same CATH topology
 3MN7 A;  2ZJP L;  1X9S A;  1HYV A;  3T1H K;  4KI4 A;  5MLC Q;  4GV3 A;  1RFQ A;  5CYM A;  2GEL A;  4DHY A;  1CLQ A;  3PIO L;  1IG8 A;  3OYG A;  3EZ5 A;  3QIO A;  3RRH A;  1GOA A;  5AFU H;  3VGM A;  3P83 D;  4H5N A;  3SV3 A;  1KD1 O;  3SAF A;  4DFM A;  2PYL A;  3ZT2 A;  4A59 A;  2ATQ A;  2E6L A;  2DFH A;  3HK2 A;  3K5N A;  3A5N C;  4CF1 A;  1NBW A;  1BUP A;  3ASM A;  4O0I A;  3QEW A;  2PZS A;  3UKR A;  5BRF A;  3K0S A;  3CC4 N;  5BPL A;  1Z26 A;  3U3Y A;  2OCE A;  4KAZ A;  4XH1 A;  1A5V A;  4DV7 K;  1LWF A;  4AF1 A;  2PAV A;  3WXI A;  3ZET A;  2Q2R A;  1SQK A;  4J2B A;  2NLX A;  2A40 A;  5FRN A;  3ZT4 A;  4B3T K;  4X64 K;  3JYT A;  4FJM A;  3GDQ A;  3J7Y P;  5CE3 A;  4CZE A;  4LFA K;  2E2Q A;  3UIQ A;  1BGX T;  3LDS A;  1U49 A;  3AA5 X;  2BDP A;  3CXC M;  3VER A;  3SZ2 A;  3LAK A;  3BUZ B;  1N34 K;  3MN9 A;  3CJC A;  3DMJ A;  1VSM A;  1JLQ A;  4H4M A;  2HVI A;  3VEO A;  3CME N;  5JVH L;  4RTF D;  1BU6 O;  4OKE A;  3DLL L;  3HYF A;  3OYI A;  3TAQ A;  1WOQ A;  2DFF A;  1BG3 A;  3AGK A;  3LDL A;  3DOL A;  2O4I A;  3VQ9 A;  4DU3 A;  4AH9 A;  4CHQ A;  4BVP A;  4NCA A;  1S6P A;  4ISF A;  3F5T A;  3F9K A;  4K41 A;  4FWO A;  3OYF A;  5KRT A;  3EN9 A;  4B1X B;  5KQ8 A;  4LF4 K;  4DR4 K;  3S41 A;  3LAM A;  5LMU K;  4BC3 A;  4PKI A;  3ZEU B;  2OZM A;  1EKE A;  5M1O A;  3V1O A;  3OJS A;  2NRW A;  2HHX A;  2OPR A;  3C6U A;  3VF6 A;  1S1X A;  3MDQ A;  3MX2 A;  4AM6 A;  1QSS A;  4FZZ A;  4CGH A;  4KB1 A;  1QQN A;  4BC2 A;  3PO4 A;  4DFP A;  1UOC A;  2A42 A;  1JCG A;  2XRI A;  3C65 A;  1HLU A;  4HUE A;  4CF0 A;  1RBT A;  5ADX A;  1EWQ A;  3DLG A;  4PHT X;  3SQ4 A;  1YUW A;  4B3S K;  3A8Y A;  3AA2 A;  3D45 A;  1TKZ A;  3E66 A;  3H1V X;  4EAH D;  1TYQ B;  2KZZ A;  3MK6 A;  1BA0 A;  4OVL A;  2VYP A;  1IBM K;  4IBN A;  2P9L B;  4BE1 A;  3FZM A;  4KRE A;  3RWU A;  3NH2 A;  3K5M A;  2E1Z A;  3M8S A;  1KFS A;  3KHY A;  4M42 A;  4H5V A;  1IKV A;  4E3S A;  1VQK N;  2Q0U A;  3V9X A;  1C0T A;  3AVG A;  1U48 A;  3DYA A;  1C1B A;  4FOE A;  5AQL A;  3WNG A;  4CFB A;  1JXB A;  4BR2 A;  1NJZ A;  2PY5 A;  3MWT A;  3MEG A;  1U04 A;  4PL8 A;  3TAM A;  3PX4 A;  1B9D A;  4BRL A;  1QQO A;  3NMU A;  3D0P A;  4DV2 K;  4FLT A;  4FJN A;  3NFA A;  3VEW A;  4CEA A;  5GIO A;  4PKG A;  1RCH A;  3DLB A;  1NMD A;  4DQQ A;  3K9K A;  4JS5 A;  1KLN A;  4PQU A;  3ENO A;  3J7A P;  4XH5 A;  4OX9 K;  1OH7 A;  1T7P A;  4JKA A;  4U7B A;  4LC9 B;  4FM0 A;  3KK7 A;  1XNR K;  2IIR A;  3QDK A;  4BRQ A;  4DTO A;  1YIT N;  1YAG A;  4ELT A;  2O8F A;  4W5O A;  2EWS A;  1TVR A;  3WXK A;  4PA1 A;  3S3O A;  1S1V A;  1JLC A;  1LW0 A;  1K73 O;  3V9U A;  2P9P B;  2Y1J A;  3L8B A;  4JLH A;  1QTM A;  2A3Z A;  4DG1 A;  3KD5 E;  2QWP A;  4E1M A;  4KTW A;  2RKI A;  4FJJ A;  2X6N A;  3P39 A;  3A2F A;  4AHS A;  4CEQ A;  2DPN A;  3VQB A;  2P1J A;  4DV1 K;  5AQQ A;  3V9S A;  4FJH A;  3HBT A;  5D3G A;  3I55 N;  3CCE N;  1LWE A;  1UAX A;  4DTJ A;  4M7X A;  4HHT A;  3KWG A;  3IFR A;  1I39 A;  1HNV A;  3CM6 A;  1QSL A;  1HNW K;  3ZX0 A;  3GE1 A;  1MWM A;  2NRX A;  1Q81 O;  1D4X A;  2O8E A;  1N36 K;  1HNZ K;  2ASP A;  3DI6 A;  3Q7B A;  4MFB A;  2W42 A;  3TSP A;  4KHY A;  1BL3 A;  3P4I A;  4GVM A;  5HBM A;  1VQL N;  3KIO A;  1QVG M;  3FE1 A;  4KI6 A;  3WXM B;  2BTF A;  4CJ5 A;  4FK2 A;  1B9F A;  3TI0 A;  3K5O A;  5FDL A;  4W5T A;  3CCL N;  3FLC O;  1GLE G;  5C0Y A;  4BDY A;  4CJW A;  1T6C A;  2HHS A;  2EX3 A;  4WYB A;  4LY7 A;  2HHW A;  3O80 A;  3RSE A;  4DV0 K;  1ASU A;  4BRH A;  1KCF A;  1VQ7 N;  3ISN C;  1TGO A;  2HF3 A;  3OVN A;  1C6V A;  2HHV A;  4KHW A;  1NGB A;  2KKZ A;  2I5J A;  5CHI A;  4UQG A;  2FBT A;  3E9P A;  1OH5 A;  3GG4 A;  4MQ3 A;  1X1P A;  1RTJ A;  4DTN A;  4HWI A;  1NKE A;  4ISG A;  4LD0 A;  3FR0 A;  2W6K A;  5LMN K;  3H45 C;  1O13 A;  1Z25 A;  3AAP A;  5AQO A;  3CCS N;  1R0A A;  4B1Y B;  5HRN A;  1VRT A;  4CEZ A;  1HX1 A;  4H0T B;  2V52 B;  4GKK K;  1IBK K;  1T3V A;  2E4L A;  3AVC A;  4B3M K;  1FKO A;  1WBD A;  1NOZ A;  4B1Z A;  4BDZ A;  1S3X A;  2QI2 A;  5J2Q A;  1C1A A;  4CF8 A;  2A5X A;  2O8B B;  3MWP A;  4IOA L;  4AHU A;  4DWI A;  3WNH A;  3K57 A;  4HCB A;  1RT6 A;  3C94 A;  3K9J A;  3SJJ A;  2X74 A;  3OY9 A;  4NLC A;  3O08 A;  3EKS A;  4MO4 A;  1C0U A;  1UA0 A;  4JI8 K;  2P9U A;  3L2V A;  1VSD A;  4HCC A;  1TAU A;  1DEJ A;  2WC9 A;  5SZT A;  1ILY A;  1YF5 L;  1U4B A;  5M1N A;  1HUX A;  3H1Q A;  3U9Z A;  1JKH A;  1GLL O;  5CR4 A;  5IWA K;  1JCF A;  3RMC A;  3SPZ A;  2HVH A;  3SMS A;  2KQ2 A;  1ZBU A;  1NWK A;  2QW9 A;  2JLE A;  1Q86 O;  2F9W A;  4CJ3 A;  1HNX K;  3FGU A;  1RIL A;  1IKW A;  3HPO A;  4PWD A;  3O9T A;  3OHR A;  4JRQ A;  2P9U B;  2E88 A;  2NRR A;  5LY3 A;  5M1K A;  1NGE A;  3TAE A;  4TSX A;  1K8A O;  4BRE A;  3R1X A;  1VQ8 N;  3JAM O;  5AQM A;  4YFU A;  5IT9 O;  1MWK A;  1W97 L;  3O5B A;  3K5L A;  3ULE A;  1K8K B;  3QIN A;  4YOX A;  4Z4G A;  1WAJ A;  2I7P A;  4M3U A;  2WFB A;  2IC3 A;  3J80 O;  5KI6 A;  2V7Y A;  4DU1 A;  1QE1 A;  4CJU A;  2QWQ A;  1NGJ A;  3AVA A;  2VG5 A;  3V81 A;  4GW6 A;  3I8D A;  3C7N B;  4CK3 A;  1WSH A;  4DKW A;  3WEE A;  4FWP A;  3ENB A;  5LL6 Z;  1NGH A;  2HNY A;  1Q7Y O;  3MEE A;  4KH4 A;  3OYA A;  4DSE A;  2ZJQ L;  3SUQ A;  4GMJ B;  1QHT A;  4O4G A;  1YHQ N;  3RR7 A;  3QIC A;  3L3V A;  3CD6 N;  4YOT A;  1U45 A;  2KFN A;  4I9L A;  3KLI A;  4WQ5 C;  1SL1 A;  3VQC A;  3PO5 A;  4LH5 A;  3EE8 A;  2YNF A;  3AVB A;  4W5Q A;  3PV8 A;  1C0G A;  3QBW A;  3TWH A;  3RSE B;  1HYZ A;  4LF5 K;  1HYS A;  3G25 A;  4NB4 A;  1HKB A;  2G8H A;  4FO0 A;  5AQR A;  3VQP A;  2Z1H A;  4I7F A;  4CJF A;  1WN7 A;  5KPR A;  3CCQ N;  1RDD A;  1T8E A;  4OJR A;  1YI2 N;  4BR5 A;  5I42 A;  4K43 A;  3ZET B;  1FKP A;  1S72 N;  1Z6R A;  5GAE P;  3OYN A;  4CJR A;  4DV6 K;  3SLC A;  4DCH A;  2OTL N;  2KZM A;  2Q31 A;  2H3G X;  1DGK N;  2BUP A;  1XHZ A;  3RTV A;  1W9H A;  5BN8 A;  4E7L A;  2FC0 A;  3BEX A;  4LF8 K;  1HQU A;  5DK5 A;  4BWM A;  3THY A;  5AQW A;  1VSE A;  3ULE B;  3M3Z A;  3RR8 A;  4EZ9 A;  5KGW A;  2ETJ A;  3VQ5 A;  2HB5 A;  4CEB A;  3D7E O;  4YNQ A;  3ZSX A;  4O5F A;  3SNN A;  5SWM A;  1T03 A;  2A41 A;  5AR0 A;  3TTD A;  4CBX A;  4X65 K;  4I6M B;  3T1Y K;  3TSU A;  4W5N A;  4EHU A;  3T3F A;  3IKM A;  3CCU N;  1X9W A;  3OS2 A;  1NLV A;  1NU0 A;  3HPH A;  3HM8 A;  4JKG B;  4ILH A;  5J2P A;  5A2Q O;  3BP8 A;  4FZX C;  2IS3 A;  4J8F A;  4IEI A;  4JV5 K;  1KVC A;  1IG9 A;  4DR2 K;  5CZ2 A;  5KPT A;  2ASO A;  4XIU A;  3TPQ A;  3HVT A;  1NK4 A;  3HXM A;  2E1Y A;  5GIP A;  3LDP A;  4O55 A;  2E2O A;  2X78 A;  4KHU A;  3D6R A;  1VQ6 N;  4QCL A;  4YOY A;  3FZH A;  5AQJ A;  1WSE A;  2YHA A;  3I33 A;  2UU9 K;  2HMP A;  4CHO A;  2O8D A;  4DQ8 A;  4JKF A;  1LW2 A;  4R5P A;  3LZJ A;  4B9Q A;  4FK4 A;  3LP1 A;  1NGF A;  4F3T A;  2F7T A;  3OYB A;  3JSM A;  3DM2 A;  3QO9 A;  3DXK A;  3F9M A;  3C6A A;  5FPE A;  2IVP A;  1IH7 A;  4C8N A;  5AZJ A;  4FWM A;  4BRI A;  1X3M A;  3ZYY X;  3H3N O;  4JK9 A;  4Z94 A;  1NK0 A;  5TKY A;  2E5L K;  2OZS A;  3PX0 A;  1UWB A;  5K14 A;  3BZK A;  3AGR A;  1EWR A;  4A5B A;  2NNW A;  2QXL A;  1KXP A;  3O6W A;  3CPE A;  3SUP A;  3KLE A;  2YHY A;  3CER A;  1XMQ K;  4DQR A;  4KB0 A;  3OBW A;  2P9K B;  1ASV A;  1EXQ A;  3U3G A;  3ZX3 A;  2B6A A;  4HUG A;  3LAL A;  2IVN A;  3AA3 A;  4E7J A;  3J8A A;  5FRM A;  5AQY A;  4CD1 A;  1GLF O;  4WQ5 A;  1ATR A;  1SL0 A;  1K9M O;  2RF2 A;  4FL9 A;  1TL3 A;  3L6Q A;  5C2D A;  3VEZ A;  4ISE A;  2E2P A;  4N5S A;  4ELV A;  2B4J A;  4I2Q A;  1MA9 B;  2V51 B;  3C6H A;  4YOU A;  4JN4 A;  2P5O A;  2UXB K;  1P8Z A;  4CGD A;  4JHD B;  4NCG A;  4IWV A;  2QWO A;  1RDA A;  1RT4 A;  3VEX A;  1U2V B;  4GY2 B;  2QEX N;  4CCH A;  4H03 B;  4F2R A;  3VA0 A;  2KTQ A;  1WLJ A;  1NG9 A;  1BIS A;  5AQU A;  1RDB A;  2I7N A;  3TAG A;  2ASM A;  4DR6 K;  1SV5 A;  1S5J A;  4BRM A;  4CK2 A;  4EZ6 A;  2IGI A;  2HMI A;  4H4O A;  5HRP A;  4DQI A;  3SAH A;  4DR3 K;  2KFZ A;  4WQ4 A;  3TAR A;  3O9U A;  4FW1 A;  3B8A X;  4IFE A;  4CF9 A;  3V4I A;  1ZC6 A;  3AAQ A;  3CFP A;  2V7Z A;  4CGG A;  3I0R A;  2FSJ A;  2E2N A;  2YKN A;  1KTQ A;  4CIG A;  3D2F A;  5JIC A;  3NGY A;  3U6F A;  4B1V A;  2GBZ A;  4BQZ A;  3QBX A;  1QZ6 A;  4CVN E;  2O8F B;  1S9G A;  3VN5 A;  4DR7 K;  4IJA A;  4N41 A;  4ZHR A;  3AVK A;  4OPH A;  4RW8 A;  4FJ9 A;  1BI4 A;  2UUB K;  1T6D A;  3ATU A;  3R8E A;  1D5A A;  2LSN A;  3VOV A;  4JHD A;  1HKG A;  4BG9 A;  1VSI A;  3AVF A;  3DLK A;  1I3A A;  4KHP K;  2FXU A;  1BQM A;  3S3M A;  1LAW A;  4A2B A;  4DSF A;  1NGC A;  1L3U A;  1RNH A;  2JGU A;  4B9M A;  4XH4 A;  1EET A;  4BQL A;  5I9E B;  4IG0 A;  4A5A A;  4F9O A;  2UXC K;  1VK0 A;  2VQF K;  3OYJ A;  3NF8 A;  4BDP A;  4MDA A;  4AHR A;  4E1J A;  3KKS A;  4CJK A;  4JKE A;  3CJ9 A;  4PUO A;  1X9J A;  1BCM A;  3THX B;  5JVG L;  2GUI A;  3BF1 A;  2A1S A;  4CZI A;  2VWB A;  1D8Y A;  4CBU A;  1HR0 K;  4CHP A;  4BRF A;  4FLU A;  4JD2 B;  3M5R A;  4MLH A;  2ZJR L;  3G71 N;  3CCR N;  3HRG A;  1M1K O;  1L3V A;  4Y0W A;  2DY4 A;  3CF5 L;  1TKT A;  3H08 A;  4RW9 A;  2IOC A;  2YI1 A;  3THW A;  1JLA A;  5AQG A;  4EP5 A;  1SKW A;  2HBM A;  3ZSV A;  2PFU A;  4B9V A;  1HMV A;  2HBL A;  4QS7 A;  5FPD A;  4LFB K;  2HOE A;  1RTD A;  2GWJ A;  3RMA A;  4E7H A;  1UA1 A;  1P90 A;  3TTC A;  1OH6 A;  3G10 A;  3AVI A;  1VSH A;  5AZJ B;  3QNN A;  3GBT A;  3MN5 A;  4O44 A;  4IDH A;  4RW4 A;  4IFV A;  4MDB A;  1SKS A;  4C8L A;  3ITH A;  2PYJ A;  4ELU A;  3SBT A;  1C0M A;  1S1W A;  1D9D A;  3NHG A;  4WE1 A;  4OO1 J;  1N6Q A;  4BGA A;  4JAX A;  1VQO N;  5KQD A;  3BDP A;  4DTM A;  4A62 A;  1RT2 A;  3OYL A;  4DSL A;  3SI6 A;  3LM2 A;  4JKD A;  2P9I B;  2QKB A;  3W0L A;  4QAG A;  4LH4 A;  1DTT A;  4Q5V A;  3L2U A;  4CZH A;  3AVH A;  3LL3 A;  1VQ4 N;  3A5O C;  4NYN A;  4JK8 A;  4GV9 A;  3CQY A;  3JXU A;  4OKJ A;  4JI5 K;  1BIU A;  1REV A;  5EOY A;  1QZ5 A;  1EP4 A;  3F2K A;  2CGJ A;  3ZSZ A;  1KRP A;  1C1C A;  4FWQ A;  4ZTF A;  1TK0 A;  3J81 O;  1XUP O;  3O9R A;  1DTQ A;  2YHW A;  2NZT A;  2QM1 A;  5J2M A;  1NGA A;  3VQE A;  1TUU A;  4KKO A;  3VQ4 A;  1I94 K;  1ZBF A;  3HOS A;  1C0F A;  4R79 A;  3LDO A;  4CEF A;  5J1E A;  4FJL A;  4FJI A;  4B9U A;  3CJA A;  3DXM B;  3T1A A;  4Z4I A;  1LWC A;  3ID6 A;  1RBV A;  4DLE A;  2YNH A;  3CFR A;  3CHW A;  1CZB A;  3SQ0 A;  1K6Y A;  1NK7 A;  5GAG P;  3ZSQ A;  2HHU A;  3P5J A;  4AQY K;  1VSL A;  1IO2 A;  4CJL A;  3OJU A;  4CIF A;  3NVM A;  3FZF A;  4DR1 K;  4C1N I;  4JS4 A;  3AA4 A;  2RPI A;  4FWR A;  3G6E N;  3SBG A;  4OPA A;  3NVK A;  1S9E A;  1HQE A;  2D0C A;  3VTI A;  1EO1 A;  3TAP A;  1FJG K;  4DU4 A;  3HO1 A;  3I8B A;  3WNE A;  2CH6 A;  5JMV A;  4O8K A;  4CJV A;  1Q18 A;  4BRC A;  1FW6 A;  4ILJ A;  5EY4 A;  3AVN A;  3HM9 A;  2GUP A;  2OA8 A;  2YX6 A;  4FWK A;  3K2P A;  1NK6 A;  3HT3 A;  3TTF A;  3SMP A;  3VQ6 A;  2W6L A;  5C42 A;  4BE0 A;  4IOC L;  2F8S A;  3U8X A;  5T7B A;  2AA4 A;  3C6T A;  2OPP A;  3A5M C;  4DQS A;  3VQQ A;  1W7A A;  5GAH P;  3WUH A;  4H0X B;  5JLF A;  4N76 A;  4O0J A;  1LOT B;  3AO2 A;  3NGI A;  1WSJ A;  4NXM K;  3OYM A;  4DV5 K;  2BH1 A;  1J5E K;  5C24 A;  4FW2 A;  1VSF A;  3HP9 A;  3JS6 A;  3HST B;  5H1S Q;  4FLZ A;  1KC8 O;  2HHQ A;  3L4Q A;  4CHZ A;  1BIZ A;  3TU5 A;  3KLH A;  1ZBI A;  4YDU A;  3P38 A;  4B9T A;  4B8A B;  4ID5 A;  4GNI A;  3KTQ A;  3CC7 N;  1CZA N;  1J5O A;  4BRP A;  3QFU A;  3SQ1 A;  3SYZ A;  3O3F A;  1NGI A;  4K0K K;  4DUZ K;  4FJ8 A;  4M45 A;  4BRG A;  1L3S A;  4CD3 A;  4HUF A;  4O8U A;  1K8K A;  4IZ9 A;  3HOT A;  4CW7 B;  3B6O A;  4HTU A;  3VEV A;  3H6E A;  2J4R A;  2VWJ A;  1WUA A;  3O1B A;  4WFN L;  1XI1 A;  2FBX A;  4DV3 K;  1NNE A;  4JRP A;  2ZF5 O;  3G4S N;  4Z4H A;  4LSL A;  4H0Y B;  1W2B M;  5CZ1 A;  4IO8 A;  1EQY A;  1WSF A;  1ESV A;  2ZGZ A;  5BPM A;  2F96 A;  3QER A;  1WSG A;  4Q0B A;  3DWL A;  5HP1 A;  3L2W A;  3VQA A;  2YKM A;  3VQD A;  3ALY A;  4YOV A;  3L0Q A;  1HJR A;  2IAJ A;  3M6G A;  3CI5 A;  4KRF A;  2P51 A;  2HND A;  3U9D A;  4HVJ A;  4Z4E A;  2UUA K;  2YV0 X;  5LJV A;  3QLH A;  4N47 A;  5FRO A;  4JKC A;  3UE5 A;  1VSJ A;  4B08 A;  3OYH A;  3V1Q A;  3ZSW A;  4JD2 A;  4DR5 K;  3ZSO A;  1JL2 A;  4BC4 A;  3CJB A;  1ATS A;  1NGG A;  4DQP A;  2P5G A;  2X6S A;  4C23 A;  2A6A A;  2DTU A;  4FJX A;  3SK3 A;  3QIP A;  3GL1 A;  4DTP A;  3NF6 A;  4M7Y A;  3BGR A;  1S22 A;  4BE2 A;  5E84 A;  4A2A A;  4EFH A;  2DFE A;  3IDH A;  4Z0U A;  1JCE A;  4JI3 K;  4LF7 K;  5HOO A;  3THY B;  4KHQ A;  1HNI A;  2AJQ A;  4OLB A;  1ASW A;  3V6D A;  3MCA B;  4KHN A;  3O3G A;  3VGK A;  3NE6 A;  3EKU A;  4NXN K;  5KRS A;  4DLG A;  5CYQ A;  2UUC K;  4CZM A;  4H5R A;  5BPN A;  3PY8 A;  1RDU A;  4J2E A;  1XC9 A;  4FWS A;  3O3H A;  4NCB A;  1L3T A;  4WFB L;  1NJI O;  2GV9 A;  3R9P A;  4KBO A;  4NYF A;  1YTU A;  3IG1 A;  1X9M A;  3KJV A;  4BRD A;  1QQM A;  3OW2 M;  4CE9 A;  1YJ9 N;  1JL1 A;  4FWN A;  5BR9 A;  3MCP A;  4FJ5 A;  4H0O A;  1N33 K;  4KH5 A;  3WQU A;  4F4K A;  3E01 A;  4B9N A;  1NKC A;  1NKB A;  4JI7 K;  4CJQ A;  4CJE A;  2FBY A;  2HHT A;  1S6Q A;  3MX5 A;  4CZK A;  3PSF A;  2HF4 A;  3R6M A;  1A5W A;  3LWM A;  4JNE A;  3CET A;  4RG8 A;  2CH5 A;  2NRH A;  1F21 A;  1WAF A;  4M41 A;  1JLF A;  1S1T A;  4FPA A;  1JLG A;  2ZM6 K;  1KSP A;  4MO5 A;  5HLF A;  1ZBH A;  3QET A;  1BWF O;  3KK2 A;  4Y1C A;  3L4I A;  5BN9 A;  3Q7C A;  1OKJ A;  2QKK A;  3PLA A;  4FXD A;  2NRT A;  5KPZ A;  1KFD A;  3WQT A;  4XEI A;  1V4S A;  4B1U B;  3L2R A;  4Z4F A;  3IRX A;  3P31 A;  1NMN A;  3HI0 A;  5M1P A;  3O8M A;  5CY4 A;  1NK8 A;  1Q82 O;  1CZ9 A;  3BY5 A;  4A57 A;  3SAG A;  3I56 N;  2R7Y A;  2ZQB A;  4M3T A;  1NJW A;  2QXF A;  4IFY A;  1Q9Y A;  4UY8 O;  3WXL A;  3TAF A;  4AHT A;  1TK5 A;  3KK3 A;  3KK1 A;  2D1K A;  4W5R A;  1YIJ N;  1SAZ A;  5E41 A;  2O8C A;  3E9O A;  4RW6 A;  3G0Z A;  3SJH A;  1VQ5 N;  2RN2 A;  1MU2 A;  4KO0 A;  2Q0R A;  1KQS M;  1WB9 A;  1J54 A;  3S3N A;  2P9K A;  4E7I A;  1HJO A;  1M90 O;  5C2F A;  4BRO A;  4OLA A;  4CK1 A;  5EU7 A;  5EX5 A;  3RRG A;  3SCX A;  1RBR A;  2OAN A;  2HBK A;  4QOZ B;  5AQN A;  1BOT O;  1VQ9 N;  3QEP A;  5E26 A;  5B8H A;  1XMO K;  3HP6 A;  2NRZ A;  2HHH K;  4L8R B;  3MMV A;  3THX A;  3UB5 A;  4KTZ A;  1KAY A;  1FK9 A;  3U4L A;  3MN6 A;  4CIE A;  2Q36 A;  1RTI A;  3W3D A;  4M3Y A;  3EE9 A;  4U67 L;  1E4G T;  1QQC A;  5FPN A;  1VQM N;  3O9Q A;  5JS1 A;  1NM1 A;  5KTQ A;  1Q9X A;  1EX4 A;  1XHX A;  3A0I X;  4E0D A;  1HPM A;  3ATV A;  1JXE A;  1S1U A;  2GTD A;  3OYE A;  4B3O A;  4M3W A;  3NDK A;  5TKW A;  5JS2 A;  3D2E A;  1Y97 A;  1GLJ O;  4HTL A;  1SUQ A;  2XO7 A;  3HJF A;  1BI4 B;  2WON A;  3DRS A;  4C8M A;  4Z4C A;  1IV0 A;  2P9L A;  2CGL A;  4Y1D A;  3CM5 A;  4CZF A;  3VF4 A;  1TYQ A;  3QB0 A;  5HRR A;  2WUS A;  1TUY A;  3D2F B;  2G8F A;  2ITM A;  2JWK A;  2IVO A;  4CJ4 A;  3T7Z A;  3NGZ A;  4O5B A;  2YNI A;  2D4W A;  3ZT3 A;  4DSK A;  3N4Q A;  4NO7 A;  1KVB A;  2YJE A;  4KHS A;  1J9A A;  5AZI B;  1IKX A;  1SZ2 A;  4KH6 A;  3SQ2 A;  4RW7 A;  3OTO K;  1BA1 A;  3E9L A;  4CER A;  1ATN A;  3ZEU A;  4CES A;  1KLM A;  2IDO A;  3H3O B;  3I0S A;  4BR7 A;  2OTJ N;  5AZI A;  1RT1 A;  4CZL A;  3SUO A;  3ULD A;  3TAB A;  1JLE A;  1XQS C;  4IEE A;  3QES A;  2QK9 A;  1QVF M;  3VPZ A;  3MEC A;  2UXD K;  4AHC A;  4KTQ A;  4DF4 A;  5C25 A;  1GLA G;  4L3Q A;  3AO3 A;  2XY6 A;  5ELZ A;  2Y1I A;  4CJS A;  1BO5 O;  3DJC A;  3VET A;  2O8E B;  4DS5 A;  5I3U A;  3FFI A;  3RMD A;  4H0P A;  3QEI A;  2D0O A;  1O1W A;  4K25 A;  3NH0 A;  2YHX A;  5DMR A;  4FLW A;  1WNS A;  3LDQ A;  4I2P A;  2D0A A;  4ICL A;  3ZLJ A;  1IJJ A;  4C1N K;  4FVM A;  4FJG A;  1LAV A;  2KHO A;  5C12 A;  1LV5 A;  4KV8 A;  1R59 O;  1NJY A;  1GLC G;  3OS1 A;  4FOI A;  3LZI A;  3LDN A;  1KAX A;  2QWR A;  5JLH A;  3HL8 A;  4YY3 K;  2YNG A;  5BRE A;  3F73 A;  3SV4 A;  3GOI A;  3ZSY A;  3LM9 A;  4E19 A;  5AQK A;  4KPY A;  2FF6 A;  2F4V K;  3FFK B;  3P1G A;  4H8K A;  1FXX A;  3QFP A;  4FSV A;  2ITG A;  2WBN A;  2E8A A;  4DFJ A;  3DRP A;  2A1R A;  5M1F A;  3IUC A;  3EY1 A;  4E7K A;  3O4Q A;  4BG8 A;  2OYQ A;  5F2R A;  1GOB A;  2QA4 N;  4YDU C;  1RDC A;  2O4G A;  5F1X A;  3IMX A;  3UKR B;  4DMN A;  1VHX A;  3ZT1 A;  2W41 A;  3KLF A;  4CGJ A;  4IO9 L;  1JJ2 M;  4FLX A;  4BGB A;  5AQT A;  4NLB A;  2OPQ A;  3AO4 A;  3N4P A;  1N5Y A;  1Q8I A;  4WCE L;  5GIN A;  1Y64 A;  2BAN A;  4CF2 A;  2HST A;  3HPG A;  2Z1G A;  1W0H A;  4DUY K;  2Z1I A;  3ZT0 A;  2G8I A;  4CBW A;  2O8D B;  3IS9 A;  4DSJ A;  5BRH A;  4FLY A;  4CZJ A;  2VG6 A;  2RE2 A;  4WF9 L;  4G9Z A;  4DV4 K;  4BR4 A;  4FJ7 A;  4B1W B;  1QSY A;  3EYZ A;  1CXU A;  1BHL A;  4JKH A;  3V1R A;  5BRD A;  2UYT A;  1TL1 A;  2EHG A;  4CHN A;  3NAE A;  3PIP L;  3MED A;  5AFU A;  1E3M A;  3BZC A;  3ENH A;  4FYD A;  4BRA A;  3O4N A;  4E89 A;  3PUF A;  4IXC A;  3WXJ A;  4N56 A;  4X62 K;  1BDG A;  3CFO A;  4DSI A;  3KZB A;  5FLX O;  4MLE A;  3VQ7 A;  1WBB A;  2YJF A;  3AO1 A;  1QS4 A;  4I6M A;  2G8V A;  3M1F A;  1RBU A;  3FZK A;  1YT3 A;  1SL2 A;  1WSI A;  1J6Z A;  3KWI A;  4BR9 A;  5AQX A;  3O1W A;  3CCM N;  5J2N A;  1V4T A;  4B9L A;  4GKJ K;  3THV A;  3ZCM A;  4AM7 A;  4YHH K;  1J53 A;  3VA3 A;  4FPB A;  3HSC A;  4G1Q A;  3AVL A;  3LPT A;  4CFD A;  3DXM A;  1NK9 A;  2FSK A;  4X66 K;  3QNO A;  4IJN A;  4B9S A;  2ZD1 A;  3VES A;  4EHT A;  5HRO A;  4AHV A;  4CJ7 A;  4CGI A;  1U47 A;  3S9H A;  4J2D A;  3HTV A;  2GEM A;  1YTA A;  3KVG A;  2D0P A;  3TAN A;  1U2V A;  2XY5 A;  4FZY A;  3CIP A;  1T05 A;  4PL7 A;  4JI4 K;  3TR8 A;  5AQV A;  1VAZ A;  4CHY A;  4LF6 K;  3D2E B;  1NK5 A;  2RHK A;  3T69 A;  2G8U A;  1TKX A;  3C95 A;  2P9I A;  3AVJ A;  3K59 A;  5FPM A;  3ZX2 A;  4CED A;  2CGK A;  3KD1 E;  5EXW A;  1TV6 A;  1T44 A;  1KVA A;  2KW4 A;  4LSN A;  2D0B A;  1OH8 A;  3MAQ A;  1HRH A;  1VQP N;  3QEX A;  4ID1 A;  5DM7 L;  2OPS A;  3NH1 A;  4K8X A;  3FZL A;  3WEE B;  4DTU A;  2P9N A;  1YJW N;  4OGC A;  4QS8 A;  1H1V A;  5KGX A;  4JKB A;  3EZW A;  2HNZ A;  4M3X A;  1XNQ K;  1RT5 A;  5AQS A;  1YJN N;  5C15 A;  4AIL C;  3QEV A;  3THW B;  1GLD G;  4BAC A;  4F3O A;  2WOM A;  3ID8 A;  1G15 A;  1RDW X;  3KLG A;  4OPJ A;  1NOY A;  3AY9 A;  5GAD P;  1SS6 A;  3CCJ N;  4CEE A;  3NF7 A;  4IKF A;  4DF8 A;  3OYD A;  4BVO A;  2GX9 A;  4YOW A;  4FJK A;  5AJ3 K;  3AVM A;  2O8C B;  3TSQ A;  4JEP A;  3O9S A;  1IKY A;  4K8Z A;  3DXK B;  2QWM A;  4M3R A;  3V9W A;  2ZGY A;  3V9Z A;  1HKC A;  2P9P A;  1OVY A;  2GWK A;  3AO5 A;  4OPK A;  3E1Y A;  1N8R O;  1B92 A;  3IAY A;  3B6P A;  4V19 S;  3H46 O;  5AQZ A;  3DOK A;  4BRK A;  2P9S A;  1VRU A;  3VEN A;  1ZBS A;  3DLR A;  2F8T A;  3MXJ A;  4JI2 K;  1RGI A;  1Z05 A;  4BWJ A;  4B3R K;  3CC2 N;  1MDU B;  3NBP A;  3VEY A;  1X3N A;  3MXI A;  5EVZ A;  3L2Q A;  1RTH A;  1JLB A;  3WNF A;  3EEQ A;  4CZG A;  4JKG A;  2QTD A;  1DKG D;  1SKR A;  4IOX A;  3LP0 A;  4ZTJ A;  4H5W A;  1LCU A;  3R3L A;  3A5L C;  3LAN A;  4WQ4 C;  4A61 A;  2O8B A;  3OYC A;  1DLO A;  1CXQ A;  4GVE A;  3CCV N;  3AAR A;  3UKU B;  2G8W A;  3CQ8 A;  2E20 A;  4IG3 A;  1ZYQ A;  2Q97 A;  1KAZ A;  3AV9 A;  5AQF A;  3OYK A;  4QS9 A;  3J7Z O;  2AP1 A;  1HPZ A;  1L5U A;  3LWL A;  4F8R A;  4JYA K;  5M1Q A;  1YXQ A;  4DS4 A;  4BR0 A;  2NUB A;  2ZE2 A;  4YOR A;  2YCH A;  2HW3 A;  1TAQ A;  3DAW A;  3CQX A;  2XY7 A;  4FCY A;  4OGE A;  3SUN A;  4ILG B;  4JI0 K;  2QWN A;  1BCO A;  1RBS A;  2W40 A;  5AQH A;  3HVR A;  2YHB A;  5AQP A;  2E6M A;  1VQN N;  4BC5 A;  2BE2 A;  3NF9 A;  4DFK A;  2P9N B;  3K58 A;  4M3Z A;  2G8K A;  3BF3 A;  1DT9 A;  2VG7 A;  1YVU A;  2ZWH A;  4DTS A;  3CG7 A;  5AQI A;  2XY8 A;  2FLO A;  3M8Q A;  3VMF B;  3LP2 A;  4CGF A;  3MXM A;  1E4F T;  2VGN A;  3WT0 A;  4EP4 A;  1BQN A;  1NGD A;  3L3U A;  5C10 A;  2Z1J A;  2JWL A;  4I9Q A;  4FK0 A;  3DLE A;  1GOC A;  1QHA A;  4CFA A;  3C0B A;  4C8K A;  3O4W A;  1D9F A;  1GLB G;  1OVQ A;  4FLV A;  4OKK A;  2NRV A;  4JI1 K;  4JI6 K;  4H0V B;  1ITG A;  3RVC A;  4FM2 A;  2FF3 B;  2PBD A;  4FWL A;  2VGM A;  3C7N A;  3VTH A;  4DTR A;  4BY9 C;  3VF2 A;  3KKR A;  3CMA N;  3CJ1 A;  4WFA L;  4JK7 A;  4H5T A;  3DLH A;  5HRS A;  2FBV A;  3DRR A;  3CJ7 A;  3PX6 A;  3OBY A;  1XWL A;  3VGL A;  4J2A A;  4LF9 K;  3EL2 A;  3EO3 A;  2KLA A;  2Q1N A;  4RCH A;  3NCI A;  4IDK A;  2HBJ A;  2XHB A;  1N32 K;  4PY5 A;  3CYM A;  3OS0 A;  4F2S A;  1RT7 A;  2VQE K;  3OA9 A;  2Q3S A;  4GV6 A;  2WTU A;  1YVN A;  3UKU A;  1RT3 A;  4E1N A;  1TKD A;  4DB3 A;  1ZBL A;  3VQ8 A;  1VSK A;  4DTX A;  4FM1 A;  1U6Z A;  3QML A;  4EIA A;  2B5J A;  2D5R A;  2VCP A;  1G99 A;  1TK8 A;  1IBL K;  2VWK A;  1A5X A;  1ZXO A;  4CFC A;  5F0X A;  5DM6 L;  3LPU A;  3SPY A;  5BR8 K;  4C8O A;  3T19 A;  2FSN A;  4BRN A;  4M63 C;  4B8C A;  3PSI A;  3ZSR A;  3M8R A;  2F9T A;  4PKH A;  5ADX H;  5LJW A;  4LFC K;  4CEC A;  5HL7 L;  1XC3 A;  4CJP A;  3CPW M;  3RMB A;  1NJX A;  4KFB A;  4RWT A;  4FVU A;  3M8P A;  4CI6 A;  2QWL A;  4CJT A;  2P9S B;  3LP3 A;  2BGG A;  3HZ6 A;  4CEO A;  4K42 A; 
#chains in the Genus database with same CATH homology
 4I2P A;  4DU1 A;  2RPI A;  1QE1 A;  2D0A A;  4CJU A;  1X9S A;  4ICL A;  1HYV A;  4FVM A;  3AVA A;  4KI4 A;  4FJG A;  1LAV A;  1LV5 A;  4KV8 A;  5CYM A;  1NJY A;  2VG5 A;  3OS1 A;  1S9E A;  1HQE A;  1CLQ A;  2D0C A;  3V81 A;  4GW6 A;  3TAP A;  3LZI A;  3I8D A;  4DU4 A;  4CK3 A;  1WSH A;  3OYG A;  3EZ5 A;  3HO1 A;  3HL8 A;  3QIO A;  2YNG A;  3RRH A;  2HNY A;  3WNE A;  3F73 A;  1GOA A;  3MEE A;  3OYA A;  3P83 D;  3SV4 A;  4DSE A;  3ZSY A;  4CJV A;  3SV3 A;  4E19 A;  3SUQ A;  4DFM A;  2PYL A;  4GMJ B;  4KPY A;  1QHT A;  4O4G A;  3ZT2 A;  2ATQ A;  3RR7 A;  2E6L A;  3AVN A;  2DFH A;  3L3V A;  1U45 A;  4I9L A;  3KLI A;  3P1G A;  4H8K A;  3HM9 A;  3K5N A;  1FXX A;  3HK2 A;  1SL1 A;  3VQC A;  2ITG A;  4CF1 A;  3PO5 A;  3ASM A;  4DFJ A;  3DRP A;  4O0I A;  2A1R A;  4LH5 A;  3QEW A;  2OA8 A;  2YNF A;  3AVB A;  3K2P A;  3HT3 A;  1NK6 A;  2PZS A;  4W5Q A;  3EY1 A;  4E7K A;  3O4Q A;  3VQ6 A;  3PV8 A;  2OYQ A;  1HYS A;  3TWH A;  1GOB A;  1HYZ A;  1RDC A;  2O4G A;  5C42 A;  4BE0 A;  4DMN A;  1Z26 A;  3U3Y A;  2G8H A;  3ZT1 A;  2F8S A;  4KAZ A;  5T7B A;  3C6T A;  3VQP A;  2Z1H A;  3KLF A;  4I7F A;  2OPP A;  4CJF A;  1A5V A;  4CGJ A;  3VQQ A;  1LWF A;  4FLX A;  4DQS A;  1WN7 A;  4N76 A;  4CEO A;  1RDD A;  2OPQ A;  3AO4 A;  1T8E A;  4O0J A;  1N5Y A;  4OJR A;  3AO2 A;  3NGI A;  1Q8I A;  5I42 A;  4J2B A;  1WSJ A;  2BAN A;  4CF2 A;  3OYM A;  5FRN A;  5C24 A;  3ZT4 A;  3HPG A;  4FW2 A;  3JYT A;  4FJM A;  1VSF A;  3HP9 A;  4FLZ A;  2Z1G A;  3HST B;  1W0H A;  1FKP A;  2HHQ A;  3OYN A;  2Z1I A;  3ZT0 A;  1BIZ A;  4CHZ A;  3UIQ A;  2G8I A;  4CJR A;  1BGX T;  3LDS A;  3KLH A;  3AA5 X;  1U49 A;  2BDP A;  1ZBI A;  4B9T A;  3IS9 A;  4DSJ A;  2KZM A;  4B8A B;  4ID5 A;  3KTQ A;  4FLY A;  1J5O A;  2VG6 A;  3SZ2 A;  3LAK A;  1XHZ A;  3RTV A;  1W9H A;  3SQ1 A;  4E7L A;  2FC0 A;  3SYZ A;  1HQU A;  4FJ7 A;  3DMJ A;  5DK5 A;  1VSM A;  4BWM A;  3O3F A;  1JLQ A;  4H4M A;  2HVI A;  1VSE A;  3RR8 A;  4EZ9 A;  1QSY A;  3EYZ A;  5KGW A;  4FJ8 A;  2ETJ A;  4M45 A;  3VQ5 A;  1CXU A;  1BHL A;  3V1R A;  1L3S A;  2HB5 A;  4OKE A;  4CEB A;  4HUF A;  4YNQ A;  1TL1 A;  3HYF A;  3ZSX A;  3OYI A;  2EHG A;  4CHN A;  3NAE A;  3TAQ A;  3SNN A;  3MED A;  3B6O A;  2DFF A;  4HTU A;  5SWM A;  4FYD A;  3O4N A;  4E89 A;  1T03 A;  2O4I A;  3DOL A;  3PUF A;  3VQ9 A;  4DU3 A;  4AH9 A;  4CHQ A;  2VWJ A;  4N56 A;  4W5N A;  3T3F A;  1XI1 A;  2FBX A;  4NCA A;  1S6P A;  4JRP A;  3OS2 A;  3CFO A;  1X9W A;  3HPH A;  4Z4H A;  4LSL A;  4DSI A;  3VQ7 A;  3F9K A;  3AO1 A;  1QS4 A;  5CZ1 A;  2G8V A;  1WSF A;  1RBU A;  5J2P A;  3OYF A;  5KRT A;  1YT3 A;  2F96 A;  3QER A;  1WSG A;  1SL2 A;  1WSI A;  4FZX C;  2IS3 A;  5HP1 A;  4Q0B A;  1KVC A;  3L2W A;  1IG9 A;  3VQA A;  5J2N A;  5CZ2 A;  3LAM A;  2YKM A;  4B9L A;  3VQD A;  3THV A;  3ALY A;  3ZCM A;  1J53 A;  4KRF A;  1HJR A;  2IAJ A;  2OZM A;  4XIU A;  1EKE A;  3VA3 A;  3V1O A;  3HVT A;  2P51 A;  2HND A;  3OJS A;  3HXM A;  1NK4 A;  4G1Q A;  2HHX A;  2OPR A;  3AVL A;  3LPT A;  4O55 A;  2YV0 X;  2X78 A;  3C6U A;  4CFD A;  4HVJ A;  3QLH A;  1NK9 A;  4N47 A;  1S1X A;  4KHU A;  4QCL A;  5FRO A;  3QNO A;  1WSE A;  2YHA A;  1QSS A;  1VSJ A;  4B08 A;  2ZD1 A;  4B9S A;  4FZZ A;  4CGH A;  3OYH A;  4KB1 A;  5HRO A;  4CHO A;  4AHV A;  3V1Q A;  3ZSW A;  3PO4 A;  1LW2 A;  4CGI A;  3ZSO A;  4R5P A;  1JL2 A;  1UOC A;  3LZJ A;  4DFP A;  3S9H A;  1U47 A;  4J2D A;  2XRI A;  3LP1 A;  4FK4 A;  4F3T A;  3OYB A;  4DQP A;  3JSM A;  3DM2 A;  1YTA A;  4HUE A;  2P5G A;  2X6S A;  3QO9 A;  3TAN A;  2DTU A;  4CF0 A;  2XY5 A;  4FZY A;  4FJX A;  1T05 A;  1RBT A;  3DLG A;  3SQ4 A;  3QIP A;  3AA2 A;  3D45 A;  1TKZ A;  3TR8 A;  1IH7 A;  3NF6 A;  4C8N A;  4DTP A;  3BGR A;  4BE2 A;  4CHY A;  2KZZ A;  4OVL A;  1NK5 A;  4IBN A;  2DFE A;  4Z0U A;  2G8U A;  4BE1 A;  1TKX A;  3C95 A;  3AVJ A;  3K59 A;  4KRE A;  4CED A;  3RWU A;  3KD1 E;  3NH2 A;  1NK0 A;  4KHQ A;  2OZS A;  1TV6 A;  3K5M A;  1HNI A;  3PX0 A;  1UWB A;  2AJQ A;  5K14 A;  4OLB A;  1ASW A;  3M8S A;  1KFS A;  3V6D A;  1KVA A;  2KW4 A;  4LSN A;  4M42 A;  1IKV A;  4KHN A;  3O3G A;  2D0B A;  3NE6 A;  3MAQ A;  1HRH A;  4E3S A;  3V9X A;  3SUP A;  3KLE A;  1C0T A;  5KRS A;  4ID1 A;  3QEX A;  2OPS A;  4DLG A;  3AVG A;  5CYQ A;  4DQR A;  3NH1 A;  3DYA A;  1U48 A;  4KB0 A;  1C1B A;  3PY8 A;  4K8X A;  4J2E A;  4DTU A;  1XC9 A;  4OGC A;  3O3H A;  1ASV A;  4NCB A;  1EXQ A;  3U3G A;  5KGX A;  3WNG A;  1L3T A;  2HNZ A;  4CFB A;  1JXB A;  4M3X A;  2B6A A;  1NJZ A;  4HUG A;  2PY5 A;  3LAL A;  1RT5 A;  2GV9 A;  3AA3 A;  4E7J A;  3MEG A;  1U04 A;  3TAM A;  3PX4 A;  4NYF A;  1B9D A;  4AIL C;  3QEV A;  1YTU A;  3IG1 A;  3D0P A;  4FLT A;  1X9M A;  4FJN A;  5FRM A;  3NFA A;  3KJV A;  4CEA A;  1RCH A;  3DLB A;  1SL0 A;  4BAC A;  4CE9 A;  2WOM A;  4DQQ A;  1JL1 A;  4F3O A;  4JS5 A;  1KLN A;  2KFN A;  4PQU A;  2RF2 A;  1TL3 A;  1G15 A;  3KLG A;  1T7P A;  4FJ5 A;  4OPJ A;  4FM0 A;  4N5S A;  4ELV A;  4F4K A;  2B4J A;  3E01 A;  1NOY A;  4I2Q A;  4B9N A;  1NKC A;  4CEE A;  4DTO A;  3NF7 A;  1NKB A;  4IKF A;  4CJQ A;  4DF8 A;  2P5O A;  4CJE A;  3OYD A;  2FBY A;  4ELT A;  2HHT A;  1S6Q A;  4CGD A;  4FJK A;  4NCG A;  3LWM A;  4W5O A;  1A5W A;  3AVM A;  4RG8 A;  1TVR A;  1F21 A;  1RDA A;  1WAF A;  4M41 A;  1JLF A;  1RT4 A;  1S1T A;  1IKY A;  1JLG A;  4K8Z A;  4PA1 A;  3S3O A;  1S1V A;  1JLC A;  4M3R A;  1KSP A;  1LW0 A;  3V9W A;  5HLF A;  3V9Z A;  1ZBH A;  3QET A;  3V9U A;  2Y1J A;  3L8B A;  4JLH A;  4CCH A;  1QTM A;  4DG1 A;  4F2R A;  2KTQ A;  3VA0 A;  3KD5 E;  1WLJ A;  4KTW A;  3AO5 A;  2RKI A;  4E1M A;  2X6N A;  1BIS A;  4OPK A;  3KK2 A;  4FJJ A;  1RDB A;  3A2F A;  1B92 A;  4Y1C A;  4AHS A;  4CEQ A;  3IAY A;  3B6P A;  3TAG A;  3VQB A;  2P1J A;  3DOK A;  3V9S A;  2QKK A;  4FJH A;  4FXD A;  5D3G A;  4Z4E A;  1SV5 A;  1S5J A;  1LWE A;  1UAX A;  1VRU A;  4DTJ A;  1KFD A;  4CK2 A;  4HHT A;  4EZ6 A;  2IGI A;  3L2R A;  1I39 A;  1HNV A;  4FLW A;  3DLR A;  2HMI A;  4H4O A;  3CM6 A;  3IRX A;  5HRP A;  1QSL A;  4DQI A;  4Z4F A;  2F8T A;  3MXJ A;  2KFZ A;  1NK8 A;  3TAR A;  5CY4 A;  4BWJ A;  4FW1 A;  4CF9 A;  1CZ9 A;  3V4I A;  3CFP A;  4CGG A;  3I0R A;  2R7Y A;  2ZQB A;  3NBP A;  2YKN A;  3DI6 A;  4MFB A;  2W42 A;  1NJW A;  2QXF A;  4IFY A;  1Q9Y A;  4M3T A;  1KTQ A;  3MXI A;  3TAF A;  4AHT A;  4CIG A;  3L2Q A;  1BL3 A;  1TK5 A;  4KHY A;  1RTH A;  1JLB A;  3NGY A;  3KK3 A;  3U6F A;  3KK1 A;  4W5R A;  2GBZ A;  3WNF A;  4GVM A;  5HBM A;  5E41 A;  3KIO A;  1SKR A;  4RW6 A;  3G0Z A;  1S9G A;  2RN2 A;  3LP0 A;  3VN5 A;  4ZTJ A;  1MU2 A;  3LAN A;  4KI6 A;  4N41 A;  4ZHR A;  3AVK A;  4KO0 A;  4CJ5 A;  3OYC A;  1DLO A;  4FK2 A;  1CXQ A;  1B9F A;  4RW8 A;  4FJ9 A;  1BI4 A;  3K5O A;  5FDL A;  3TI0 A;  1J54 A;  3S3N A;  2G8W A;  1D5A A;  2LSN A;  3CQ8 A;  4E7I A;  4IG3 A;  4W5T A;  1ZYQ A;  1VSI A;  3AVF A;  3DLK A;  3AV9 A;  4BDY A;  4CJW A;  4CK1 A;  5EU7 A;  3OYK A;  1I3A A;  4OLA A;  1BQM A;  1HPZ A;  3S3M A;  1L5U A;  2EX3 A;  3RRG A;  1LAW A;  3LWL A;  4DSF A;  1RBR A;  3SCX A;  4LY7 A;  2HHS A;  2HHW A;  4F8R A;  1L3U A;  4QOZ B;  1ASU A;  1RNH A;  2JGU A;  4DS4 A;  4B9M A;  1KCF A;  1EET A;  2NUB A;  2ZE2 A;  1TGO A;  3ISN C;  4IG0 A;  3QEP A;  2HW3 A;  1TAQ A;  3OVN A;  1VK0 A;  1C6V A;  2XY7 A;  2HHV A;  4KHW A;  3HP6 A;  4FCY A;  4OGE A;  3OYJ A;  3SUN A;  3NF8 A;  4BDP A;  4L8R B;  2I5J A;  4UQG A;  4AHR A;  4KTZ A;  2FBT A;  3KKS A;  1BCO A;  1RBS A;  3HVR A;  1FK9 A;  2YHB A;  1X1P A;  1RTJ A;  4MQ3 A;  4CJK A;  4PUO A;  4DTN A;  4CIE A;  1NKE A;  4LD0 A;  4M3Y A;  1RTI A;  2E6M A;  2BE2 A;  3NF9 A;  1BCM A;  2GUI A;  2A1S A;  1QQC A;  4DFK A;  1Z25 A;  1D8Y A;  5JS1 A;  5KTQ A;  3K58 A;  1R0A A;  1Q9X A;  1EX4 A;  1XHX A;  1VRT A;  5HRN A;  2G8K A;  4CHP A;  4M3Z A;  4FLU A;  4E0D A;  1JXE A;  1S1U A;  2VG7 A;  1YVU A;  4CEZ A;  4DTS A;  3CG7 A;  2XY8 A;  3M8Q A;  3OYE A;  4B3O A;  4CGF A;  3LP2 A;  4M3W A;  3NDK A;  3MXM A;  1L3V A;  2DY4 A;  1TKT A;  1BQN A;  3H08 A;  3L3U A;  4RW9 A;  2IOC A;  5JS2 A;  4EP4 A;  1Y97 A;  1JLA A;  2E4L A;  3AVC A;  2Z1J A;  4I9Q A;  4FK0 A;  1FKO A;  3DLE A;  1SUQ A;  4EP5 A;  1NOZ A;  1SKW A;  1GOC A;  3ZSV A;  4BDZ A;  4B9V A;  1HMV A;  2XO7 A;  4CFA A;  3HJF A;  5J2Q A;  1BI4 B;  2WON A;  1C1A A;  3DRS A;  4C8M A;  4Z4C A;  4CF8 A;  1RTD A;  3RMA A;  4E7H A;  1UA1 A;  4Y1D A;  4C8K A;  3CM5 A;  3G10 A;  3AVI A;  1VSH A;  1D9F A;  4AHU A;  4FLV A;  4DWI A;  3WNH A;  4OKK A;  3K57 A;  3QNN A;  1RT6 A;  4HCB A;  3C94 A;  1ITG A;  4O44 A;  4FM2 A;  3SJJ A;  2X74 A;  4RW4 A;  4IFV A;  4C8L A;  5HRR A;  3OY9 A;  1SKS A;  2G8F A;  3ITH A;  2PYJ A;  4ELU A;  1C0M A;  1S1W A;  4CJ4 A;  4DTR A;  1D9D A;  3NHG A;  4WE1 A;  3NGZ A;  1N6Q A;  1C0U A;  3KKR A;  4O5B A;  1UA0 A;  2YNI A;  3BDP A;  3L2V A;  4DTM A;  1RT2 A;  3ZT3 A;  3DLH A;  5HRS A;  2FBV A;  3OYL A;  3DRR A;  4DSK A;  3PX6 A;  1VSD A;  4DSL A;  3SI6 A;  1XWL A;  4HCC A;  4J2A A;  1TAU A;  1KVB A;  4KHS A;  5SZT A;  1J9A A;  1U4B A;  1IKX A;  2QKB A;  3NCI A;  4IDK A;  4LH4 A;  1DTT A;  4QAG A;  4Q5V A;  1JKH A;  3L2U A;  2XHB A;  3SQ2 A;  4RW7 A;  3AVH A;  4PY5 A;  4NYN A;  3CYM A;  3OS0 A;  3RMC A;  4CER A;  3SPZ A;  1RT7 A;  2KQ2 A;  4F2S A;  2Q3S A;  1ZBU A;  2HVH A;  4OKJ A;  1BIU A;  1REV A;  2JLE A;  4CES A;  1RT3 A;  4E1N A;  4CJ3 A;  1KLM A;  1TKD A;  2IDO A;  1EP4 A;  1ZBL A;  1RIL A;  3VQ8 A;  1IKW A;  3I0S A;  3ZSZ A;  1VSK A;  1KRP A;  1RT1 A;  3HPO A;  4FM1 A;  4DTX A;  4PWD A;  1C1C A;  4ZTF A;  1TK0 A;  3SUO A;  3ULD A;  2B5J A;  2D5R A;  3TAB A;  1TK8 A;  1JLE A;  3QES A;  4JRQ A;  1DTQ A;  2VWK A;  5J2M A;  3VQE A;  2QK9 A;  3VQ4 A;  1A5X A;  4KKO A;  4CFC A;  3MEC A;  3TAE A;  4AHC A;  1ZBF A;  3LPU A;  4TSX A;  3SPY A;  4KTQ A;  4DF4 A;  5C25 A;  4C8O A;  4CEF A;  5J1E A;  4FJL A;  3AO3 A;  3T19 A;  2XY6 A;  4B9U A;  3T1A A;  4FJI A;  4Z4I A;  2Y1I A;  1LWC A;  4B8C A;  3ZSR A;  4CJS A;  3M8R A;  4YFU A;  1RBV A;  4DLE A;  2YNH A;  3CFR A;  1CZB A;  3SQ0 A;  1K6Y A;  4DS5 A;  4CEC A;  5I3U A;  1NK7 A;  3FFI A;  4CJP A;  3RMD A;  3RMB A;  3ZSQ A;  2HHU A;  1NJX A;  3P5J A;  3K5L A;  4KFB A;  3QEI A;  1O1W A;  1VSL A;  1IO2 A;  3M8P A;  4CJL A;  3QIN A;  3NH0 A;  3OJU A;  4CJT A;  4Z4G A;  4CIF A;  1WAJ A;  3LP3 A;  4M3U A;  2BGG A;  2IC3 A;  5DMR A;  4JS4 A;  5KI6 A;  3AA4 A;  1WNS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...