3VQQA

Hiv-1 integrase core domain in complex with 2,1,3-benzothiadiazol-4-amine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
144
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYNPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 53
structure length 144
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqqA00
3ZSZA 4CHYA 4CGGA 3SUQA 3OYHA 3BGRA 3AVNA 3DLHA 1B9DA 3L2WA 4IG3A 3S3NA 1ASUA 4CJEA 4CCHA 1D5AA 5C42A 4CERA 3AVFA 3AO5A 4RG8A 3I8DA 1KTQA 4FLWA 5HRSA 3TARA 1ZBLA 1NK9A 4HCBA 3OJUA 1YTUA 4FLTA 3ZCMA 4F4KA 3OYKA 3SJJA 2KZZA 3TR8A 3PX4A 4E7IA 4B9UA 2P5GA 1S1UA 3AVGA 2ATQA 3HSTB 2QK9A 2I5JA 4CK1A 1WSGA 4IBNA 4AHSA 4FJKA 2A1SA 5KGXA 4UQGA 4CIEA 3NDKA 1VSFA 3TWHA 4FJXA 1JLQA 1Y97A 1VSKA 3CM6A 1KVCA 1TKXA 3T1AA 3RMCA 4R5PA 3IAYA 2HHSA 3L2RA 4KI4A 3AO4A 3ZT4A 3KIOA 2XY7A 2X74A 3OYNA 1C1CA 4QOZB 4EZ9A 1D8YA 1JLCA 1NJZA 4M3TA 2DY4A 1C0MA 1Q8IA 4CHNA 3EZ5A 2DFEA 4WE1A 3DM2A 3OYMA 3LWLA 1R0AA 1NJYA 4J2EA 3TAMA 2KTQA 4CJ5A 4ICLA 3U3GA 2VG6A 1RTDA 3QEXA 5C24A 1LV5A 5EU7A 3KD1E 3UIQA 3PV8A 3VQ9A 1EETA 1B9FA 4O44A 4OKJA 2NUBA 1BI4A 3V9XA 2B5JA 1A5VA 3EYZA 4C8OA 4RW4A 1ZBHA 3C6TA 2ZD1A 4J2BA 5CYQA 2Z1GA 3TAPA 1KVBA 1TV6A 4FM2A 1TL1A 3THVA 1BIUA 3KK2A 1HYSA 2Z1JA 1WAJA 1DTQA 5FROA 4B8CA 2E6MA 4I9LA 1J5OA 2E4LA 1W0HA 2FBTA 2VG7A 1TK5A 2D0AA 1BL3A 4CFCA 1HNVA 1UWBA 3LP1A 3SQ4A 3VN5A 1L3TA 4IFVA 3VQBA 4CJQA 4CFBA 2XY6A 4FJ5A 1JL2A 1N5YA 4E1MA 1MU2A 1VSIA 1Z25A 3SZ2A 4BE2A 3OS0A 3H08A 5HBMA 3KTQA 4E1NA 4CJPA 1ZBFA 3M8PA 3DRSA 3WNEA 4CGJA 1JLEA 1G15A 4DTXA 1UA1A 4M3WA 4OGEA 4DMNA 1IKXA 4KFBA 1NK7A 3DLGA 1LWCA 1BQMA 3LDSA 1YTAA 4DTMA 5HLFA 4CEEA 4I7FA 4JS5A 1JLAA 4DTJA 4HCCA 4ID5A 1L3SA 4RW6A 4BWMA 4DU3A 3PO5A 3NGIA 1XHXA 2ETJA 4H4MA 4CEAA 3VQ5A 1U49A 4Z4CA 1QSYA 2HHWA 1CXUA 3QNOA 3OS2A 3ZSYA 3O4NA 1NJWA 3SQ2A 4FZZA 3L3VA 3M8QA 1LAVA 3DYAA 4CIGA 4AILC 3QESA 4C8LA 1NKEA 1HYVA 2DFFA 1CXQA 4C8MA 4KRFA 1QQCA 4JLHA 4CEZA 4I2QA 3VQ8A 3OYDA 3NGZA 3K5MA 3HP6A 1RDCA 1S1TA 1JL1A 3LP0A 3VQEA 5J2QA 3LP3A 1L3VA 4NCAA 1JXEA 2YNFA 4DS5A 1QE1A 1S1VA 3I0SA 4C8KA 1QTMA 3HT3A 3KK1A 1J53A 1KLMA 2KW4A 4F2SA 4IDKA 3CYMA 3DOLA 4L8RB 3K58A 3SV3A 4FM1A 1TVRA 4K8XA 3G0ZA 3ZSQA 3ASMA 1YT3A 3AVMA 3VQAA 1RBRA 3AVHA 1JLFA 2VWKA 4DG1A 4DTUA 4E7JA 1I39A 3K5OA 3AVCA 1KFSA 4CF2A 3NFAA 4OGCA 2GV9A 4W5OA 5FDLA 2YNIA 3L2UA 1REVA 2G8VA 1LW0A 2HNYA 3HPHA 4FXDA 3ISNC 3KLEA 1HPZA 1KSPA 4Z4IA 3B6PA 2XRIA 1HNIA 3E01A 4OKKA 2VG5A 3LALA 4YFUA 2W42A 3PX6A 4H8KA 4N76A 3OJSA 4DFJA 1CZBA 1BISA 1TAQA 2PYLA 4KREA 3LZJA 2G8IA 4PUOA 1KVAA 1IKYA 4N5SA 4LD0A 3TAEA 3VQCA 4O4GA 3DLEA 4DQQA 3P5JA 3VQ4A 3HVRA 1NK6A 3CQ8A 3KJVA 4FZXC 3SNNA 4KPYA 1LW2A 4BE0A 4M3RA 2YNGA 3V81A 1RBSA 4OJRA 2DTUA 5SWMA 3AV9A 3I0RA 4M41A 1JXBA 4E7KA 3PY8A 1L5UA 2HHTA 1XWLA 4FJGA 3KKRA 1L3UA 2P1JA 4NCGA 2O4GA 3F73A 1J9AA 1WSEA 4B9VA 1S1WA 3HVTA 2XO7A 4OPKA 2ZE2A 1TKDA 1K6YA 1RDDA 3QINA 2YKMA 3V4IA 3NAEA 4CK2A 4QCLA 4OKEA 3V6DA 4DLGA 3HPGA 4FLYA 2EHGA 4DF8A 1RT7A 5HRPA 3OS1A 3CFRA 3D0PA 3S3MA 4O0IA 2QKKA 2G8FA 2BGGA 1WSHA 1FKPA 4O5BA 4FM0A 4HUGA 3KLIA 3V1RA 3ZSWA 1GOCA 3K2PA 3NF8A 4ELVA 2OPRA 2JGUA 4KV8A 5DMRA 3L2QA 4HHTA 1NOYA 4KHUA 3IS9A 3ZSRA 3RR7A 2YKNA 3AA5X 3P1GA 2G8UA 5CZ2A 4XIUA 2B6AA 4F3TA 4KHWA 4C8NA 4FJMA 3OYAA 2ITGA 4OVLA 1DTTA 3OVNA 4MQ3A 1T03A 1NK8A 1VRUA 4K8ZA 2IC3A 1T8EA 4FJNA 3G10A 3KKSA 5KI6A 1U45A 1QSSA 3ITHA 3LAKA 3NF9A 3JYTA 2P5OA 3TANA 1S9GA 2BE2A 4DTRA 3ZSOA 2D5RA 1D9DA 2HHXA 1TAUA 3QEIA 4KHYA 1RDBA 4CJKA 2Y1IA 2HNDA 2X78A 3NHGA 1HYZA 4FLVA 4DTPA 3L8BA 1XI1A 4CF8A 1WAFA 3ULDA 4DQRA 1EX4A 4AHCA 4ZTJA 1X9MA 4FK2A 5SZTA 4AHRA 1SV5A 3SYZA 5JS2A 4CEOA 3K57A 1NK4A 1IG9A 3KK3A 3SV4A 3NF7A 4CIFA 1SUQA 3M8SA 3CG7A 5HRRA 3QO9A 3DRRA 1BHLA 4NYFA 4O0JA 4AHUA 4CGIA 3NH2A 4H4OA 5DK5A 3LWMA 4E3SA 3VQQA 4J2AA 5FRNA 4PY5A 3QIOA 4Z4HA 1FKOA 4DSIA 3AVKA 2IOCA 4PA1A 4M3UA 4I9QA 1GOBA 4KKOA 2G8KA 2YHBA 4LH5A 2F96A 4FLXA 4B08A 1RT3A 2HW3A 4NCBA 2ZQBA 2HB5A 4JS4A 2HVIA 3AVBA 5KTQA 2RN2A 4HUEA 3O3HA 1JLGA 5J1EA 3C95A 1C1BA 2P51A 3ZT0A 1BCOA 4AHVA 4CK3A 3MEGA 2R7YA 4DTSA 2RPIA 3V1QA 1C0UA 1S6PA 3V1OA 2OZSA 4F8RA 5T7BA 2BDPA 2OYQA 1GOAA 3AO1A 1T05A 1ZBIA 4F2RA 1O1WA 4IFYA 1RILA 4PQUA 1VRTA 3RMDA 2AJQA 3LANA 3BDPA 4AHTA 4DSLA 3V9ZA 1NKBA 1BQNA 1JLBA 2EX3A 3KLHA 3QETA 4EP5A 2HHVA 2RKIA 3IG1A 4DLEA 3TAGA 3MEDA 4KTQA 1RT2A 1A5WA 4M3ZA 3FFIA 1BCMA 3VA3A 4LH4A 1SL1A 4KTWA 4FJ8A 5J2PA 1HMVA 1HQEA 2HNZA 1WSIA 2WOMA 3DOKA 3QLHA 3WNHA 3B6OA 3L2VA 3OYCA 1IH7A 3NGYA 2X6SA 3CFOA 2WONA 4ELUA 2B4JA 1RDAA 4ZHRA 3K5NA 4DS4A 3SUNA 1F21A 1UOCA 3HXMA 1CZ9A 3L3UA 2PYJA 1RNHA 1TKZA 3DLKA 2FBVA 3OYEA 4E7HA 3TAQA 5D3GA 1U04A 3ALYA 3RRHA 1S1XA 4RW9A 1I3AA 4JRQA 1VSMA 4CGHA 2FBXA 1RTJA 1ASWA 4CEDA 1RT4A 1TKTA 3SUOA 1SKWA 1FK9A 3O3FA 1UA0A 4FCYA 4Z4EA 3AVAA 2OPSA 2KFZA 4DQSA 3TAFA 5JS1A 1A5XA 1BIZA 4Q0BA 4CFDA 3AVIA 4FJLA 4Y1DA 4W5NA 1ZBUA 1ASVA 3SUPA 3OYBA 3P83D 1RBVA 3VQPA 5KRSA 2XHBA 2PY5A 3IRXA 4LSNA 4CF1A 3C6UA 1HQUA 3M8RA 1QS4A 1KLNA 4DU4A 2G8WA 3RWUA 3MECA 3AA2A 2KQ2A 2OPPA 2Q3SA 1TGOA 4CGDA 2FBYA 4HVJA 3SPYA 4B3OA 3PO4A 1TK0A 5I42A 5CY4A 4BWJA 2GUIA 4OPJA 2OA8A 3NH1A 4CF9A 3MAQA 3CFPA 1QHTA 4E19A 1HRHA 3D45A 2IDOA 4KHSA 4TSXA 1X9WA 2IS3A 4DSEA 3OYFA 3QIPA 1VSHA 1QSLA 2XY5A 2A1RA 4CF0A 4CJVA 4O55A 4YNQA 3AO3A 1NOZA 4N47A 4E89A 4Q5VA 1Q9XA 3HM9A 4AH9A 2IGIA 4CHPA 3V9SA 4F3OA 3AA4A 4KHNA 2HVHA 3LPTA 3EY1A 1VSLA 1VK0A 4IG0A 1IKWA 3DLBA 4W5RA 1EXQA 4MFBA 4CEBA 5HRNA 1XHZA 1B92A 5KGWA 2OZMA 3NE6A 3S9HA 1IKVA 4BDPA 1W9HA 2KZMA 4CHOA 4BACA 3PUFA 4KAZA 3RRGA 4E0DA 4CEFA 1C0TA 1RT6A 3VQ6A 3RMAA 3KD5E 1NJXA 2BANA 4CESA 1LWFA 4OLBA 2DFHA 4DU1A 4B8AB 3LAMA 5CZ1A 1S5JA 2G8HA 4CJFA 4FJ9A 2HHUA 1WLJA 2XY8A 4CEQA 4M45A 5CYMA 4CGFA 1BI4B 1S6QA 4G1QA 3WNFA 4EP4A 4ZTFA 3MEEA 4Z4GA 1SL2A 3WNGA 3K59A 3MXJA 1C6VA 1VSEA 2Z1HA 3HPOA 3VA0A 4FLUA 4CFAA 3S3OA 4Z4FA 3V9UA 4EZ6A 4HUFA 4CJ3A 1VSDA 3OYLA 4BDYA 1Z26A 3KLGA 3QEPA 4J2DA 2GBZA 2HMIA 2YNHA 1J54A 5HP1A 2QXFA 3T19A 4KTZA 1KFDA 1NKCA 1U47A 4FK0A 1VSJA 1WN7A 3AA3A 3LPUA 4DQIA 4N41A 4CJLA 1BGXT 3HYFA 3RTVA 4OLAA 2QKBA 4DFMA 2D0BA 4QAGA 1RBUA 2YV0X 1RTHA 1D9FA 4DSKA 4FJHA 3AVLA 3F9KA 2OPQA 2Z1IA 3RR8A 1RT5A 5K14A 1RBTA 2HHQA 3ZSXA 3ZT3A 5HROA 3HO1A 3HJFA 3DLRA 4LSLA 4FZYA 4B9MA 4PWDA 1KRPA 3ZT2A 4Y1CA 1SKSA 3OY9A 1Q9YA 1NK5A 3SCXA 4FLZA 2RF2A 3KLFA 3DMJA 4FVMA 1SL0A 1IO2A 4B9SA 3QNNA 4CJRA 4BDZA 3U6FA 3PX0A 3SQ1A 3OYJA 5FRMA 4CJUA 3ZT1A 1WSFA 3O3GA 3C94A 1U4BA 1ZYQA 3O4QA 4M3YA 4E7LA 3CM5A 4RW7A 1ITGA 4JRPA 1SKRA 3OYGA 2F8TA 3RMBA 4KB0A 4FW2A 4ELTA 4W5QA 3NH0A 2Y1JA 2E6LA 1KCFA 3VQ7A 2O4IA 1FXXA 4B9LA 1WNSA 2VWJA 4B9TA 3LP2A 3ZSVA 3VQDA 1X9SA 1U48A 2X6NA 4KB1A 4DFKA 4GMJB 4GW6A 4DF4A 4FJIA 5C25A 3SPZA 3AO2A 3OYIA 1JKHA 4DSJA 1WSJA 1TK8A 4NYNA 3NCIA 4FJ7A 4ID1A 3TI0A 3K5LA 1NK0A 4DQPA 2YHAA 2FC0A 4I2PA 3T3FA 3SI6A 4CHQA 3HP9A 4DSFA 1UAXA 4M3XA 1X1PA 2JLEA 1EP4A 1C1AA 4HTUA 2F8SA 4CE9A 3AVJA 3LZIA 4KO0A 1RT1A 4GVMA 4W5TA 5J2MA 4DWIA 1DLOA 4IKFA 4CJSA 1TL3A 3QERA 3TABA 4B9NA 4FJJA 1S9EA 2LSNA 4M42A 4FK4A 3QEVA 4LY7A 4CJWA 3JSMA 1T7PA 2PZSA 1LWEA 4Z0UA 4DTNA 4N56A 4KI6A 4CJTA 3DRPA 3HL8A 5KRTA 4CHZA 1XC9A 2IAJA 3MXMA 1N6QA 3HK2A 4FYDA 1YVUA 5J2NA 2KFNA 3U3YA 4DTOA 4CECA 3A2FA 3MXIA 1RCHA 3DI6A 4FW1A 1EKEA 4BE1A 1LAWA 3NBPA 1HJRA 3NF6A 2D0CA 3V9WA 5I3UA 1CLQA 1RTIA 5E41A 3QEWA 4DFPA 4KHQA 3SQ0A 4CJ4A 4RW8A
chains in the Genus database with same CATH superfamily
2QEXN 2KLAA 3ZSZA 4UY8O 5ELZA 3DLHA 3OYHA 3AVNA 1B9DA 4JHDA 3VERA 4BC2A 2OTLN 1ASUA 3U8XA 1D5AA 4B1XB 2ASMA 2NNWA 3AVFA 5BN9A 3O8MA 2YI1A 3TARA 1ZBLA 3OJUA 3MMVA 1YTUA 4IXCA 3PX4A 1WOQA 1S1UA 2ATQA 2I5JA 2O8CB 4AHSA 2UXCK 4YY3K 4UQGA 3NDKA 4JAXA 4CIEA 5KQ8A 3TWHA 1NWKA 1KVCA 2UXBK 1BU6O 3M6GA 2XY7A 2X74A 3OYNA 1C1CA 4DR2K 4EZ9A 4QOZB 1D8YA 4CHNA 3EZ5A 1EWQA 3TAMA 1RTDA 3U3GA 1NGCA 3I8BA 3QEXA 4LFAK 3VQ9A 2WUSA 4OKJA 2NUBA 3V9XA 2B5JA 3EYZA 4C8OA 4RW4A 3C6TA 4EFHA 3TTCA 3I33A 5CYQA 3ID8A 3VOVA 3TAPA 1TV6A 3E9PA 1TL1A 2ZM6K 3THVA 1HYSA 3THWA 1IJJA 2P9KB 5AQOA 2NLXA 1TK5A 1BL3A 1HNVA 3TSQA 5C15A 3SQ4A 2UU9K 3PY8A 2CGJA 4E1MA 1MU2A 1Z25A 3SZ2A 2P9LB 3H08A 5HBMA 5C12A 4CJPA 1ZBFA 1UA1A 1G15A 3CC2N 4DMNA 4YOTA 3VEZA 3DLGA 2WTUA 3LDSA 1YTAA 4DTMA 1NGJA 4I7FA 4K0KK 5AQGA 1DEJA 3PO5A 4DU3A 3NGIA 4Z4CA 2IVOA 2E1YA 3QNOA 3ZSYA 3H3NO 3LL3A 3DYAA 3QESA 4AILC 2DFFA 1CXQA 1QQCA 4CEZA 3VQ8A 3OYDA 4DV5K 4BREA 1JL1A 3LP0A 3FZLA 3FZKA 2YNFA 4JKDA 3H3OB 4C8KA 3KK1A 1KLMA 4GKKK 2KW4A 4L8RB 4FM1A 1HLUA 1TVRA 3AVMA 1YT3A 4B1ZA 2VWKA 4DG1A 4DTUA 1OKJA 4H5WA 4C8LA 2HF3A 3L2UA 5FDLA 1REVA 2HNYA 5KPZA 3U4LA 1HPZA 4IEEA 4YFUA 2W42A 3QDKA 3C6HA 4WFBL 1CZBA 5F0XA 4KREA 3LZJA 3C7NA 1Q82O 4LFCK 3HVRA 4M3RA 4H0XB 5EY4A 4M41A 5BPLA 4E7KA 4GNIA 3OBYA 1YHQN 2HHHK 5AQWA 3HVTA 1TKDA 1K6YA 3D2EA 1VQLN 2YKMA 1NG9A 4QCLA 4OKEA 3V6DA 5AQPA 1RT7A 3EN9A 3OS1A 4PL8A 2QKKA 4V19S 1NJIO 4FM0A 4IEIA 2O8EB 2D4WA 3V1RA 4ELVA 1G99A 2JGUA 3L2QA 3CPEA 1X3NA 3IS9A 3DLLL 4FVUA 1GLDG 5A2QO 3P1GA 3QICA 2O8DB 3CCSN 4KHWA 3WT0A 2PAVA 1WB9A 1T03A 1N32K 3EKUA 4JI7K 2QI2A 3A5LC 1QZ5A 3ENOA 1W97L 3G10A 3KKSA 3FE1A 3VF6A 4DTRA 1Y64A 3DXMB 1SS6A 3P39A 1TAUA 5BN8A 4NXNK 3P38A 4B3TK 4CJKA 4LF7K 2F9TA 2X78A 3L8BA 4CF8A 5AFUA 3SYZA 3ZX0A 4JI0K 4AM7A 3M8SA 3CD6N 3VEVA 3CG7A 4B1UB 1HKBA 4O0JA 3F2KA 5DK5A 4PY5A 2QTDA 3H1QA 3AVKA 4U67L 2FXUA 4LH5A 4MDBA 4FLXA 5EX5A 4B08A 5AQVA 3O3HA 4IO9L 4CK3A 4AHVA 2RPIA 3R3LA 5CR4A 1K73O 2BDPA 2F7TA 4DR3K 1GOAA 3AO1A 2OYQA 4F8RA 1ZBIA 4YDUC 1VHXA 1XC3A 4IJNA 4CJ7A 2E5LK 3V9ZA 1JLBA 2EX3A 5AZJB 4KTQA 1ESVA 3HI0A 4DR5K 3FZHA 4JI2K 2F4VK 2CH6A 4DB3A 1SL1A 3LM9A 1VQNN 2HNZA 3SBTA 3M5RA 1BWFO 1IH7A 3BF1A 5FPDA 4ELUA 3SUNA 4A61A 4WYBA 4EIAA 1RNHA 1IBMK 2FBVA 4E7HA 3TAQA 3CQXA 1M90O 5D3GA 4ILGB 3WQUA 3ALYA 3RRHA 3D2FA 5ADXA 2P9NA 4JRQA 5AQMA 1ILYA 3SUOA 3O3FA 1S72N 4FCYA 4BR9A 3KZBA 1A5XA 4Y1DA 3R6MA 4GV9A 4W5NA 1ASVA 3AAPA 4JKAA 3SLCA 2PY5A 2XHBA 3C6UA 3M8RA 2HF4A 2KQ2A 3CI5A 2P9IB 3PO4A 5I42A 4BWJA 4DV4K 3Q7BA 3CFPA 4E19A 1HRHA 3ATVA 4CD3A 2IDOA 3WXIA 4NLCA 1X9WA 1K9MO 3OYFA 2I7NA 1CZAN 1ZBSA 4YNQA 1Q9XA 3RSEB 3EZWA 4CW7B 2ZGYA 2O8FB 3LDPA 2WC9A 4MFBA 1IBKK 5GIOA 2KZMA 4CHOA 4BACA 3RRGA 3WEEA 4CEFA 1C0TA 3KD5E 2BANA 4OLBA 4DU1A 4B8AB 4BRMA 4CJFA 1WLJA 3BZCA 3CJ9A 4EP4A 1SL2A 3ZYYX 1MWKA 4HWIA 4EZ6A 4CJ3A 4RWTA 4BDYA 2NRZA 3QEPA 2QXFA 2QW9A 4JD2A 3ZX2A 2QWMA 1WN7A 3AA3A 3E1YA 2A42A 4JKCA 1K8AO 1YIJN 1D9FA 4FJHA 3AVLA 3CXCM 2OPQA 5C2DA 5K14A 1RBTA 1YJNN 3N4QA 4FZYA 1U2VA 4B9MA 1KRPA 3O5BA 2O8DA 3A5MC 3HSCA 2FSNA 2RF2A 1HPMA 1SL0A 4JKBA 3QNNA 1ATRA 3SQ1A 4CJUA 5HOOA 3O3GA 4H0TB 3UKUB 3CM5A 1ITGA 3ENHA 3RMBA 4KB0A 4W5QA 4GV3A 3FLCO 5JICA 5C0YA 2YJFA 3ZSVA 4BGBA 4ILJA 3VF4A 1X9SA 4CZMA 4KB1A 4DFKA 4GMJB 4GW6A 4DF4A 3OYIA 4NYNA 5AQNA 1HUXA 3NCIA 2YJEA 1NK0A 2FC0A 3HP9A 3VEXA 1O13A 2AP1A 4DSFA 1QVFM 2P9IA 2E20A 4XH4A 4NXMK 1RT1A 4GVMA 3J80O 4DWIA 5CHIA 1DLOA 1TL3A 3CPWM 1N8RO 3OTOK 1E4GT 4LY7A 4Z0UA 4DTNA 4N56A 3FGUA 3HL8A 2O8BB 2IAJA 3CCJN 1YVUA 3U3YA 1JJ2M 3O08A 3MXIA 1RCHA 5I3UA 3MWPA 3QEWA 3WQTA 2GELA 4CJ4A 3R8EA 3SUQA 3S3NA 2O8CA 4CCHA 3C6AA 3I8DA 1KTQA 4FLWA 3A5OC 4F4KA 2KZZA 2P5GA 5AQKA 1HNZK 5GAGP 4CK1A 1WSGA 2CGKA 2A1SA 1OVYA 4K41A 4YORA 5KQDA 1VSKA 3CM6A 3T1AA 2W41A 1GLEG 3ZT4A 4ISEA 3HTVA 1JLCA 1DGKN 1C0MA 3E9LA 3W0LA 4WE1A 1NJYA 5M1KA 1R0AA 2KTQA 3DAWA 3O9RA 2VG6A 1LV5A 3KD1E 3UIQA 1TUYA 1B9FA 3CCRN 4CBWA 1BI4A 1A5VA 2V7YA 2UUBK 4IOCL 2KHOA 2Z1GA 4X65K 1KVBA 4FM2A 3EKSA 1BIUA 3KK2A 4DV1K 2Z1JA 1DTQA 1GLLO 3T7ZA 2E4LA 4FWNA 3ZEUB 3THXB 4H0YB 1UWBA 4IFVA 4CFBA 5LMUK 1SQKA 4JK8A 2E2QA 3OS0A 3M8PA 4DTXA 2P9LA 3DRSA 1YUWA 4OGEA 5JMVA 1DKGD 1LWCA 1NM1A 4CEEA 2I7PA 4DTJA 4HCCA 4RW6A 4BWMA 1MA9B 3LDLA 4CEAA 3VQ5A 1N34K 3OS2A 1NJWA 3L3VA 5AQFA 1LAVA 2E2NA 4EHUA 5EVZA 1NKEA 2ASPA 3BZKA 4JLHA 4I2QA 3SAGA 3NGZA 4NCAA 1L3VA 1ZXOA 1QTMA 1J53A 2J4RA 3WXJA 4F2SA 3CYMA 4RTFD 4E1JA 4K8XA 2NRVA 3EO3A 1P90A 3DJCA 3THXA 3I56N 3AVHA 1U2VB 5M1FA 3K5OA 4CF2A 3NFAA 2GV9A 2YNIA 3HPHA 1Q18A 3ISNC 1KSPA 4Z4IA 2XRIA 2VG5A 2NRWA 2ASOA 3LALA 5AJ3K 3TU5A 3JAMO 4N76A 2PYLA 1WUAA 4NLBA 4PUOA 4N5SA 1N6QA 4DQQA 3P5JA 2FF6A 4JI1K 3G25A 1ZC6A 5SWMA 1XMOK 3AV9A 4JKEA 2HHTA 1XWLA 5BREA 2WBNA 3VESA 4FJGA 3VEOA 1LCUA 4NCGA 3F73A 1J9AA 4H5TA 4BRDA 3AY9A 2XO7A 3VEWA 4B3MK 4GVEA 3VF2A 4FWKA 4JYAK 1T6CA 4YHHK 1FJGK 4DLGA 3HPGA 1VQPN 4O0IA 2EWSA 2QWOA 2G8FA 4X62K 4JKGB 1GOCA 4JK7A 3S41A 4KV8A 4HHTA 1LOTB 3A8YA 2YKNA 3MN7A 5AZIB 2G8UA 2P9NB 1J6ZA 5EOYA 4FJMA 1D4XA 2ITGA 1DTTA 1NK8A 2IC3A 4JV5K 1T8EA 5KI6A 1U45A 3ITHA 4PL7A 2BE2A 4DHYA 1D9DA 3QMLA 2QWLA 1HYZA 4B3SK 4DTPA 5BR9A 3IMXA 1WAFA 1C0GA 3ULDA 1X9MA 4DR4K 4CEOA 3SK3A 4NB4A 1X3MA 5BRDA 4I6MB 4NYFA 4AHUA 3NH2A 4CGIA 5AFUH 1T3VA 5BRHA 3LWMA 4E3SA 3VQQA 3QIOA 1FKOA 4DSIA 2IOCA 4PA1A 3RSEA 2G8KA 4KKOA 3NMUA 3PIPL 3HOTA 2F96A 2HW3A 4JKGA 2ZQBA 2HB5A 2ZGZA 4JS4A 2HVIA 3IDHA 2JWLA 4F9OA 5KTQA 4A2BA 5J1EA 3C95A 1C1BA 2P51A 2R7YA 1NNEA 3V1QA 3EEQA 5ADXH 2GX9A 4BC5A 2OZSA 2CH5A 3D6RA 3PIOL 4F2RA 2AJQA 3LANA 3BDPA 4DSLA 1BQNA 4BRGA 3KLHA 1HKCA 4AF1A 2RKIA 3MEDA 2A6AA 1A5WA 1BA0A 4IO8A 4M3ZA 4LH4A 3JS6A 4FJ8A 4CZGA 5J2PA 1HQEA 3DOKA 2WOMA 2X6SA 3CCMN 4BR4A 2WONA 4ZHRA 1K8KB 4IOXA 3K5NA 1CZ9A 3KVGA 4I6MA 3DLKA 1S1XA 2GWKA 4JKHA 2IVNA 3CCVN 1VQON 1VSMA 5KPRA 1RTJA 1ASWA 4CEDA 1TKTA 4AQYK 4BR7A 3MN6A 4IJAA 4QS8A 2UUAK 3TAFA 4Q0BA 5FPMA 4FJLA 2DPNA 3KWIA 3P83D 3VQPA 5KRSA 3IRXA 4LSNA 3BY5A 2P9SB 4DU4A 3P4IA 1TGOA 4PHTX 3SPYA 4B3OA 1TK0A 5CY4A 3THYB 4BR0A 2OA8A 3NH1A 2O8FA 1N33K 4HTLA 4DUZK 3D45A 2P9UA 3L0QA 2IS3A 3K0SA 1NGIA 3OA9A 4AH9A 1Z6RA 4CHPA 4Y0WA 4CZEA 4F3OA 2HVHA 3LPTA 1NGBA 1NGFA 1OH5A 5FLXO 1JCGA 3NE6A 1IKVA 4X64K 3PUFA 2NRHA 3E9OA 3J7YP 4E0DA 2QWNA 3VGKA 3CJBA 3RMAA 1MWMA 3CC7N 1NJXA 4JI3K 1KAYA 1EWRA 1XNRK 1GLCG 2DFHA 4FJ9A 3VEYA 2FF3B 4CGFA 4M45A 4BR5A 1S3XA 1V4SA 3WNFA 4Z4GA 3UE5A 1NGAA 3HPOA 4DUYK 4FLUA 4CFAA 4M63C 3V9UA 1P8ZA 4HUFA 1VSDA 3OYLA 1Z26A 4YDUA 4WFNL 2JWKA 2HMIA 2Q0UA 2UYTA 3T19A 3LM2A 1U6ZA 3IKMA 1KFDA 1NKCA 2P9KA 1EQYA 4CJLA 1BGXT 4OLAA 2Q36A 2D0BA 4QAGA 1RBUA 2YV0X 4DFMA 5TKWA 4DSKA 1BUPA 3PSIA 3F9KA 4CZJA 4JK9A 2O8EA 3ZSXA 5IWAK 3HJFA 3DLRA 4B1YB 1XUPO 3OW2M 3OBWA 4CZKA 1Q9YA 5AQIA 3KLFA 2D1KA 1YXQA 3AARA 4FVMA 1IO2A 4IWVA 4B9SA 4BDZA 4K42A 5E26A 3U6FA 4YOVA 1IG8A 3PX0A 3VPZA 3OYJA 3ZT1A 1Z05A 2VYPA 4O5FA 3O1WA 1ZYQA 3O4QA 3OHRA 2QWPA 3R1XA 3GOIA 4ISGA 4LC9B 5FPNA 3VTHA 4DV3K 4ELTA 3NH0A 1ATSA 1KCFA 3GG4A 4B9LA 2VWJA 3SBGA 4B9TA 3LP2A 3CCQN 4BRCA 4DSJA 4XEIA 1TK8A 4DQPA 3SI6A 4I2PA 4CHQA 3ULEA 2HBMA 3C0BA 4DR1K 1UAXA 3HOSA 4M3XA 1E4FT 1X1PA 2HBLA 2HBKA 1C1AA 4DV6K 4G9ZA 2F8SA 4WCEL 3UKRB 4CE9A 5AR0A 1XNQK 3TABA 3QEVA 4NO7A 4KI6A 3O9TA 4CHZA 1XC9A 3HK2A 4FYDA 1H1VA 3P31A 3L6QA 4BRFA 4BE1A 4FW1A 1QQOA 2FLOA 1CLQA 3QBWA 5CE3A 3V9WA 1RTIA 4KHQA 3QETA 5JLHA 3BGRA 3L2WA 4IG3A 4CJEA 5C42A 3AO5A 4RG8A 3QBXA 4JI8K 4HCBA 4ISFA 4IDHA 4X66K 3ZCMA 3OYKA 2HSTA 3C65A 3SJJA 4E7IA 3AVGA 4R79A 2A41A 5EXWA 3HSTB 4WFAL 2QK9A 4GV6A 1JCFA 4IBNA 5KGXA 3CJ1A 4OPHA 1Y97A 4FWQA 2P9PB 4R5PA 3IAYA 3L2RA 4KI4A 3AO4A 4M3TA 2DY4A 4J2EA 5GIPA 3DM2A 3LWLA 2WFBA 1M1KO 1QHAA 3G4SN 4ICLA 1J5EK 3VGLA 5EU7A 4J8FA 3PV8A 3MCAB 4C23A 3MN9A 3THYA 1ZBHA 2ZJQL 2ZD1A 1NGDA 1WAJA 4B8CA 1NBWA 2VG7A 2D0AA 2IIRA 4CFCA 3LP1A 3VN5A 3VQBA 4CJQA 1JL2A 5AZJA 1VSIA 4GKJK 5AQJA 1VQ7N 3GBTA 4EHTA 3WNEA 4LF6K 4KFBA 1NK7A 1BQMA 5BR8K 4FWMA 4O8KA 2OANA 4H0VB 2QM1A 2ETJA 4H4MA 1U49A 4BY9C 4DV0K 2HHWA 1CXUA 1BO5O 3M8QA 4CIGA 3UB5A 3PSFA 3VQEA 5J2QA 3LP3A 2Q1NA 3KK7A 4XH1A 4DS5A 1QE1A 1S1VA 3I0SA 4IDKA 3DOLA 3K58A 3SV3A 2NRXA 3HZ6A 4EAHD 3QFUA 1IV0A 2A40A 3ASMA 3ZSQA 3VQAA 1RBRA 1DT9A 1JLFA 1KFSA 2IVPA 1HNXK 1LW0A 4FXDA 1N36K 1HJOA 1HNIA 4OKKA 3CCEN 3OJSA 2VCPA 1BISA 1NU0A 1TAQA 2A3ZA 2HBJA 2G8IA 1IKYA 1QZ6A 1TYQB 4LD0A 4O4GA 3DLEA 3THWB 3CQ8A 3SNNA 4KPYA 2YNGA 3V81A 5LJVA 4LF5K 3KKRA 3DXKA 1GLBG 2ZWHA 4MLHA 1T44A 4B9VA 1S1WA 4DCHA 4OPKA 1X9JA 1RDDA 4CK2A 3CJAA 4DF8A 4MLEA 2BH1A 4IFEA 3CC4N 3EE8A 2BGGA 1YITN 1WSHA 1T6DA 4HUGA 1NGGA 3KLIA 3ZSWA 3NF8A 3MCPA 5DMRA 5DM6L 1BA1A 3ZSRA 3AA5X 2GUPA 5CZ2A 3T1HK 1GLAG 2B6AA 3J8AA 3OVNA 1VRUA 4KBOA 3HBTA 4FJNA 5M1OA 4CVNE 3TANA 1S9GA 2D5RA 2HHXA 4OX9K 4KHYA 3J7ZO 3CERA 2ZJRL 3T1YK 2Y1IA 1JCEA 3D2EB 3DXMA 3NHGA 4FLVA 3HM8A 1XI1A 4DQRA 1EX4A 4FK2A 4AHRA 3K57A 1IG9A 3KK3A 3NF7A 4CIFA 1SUQA 2FSKA 4BGAA 1RDUA 5HRRA 3H46O 3QO9A 3DRRA 4J2AA 5FRNA 4DR6K 5LMNK 4Z4HA 4H5NA 3VENA 4M3UA 1KD1O 2YHBA 5KPTA 3W3DA 3AVBA 4HUEA 1JLGA 2Q2RA 4A5AA 4DTSA 1BCOA 2VGMA 3MEGA 1S6PA 2F9WA 4K25A 3V1OA 3VTIA 5T7BA 5M1PA 3BF3A 3RMDA 4L3QA 1NKBA 4C1NK 2HHVA 4EP5A 3IG1A 3TAGA 4DLEA 3AAQA 1BCMA 4DV2K 4FPBA 1HMVA 3QLHA 1WSIA 3L2VA 3G71N 3WNHA 4B3RK 3B6OA 4BRIA 3OYCA 4CZHA 4FJKA 2B4JA 2P9UB 4DS4A 3CIPA 1TKZA 2QA4N 1SKWA 1RT4A 2HMPA 4K43A 2O8BA 4H03B 1FK9A 1UA0A 4Z4EA 4DQSA 5JS1A 1BIZA 4Z94A 4CFDA 3MWTA 2P9PA 1ZBUA 3OYBA 1RBVA 3O4WA 3AGKA 2G8WA 5LY3A 3AA2A 2OPPA 2Q3SA 4CGDA 4JKFA 3LDOA 3WXMB 4B1WB 4CF9A 3MAQA 1QHTA 3UKUA 1TUUA 4TSXA 5AQRA 4DSEA 1QSLA 1V4TA 3QFPA 4CF0A 2A1RA 3AO3A 1NOZA 4N47A 2YX6A 4LF9K 3HM9A 2IGIA 4KH6A 3ULEB 3AA4A 4KHNA 3EY1A 4IG0A 1IKWA 1EXQA 1XQSC 3CCLN 1XHZA 2OZMA 5KGWA 4FPAA 3CMEN 3S9HA 4BDPA 2YHWA 2GTDA 4KAZA 4KH4A 3VQ6A 4H0PA 1TYQA 3VETA 5JVHL 1LWFA 2W6LA 3LAMA 3NVKA 5CZ1A 5BRFA 2HHUA 4G1QA 3MEEA 3WNGA 3K59A 3MXJA 1C6VA 1VSEA 2Z1HA 3H1VX 4M7XA 4Z4FA 3CF5L 2W6KA 4J2DA 2GBZA 5AQUA 1U47A 4DQIA 3LPUA 5F1XA 3HYFA 3RTVA 1BDGA 4CI6A 4KH5A 4BQLA 1RTHA 5C2FA 3CJ7A 4PKHA 2HHQA 5HROA 4LSLA 1SKSA 3OY9A 5TKYA 4O8UA 1OVQA 3DMJA 4CJRA 1WSFA 5M1NA 3C94A 4CZLA 3IFRA 3F9MA 4C1NI 4E7LA 1KC8O 4JRPA 4A59A 2E6LA 3VQ7A 2O4IA 3L4IA 4LF8K 3VQDA 2X6NA 5C25A 3SPZA 3AO2A 4JI4K 1ATNA 4BC4A 2YHAA 2BUPA 4DKWA 3MN5A 4FWPA 2JLEA 1EP4A 5AQHA 3AVJA 3LZIA 4KO0A 4YOWA 2QXLA 4IKFA 4CJSA 3J81O 4FWOA 3QERA 4FJJA 4B9NA 1S9EA 2LSNA 1VQKN 2PZSA 1T7PA 5IT9O 5C10A 4CJTA 5KRTA 4M7YA 4A5BA 1YJ9N 4A57A 4LFBK 2KFNA 4WQ5A 4JN4A 4QS9A 4CECA 3A2FA 2D0CA 2RE2A 3WXKA 5E41A 3DWLA 5AQTA 4H5RA 1IBLK 4CHYA 4CGGA 1OH8A 4BR2A 4BRQA 3J7AP 4CERA 4XH5A 3O9UA 5HRSA 4YOYA 1NK9A 4CBXA 4FLTA 3TR8A 4B9UA 5E84A 1K8KA 3ATUA 2Q97A 2ZJPL 3L4QA 1VSFA 1JLQA 3Q7CA 2HHSA 3MDQA 1TKXA 3RMCA 2OCEA 3KIOA 1SZ2A 1NJZA 4OO1J 1Q8IA 2DFEA 3OYMA 3N4PA 4CJ5A 1YAGA 5C24A 2P9SA 1EETA 4O44A 3ZLJA 3E66A 3H6EA 4A2AA 4J2BA 1WBBA 2QWQA 5MLCQ 4BRHA 5FROA 1YJWN 1J5OA 2E6MA 4I9LA 2FBTA 1W0HA 4JD2B 1L3TA 3VGMA 2QKBA 4FJ5A 2E2PA 2XY6A 1N5YA 4WF9L 3MX2A 4BE2A 4CZFA 3KTQA 2GWJA 4E1NA 3A5NC 4CGJA 1JLEA 4M3WA 3AGRA 3GL1A 5F2RA 1IKXA 5HLFA 3K9JA 4FOEA 4JS5A 4AM6A 1JLAA 3F5TA 4ID5A 1L3SA 4JEPA 1XHXA 1QSYA 3O6WA 3O4NA 3SQ2A 4FZZA 4JI5K 1C0FA 1HYVA 4KRFA 4C8MA 3CCUN 1HX1A 3HP6A 1RDCA 1S1TA 3K5MA 1FW6A 3U9DA 1VQ8N 1JXEA 2YHYA 3HT3A 3VMFB 3KHYA 4BC3A 3QB0A 3DXKB 2ZF5O 2PBDA 4GY2B 1WBDA 1NLVA 2Q31A 3G0ZA 3TTDA 4FJXA 4E7JA 1I39A 3AVCA 4W5OA 4OGCA 2G8VA 4BQZA 3KLEA 2BTFA 1BG3A 3SMSA 3B6PA 3SAFA 3E01A 4YOXA 1YF5L 4DV7K 3PX6A 4H8KA 2W40A 4DFJA 4PKGA 1HNWK 5AZIA 1KVAA 4B1VA 5FPEA 1NMDA 3VQCA 3FZFA 3TAEA 3VQ4A 1NK6A 3KJVA 4FZXC 4WQ4A 1LW2A 2Q0RA 4BE0A 4YOUA 1E3MA 1RBSA 4OJRA 3SAHA 2DTUA 3I0RA 1JXBA 1L5UA 1YI2N 1QQNA 1L3UA 1QQMA 2P1JA 2O4GA 1WSEA 4FO0A 2ZE2A 3QINA 3V4IA 3NAEA 3WXLA 1VQ5N 4FLYA 2EHGA 5HRPA 3CFRA 3UKRA 3MK6A 3TSPA 3D0PA 3S3MA 1FKPA 4O5BA 3ENBA 3K2PA 3JXUA 5DM7L 2OPRA 1NOYA 4KHUA 4ILHA 1NMNA 3RR7A 4BG8A 4XIUA 3CHWA 5GINA 4F3TA 4CZIA 3LDNA 4C8NA 5HL7L 2OTJN 1Q86O 3OYAA 5AQSA 4OVLA 4MQ3A 4JHDB 4BRKA 4K8ZA 3TSUA 4MO4A 3HRGA 1QSSA 4U7BA 3LAKA 3NF9A 3JYTA 2P5OA 5B8HA 1HKGA 3ZSOA 2VQEK 3QEIA 2QWRA 1RDBA 3KWGA 2HNDA 1KAZA 5AQXA 2UUCK 2NRRA 4MO5A 4AHCA 4ZTJA 5SZTA 1NK4A 1SV5A 5LJWA 5JS2A 4DQ8A 2NZTA 3SV4A 4QS7A 1KAXA 4CBUA 3ZETB 1BHLA 3CMAN 5JLFA 1KXPA 4H4OA 4WQ5C 4FL9A 4I9QA 1GOBA 3CQYA 1VQ4N 1W7AA 1RT3A 4NCBA 1BOTO 5JVGL 1GLFO 2RN2A 4BVOA 3ZT0A 1C0UA 4DR7K 1T05A 1RDWX 1O1WA 4IFYA 1RILA 4PQUA 1VRTA 4AHTA 4B9QA 4JI6K 1VQ6N 3SJHA 3BEXA 1RT2A 5H1SQ 3FFIA 2YCHA 3VA3A 2KKZA 4KTWA 5AQYA 4BRLA 3O9QA 3NVMA 2E1ZA 3NGYA 3CFOA 1RDAA 2PYJA 1F21A 1UOCA 1VAZA 3L3UA 3HXMA 1Q81O 2E2OA 2E88A 4BRPA 5GADP 3OYEA 4BG9A 1U04A 4MDAA 4RW9A 1I3AA 5M1QA 1W2BM 4FWLA 2AA4A 1QVGM 1OH7A 4CGHA 2FBXA 3A0IX 1HR0K 3TPQA 5GAEP 3AVAA 2OPSA 2KFZA 2HOEA 4H0OA 3AVIA 3R9PA 1XMQK 5AQLA 2H3GX 3PLAA 1RGIA 4PKIA 2E8AA 3SUPA 4CF1A 3RWUA 1HQUA 1QS4A 1KLNA 4BROA 4LF4K 3MECA 3C7NB 2FBYA 4HVJA 3EE9A 2D0OA 3IUCA 2GUIA 5BPNA 4OPJA 2PFUA 1NGEA 3SMPA 3EL2A 4KHSA 3K9KA 3QIPA 1VSHA 2XY5A 2ITMA 4CJVA 4O55A 2VWBA 3TTFA 3GDQA 4E89A 1YVNA 1EO1A 4Q5VA 3V9SA 3CJCA 4IZ9A 1VSLA 1VK0A 3DLBA 1S22A 4W5RA 4KHPK 5HRNA 3BP8A 4CEBA 1B92A 5GAHP 4RCHA 2UXDK 1W9HA 2VGNA 5I9EB 1RT6A 4CESA 3MX5A 1NGHA 1S5JA 2G8HA 3B8AX 2XY8A 4CEQA 3FFKB 5CYMA 1BI4B 1S6QA 1GLJO 4ZTFA 2D0PA 3VA0A 3S3OA 3ID6A 3WEEB 1Q7YO 3KLGA 2V52B 3FR0A 2YNHA 4A62A 1J54A 5HP1A 4KTZA 4FK0A 1VSJA 4N41A 1I94K 4FWSA 2GEMA 5LL6Z 1SAZA 4WQ4C 3FZMA 2CGLA 2Z1IA 3RR8A 1RT5A 2RHKA 4JNEA 3ZT3A 3HO1A 2NRTA 4OPAA 3D2FB 4PWDA 3ZT2A 4Y1CA 3G6EN 1NK5A 3SCXA 2A5XA 5BPMA 4FLZA 5FRMA 3M3ZA 4IOAL 4CD1A 1U4BA 4FOIA 4M3YA 3D7EO 4RW7A 1SKRA 3OYGA 2F8TA 3GE1A 4FW2A 3CETA 2Y1JA 3O80A 3ZX3A 1FXXA 1R59O 2V7ZA 1WNSA 4BVPA 1U48A 4FJIA 3U9ZA 1JKHA 1WSJA 4FJ7A 3O1BA 4ID1A 3TI0A 3K5LA 1VQ9N 3T3FA 3ZETA 3M1FA 3I55N 5AQQA 4FSVA 4FWRA 4HTUA 1MDUB 3ZEUA 4W5TA 5J2MA 2VQFK 3T69A 4BRAA 4M42A 4FK4A 4CJWA 3JSMA 2V51B 1LWEA 3BUZB 1RFQA 3O9SA 3DRPA 1OH6A 1VQMN 2FSJA 3MXMA 5AQZA 3H45C 5J2NA 1KQSM 3RVCA 4DTOA 4H5VA 3DI6A 1EKEA 1LAWA 3NBPA 1HJRA 3NF6A 3WUHA 3LDQA 4BRNA 2YHXA 4DFPA 3SQ0A 4RW8A
chains in the Genus database with same CATH topology
3ZSZA 4CHYA 4CGGA 3SUQA 3OYHA 3BGRA 3AVNA 3DLHA 1B9DA 3L2WA 4IG3A 3S3NA 1ASUA 4CJEA 4CCHA 1D5AA 5C42A 4CERA 3AVFA 3AO5A 4RG8A 3I8DA 1KTQA 4FLWA 5HRSA 3TARA 1ZBLA 1NK9A 4HCBA 3OJUA 1YTUA 4FLTA 3ZCMA 4F4KA 3OYKA 3SJJA 2KZZA 3TR8A 3PX4A 4E7IA 4B9UA 2P5GA 1S1UA 3AVGA 2ATQA 3HSTB 2QK9A 2I5JA 4CK1A 1WSGA 4IBNA 4AHSA 4FJKA 2A1SA 5KGXA 4UQGA 4CIEA 3NDKA 1VSFA 3TWHA 4FJXA 1JLQA 1Y97A 1VSKA 3CM6A 1KVCA 1TKXA 3T1AA 3RMCA 4R5PA 3IAYA 2HHSA 3L2RA 4KI4A 3AO4A 3ZT4A 3KIOA 2XY7A 2X74A 3OYNA 1C1CA 4QOZB 4EZ9A 1D8YA 1JLCA 1NJZA 4M3TA 2DY4A 1C0MA 1Q8IA 4CHNA 3EZ5A 2DFEA 4WE1A 3DM2A 3OYMA 3LWLA 1R0AA 1NJYA 4J2EA 3TAMA 2KTQA 4CJ5A 4ICLA 3U3GA 2VG6A 1RTDA 3QEXA 5C24A 1LV5A 5EU7A 3KD1E 3UIQA 3PV8A 3VQ9A 1EETA 1B9FA 4O44A 4OKJA 2NUBA 1BI4A 3V9XA 2B5JA 1A5VA 3EYZA 4C8OA 4RW4A 1ZBHA 3C6TA 2ZD1A 4J2BA 5CYQA 2Z1GA 3TAPA 1KVBA 1TV6A 4FM2A 1TL1A 3THVA 1BIUA 3KK2A 1HYSA 2Z1JA 1WAJA 1DTQA 5FROA 4B8CA 2E6MA 4I9LA 1J5OA 2E4LA 1W0HA 2FBTA 2VG7A 1TK5A 2D0AA 1BL3A 4CFCA 1HNVA 1UWBA 3LP1A 3SQ4A 3VN5A 1L3TA 4IFVA 3VQBA 4CJQA 4CFBA 2XY6A 4FJ5A 1JL2A 1N5YA 4E1MA 1MU2A 1VSIA 1Z25A 3SZ2A 4BE2A 3OS0A 3H08A 5HBMA 3KTQA 4E1NA 4CJPA 1ZBFA 3M8PA 3DRSA 3WNEA 4CGJA 1JLEA 1G15A 4DTXA 1UA1A 4M3WA 4OGEA 4DMNA 1IKXA 4KFBA 1NK7A 3DLGA 1LWCA 1BQMA 3LDSA 1YTAA 4DTMA 5HLFA 4CEEA 4I7FA 4JS5A 1JLAA 4DTJA 4HCCA 4ID5A 1L3SA 4RW6A 4BWMA 4DU3A 3PO5A 3NGIA 1XHXA 2ETJA 4H4MA 4CEAA 3VQ5A 1U49A 4Z4CA 1QSYA 2HHWA 1CXUA 3QNOA 3OS2A 3ZSYA 3O4NA 1NJWA 3SQ2A 4FZZA 3L3VA 3M8QA 1LAVA 3DYAA 4CIGA 4AILC 3QESA 4C8LA 1NKEA 1HYVA 2DFFA 1CXQA 4C8MA 4KRFA 1QQCA 4JLHA 4CEZA 4I2QA 3VQ8A 3OYDA 3NGZA 3K5MA 3HP6A 1RDCA 1S1TA 1JL1A 3LP0A 3VQEA 5J2QA 3LP3A 1L3VA 4NCAA 1JXEA 2YNFA 4DS5A 1QE1A 1S1VA 3I0SA 4C8KA 1QTMA 3HT3A 3KK1A 1J53A 1KLMA 2KW4A 4F2SA 4IDKA 3CYMA 3DOLA 4L8RB 3K58A 3SV3A 4FM1A 1TVRA 4K8XA 3G0ZA 3ZSQA 3ASMA 1YT3A 3AVMA 3VQAA 1RBRA 3AVHA 1JLFA 2VWKA 4DG1A 4DTUA 4E7JA 1I39A 3K5OA 3AVCA 1KFSA 4CF2A 3NFAA 4OGCA 2GV9A 4W5OA 5FDLA 2YNIA 3L2UA 1REVA 2G8VA 1LW0A 2HNYA 3HPHA 4FXDA 3ISNC 3KLEA 1HPZA 1KSPA 4Z4IA 3B6PA 2XRIA 1HNIA 3E01A 4OKKA 2VG5A 3LALA 4YFUA 2W42A 3PX6A 4H8KA 4N76A 3OJSA 4DFJA 1CZBA 1BISA 1TAQA 2PYLA 4KREA 3LZJA 2G8IA 4PUOA 1KVAA 1IKYA 4N5SA 4LD0A 3TAEA 3VQCA 4O4GA 3DLEA 4DQQA 3P5JA 3VQ4A 3HVRA 1NK6A 3CQ8A 3KJVA 4FZXC 3SNNA 4KPYA 1LW2A 4BE0A 4M3RA 2YNGA 3V81A 1RBSA 4OJRA 2DTUA 5SWMA 3AV9A 3I0RA 4M41A 1JXBA 4E7KA 3PY8A 1L5UA 2HHTA 1XWLA 4FJGA 3KKRA 1L3UA 2P1JA 4NCGA 2O4GA 3F73A 1J9AA 1WSEA 4B9VA 1S1WA 3HVTA 2XO7A 4OPKA 2ZE2A 1TKDA 1K6YA 1RDDA 3QINA 2YKMA 3V4IA 3NAEA 4CK2A 4QCLA 4OKEA 3V6DA 4DLGA 3HPGA 4FLYA 2EHGA 4DF8A 1RT7A 5HRPA 3OS1A 3CFRA 3D0PA 3S3MA 4O0IA 2QKKA 2G8FA 2BGGA 1WSHA 1FKPA 4O5BA 4FM0A 4HUGA 3KLIA 3V1RA 3ZSWA 1GOCA 3K2PA 3NF8A 4ELVA 2OPRA 2JGUA 4KV8A 5DMRA 3L2QA 4HHTA 1NOYA 4KHUA 3IS9A 3ZSRA 3RR7A 2YKNA 3AA5X 3P1GA 2G8UA 5CZ2A 4XIUA 2B6AA 4F3TA 4KHWA 4C8NA 4FJMA 3OYAA 2ITGA 4OVLA 1DTTA 3OVNA 4MQ3A 1T03A 1NK8A 1VRUA 4K8ZA 2IC3A 1T8EA 4FJNA 3G10A 3KKSA 5KI6A 1U45A 1QSSA 3ITHA 3LAKA 3NF9A 3JYTA 2P5OA 3TANA 1S9GA 2BE2A 4DTRA 3ZSOA 2D5RA 1D9DA 2HHXA 1TAUA 3QEIA 4KHYA 1RDBA 4CJKA 2Y1IA 2HNDA 2X78A 3NHGA 1HYZA 4FLVA 4DTPA 3L8BA 1XI1A 4CF8A 1WAFA 3ULDA 4DQRA 1EX4A 4AHCA 4ZTJA 1X9MA 4FK2A 5SZTA 4AHRA 1SV5A 3SYZA 5JS2A 4CEOA 3K57A 1NK4A 1IG9A 3KK3A 3SV4A 3NF7A 4CIFA 1SUQA 3M8SA 3CG7A 5HRRA 3QO9A 3DRRA 1BHLA 4NYFA 4O0JA 4AHUA 4CGIA 3NH2A 4H4OA 5DK5A 3LWMA 4E3SA 3VQQA 4J2AA 5FRNA 4PY5A 3QIOA 4Z4HA 1FKOA 4DSIA 3AVKA 2IOCA 4PA1A 4M3UA 4I9QA 1GOBA 4KKOA 2G8KA 2YHBA 4LH5A 2F96A 4FLXA 4B08A 1RT3A 2HW3A 4NCBA 2ZQBA 2HB5A 4JS4A 2HVIA 3AVBA 5KTQA 2RN2A 4HUEA 3O3HA 1JLGA 5J1EA 3C95A 1C1BA 2P51A 3ZT0A 1BCOA 4AHVA 4CK3A 3MEGA 2R7YA 4DTSA 2RPIA 3V1QA 1C0UA 1S6PA 3V1OA 2OZSA 4F8RA 5T7BA 2BDPA 2OYQA 1GOAA 3AO1A 1T05A 1ZBIA 4F2RA 1O1WA 4IFYA 1RILA 4PQUA 1VRTA 3RMDA 2AJQA 3LANA 3BDPA 4AHTA 4DSLA 3V9ZA 1NKBA 1BQNA 1JLBA 2EX3A 3KLHA 3QETA 4EP5A 2HHVA 2RKIA 3IG1A 4DLEA 3TAGA 3MEDA 4KTQA 1RT2A 1A5WA 4M3ZA 3FFIA 1BCMA 3VA3A 4LH4A 1SL1A 4KTWA 4FJ8A 5J2PA 1HMVA 1HQEA 2HNZA 1WSIA 2WOMA 3DOKA 3QLHA 3WNHA 3B6OA 3L2VA 3OYCA 1IH7A 3NGYA 2X6SA 3CFOA 2WONA 4ELUA 2B4JA 1RDAA 4ZHRA 3K5NA 4DS4A 3SUNA 1F21A 1UOCA 3HXMA 1CZ9A 3L3UA 2PYJA 1RNHA 1TKZA 3DLKA 2FBVA 3OYEA 4E7HA 3TAQA 5D3GA 1U04A 3ALYA 3RRHA 1S1XA 4RW9A 1I3AA 4JRQA 1VSMA 4CGHA 2FBXA 1RTJA 1ASWA 4CEDA 1RT4A 1TKTA 3SUOA 1SKWA 1FK9A 3O3FA 1UA0A 4FCYA 4Z4EA 3AVAA 2OPSA 2KFZA 4DQSA 3TAFA 5JS1A 1A5XA 1BIZA 4Q0BA 4CFDA 3AVIA 4FJLA 4Y1DA 4W5NA 1ZBUA 1ASVA 3SUPA 3OYBA 3P83D 1RBVA 3VQPA 5KRSA 2XHBA 2PY5A 3IRXA 4LSNA 4CF1A 3C6UA 1HQUA 3M8RA 1QS4A 1KLNA 4DU4A 2G8WA 3RWUA 3MECA 3AA2A 2KQ2A 2OPPA 2Q3SA 1TGOA 4CGDA 2FBYA 4HVJA 3SPYA 4B3OA 3PO4A 1TK0A 5I42A 5CY4A 4BWJA 2GUIA 4OPJA 2OA8A 3NH1A 4CF9A 3MAQA 3CFPA 1QHTA 4E19A 1HRHA 3D45A 2IDOA 4KHSA 4TSXA 1X9WA 2IS3A 4DSEA 3OYFA 3QIPA 1VSHA 1QSLA 2XY5A 2A1RA 4CF0A 4CJVA 4O55A 4YNQA 3AO3A 1NOZA 4N47A 4E89A 4Q5VA 1Q9XA 3HM9A 4AH9A 2IGIA 4CHPA 3V9SA 4F3OA 3AA4A 4KHNA 2HVHA 3LPTA 3EY1A 1VSLA 1VK0A 4IG0A 1IKWA 3DLBA 4W5RA 1EXQA 4MFBA 4CEBA 5HRNA 1XHZA 1B92A 5KGWA 2OZMA 3NE6A 3S9HA 1IKVA 4BDPA 1W9HA 2KZMA 4CHOA 4BACA 3PUFA 4KAZA 3RRGA 4E0DA 4CEFA 1C0TA 1RT6A 3VQ6A 3RMAA 3KD5E 1NJXA 2BANA 4CESA 1LWFA 4OLBA 2DFHA 4DU1A 4B8AB 3LAMA 5CZ1A 1S5JA 2G8HA 4CJFA 4FJ9A 2HHUA 1WLJA 2XY8A 4CEQA 4M45A 5CYMA 4CGFA 1BI4B 1S6QA 4G1QA 3WNFA 4EP4A 4ZTFA 3MEEA 4Z4GA 1SL2A 3WNGA 3K59A 3MXJA 1C6VA 1VSEA 2Z1HA 3HPOA 3VA0A 4FLUA 4CFAA 3S3OA 4Z4FA 3V9UA 4EZ6A 4HUFA 4CJ3A 1VSDA 3OYLA 4BDYA 1Z26A 3KLGA 3QEPA 4J2DA 2GBZA 2HMIA 2YNHA 1J54A 5HP1A 2QXFA 3T19A 4KTZA 1KFDA 1NKCA 1U47A 4FK0A 1VSJA 1WN7A 3AA3A 3LPUA 4DQIA 4N41A 4CJLA 1BGXT 3HYFA 3RTVA 4OLAA 2QKBA 4DFMA 2D0BA 4QAGA 1RBUA 2YV0X 1RTHA 1D9FA 4DSKA 4FJHA 3AVLA 3F9KA 2OPQA 2Z1IA 3RR8A 1RT5A 5K14A 1RBTA 2HHQA 3ZSXA 3ZT3A 5HROA 3HO1A 3HJFA 3DLRA 4LSLA 4FZYA 4B9MA 4PWDA 1KRPA 3ZT2A 4Y1CA 1SKSA 3OY9A 1Q9YA 1NK5A 3SCXA 4FLZA 2RF2A 3KLFA 3DMJA 4FVMA 1SL0A 1IO2A 4B9SA 3QNNA 4CJRA 4BDZA 3U6FA 3PX0A 3SQ1A 3OYJA 5FRMA 4CJUA 3ZT1A 1WSFA 3O3GA 3C94A 1U4BA 1ZYQA 3O4QA 4M3YA 4E7LA 3CM5A 4RW7A 1ITGA 4JRPA 1SKRA 3OYGA 2F8TA 3RMBA 4KB0A 4FW2A 4ELTA 4W5QA 3NH0A 2Y1JA 2E6LA 1KCFA 3VQ7A 2O4IA 1FXXA 4B9LA 1WNSA 2VWJA 4B9TA 3LP2A 3ZSVA 3VQDA 1X9SA 1U48A 2X6NA 4KB1A 4DFKA 4GMJB 4GW6A 4DF4A 4FJIA 5C25A 3SPZA 3AO2A 3OYIA 1JKHA 4DSJA 1WSJA 1TK8A 4NYNA 3NCIA 4FJ7A 4ID1A 3TI0A 3K5LA 1NK0A 4DQPA 2YHAA 2FC0A 4I2PA 3T3FA 3SI6A 4CHQA 3HP9A 4DSFA 1UAXA 4M3XA 1X1PA 2JLEA 1EP4A 1C1AA 4HTUA 2F8SA 4CE9A 3AVJA 3LZIA 4KO0A 1RT1A 4GVMA 4W5TA 5J2MA 4DWIA 1DLOA 4IKFA 4CJSA 1TL3A 3QERA 3TABA 4B9NA 4FJJA 1S9EA 2LSNA 4M42A 4FK4A 3QEVA 4LY7A 4CJWA 3JSMA 1T7PA 2PZSA 1LWEA 4Z0UA 4DTNA 4N56A 4KI6A 4CJTA 3DRPA 3HL8A 5KRTA 4CHZA 1XC9A 2IAJA 3MXMA 1N6QA 3HK2A 4FYDA 1YVUA 5J2NA 2KFNA 3U3YA 4DTOA 4CECA 3A2FA 3MXIA 1RCHA 3DI6A 4FW1A 1EKEA 4BE1A 1LAWA 3NBPA 1HJRA 3NF6A 2D0CA 3V9WA 5I3UA 1CLQA 1RTIA 5E41A 3QEWA 4DFPA 4KHQA 3SQ0A 4CJ4A 4RW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZSZ A;  4CHY A;  4CGG A;  3SUQ A;  3OYH A;  3BGR A;  3AVN A;  3DLH A;  1B9D A;  3L2W A;  4IG3 A;  3S3N A;  1ASU A;  4CJE A;  4CCH A;  1D5A A;  5C42 A;  4CER A;  3AVF A;  3AO5 A;  4RG8 A;  3I8D A;  1KTQ A;  4FLW A;  5HRS A;  3TAR A;  1ZBL A;  1NK9 A;  4HCB A;  3OJU A;  1YTU A;  4FLT A;  3ZCM A;  4F4K A;  3OYK A;  3SJJ A;  2KZZ A;  3TR8 A;  3PX4 A;  4E7I A;  4B9U A;  2P5G A;  1S1U A;  3AVG A;  2ATQ A;  3HST B;  2QK9 A;  2I5J A;  4CK1 A;  1WSG A;  4IBN A;  4AHS A;  4FJK A;  2A1S A;  5KGX A;  4UQG A;  4CIE A;  3NDK A;  1VSF A;  3TWH A;  4FJX A;  1JLQ A;  1Y97 A;  1VSK A;  3CM6 A;  1KVC A;  1TKX A;  3T1A A;  3RMC A;  4R5P A;  3IAY A;  2HHS A;  3L2R A;  4KI4 A;  3AO4 A;  3ZT4 A;  3KIO A;  2XY7 A;  2X74 A;  3OYN A;  1C1C A;  4QOZ B;  4EZ9 A;  1D8Y A;  1JLC A;  1NJZ A;  4M3T A;  2DY4 A;  1C0M A;  1Q8I A;  4CHN A;  3EZ5 A;  2DFE A;  4WE1 A;  3DM2 A;  3OYM A;  3LWL A;  1R0A A;  1NJY A;  4J2E A;  3TAM A;  2KTQ A;  4CJ5 A;  4ICL A;  3U3G A;  2VG6 A;  1RTD A;  3QEX A;  5C24 A;  1LV5 A;  5EU7 A;  3KD1 E;  3UIQ A;  3PV8 A;  3VQ9 A;  1EET A;  1B9F A;  4O44 A;  4OKJ A;  2NUB A;  1BI4 A;  3V9X A;  2B5J A;  1A5V A;  3EYZ A;  4C8O A;  4RW4 A;  1ZBH A;  3C6T A;  2ZD1 A;  4J2B A;  5CYQ A;  2Z1G A;  3TAP A;  1KVB A;  1TV6 A;  4FM2 A;  1TL1 A;  3THV A;  1BIU A;  3KK2 A;  1HYS A;  2Z1J A;  1WAJ A;  1DTQ A;  5FRO A;  4B8C A;  2E6M A;  4I9L A;  1J5O A;  2E4L A;  1W0H A;  2FBT A;  2VG7 A;  1TK5 A;  2D0A A;  1BL3 A;  4CFC A;  1HNV A;  1UWB A;  3LP1 A;  3SQ4 A;  3VN5 A;  1L3T A;  4IFV A;  3VQB A;  4CJQ A;  4CFB A;  2XY6 A;  4FJ5 A;  1JL2 A;  1N5Y A;  4E1M A;  1MU2 A;  1VSI A;  1Z25 A;  3SZ2 A;  4BE2 A;  3OS0 A;  3H08 A;  5HBM A;  3KTQ A;  4E1N A;  4CJP A;  1ZBF A;  3M8P A;  3DRS A;  3WNE A;  4CGJ A;  1JLE A;  1G15 A;  4DTX A;  1UA1 A;  4M3W A;  4OGE A;  4DMN A;  1IKX A;  4KFB A;  1NK7 A;  3DLG A;  1LWC A;  1BQM A;  3LDS A;  1YTA A;  4DTM A;  5HLF A;  4CEE A;  4I7F A;  4JS5 A;  1JLA A;  4DTJ A;  4HCC A;  4ID5 A;  1L3S A;  4RW6 A;  4BWM A;  4DU3 A;  3PO5 A;  3NGI A;  1XHX A;  2ETJ A;  4H4M A;  4CEA A;  3VQ5 A;  1U49 A;  4Z4C A;  1QSY A;  2HHW A;  1CXU A;  3QNO A;  3OS2 A;  3ZSY A;  3O4N A;  1NJW A;  3SQ2 A;  4FZZ A;  3L3V A;  3M8Q A;  1LAV A;  3DYA A;  4CIG A;  4AIL C;  3QES A;  4C8L A;  1NKE A;  1HYV A;  2DFF A;  1CXQ A;  4C8M A;  4KRF A;  1QQC A;  4JLH A;  4CEZ A;  4I2Q A;  3VQ8 A;  3OYD A;  3NGZ A;  3K5M A;  3HP6 A;  1RDC A;  1S1T A;  1JL1 A;  3LP0 A;  3VQE A;  5J2Q A;  3LP3 A;  1L3V A;  4NCA A;  1JXE A;  2YNF A;  4DS5 A;  1QE1 A;  1S1V A;  3I0S A;  4C8K A;  1QTM A;  3HT3 A;  3KK1 A;  1J53 A;  1KLM A;  2KW4 A;  4F2S A;  4IDK A;  3CYM A;  3DOL A;  4L8R B;  3K58 A;  3SV3 A;  4FM1 A;  1TVR A;  4K8X A;  3G0Z A;  3ZSQ A;  3ASM A;  1YT3 A;  3AVM A;  3VQA A;  1RBR A;  3AVH A;  1JLF A;  2VWK A;  4DG1 A;  4DTU A;  4E7J A;  1I39 A;  3K5O A;  3AVC A;  1KFS A;  4CF2 A;  3NFA A;  4OGC A;  2GV9 A;  4W5O A;  5FDL A;  2YNI A;  3L2U A;  1REV A;  2G8V A;  1LW0 A;  2HNY A;  3HPH A;  4FXD A;  3ISN C;  3KLE A;  1HPZ A;  1KSP A;  4Z4I A;  3B6P A;  2XRI A;  1HNI A;  3E01 A;  4OKK A;  2VG5 A;  3LAL A;  4YFU A;  2W42 A;  3PX6 A;  4H8K A;  4N76 A;  3OJS A;  4DFJ A;  1CZB A;  1BIS A;  1TAQ A;  2PYL A;  4KRE A;  3LZJ A;  2G8I A;  4PUO A;  1KVA A;  1IKY A;  4N5S A;  4LD0 A;  3TAE A;  3VQC A;  4O4G A;  3DLE A;  4DQQ A;  3P5J A;  3VQ4 A;  3HVR A;  1NK6 A;  3CQ8 A;  3KJV A;  4FZX C;  3SNN A;  4KPY A;  1LW2 A;  4BE0 A;  4M3R A;  2YNG A;  3V81 A;  1RBS A;  4OJR A;  2DTU A;  5SWM A;  3AV9 A;  3I0R A;  4M41 A;  1JXB A;  4E7K A;  3PY8 A;  1L5U A;  2HHT A;  1XWL A;  4FJG A;  3KKR A;  1L3U A;  2P1J A;  4NCG A;  2O4G A;  3F73 A;  1J9A A;  1WSE A;  4B9V A;  1S1W A;  3HVT A;  2XO7 A;  4OPK A;  2ZE2 A;  1TKD A;  1K6Y A;  1RDD A;  3QIN A;  2YKM A;  3V4I A;  3NAE A;  4CK2 A;  4QCL A;  4OKE A;  3V6D A;  4DLG A;  3HPG A;  4FLY A;  2EHG A;  4DF8 A;  1RT7 A;  5HRP A;  3OS1 A;  3CFR A;  3D0P A;  3S3M A;  4O0I A;  2QKK A;  2G8F A;  2BGG A;  1WSH A;  1FKP A;  4O5B A;  4FM0 A;  4HUG A;  3KLI A;  3V1R A;  3ZSW A;  1GOC A;  3K2P A;  3NF8 A;  4ELV A;  2OPR A;  2JGU A;  4KV8 A;  5DMR A;  3L2Q A;  4HHT A;  1NOY A;  4KHU A;  3IS9 A;  3ZSR A;  3RR7 A;  2YKN A;  3AA5 X;  3P1G A;  2G8U A;  5CZ2 A;  4XIU A;  2B6A A;  4F3T A;  4KHW A;  4C8N A;  4FJM A;  3OYA A;  2ITG A;  4OVL A;  1DTT A;  3OVN A;  4MQ3 A;  1T03 A;  1NK8 A;  1VRU A;  4K8Z A;  2IC3 A;  1T8E A;  4FJN A;  3G10 A;  3KKS A;  5KI6 A;  1U45 A;  1QSS A;  3ITH A;  3LAK A;  3NF9 A;  3JYT A;  2P5O A;  3TAN A;  1S9G A;  2BE2 A;  4DTR A;  3ZSO A;  2D5R A;  1D9D A;  2HHX A;  1TAU A;  3QEI A;  4KHY A;  1RDB A;  4CJK A;  2Y1I A;  2HND A;  2X78 A;  3NHG A;  1HYZ A;  4FLV A;  4DTP A;  3L8B A;  1XI1 A;  4CF8 A;  1WAF A;  3ULD A;  4DQR A;  1EX4 A;  4AHC A;  4ZTJ A;  1X9M A;  4FK2 A;  5SZT A;  4AHR A;  1SV5 A;  3SYZ A;  5JS2 A;  4CEO A;  3K57 A;  1NK4 A;  1IG9 A;  3KK3 A;  3SV4 A;  3NF7 A;  4CIF A;  1SUQ A;  3M8S A;  3CG7 A;  5HRR A;  3QO9 A;  3DRR A;  1BHL A;  4NYF A;  4O0J A;  4AHU A;  4CGI A;  3NH2 A;  4H4O A;  5DK5 A;  3LWM A;  4E3S A;  3VQQ A;  4J2A A;  5FRN A;  4PY5 A;  3QIO A;  4Z4H A;  1FKO A;  4DSI A;  3AVK A;  2IOC A;  4PA1 A;  4M3U A;  4I9Q A;  1GOB A;  4KKO A;  2G8K A;  2YHB A;  4LH5 A;  2F96 A;  4FLX A;  4B08 A;  1RT3 A;  2HW3 A;  4NCB A;  2ZQB A;  2HB5 A;  4JS4 A;  2HVI A;  3AVB A;  5KTQ A;  2RN2 A;  4HUE A;  3O3H A;  1JLG A;  5J1E A;  3C95 A;  1C1B A;  2P51 A;  3ZT0 A;  1BCO A;  4AHV A;  4CK3 A;  3MEG A;  2R7Y A;  4DTS A;  2RPI A;  3V1Q A;  1C0U A;  1S6P A;  3V1O A;  2OZS A;  4F8R A;  5T7B A;  2BDP A;  2OYQ A;  1GOA A;  3AO1 A;  1T05 A;  1ZBI A;  4F2R A;  1O1W A;  4IFY A;  1RIL A;  4PQU A;  1VRT A;  3RMD A;  2AJQ A;  3LAN A;  3BDP A;  4AHT A;  4DSL A;  3V9Z A;  1NKB A;  1BQN A;  1JLB A;  2EX3 A;  3KLH A;  3QET A;  4EP5 A;  2HHV A;  2RKI A;  3IG1 A;  4DLE A;  3TAG A;  3MED A;  4KTQ A;  1RT2 A;  1A5W A;  4M3Z A;  3FFI A;  1BCM A;  3VA3 A;  4LH4 A;  1SL1 A;  4KTW A;  4FJ8 A;  5J2P A;  1HMV A;  1HQE A;  2HNZ A;  1WSI A;  2WOM A;  3DOK A;  3QLH A;  3WNH A;  3B6O A;  3L2V A;  3OYC A;  1IH7 A;  3NGY A;  2X6S A;  3CFO A;  2WON A;  4ELU A;  2B4J A;  1RDA A;  4ZHR A;  3K5N A;  4DS4 A;  3SUN A;  1F21 A;  1UOC A;  3HXM A;  1CZ9 A;  3L3U A;  2PYJ A;  1RNH A;  1TKZ A;  3DLK A;  2FBV A;  3OYE A;  4E7H A;  3TAQ A;  5D3G A;  1U04 A;  3ALY A;  3RRH A;  1S1X A;  4RW9 A;  1I3A A;  4JRQ A;  1VSM A;  4CGH A;  2FBX A;  1RTJ A;  1ASW A;  4CED A;  1RT4 A;  1TKT A;  3SUO A;  1SKW A;  1FK9 A;  3O3F A;  1UA0 A;  4FCY A;  4Z4E A;  3AVA A;  2OPS A;  2KFZ A;  4DQS A;  3TAF A;  5JS1 A;  1A5X A;  1BIZ A;  4Q0B A;  4CFD A;  3AVI A;  4FJL A;  4Y1D A;  4W5N A;  1ZBU A;  1ASV A;  3SUP A;  3OYB A;  3P83 D;  1RBV A;  3VQP A;  5KRS A;  2XHB A;  2PY5 A;  3IRX A;  4LSN A;  4CF1 A;  3C6U A;  1HQU A;  3M8R A;  1QS4 A;  1KLN A;  4DU4 A;  2G8W A;  3RWU A;  3MEC A;  3AA2 A;  2KQ2 A;  2OPP A;  2Q3S A;  1TGO A;  4CGD A;  2FBY A;  4HVJ A;  3SPY A;  4B3O A;  3PO4 A;  1TK0 A;  5I42 A;  5CY4 A;  4BWJ A;  2GUI A;  4OPJ A;  2OA8 A;  3NH1 A;  4CF9 A;  3MAQ A;  3CFP A;  1QHT A;  4E19 A;  1HRH A;  3D45 A;  2IDO A;  4KHS A;  4TSX A;  1X9W A;  2IS3 A;  4DSE A;  3OYF A;  3QIP A;  1VSH A;  1QSL A;  2XY5 A;  2A1R A;  4CF0 A;  4CJV A;  4O55 A;  4YNQ A;  3AO3 A;  1NOZ A;  4N47 A;  4E89 A;  4Q5V A;  1Q9X A;  3HM9 A;  4AH9 A;  2IGI A;  4CHP A;  3V9S A;  4F3O A;  3AA4 A;  4KHN A;  2HVH A;  3LPT A;  3EY1 A;  1VSL A;  1VK0 A;  4IG0 A;  1IKW A;  3DLB A;  4W5R A;  1EXQ A;  4MFB A;  4CEB A;  5HRN A;  1XHZ A;  1B92 A;  5KGW A;  2OZM A;  3NE6 A;  3S9H A;  1IKV A;  4BDP A;  1W9H A;  2KZM A;  4CHO A;  4BAC A;  3PUF A;  4KAZ A;  3RRG A;  4E0D A;  4CEF A;  1C0T A;  1RT6 A;  3VQ6 A;  3RMA A;  3KD5 E;  1NJX A;  2BAN A;  4CES A;  1LWF A;  4OLB A;  2DFH A;  4DU1 A;  4B8A B;  3LAM A;  5CZ1 A;  1S5J A;  2G8H A;  4CJF A;  4FJ9 A;  2HHU A;  1WLJ A;  2XY8 A;  4CEQ A;  4M45 A;  5CYM A;  4CGF A;  1BI4 B;  1S6Q A;  4G1Q A;  3WNF A;  4EP4 A;  4ZTF A;  3MEE A;  4Z4G A;  1SL2 A;  3WNG A;  3K59 A;  3MXJ A;  1C6V A;  1VSE A;  2Z1H A;  3HPO A;  3VA0 A;  4FLU A;  4CFA A;  3S3O A;  4Z4F A;  3V9U A;  4EZ6 A;  4HUF A;  4CJ3 A;  1VSD A;  3OYL A;  4BDY A;  1Z26 A;  3KLG A;  3QEP A;  4J2D A;  2GBZ A;  2HMI A;  2YNH A;  1J54 A;  5HP1 A;  2QXF A;  3T19 A;  4KTZ A;  1KFD A;  1NKC A;  1U47 A;  4FK0 A;  1VSJ A;  1WN7 A;  3AA3 A;  3LPU A;  4DQI A;  4N41 A;  4CJL A;  1BGX T;  3HYF A;  3RTV A;  4OLA A;  2QKB A;  4DFM A;  2D0B A;  4QAG A;  1RBU A;  2YV0 X;  1RTH A;  1D9F A;  4DSK A;  4FJH A;  3AVL A;  3F9K A;  2OPQ A;  2Z1I A;  3RR8 A;  1RT5 A;  5K14 A;  1RBT A;  2HHQ A;  3ZSX A;  3ZT3 A;  5HRO A;  3HO1 A;  3HJF A;  3DLR A;  4LSL A;  4FZY A;  4B9M A;  4PWD A;  1KRP A;  3ZT2 A;  4Y1C A;  1SKS A;  3OY9 A;  1Q9Y A;  1NK5 A;  3SCX A;  4FLZ A;  2RF2 A;  3KLF A;  3DMJ A;  4FVM A;  1SL0 A;  1IO2 A;  4B9S A;  3QNN A;  4CJR A;  4BDZ A;  3U6F A;  3PX0 A;  3SQ1 A;  3OYJ A;  5FRM A;  4CJU A;  3ZT1 A;  1WSF A;  3O3G A;  3C94 A;  1U4B A;  1ZYQ A;  3O4Q A;  4M3Y A;  4E7L A;  3CM5 A;  4RW7 A;  1ITG A;  4JRP A;  1SKR A;  3OYG A;  2F8T A;  3RMB A;  4KB0 A;  4FW2 A;  4ELT A;  4W5Q A;  3NH0 A;  2Y1J A;  2E6L A;  1KCF A;  3VQ7 A;  2O4I A;  1FXX A;  4B9L A;  1WNS A;  2VWJ A;  4B9T A;  3LP2 A;  3ZSV A;  3VQD A;  1X9S A;  1U48 A;  2X6N A;  4KB1 A;  4DFK A;  4GMJ B;  4GW6 A;  4DF4 A;  4FJI A;  5C25 A;  3SPZ A;  3AO2 A;  3OYI A;  1JKH A;  4DSJ A;  1WSJ A;  1TK8 A;  4NYN A;  3NCI A;  4FJ7 A;  4ID1 A;  3TI0 A;  3K5L A;  1NK0 A;  4DQP A;  2YHA A;  2FC0 A;  4I2P A;  3T3F A;  3SI6 A;  4CHQ A;  3HP9 A;  4DSF A;  1UAX A;  4M3X A;  1X1P A;  2JLE A;  1EP4 A;  1C1A A;  4HTU A;  2F8S A;  4CE9 A;  3AVJ A;  3LZI A;  4KO0 A;  1RT1 A;  4GVM A;  4W5T A;  5J2M A;  4DWI A;  1DLO A;  4IKF A;  4CJS A;  1TL3 A;  3QER A;  3TAB A;  4B9N A;  4FJJ A;  1S9E A;  2LSN A;  4M42 A;  4FK4 A;  3QEV A;  4LY7 A;  4CJW A;  3JSM A;  1T7P A;  2PZS A;  1LWE A;  4Z0U A;  4DTN A;  4N56 A;  4KI6 A;  4CJT A;  3DRP A;  3HL8 A;  5KRT A;  4CHZ A;  1XC9 A;  2IAJ A;  3MXM A;  1N6Q A;  3HK2 A;  4FYD A;  1YVU A;  5J2N A;  2KFN A;  3U3Y A;  4DTO A;  4CEC A;  3A2F A;  3MXI A;  1RCH A;  3DI6 A;  4FW1 A;  1EKE A;  4BE1 A;  1LAW A;  3NBP A;  1HJR A;  3NF6 A;  2D0C A;  3V9W A;  5I3U A;  1CLQ A;  1RTI A;  5E41 A;  3QEW A;  4DFP A;  4KHQ A;  3SQ0 A;  4CJ4 A;  4RW8 A; 
#chains in the Genus database with same CATH topology
 2QEX N;  2KLA A;  3ZSZ A;  4UY8 O;  5ELZ A;  3DLH A;  3OYH A;  3AVN A;  1B9D A;  4JHD A;  3VER A;  4BC2 A;  2OTL N;  1ASU A;  3U8X A;  1D5A A;  4B1X B;  2ASM A;  2NNW A;  3AVF A;  5BN9 A;  3O8M A;  2YI1 A;  3TAR A;  1ZBL A;  3OJU A;  3MMV A;  1YTU A;  4IXC A;  3PX4 A;  1WOQ A;  1S1U A;  2ATQ A;  2I5J A;  2O8C B;  4AHS A;  2UXC K;  4YY3 K;  4UQG A;  3NDK A;  4JAX A;  4CIE A;  5KQ8 A;  3TWH A;  1NWK A;  1KVC A;  2UXB K;  1BU6 O;  3M6G A;  2XY7 A;  2X74 A;  3OYN A;  1C1C A;  4DR2 K;  4EZ9 A;  4QOZ B;  1D8Y A;  4CHN A;  3EZ5 A;  1EWQ A;  3TAM A;  1RTD A;  3U3G A;  1NGC A;  3I8B A;  3QEX A;  4LFA K;  3VQ9 A;  2WUS A;  4OKJ A;  2NUB A;  3V9X A;  2B5J A;  3EYZ A;  4C8O A;  4RW4 A;  3C6T A;  4EFH A;  3TTC A;  3I33 A;  5CYQ A;  3ID8 A;  3VOV A;  3TAP A;  1TV6 A;  3E9P A;  1TL1 A;  2ZM6 K;  3THV A;  1HYS A;  3THW A;  1IJJ A;  2P9K B;  5AQO A;  2NLX A;  1TK5 A;  1BL3 A;  1HNV A;  3TSQ A;  5C15 A;  3SQ4 A;  2UU9 K;  3PY8 A;  2CGJ A;  4E1M A;  1MU2 A;  1Z25 A;  3SZ2 A;  2P9L B;  3H08 A;  5HBM A;  5C12 A;  4CJP A;  1ZBF A;  1UA1 A;  1G15 A;  3CC2 N;  4DMN A;  4YOT A;  3VEZ A;  3DLG A;  2WTU A;  3LDS A;  1YTA A;  4DTM A;  1NGJ A;  4I7F A;  4K0K K;  5AQG A;  1DEJ A;  3PO5 A;  4DU3 A;  3NGI A;  4Z4C A;  2IVO A;  2E1Y A;  3QNO A;  3ZSY A;  3H3N O;  3LL3 A;  3DYA A;  3QES A;  4AIL C;  2DFF A;  1CXQ A;  1QQC A;  4CEZ A;  3VQ8 A;  3OYD A;  4DV5 K;  4BRE A;  1JL1 A;  3LP0 A;  3FZL A;  3FZK A;  2YNF A;  4JKD A;  3H3O B;  4C8K A;  3KK1 A;  1KLM A;  4GKK K;  2KW4 A;  4L8R B;  4FM1 A;  1HLU A;  1TVR A;  3AVM A;  1YT3 A;  4B1Z A;  2VWK A;  4DG1 A;  4DTU A;  1OKJ A;  4H5W A;  4C8L A;  2HF3 A;  3L2U A;  5FDL A;  1REV A;  2HNY A;  5KPZ A;  3U4L A;  1HPZ A;  4IEE A;  4YFU A;  2W42 A;  3QDK A;  3C6H A;  4WFB L;  1CZB A;  5F0X A;  4KRE A;  3LZJ A;  3C7N A;  1Q82 O;  4LFC K;  3HVR A;  4M3R A;  4H0X B;  5EY4 A;  4M41 A;  5BPL A;  4E7K A;  4GNI A;  3OBY A;  1YHQ N;  2HHH K;  5AQW A;  3HVT A;  1TKD A;  1K6Y A;  3D2E A;  1VQL N;  2YKM A;  1NG9 A;  4QCL A;  4OKE A;  3V6D A;  5AQP A;  1RT7 A;  3EN9 A;  3OS1 A;  4PL8 A;  2QKK A;  4V19 S;  1NJI O;  4FM0 A;  4IEI A;  2O8E B;  2D4W A;  3V1R A;  4ELV A;  1G99 A;  2JGU A;  3L2Q A;  3CPE A;  1X3N A;  3IS9 A;  3DLL L;  4FVU A;  1GLD G;  5A2Q O;  3P1G A;  3QIC A;  2O8D B;  3CCS N;  4KHW A;  3WT0 A;  2PAV A;  1WB9 A;  1T03 A;  1N32 K;  3EKU A;  4JI7 K;  2QI2 A;  3A5L C;  1QZ5 A;  3ENO A;  1W97 L;  3G10 A;  3KKS A;  3FE1 A;  3VF6 A;  4DTR A;  1Y64 A;  3DXM B;  1SS6 A;  3P39 A;  1TAU A;  5BN8 A;  4NXN K;  3P38 A;  4B3T K;  4CJK A;  4LF7 K;  2F9T A;  2X78 A;  3L8B A;  4CF8 A;  5AFU A;  3SYZ A;  3ZX0 A;  4JI0 K;  4AM7 A;  3M8S A;  3CD6 N;  3VEV A;  3CG7 A;  4B1U B;  1HKB A;  4O0J A;  3F2K A;  5DK5 A;  4PY5 A;  2QTD A;  3H1Q A;  3AVK A;  4U67 L;  2FXU A;  4LH5 A;  4MDB A;  4FLX A;  5EX5 A;  4B08 A;  5AQV A;  3O3H A;  4IO9 L;  4CK3 A;  4AHV A;  2RPI A;  3R3L A;  5CR4 A;  1K73 O;  2BDP A;  2F7T A;  4DR3 K;  1GOA A;  3AO1 A;  2OYQ A;  4F8R A;  1ZBI A;  4YDU C;  1VHX A;  1XC3 A;  4IJN A;  4CJ7 A;  2E5L K;  3V9Z A;  1JLB A;  2EX3 A;  5AZJ B;  4KTQ A;  1ESV A;  3HI0 A;  4DR5 K;  3FZH A;  4JI2 K;  2F4V K;  2CH6 A;  4DB3 A;  1SL1 A;  3LM9 A;  1VQN N;  2HNZ A;  3SBT A;  3M5R A;  1BWF O;  1IH7 A;  3BF1 A;  5FPD A;  4ELU A;  3SUN A;  4A61 A;  4WYB A;  4EIA A;  1RNH A;  1IBM K;  2FBV A;  4E7H A;  3TAQ A;  3CQX A;  1M90 O;  5D3G A;  4ILG B;  3WQU A;  3ALY A;  3RRH A;  3D2F A;  5ADX A;  2P9N A;  4JRQ A;  5AQM A;  1ILY A;  3SUO A;  3O3F A;  1S72 N;  4FCY A;  4BR9 A;  3KZB A;  1A5X A;  4Y1D A;  3R6M A;  4GV9 A;  4W5N A;  1ASV A;  3AAP A;  4JKA A;  3SLC A;  2PY5 A;  2XHB A;  3C6U A;  3M8R A;  2HF4 A;  2KQ2 A;  3CI5 A;  2P9I B;  3PO4 A;  5I42 A;  4BWJ A;  4DV4 K;  3Q7B A;  3CFP A;  4E19 A;  1HRH A;  3ATV A;  4CD3 A;  2IDO A;  3WXI A;  4NLC A;  1X9W A;  1K9M O;  3OYF A;  2I7N A;  1CZA N;  1ZBS A;  4YNQ A;  1Q9X A;  3RSE B;  3EZW A;  4CW7 B;  2ZGY A;  2O8F B;  3LDP A;  2WC9 A;  4MFB A;  1IBK K;  5GIO A;  2KZM A;  4CHO A;  4BAC A;  3RRG A;  3WEE A;  4CEF A;  1C0T A;  3KD5 E;  2BAN A;  4OLB A;  4DU1 A;  4B8A B;  4BRM A;  4CJF A;  1WLJ A;  3BZC A;  3CJ9 A;  4EP4 A;  1SL2 A;  3ZYY X;  1MWK A;  4HWI A;  4EZ6 A;  4CJ3 A;  4RWT A;  4BDY A;  2NRZ A;  3QEP A;  2QXF A;  2QW9 A;  4JD2 A;  3ZX2 A;  2QWM A;  1WN7 A;  3AA3 A;  3E1Y A;  2A42 A;  4JKC A;  1K8A O;  1YIJ N;  1D9F A;  4FJH A;  3AVL A;  3CXC M;  2OPQ A;  5C2D A;  5K14 A;  1RBT A;  1YJN N;  3N4Q A;  4FZY A;  1U2V A;  4B9M A;  1KRP A;  3O5B A;  2O8D A;  3A5M C;  3HSC A;  2FSN A;  2RF2 A;  1HPM A;  1SL0 A;  4JKB A;  3QNN A;  1ATR A;  3SQ1 A;  4CJU A;  5HOO A;  3O3G A;  4H0T B;  3UKU B;  3CM5 A;  1ITG A;  3ENH A;  3RMB A;  4KB0 A;  4W5Q A;  4GV3 A;  3FLC O;  5JIC A;  5C0Y A;  2YJF A;  3ZSV A;  4BGB A;  4ILJ A;  3VF4 A;  1X9S A;  4CZM A;  4KB1 A;  4DFK A;  4GMJ B;  4GW6 A;  4DF4 A;  3OYI A;  4NYN A;  5AQN A;  1HUX A;  3NCI A;  2YJE A;  1NK0 A;  2FC0 A;  3HP9 A;  3VEX A;  1O13 A;  2AP1 A;  4DSF A;  1QVF M;  2P9I A;  2E20 A;  4XH4 A;  4NXM K;  1RT1 A;  4GVM A;  3J80 O;  4DWI A;  5CHI A;  1DLO A;  1TL3 A;  3CPW M;  1N8R O;  3OTO K;  1E4G T;  4LY7 A;  4Z0U A;  4DTN A;  4N56 A;  3FGU A;  3HL8 A;  2O8B B;  2IAJ A;  3CCJ N;  1YVU A;  3U3Y A;  1JJ2 M;  3O08 A;  3MXI A;  1RCH A;  5I3U A;  3MWP A;  3QEW A;  3WQT A;  2GEL A;  4CJ4 A;  3R8E A;  3SUQ A;  3S3N A;  2O8C A;  4CCH A;  3C6A A;  3I8D A;  1KTQ A;  4FLW A;  3A5O C;  4F4K A;  2KZZ A;  2P5G A;  5AQK A;  1HNZ K;  5GAG P;  4CK1 A;  1WSG A;  2CGK A;  2A1S A;  1OVY A;  4K41 A;  4YOR A;  5KQD A;  1VSK A;  3CM6 A;  3T1A A;  2W41 A;  1GLE G;  3ZT4 A;  4ISE A;  3HTV A;  1JLC A;  1DGK N;  1C0M A;  3E9L A;  3W0L A;  4WE1 A;  1NJY A;  5M1K A;  1R0A A;  2KTQ A;  3DAW A;  3O9R A;  2VG6 A;  1LV5 A;  3KD1 E;  3UIQ A;  1TUY A;  1B9F A;  3CCR N;  4CBW A;  1BI4 A;  1A5V A;  2V7Y A;  2UUB K;  4IOC L;  2KHO A;  2Z1G A;  4X65 K;  1KVB A;  4FM2 A;  3EKS A;  1BIU A;  3KK2 A;  4DV1 K;  2Z1J A;  1DTQ A;  1GLL O;  3T7Z A;  2E4L A;  4FWN A;  3ZEU B;  3THX B;  4H0Y B;  1UWB A;  4IFV A;  4CFB A;  5LMU K;  1SQK A;  4JK8 A;  2E2Q A;  3OS0 A;  3M8P A;  4DTX A;  2P9L A;  3DRS A;  1YUW A;  4OGE A;  5JMV A;  1DKG D;  1LWC A;  1NM1 A;  4CEE A;  2I7P A;  4DTJ A;  4HCC A;  4RW6 A;  4BWM A;  1MA9 B;  3LDL A;  4CEA A;  3VQ5 A;  1N34 K;  3OS2 A;  1NJW A;  3L3V A;  5AQF A;  1LAV A;  2E2N A;  4EHU A;  5EVZ A;  1NKE A;  2ASP A;  3BZK A;  4JLH A;  4I2Q A;  3SAG A;  3NGZ A;  4NCA A;  1L3V A;  1ZXO A;  1QTM A;  1J53 A;  2J4R A;  3WXJ A;  4F2S A;  3CYM A;  4RTF D;  4E1J A;  4K8X A;  2NRV A;  3EO3 A;  1P90 A;  3DJC A;  3THX A;  3I56 N;  3AVH A;  1U2V B;  5M1F A;  3K5O A;  4CF2 A;  3NFA A;  2GV9 A;  2YNI A;  3HPH A;  1Q18 A;  3ISN C;  1KSP A;  4Z4I A;  2XRI A;  2VG5 A;  2NRW A;  2ASO A;  3LAL A;  5AJ3 K;  3TU5 A;  3JAM O;  4N76 A;  2PYL A;  1WUA A;  4NLB A;  4PUO A;  4N5S A;  1N6Q A;  4DQQ A;  3P5J A;  2FF6 A;  4JI1 K;  3G25 A;  1ZC6 A;  5SWM A;  1XMO K;  3AV9 A;  4JKE A;  2HHT A;  1XWL A;  5BRE A;  2WBN A;  3VES A;  4FJG A;  3VEO A;  1LCU A;  4NCG A;  3F73 A;  1J9A A;  4H5T A;  4BRD A;  3AY9 A;  2XO7 A;  3VEW A;  4B3M K;  4GVE A;  3VF2 A;  4FWK A;  4JYA K;  1T6C A;  4YHH K;  1FJG K;  4DLG A;  3HPG A;  1VQP N;  4O0I A;  2EWS A;  2QWO A;  2G8F A;  4X62 K;  4JKG B;  1GOC A;  4JK7 A;  3S41 A;  4KV8 A;  4HHT A;  1LOT B;  3A8Y A;  2YKN A;  3MN7 A;  5AZI B;  2G8U A;  2P9N B;  1J6Z A;  5EOY A;  4FJM A;  1D4X A;  2ITG A;  1DTT A;  1NK8 A;  2IC3 A;  4JV5 K;  1T8E A;  5KI6 A;  1U45 A;  3ITH A;  4PL7 A;  2BE2 A;  4DHY A;  1D9D A;  3QML A;  2QWL A;  1HYZ A;  4B3S K;  4DTP A;  5BR9 A;  3IMX A;  1WAF A;  1C0G A;  3ULD A;  1X9M A;  4DR4 K;  4CEO A;  3SK3 A;  4NB4 A;  1X3M A;  5BRD A;  4I6M B;  4NYF A;  4AHU A;  3NH2 A;  4CGI A;  5AFU H;  1T3V A;  5BRH A;  3LWM A;  4E3S A;  3VQQ A;  3QIO A;  1FKO A;  4DSI A;  2IOC A;  4PA1 A;  3RSE A;  2G8K A;  4KKO A;  3NMU A;  3PIP L;  3HOT A;  2F96 A;  2HW3 A;  4JKG A;  2ZQB A;  2HB5 A;  2ZGZ A;  4JS4 A;  2HVI A;  3IDH A;  2JWL A;  4F9O A;  5KTQ A;  4A2B A;  5J1E A;  3C95 A;  1C1B A;  2P51 A;  2R7Y A;  1NNE A;  3V1Q A;  3EEQ A;  5ADX H;  2GX9 A;  4BC5 A;  2OZS A;  2CH5 A;  3D6R A;  3PIO L;  4F2R A;  2AJQ A;  3LAN A;  3BDP A;  4DSL A;  1BQN A;  4BRG A;  3KLH A;  1HKC A;  4AF1 A;  2RKI A;  3MED A;  2A6A A;  1A5W A;  1BA0 A;  4IO8 A;  4M3Z A;  4LH4 A;  3JS6 A;  4FJ8 A;  4CZG A;  5J2P A;  1HQE A;  3DOK A;  2WOM A;  2X6S A;  3CCM N;  4BR4 A;  2WON A;  4ZHR A;  1K8K B;  4IOX A;  3K5N A;  1CZ9 A;  3KVG A;  4I6M A;  3DLK A;  1S1X A;  2GWK A;  4JKH A;  2IVN A;  3CCV N;  1VQO N;  1VSM A;  5KPR A;  1RTJ A;  1ASW A;  4CED A;  1TKT A;  4AQY K;  4BR7 A;  3MN6 A;  4IJA A;  4QS8 A;  2UUA K;  3TAF A;  4Q0B A;  5FPM A;  4FJL A;  2DPN A;  3KWI A;  3P83 D;  3VQP A;  5KRS A;  3IRX A;  4LSN A;  3BY5 A;  2P9S B;  4DU4 A;  3P4I A;  1TGO A;  4PHT X;  3SPY A;  4B3O A;  1TK0 A;  5CY4 A;  3THY B;  4BR0 A;  2OA8 A;  3NH1 A;  2O8F A;  1N33 K;  4HTL A;  4DUZ K;  3D45 A;  2P9U A;  3L0Q A;  2IS3 A;  3K0S A;  1NGI A;  3OA9 A;  4AH9 A;  1Z6R A;  4CHP A;  4Y0W A;  4CZE A;  4F3O A;  2HVH A;  3LPT A;  1NGB A;  1NGF A;  1OH5 A;  5FLX O;  1JCG A;  3NE6 A;  1IKV A;  4X64 K;  3PUF A;  2NRH A;  3E9O A;  3J7Y P;  4E0D A;  2QWN A;  3VGK A;  3CJB A;  3RMA A;  1MWM A;  3CC7 N;  1NJX A;  4JI3 K;  1KAY A;  1EWR A;  1XNR K;  1GLC G;  2DFH A;  4FJ9 A;  3VEY A;  2FF3 B;  4CGF A;  4M45 A;  4BR5 A;  1S3X A;  1V4S A;  3WNF A;  4Z4G A;  3UE5 A;  1NGA A;  3HPO A;  4DUY K;  4FLU A;  4CFA A;  4M63 C;  3V9U A;  1P8Z A;  4HUF A;  1VSD A;  3OYL A;  1Z26 A;  4YDU A;  4WFN L;  2JWK A;  2HMI A;  2Q0U A;  2UYT A;  3T19 A;  3LM2 A;  1U6Z A;  3IKM A;  1KFD A;  1NKC A;  2P9K A;  1EQY A;  4CJL A;  1BGX T;  4OLA A;  2Q36 A;  2D0B A;  4QAG A;  1RBU A;  2YV0 X;  4DFM A;  5TKW A;  4DSK A;  1BUP A;  3PSI A;  3F9K A;  4CZJ A;  4JK9 A;  2O8E A;  3ZSX A;  5IWA K;  3HJF A;  3DLR A;  4B1Y B;  1XUP O;  3OW2 M;  3OBW A;  4CZK A;  1Q9Y A;  5AQI A;  3KLF A;  2D1K A;  1YXQ A;  3AAR A;  4FVM A;  1IO2 A;  4IWV A;  4B9S A;  4BDZ A;  4K42 A;  5E26 A;  3U6F A;  4YOV A;  1IG8 A;  3PX0 A;  3VPZ A;  3OYJ A;  3ZT1 A;  1Z05 A;  2VYP A;  4O5F A;  3O1W A;  1ZYQ A;  3O4Q A;  3OHR A;  2QWP A;  3R1X A;  3GOI A;  4ISG A;  4LC9 B;  5FPN A;  3VTH A;  4DV3 K;  4ELT A;  3NH0 A;  1ATS A;  1KCF A;  3GG4 A;  4B9L A;  2VWJ A;  3SBG A;  4B9T A;  3LP2 A;  3CCQ N;  4BRC A;  4DSJ A;  4XEI A;  1TK8 A;  4DQP A;  3SI6 A;  4I2P A;  4CHQ A;  3ULE A;  2HBM A;  3C0B A;  4DR1 K;  1UAX A;  3HOS A;  4M3X A;  1E4F T;  1X1P A;  2HBL A;  2HBK A;  1C1A A;  4DV6 K;  4G9Z A;  2F8S A;  4WCE L;  3UKR B;  4CE9 A;  5AR0 A;  1XNQ K;  3TAB A;  3QEV A;  4NO7 A;  4KI6 A;  3O9T A;  4CHZ A;  1XC9 A;  3HK2 A;  4FYD A;  1H1V A;  3P31 A;  3L6Q A;  4BRF A;  4BE1 A;  4FW1 A;  1QQO A;  2FLO A;  1CLQ A;  3QBW A;  5CE3 A;  3V9W A;  1RTI A;  4KHQ A;  3QET A;  5JLH A;  3BGR A;  3L2W A;  4IG3 A;  4CJE A;  5C42 A;  3AO5 A;  4RG8 A;  3QBX A;  4JI8 K;  4HCB A;  4ISF A;  4IDH A;  4X66 K;  3ZCM A;  3OYK A;  2HST A;  3C65 A;  3SJJ A;  4E7I A;  3AVG A;  4R79 A;  2A41 A;  5EXW A;  3HST B;  4WFA L;  2QK9 A;  4GV6 A;  1JCF A;  4IBN A;  5KGX A;  3CJ1 A;  4OPH A;  1Y97 A;  4FWQ A;  2P9P B;  4R5P A;  3IAY A;  3L2R A;  4KI4 A;  3AO4 A;  4M3T A;  2DY4 A;  4J2E A;  5GIP A;  3DM2 A;  3LWL A;  2WFB A;  1M1K O;  1QHA A;  3G4S N;  4ICL A;  1J5E K;  3VGL A;  5EU7 A;  4J8F A;  3PV8 A;  3MCA B;  4C23 A;  3MN9 A;  3THY A;  1ZBH A;  2ZJQ L;  2ZD1 A;  1NGD A;  1WAJ A;  4B8C A;  1NBW A;  2VG7 A;  2D0A A;  2IIR A;  4CFC A;  3LP1 A;  3VN5 A;  3VQB A;  4CJQ A;  1JL2 A;  5AZJ A;  1VSI A;  4GKJ K;  5AQJ A;  1VQ7 N;  3GBT A;  4EHT A;  3WNE A;  4LF6 K;  4KFB A;  1NK7 A;  1BQM A;  5BR8 K;  4FWM A;  4O8K A;  2OAN A;  4H0V B;  2QM1 A;  2ETJ A;  4H4M A;  1U49 A;  4BY9 C;  4DV0 K;  2HHW A;  1CXU A;  1BO5 O;  3M8Q A;  4CIG A;  3UB5 A;  3PSF A;  3VQE A;  5J2Q A;  3LP3 A;  2Q1N A;  3KK7 A;  4XH1 A;  4DS5 A;  1QE1 A;  1S1V A;  3I0S A;  4IDK A;  3DOL A;  3K58 A;  3SV3 A;  2NRX A;  3HZ6 A;  4EAH D;  3QFU A;  1IV0 A;  2A40 A;  3ASM A;  3ZSQ A;  3VQA A;  1RBR A;  1DT9 A;  1JLF A;  1KFS A;  2IVP A;  1HNX K;  1LW0 A;  4FXD A;  1N36 K;  1HJO A;  1HNI A;  4OKK A;  3CCE N;  3OJS A;  2VCP A;  1BIS A;  1NU0 A;  1TAQ A;  2A3Z A;  2HBJ A;  2G8I A;  1IKY A;  1QZ6 A;  1TYQ B;  4LD0 A;  4O4G A;  3DLE A;  3THW B;  3CQ8 A;  3SNN A;  4KPY A;  2YNG A;  3V81 A;  5LJV A;  4LF5 K;  3KKR A;  3DXK A;  1GLB G;  2ZWH A;  4MLH A;  1T44 A;  4B9V A;  1S1W A;  4DCH A;  4OPK A;  1X9J A;  1RDD A;  4CK2 A;  3CJA A;  4DF8 A;  4MLE A;  2BH1 A;  4IFE A;  3CC4 N;  3EE8 A;  2BGG A;  1YIT N;  1WSH A;  1T6D A;  4HUG A;  1NGG A;  3KLI A;  3ZSW A;  3NF8 A;  3MCP A;  5DMR A;  5DM6 L;  1BA1 A;  3ZSR A;  3AA5 X;  2GUP A;  5CZ2 A;  3T1H K;  1GLA G;  2B6A A;  3J8A A;  3OVN A;  1VRU A;  4KBO A;  3HBT A;  4FJN A;  5M1O A;  4CVN E;  3TAN A;  1S9G A;  2D5R A;  2HHX A;  4OX9 K;  4KHY A;  3J7Z O;  3CER A;  2ZJR L;  3T1Y K;  2Y1I A;  1JCE A;  3D2E B;  3DXM A;  3NHG A;  4FLV A;  3HM8 A;  1XI1 A;  4DQR A;  1EX4 A;  4FK2 A;  4AHR A;  3K57 A;  1IG9 A;  3KK3 A;  3NF7 A;  4CIF A;  1SUQ A;  2FSK A;  4BGA A;  1RDU A;  5HRR A;  3H46 O;  3QO9 A;  3DRR A;  4J2A A;  5FRN A;  4DR6 K;  5LMN K;  4Z4H A;  4H5N A;  3VEN A;  4M3U A;  1KD1 O;  2YHB A;  5KPT A;  3W3D A;  3AVB A;  4HUE A;  1JLG A;  2Q2R A;  4A5A A;  4DTS A;  1BCO A;  2VGM A;  3MEG A;  1S6P A;  2F9W A;  4K25 A;  3V1O A;  3VTI A;  5T7B A;  5M1P A;  3BF3 A;  3RMD A;  4L3Q A;  1NKB A;  4C1N K;  2HHV A;  4EP5 A;  3IG1 A;  3TAG A;  4DLE A;  3AAQ A;  1BCM A;  4DV2 K;  4FPB A;  1HMV A;  3QLH A;  1WSI A;  3L2V A;  3G71 N;  3WNH A;  4B3R K;  3B6O A;  4BRI A;  3OYC A;  4CZH A;  4FJK A;  2B4J A;  2P9U B;  4DS4 A;  3CIP A;  1TKZ A;  2QA4 N;  1SKW A;  1RT4 A;  2HMP A;  4K43 A;  2O8B A;  4H03 B;  1FK9 A;  1UA0 A;  4Z4E A;  4DQS A;  5JS1 A;  1BIZ A;  4Z94 A;  4CFD A;  3MWT A;  2P9P A;  1ZBU A;  3OYB A;  1RBV A;  3O4W A;  3AGK A;  2G8W A;  5LY3 A;  3AA2 A;  2OPP A;  2Q3S A;  4CGD A;  4JKF A;  3LDO A;  3WXM B;  4B1W B;  4CF9 A;  3MAQ A;  1QHT A;  3UKU A;  1TUU A;  4TSX A;  5AQR A;  4DSE A;  1QSL A;  1V4T A;  3QFP A;  4CF0 A;  2A1R A;  3AO3 A;  1NOZ A;  4N47 A;  2YX6 A;  4LF9 K;  3HM9 A;  2IGI A;  4KH6 A;  3ULE B;  3AA4 A;  4KHN A;  3EY1 A;  4IG0 A;  1IKW A;  1EXQ A;  1XQS C;  3CCL N;  1XHZ A;  2OZM A;  5KGW A;  4FPA A;  3CME N;  3S9H A;  4BDP A;  2YHW A;  2GTD A;  4KAZ A;  4KH4 A;  3VQ6 A;  4H0P A;  1TYQ A;  3VET A;  5JVH L;  1LWF A;  2W6L A;  3LAM A;  3NVK A;  5CZ1 A;  5BRF A;  2HHU A;  4G1Q A;  3MEE A;  3WNG A;  3K59 A;  3MXJ A;  1C6V A;  1VSE A;  2Z1H A;  3H1V X;  4M7X A;  4Z4F A;  3CF5 L;  2W6K A;  4J2D A;  2GBZ A;  5AQU A;  1U47 A;  4DQI A;  3LPU A;  5F1X A;  3HYF A;  3RTV A;  1BDG A;  4CI6 A;  4KH5 A;  4BQL A;  1RTH A;  5C2F A;  3CJ7 A;  4PKH A;  2HHQ A;  5HRO A;  4LSL A;  1SKS A;  3OY9 A;  5TKY A;  4O8U A;  1OVQ A;  3DMJ A;  4CJR A;  1WSF A;  5M1N A;  3C94 A;  4CZL A;  3IFR A;  3F9M A;  4C1N I;  4E7L A;  1KC8 O;  4JRP A;  4A59 A;  2E6L A;  3VQ7 A;  2O4I A;  3L4I A;  4LF8 K;  3VQD A;  2X6N A;  5C25 A;  3SPZ A;  3AO2 A;  4JI4 K;  1ATN A;  4BC4 A;  2YHA A;  2BUP A;  4DKW A;  3MN5 A;  4FWP A;  2JLE A;  1EP4 A;  5AQH A;  3AVJ A;  3LZI A;  4KO0 A;  4YOW A;  2QXL A;  4IKF A;  4CJS A;  3J81 O;  4FWO A;  3QER A;  4FJJ A;  4B9N A;  1S9E A;  2LSN A;  1VQK N;  2PZS A;  1T7P A;  5IT9 O;  5C10 A;  4CJT A;  5KRT A;  4M7Y A;  4A5B A;  1YJ9 N;  4A57 A;  4LFB K;  2KFN A;  4WQ5 A;  4JN4 A;  4QS9 A;  4CEC A;  3A2F A;  2D0C A;  2RE2 A;  3WXK A;  5E41 A;  3DWL A;  5AQT A;  4H5R A;  1IBL K;  4CHY A;  4CGG A;  1OH8 A;  4BR2 A;  4BRQ A;  3J7A P;  4CER A;  4XH5 A;  3O9U A;  5HRS A;  4YOY A;  1NK9 A;  4CBX A;  4FLT A;  3TR8 A;  4B9U A;  5E84 A;  1K8K A;  3ATU A;  2Q97 A;  2ZJP L;  3L4Q A;  1VSF A;  1JLQ A;  3Q7C A;  2HHS A;  3MDQ A;  1TKX A;  3RMC A;  2OCE A;  3KIO A;  1SZ2 A;  1NJZ A;  4OO1 J;  1Q8I A;  2DFE A;  3OYM A;  3N4P A;  4CJ5 A;  1YAG A;  5C24 A;  2P9S A;  1EET A;  4O44 A;  3ZLJ A;  3E66 A;  3H6E A;  4A2A A;  4J2B A;  1WBB A;  2QWQ A;  5MLC Q;  4BRH A;  5FRO A;  1YJW N;  1J5O A;  2E6M A;  4I9L A;  2FBT A;  1W0H A;  4JD2 B;  1L3T A;  3VGM A;  2QKB A;  4FJ5 A;  2E2P A;  2XY6 A;  1N5Y A;  4WF9 L;  3MX2 A;  4BE2 A;  4CZF A;  3KTQ A;  2GWJ A;  4E1N A;  3A5N C;  4CGJ A;  1JLE A;  4M3W A;  3AGR A;  3GL1 A;  5F2R A;  1IKX A;  5HLF A;  3K9J A;  4FOE A;  4JS5 A;  4AM6 A;  1JLA A;  3F5T A;  4ID5 A;  1L3S A;  4JEP A;  1XHX A;  1QSY A;  3O6W A;  3O4N A;  3SQ2 A;  4FZZ A;  4JI5 K;  1C0F A;  1HYV A;  4KRF A;  4C8M A;  3CCU N;  1HX1 A;  3HP6 A;  1RDC A;  1S1T A;  3K5M A;  1FW6 A;  3U9D A;  1VQ8 N;  1JXE A;  2YHY A;  3HT3 A;  3VMF B;  3KHY A;  4BC3 A;  3QB0 A;  3DXK B;  2ZF5 O;  2PBD A;  4GY2 B;  1WBD A;  1NLV A;  2Q31 A;  3G0Z A;  3TTD A;  4FJX A;  4E7J A;  1I39 A;  3AVC A;  4W5O A;  4OGC A;  2G8V A;  4BQZ A;  3KLE A;  2BTF A;  1BG3 A;  3SMS A;  3B6P A;  3SAF A;  3E01 A;  4YOX A;  1YF5 L;  4DV7 K;  3PX6 A;  4H8K A;  2W40 A;  4DFJ A;  4PKG A;  1HNW K;  5AZI A;  1KVA A;  4B1V A;  5FPE A;  1NMD A;  3VQC A;  3FZF A;  3TAE A;  3VQ4 A;  1NK6 A;  3KJV A;  4FZX C;  4WQ4 A;  1LW2 A;  2Q0R A;  4BE0 A;  4YOU A;  1E3M A;  1RBS A;  4OJR A;  3SAH A;  2DTU A;  3I0R A;  1JXB A;  1L5U A;  1YI2 N;  1QQN A;  1L3U A;  1QQM A;  2P1J A;  2O4G A;  1WSE A;  4FO0 A;  2ZE2 A;  3QIN A;  3V4I A;  3NAE A;  3WXL A;  1VQ5 N;  4FLY A;  2EHG A;  5HRP A;  3CFR A;  3UKR A;  3MK6 A;  3TSP A;  3D0P A;  3S3M A;  1FKP A;  4O5B A;  3ENB A;  3K2P A;  3JXU A;  5DM7 L;  2OPR A;  1NOY A;  4KHU A;  4ILH A;  1NMN A;  3RR7 A;  4BG8 A;  4XIU A;  3CHW A;  5GIN A;  4F3T A;  4CZI A;  3LDN A;  4C8N A;  5HL7 L;  2OTJ N;  1Q86 O;  3OYA A;  5AQS A;  4OVL A;  4MQ3 A;  4JHD B;  4BRK A;  4K8Z A;  3TSU A;  4MO4 A;  3HRG A;  1QSS A;  4U7B A;  3LAK A;  3NF9 A;  3JYT A;  2P5O A;  5B8H A;  1HKG A;  3ZSO A;  2VQE K;  3QEI A;  2QWR A;  1RDB A;  3KWG A;  2HND A;  1KAZ A;  5AQX A;  2UUC K;  2NRR A;  4MO5 A;  4AHC A;  4ZTJ A;  5SZT A;  1NK4 A;  1SV5 A;  5LJW A;  5JS2 A;  4DQ8 A;  2NZT A;  3SV4 A;  4QS7 A;  1KAX A;  4CBU A;  3ZET B;  1BHL A;  3CMA N;  5JLF A;  1KXP A;  4H4O A;  4WQ5 C;  4FL9 A;  4I9Q A;  1GOB A;  3CQY A;  1VQ4 N;  1W7A A;  1RT3 A;  4NCB A;  1BOT O;  5JVG L;  1GLF O;  2RN2 A;  4BVO A;  3ZT0 A;  1C0U A;  4DR7 K;  1T05 A;  1RDW X;  1O1W A;  4IFY A;  1RIL A;  4PQU A;  1VRT A;  4AHT A;  4B9Q A;  4JI6 K;  1VQ6 N;  3SJH A;  3BEX A;  1RT2 A;  5H1S Q;  3FFI A;  2YCH A;  3VA3 A;  2KKZ A;  4KTW A;  5AQY A;  4BRL A;  3O9Q A;  3NVM A;  2E1Z A;  3NGY A;  3CFO A;  1RDA A;  2PYJ A;  1F21 A;  1UOC A;  1VAZ A;  3L3U A;  3HXM A;  1Q81 O;  2E2O A;  2E88 A;  4BRP A;  5GAD P;  3OYE A;  4BG9 A;  1U04 A;  4MDA A;  4RW9 A;  1I3A A;  5M1Q A;  1W2B M;  4FWL A;  2AA4 A;  1QVG M;  1OH7 A;  4CGH A;  2FBX A;  3A0I X;  1HR0 K;  3TPQ A;  5GAE P;  3AVA A;  2OPS A;  2KFZ A;  2HOE A;  4H0O A;  3AVI A;  3R9P A;  1XMQ K;  5AQL A;  2H3G X;  3PLA A;  1RGI A;  4PKI A;  2E8A A;  3SUP A;  4CF1 A;  3RWU A;  1HQU A;  1QS4 A;  1KLN A;  4BRO A;  4LF4 K;  3MEC A;  3C7N B;  2FBY A;  4HVJ A;  3EE9 A;  2D0O A;  3IUC A;  2GUI A;  5BPN A;  4OPJ A;  2PFU A;  1NGE A;  3SMP A;  3EL2 A;  4KHS A;  3K9K A;  3QIP A;  1VSH A;  2XY5 A;  2ITM A;  4CJV A;  4O55 A;  2VWB A;  3TTF A;  3GDQ A;  4E89 A;  1YVN A;  1EO1 A;  4Q5V A;  3V9S A;  3CJC A;  4IZ9 A;  1VSL A;  1VK0 A;  3DLB A;  1S22 A;  4W5R A;  4KHP K;  5HRN A;  3BP8 A;  4CEB A;  1B92 A;  5GAH P;  4RCH A;  2UXD K;  1W9H A;  2VGN A;  5I9E B;  1RT6 A;  4CES A;  3MX5 A;  1NGH A;  1S5J A;  2G8H A;  3B8A X;  2XY8 A;  4CEQ A;  3FFK B;  5CYM A;  1BI4 B;  1S6Q A;  1GLJ O;  4ZTF A;  2D0P A;  3VA0 A;  3S3O A;  3ID6 A;  3WEE B;  1Q7Y O;  3KLG A;  2V52 B;  3FR0 A;  2YNH A;  4A62 A;  1J54 A;  5HP1 A;  4KTZ A;  4FK0 A;  1VSJ A;  4N41 A;  1I94 K;  4FWS A;  2GEM A;  5LL6 Z;  1SAZ A;  4WQ4 C;  3FZM A;  2CGL A;  2Z1I A;  3RR8 A;  1RT5 A;  2RHK A;  4JNE A;  3ZT3 A;  3HO1 A;  2NRT A;  4OPA A;  3D2F B;  4PWD A;  3ZT2 A;  4Y1C A;  3G6E N;  1NK5 A;  3SCX A;  2A5X A;  5BPM A;  4FLZ A;  5FRM A;  3M3Z A;  4IOA L;  4CD1 A;  1U4B A;  4FOI A;  4M3Y A;  3D7E O;  4RW7 A;  1SKR A;  3OYG A;  2F8T A;  3GE1 A;  4FW2 A;  3CET A;  2Y1J A;  3O80 A;  3ZX3 A;  1FXX A;  1R59 O;  2V7Z A;  1WNS A;  4BVP A;  1U48 A;  4FJI A;  3U9Z A;  1JKH A;  1WSJ A;  4FJ7 A;  3O1B A;  4ID1 A;  3TI0 A;  3K5L A;  1VQ9 N;  3T3F A;  3ZET A;  3M1F A;  3I55 N;  5AQQ A;  4FSV A;  4FWR A;  4HTU A;  1MDU B;  3ZEU A;  4W5T A;  5J2M A;  2VQF K;  3T69 A;  4BRA A;  4M42 A;  4FK4 A;  4CJW A;  3JSM A;  2V51 B;  1LWE A;  3BUZ B;  1RFQ A;  3O9S A;  3DRP A;  1OH6 A;  1VQM N;  2FSJ A;  3MXM A;  5AQZ A;  3H45 C;  5J2N A;  1KQS M;  3RVC A;  4DTO A;  4H5V A;  3DI6 A;  1EKE A;  1LAW A;  3NBP A;  1HJR A;  3NF6 A;  3WUH A;  3LDQ A;  4BRN A;  2YHX A;  4DFP A;  3SQ0 A;  4RW8 A; 
#chains in the Genus database with same CATH homology
 3ZSZ A;  4CHY A;  4CGG A;  3SUQ A;  3OYH A;  3BGR A;  3AVN A;  3DLH A;  1B9D A;  3L2W A;  4IG3 A;  3S3N A;  1ASU A;  4CJE A;  4CCH A;  1D5A A;  5C42 A;  4CER A;  3AVF A;  3AO5 A;  4RG8 A;  3I8D A;  1KTQ A;  4FLW A;  5HRS A;  3TAR A;  1ZBL A;  1NK9 A;  4HCB A;  3OJU A;  1YTU A;  4FLT A;  3ZCM A;  4F4K A;  3OYK A;  3SJJ A;  2KZZ A;  3TR8 A;  3PX4 A;  4E7I A;  4B9U A;  2P5G A;  1S1U A;  3AVG A;  2ATQ A;  3HST B;  2QK9 A;  2I5J A;  4CK1 A;  1WSG A;  4IBN A;  4AHS A;  4FJK A;  2A1S A;  5KGX A;  4UQG A;  4CIE A;  3NDK A;  1VSF A;  3TWH A;  4FJX A;  1JLQ A;  1Y97 A;  1VSK A;  3CM6 A;  1KVC A;  1TKX A;  3T1A A;  3RMC A;  4R5P A;  3IAY A;  2HHS A;  3L2R A;  4KI4 A;  3AO4 A;  3ZT4 A;  3KIO A;  2XY7 A;  2X74 A;  3OYN A;  1C1C A;  4QOZ B;  4EZ9 A;  1D8Y A;  1JLC A;  1NJZ A;  4M3T A;  2DY4 A;  1C0M A;  1Q8I A;  4CHN A;  3EZ5 A;  2DFE A;  4WE1 A;  3DM2 A;  3OYM A;  3LWL A;  1R0A A;  1NJY A;  4J2E A;  3TAM A;  2KTQ A;  4CJ5 A;  4ICL A;  3U3G A;  2VG6 A;  1RTD A;  3QEX A;  5C24 A;  1LV5 A;  5EU7 A;  3KD1 E;  3UIQ A;  3PV8 A;  3VQ9 A;  1EET A;  1B9F A;  4O44 A;  4OKJ A;  2NUB A;  1BI4 A;  3V9X A;  2B5J A;  1A5V A;  3EYZ A;  4C8O A;  4RW4 A;  1ZBH A;  3C6T A;  2ZD1 A;  4J2B A;  5CYQ A;  2Z1G A;  3TAP A;  1KVB A;  1TV6 A;  4FM2 A;  1TL1 A;  3THV A;  1BIU A;  3KK2 A;  1HYS A;  2Z1J A;  1WAJ A;  1DTQ A;  5FRO A;  4B8C A;  2E6M A;  4I9L A;  1J5O A;  2E4L A;  1W0H A;  2FBT A;  2VG7 A;  1TK5 A;  2D0A A;  1BL3 A;  4CFC A;  1HNV A;  1UWB A;  3LP1 A;  3SQ4 A;  3VN5 A;  1L3T A;  4IFV A;  3VQB A;  4CJQ A;  4CFB A;  2XY6 A;  4FJ5 A;  1JL2 A;  1N5Y A;  4E1M A;  1MU2 A;  1VSI A;  1Z25 A;  3SZ2 A;  4BE2 A;  3OS0 A;  3H08 A;  5HBM A;  3KTQ A;  4E1N A;  4CJP A;  1ZBF A;  3M8P A;  3DRS A;  3WNE A;  4CGJ A;  1JLE A;  1G15 A;  4DTX A;  1UA1 A;  4M3W A;  4OGE A;  4DMN A;  1IKX A;  4KFB A;  1NK7 A;  3DLG A;  1LWC A;  1BQM A;  3LDS A;  1YTA A;  4DTM A;  5HLF A;  4CEE A;  4I7F A;  4JS5 A;  1JLA A;  4DTJ A;  4HCC A;  4ID5 A;  1L3S A;  4RW6 A;  4BWM A;  4DU3 A;  3PO5 A;  3NGI A;  1XHX A;  2ETJ A;  4H4M A;  4CEA A;  3VQ5 A;  1U49 A;  4Z4C A;  1QSY A;  2HHW A;  1CXU A;  3QNO A;  3OS2 A;  3ZSY A;  3O4N A;  1NJW A;  3SQ2 A;  4FZZ A;  3L3V A;  3M8Q A;  1LAV A;  3DYA A;  4CIG A;  4AIL C;  3QES A;  4C8L A;  1NKE A;  1HYV A;  2DFF A;  1CXQ A;  4C8M A;  4KRF A;  1QQC A;  4JLH A;  4CEZ A;  4I2Q A;  3VQ8 A;  3OYD A;  3NGZ A;  3K5M A;  3HP6 A;  1RDC A;  1S1T A;  1JL1 A;  3LP0 A;  3VQE A;  5J2Q A;  3LP3 A;  1L3V A;  4NCA A;  1JXE A;  2YNF A;  4DS5 A;  1QE1 A;  1S1V A;  3I0S A;  4C8K A;  1QTM A;  3HT3 A;  3KK1 A;  1J53 A;  1KLM A;  2KW4 A;  4F2S A;  4IDK A;  3CYM A;  3DOL A;  4L8R B;  3K58 A;  3SV3 A;  4FM1 A;  1TVR A;  4K8X A;  3G0Z A;  3ZSQ A;  3ASM A;  1YT3 A;  3AVM A;  3VQA A;  1RBR A;  3AVH A;  1JLF A;  2VWK A;  4DG1 A;  4DTU A;  4E7J A;  1I39 A;  3K5O A;  3AVC A;  1KFS A;  4CF2 A;  3NFA A;  4OGC A;  2GV9 A;  4W5O A;  5FDL A;  2YNI A;  3L2U A;  1REV A;  2G8V A;  1LW0 A;  2HNY A;  3HPH A;  4FXD A;  3ISN C;  3KLE A;  1HPZ A;  1KSP A;  4Z4I A;  3B6P A;  2XRI A;  1HNI A;  3E01 A;  4OKK A;  2VG5 A;  3LAL A;  4YFU A;  2W42 A;  3PX6 A;  4H8K A;  4N76 A;  3OJS A;  4DFJ A;  1CZB A;  1BIS A;  1TAQ A;  2PYL A;  4KRE A;  3LZJ A;  2G8I A;  4PUO A;  1KVA A;  1IKY A;  4N5S A;  4LD0 A;  3TAE A;  3VQC A;  4O4G A;  3DLE A;  4DQQ A;  3P5J A;  3VQ4 A;  3HVR A;  1NK6 A;  3CQ8 A;  3KJV A;  4FZX C;  3SNN A;  4KPY A;  1LW2 A;  4BE0 A;  4M3R A;  2YNG A;  3V81 A;  1RBS A;  4OJR A;  2DTU A;  5SWM A;  3AV9 A;  3I0R A;  4M41 A;  1JXB A;  4E7K A;  3PY8 A;  1L5U A;  2HHT A;  1XWL A;  4FJG A;  3KKR A;  1L3U A;  2P1J A;  4NCG A;  2O4G A;  3F73 A;  1J9A A;  1WSE A;  4B9V A;  1S1W A;  3HVT A;  2XO7 A;  4OPK A;  2ZE2 A;  1TKD A;  1K6Y A;  1RDD A;  3QIN A;  2YKM A;  3V4I A;  3NAE A;  4CK2 A;  4QCL A;  4OKE A;  3V6D A;  4DLG A;  3HPG A;  4FLY A;  2EHG A;  4DF8 A;  1RT7 A;  5HRP A;  3OS1 A;  3CFR A;  3D0P A;  3S3M A;  4O0I A;  2QKK A;  2G8F A;  2BGG A;  1WSH A;  1FKP A;  4O5B A;  4FM0 A;  4HUG A;  3KLI A;  3V1R A;  3ZSW A;  1GOC A;  3K2P A;  3NF8 A;  4ELV A;  2OPR A;  2JGU A;  4KV8 A;  5DMR A;  3L2Q A;  4HHT A;  1NOY A;  4KHU A;  3IS9 A;  3ZSR A;  3RR7 A;  2YKN A;  3AA5 X;  3P1G A;  2G8U A;  5CZ2 A;  4XIU A;  2B6A A;  4F3T A;  4KHW A;  4C8N A;  4FJM A;  3OYA A;  2ITG A;  4OVL A;  1DTT A;  3OVN A;  4MQ3 A;  1T03 A;  1NK8 A;  1VRU A;  4K8Z A;  2IC3 A;  1T8E A;  4FJN A;  3G10 A;  3KKS A;  5KI6 A;  1U45 A;  1QSS A;  3ITH A;  3LAK A;  3NF9 A;  3JYT A;  2P5O A;  3TAN A;  1S9G A;  2BE2 A;  4DTR A;  3ZSO A;  2D5R A;  1D9D A;  2HHX A;  1TAU A;  3QEI A;  4KHY A;  1RDB A;  4CJK A;  2Y1I A;  2HND A;  2X78 A;  3NHG A;  1HYZ A;  4FLV A;  4DTP A;  3L8B A;  1XI1 A;  4CF8 A;  1WAF A;  3ULD A;  4DQR A;  1EX4 A;  4AHC A;  4ZTJ A;  1X9M A;  4FK2 A;  5SZT A;  4AHR A;  1SV5 A;  3SYZ A;  5JS2 A;  4CEO A;  3K57 A;  1NK4 A;  1IG9 A;  3KK3 A;  3SV4 A;  3NF7 A;  4CIF A;  1SUQ A;  3M8S A;  3CG7 A;  5HRR A;  3QO9 A;  3DRR A;  1BHL A;  4NYF A;  4O0J A;  4AHU A;  4CGI A;  3NH2 A;  4H4O A;  5DK5 A;  3LWM A;  4E3S A;  3VQQ A;  4J2A A;  5FRN A;  4PY5 A;  3QIO A;  4Z4H A;  1FKO A;  4DSI A;  3AVK A;  2IOC A;  4PA1 A;  4M3U A;  4I9Q A;  1GOB A;  4KKO A;  2G8K A;  2YHB A;  4LH5 A;  2F96 A;  4FLX A;  4B08 A;  1RT3 A;  2HW3 A;  4NCB A;  2ZQB A;  2HB5 A;  4JS4 A;  2HVI A;  3AVB A;  5KTQ A;  2RN2 A;  4HUE A;  3O3H A;  1JLG A;  5J1E A;  3C95 A;  1C1B A;  2P51 A;  3ZT0 A;  1BCO A;  4AHV A;  4CK3 A;  3MEG A;  2R7Y A;  4DTS A;  2RPI A;  3V1Q A;  1C0U A;  1S6P A;  3V1O A;  2OZS A;  4F8R A;  5T7B A;  2BDP A;  2OYQ A;  1GOA A;  3AO1 A;  1T05 A;  1ZBI A;  4F2R A;  1O1W A;  4IFY A;  1RIL A;  4PQU A;  1VRT A;  3RMD A;  2AJQ A;  3LAN A;  3BDP A;  4AHT A;  4DSL A;  3V9Z A;  1NKB A;  1BQN A;  1JLB A;  2EX3 A;  3KLH A;  3QET A;  4EP5 A;  2HHV A;  2RKI A;  3IG1 A;  4DLE A;  3TAG A;  3MED A;  4KTQ A;  1RT2 A;  1A5W A;  4M3Z A;  3FFI A;  1BCM A;  3VA3 A;  4LH4 A;  1SL1 A;  4KTW A;  4FJ8 A;  5J2P A;  1HMV A;  1HQE A;  2HNZ A;  1WSI A;  2WOM A;  3DOK A;  3QLH A;  3WNH A;  3B6O A;  3L2V A;  3OYC A;  1IH7 A;  3NGY A;  2X6S A;  3CFO A;  2WON A;  4ELU A;  2B4J A;  1RDA A;  4ZHR A;  3K5N A;  4DS4 A;  3SUN A;  1F21 A;  1UOC A;  3HXM A;  1CZ9 A;  3L3U A;  2PYJ A;  1RNH A;  1TKZ A;  3DLK A;  2FBV A;  3OYE A;  4E7H A;  3TAQ A;  5D3G A;  1U04 A;  3ALY A;  3RRH A;  1S1X A;  4RW9 A;  1I3A A;  4JRQ A;  1VSM A;  4CGH A;  2FBX A;  1RTJ A;  1ASW A;  4CED A;  1RT4 A;  1TKT A;  3SUO A;  1SKW A;  1FK9 A;  3O3F A;  1UA0 A;  4FCY A;  4Z4E A;  3AVA A;  2OPS A;  2KFZ A;  4DQS A;  3TAF A;  5JS1 A;  1A5X A;  1BIZ A;  4Q0B A;  4CFD A;  3AVI A;  4FJL A;  4Y1D A;  4W5N A;  1ZBU A;  1ASV A;  3SUP A;  3OYB A;  3P83 D;  1RBV A;  3VQP A;  5KRS A;  2XHB A;  2PY5 A;  3IRX A;  4LSN A;  4CF1 A;  3C6U A;  1HQU A;  3M8R A;  1QS4 A;  1KLN A;  4DU4 A;  2G8W A;  3RWU A;  3MEC A;  3AA2 A;  2KQ2 A;  2OPP A;  2Q3S A;  1TGO A;  4CGD A;  2FBY A;  4HVJ A;  3SPY A;  4B3O A;  3PO4 A;  1TK0 A;  5I42 A;  5CY4 A;  4BWJ A;  2GUI A;  4OPJ A;  2OA8 A;  3NH1 A;  4CF9 A;  3MAQ A;  3CFP A;  1QHT A;  4E19 A;  1HRH A;  3D45 A;  2IDO A;  4KHS A;  4TSX A;  1X9W A;  2IS3 A;  4DSE A;  3OYF A;  3QIP A;  1VSH A;  1QSL A;  2XY5 A;  2A1R A;  4CF0 A;  4CJV A;  4O55 A;  4YNQ A;  3AO3 A;  1NOZ A;  4N47 A;  4E89 A;  4Q5V A;  1Q9X A;  3HM9 A;  4AH9 A;  2IGI A;  4CHP A;  3V9S A;  4F3O A;  3AA4 A;  4KHN A;  2HVH A;  3LPT A;  3EY1 A;  1VSL A;  1VK0 A;  4IG0 A;  1IKW A;  3DLB A;  4W5R A;  1EXQ A;  4MFB A;  4CEB A;  5HRN A;  1XHZ A;  1B92 A;  5KGW A;  2OZM A;  3NE6 A;  3S9H A;  1IKV A;  4BDP A;  1W9H A;  2KZM A;  4CHO A;  4BAC A;  3PUF A;  4KAZ A;  3RRG A;  4E0D A;  4CEF A;  1C0T A;  1RT6 A;  3VQ6 A;  3RMA A;  3KD5 E;  1NJX A;  2BAN A;  4CES A;  1LWF A;  4OLB A;  2DFH A;  4DU1 A;  4B8A B;  3LAM A;  5CZ1 A;  1S5J A;  2G8H A;  4CJF A;  4FJ9 A;  2HHU A;  1WLJ A;  2XY8 A;  4CEQ A;  4M45 A;  5CYM A;  4CGF A;  1BI4 B;  1S6Q A;  4G1Q A;  3WNF A;  4EP4 A;  4ZTF A;  3MEE A;  4Z4G A;  1SL2 A;  3WNG A;  3K59 A;  3MXJ A;  1C6V A;  1VSE A;  2Z1H A;  3HPO A;  3VA0 A;  4FLU A;  4CFA A;  3S3O A;  4Z4F A;  3V9U A;  4EZ6 A;  4HUF A;  4CJ3 A;  1VSD A;  3OYL A;  4BDY A;  1Z26 A;  3KLG A;  3QEP A;  4J2D A;  2GBZ A;  2HMI A;  2YNH A;  1J54 A;  5HP1 A;  2QXF A;  3T19 A;  4KTZ A;  1KFD A;  1NKC A;  1U47 A;  4FK0 A;  1VSJ A;  1WN7 A;  3AA3 A;  3LPU A;  4DQI A;  4N41 A;  4CJL A;  1BGX T;  3HYF A;  3RTV A;  4OLA A;  2QKB A;  4DFM A;  2D0B A;  4QAG A;  1RBU A;  2YV0 X;  1RTH A;  1D9F A;  4DSK A;  4FJH A;  3AVL A;  3F9K A;  2OPQ A;  2Z1I A;  3RR8 A;  1RT5 A;  5K14 A;  1RBT A;  2HHQ A;  3ZSX A;  3ZT3 A;  5HRO A;  3HO1 A;  3HJF A;  3DLR A;  4LSL A;  4FZY A;  4B9M A;  4PWD A;  1KRP A;  3ZT2 A;  4Y1C A;  1SKS A;  3OY9 A;  1Q9Y A;  1NK5 A;  3SCX A;  4FLZ A;  2RF2 A;  3KLF A;  3DMJ A;  4FVM A;  1SL0 A;  1IO2 A;  4B9S A;  3QNN A;  4CJR A;  4BDZ A;  3U6F A;  3PX0 A;  3SQ1 A;  3OYJ A;  5FRM A;  4CJU A;  3ZT1 A;  1WSF A;  3O3G A;  3C94 A;  1U4B A;  1ZYQ A;  3O4Q A;  4M3Y A;  4E7L A;  3CM5 A;  4RW7 A;  1ITG A;  4JRP A;  1SKR A;  3OYG A;  2F8T A;  3RMB A;  4KB0 A;  4FW2 A;  4ELT A;  4W5Q A;  3NH0 A;  2Y1J A;  2E6L A;  1KCF A;  3VQ7 A;  2O4I A;  1FXX A;  4B9L A;  1WNS A;  2VWJ A;  4B9T A;  3LP2 A;  3ZSV A;  3VQD A;  1X9S A;  1U48 A;  2X6N A;  4KB1 A;  4DFK A;  4GMJ B;  4GW6 A;  4DF4 A;  4FJI A;  5C25 A;  3SPZ A;  3AO2 A;  3OYI A;  1JKH A;  4DSJ A;  1WSJ A;  1TK8 A;  4NYN A;  3NCI A;  4FJ7 A;  4ID1 A;  3TI0 A;  3K5L A;  1NK0 A;  4DQP A;  2YHA A;  2FC0 A;  4I2P A;  3T3F A;  3SI6 A;  4CHQ A;  3HP9 A;  4DSF A;  1UAX A;  4M3X A;  1X1P A;  2JLE A;  1EP4 A;  1C1A A;  4HTU A;  2F8S A;  4CE9 A;  3AVJ A;  3LZI A;  4KO0 A;  1RT1 A;  4GVM A;  4W5T A;  5J2M A;  4DWI A;  1DLO A;  4IKF A;  4CJS A;  1TL3 A;  3QER A;  3TAB A;  4B9N A;  4FJJ A;  1S9E A;  2LSN A;  4M42 A;  4FK4 A;  3QEV A;  4LY7 A;  4CJW A;  3JSM A;  1T7P A;  2PZS A;  1LWE A;  4Z0U A;  4DTN A;  4N56 A;  4KI6 A;  4CJT A;  3DRP A;  3HL8 A;  5KRT A;  4CHZ A;  1XC9 A;  2IAJ A;  3MXM A;  1N6Q A;  3HK2 A;  4FYD A;  1YVU A;  5J2N A;  2KFN A;  3U3Y A;  4DTO A;  4CEC A;  3A2F A;  3MXI A;  1RCH A;  3DI6 A;  4FW1 A;  1EKE A;  4BE1 A;  1LAW A;  3NBP A;  1HJR A;  3NF6 A;  2D0C A;  3V9W A;  5I3U A;  1CLQ A;  1RTI A;  5E41 A;  3QEW A;  4DFP A;  4KHQ A;  3SQ0 A;  4CJ4 A;  4RW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...