3VQQA

Hiv-1 integrase core domain in complex with 2,1,3-benzothiadiazol-4-amine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
144
Chain Sequence
b'SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYNPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POL polyprotein
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
total genus 53
structure length 144
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqqA00
4CK2A 3KD5E 3BDPA 2OPQA 4IG0A 1KSPA 4DFKA 3IRXA 3G0ZA 1A5WA 3OS1A 3OYFA 3I8DA 4WE1A 4XIUA 4DTOA 1S1WA 2G8FA 3OJUA 1EKEA 4CJVA 2OYQA 3PY8A 4CIEA 3DI6A 4B9UA 4DS5A 4FLZA 4DTSA 4KTZA 4DTMA 3NHGA 2BE2A 1J53A 1FKPA 2XY6A 4ICLA 4Z0UA 1LW0A 3ZT0A 4FK0A 4Y1CA 1L3UA 4K8XA 3PO4A 1JLFA 4KB1A 3TABA 3DYAA 3C6TA 2GUIA 1QS4A 3PUFA 4CJLA 3WNEA 1ZBFA 1BCMA 4JRPA 2HMIA 4CHQA 4FCYA 5FRMA 1HJRA 3NBPA 1WSJA 2X74A 3D0PA 4KFBA 1IG9A 2KZZA 2E6MA 2VG5A 4CFAA 2IS3A 1XC9A 4EZ9A 4I9QA 1HQUA 1S6PA 4FJ9A 2YNFA 3QNOA 4M3TA 3JYTA 1IKVA 1T03A 1HYZA 1JKHA 2RKIA 2G8HA 1KFDA 3ZSQA 1I3AA 3LP1A 4GMJB 2RN2A 1EETA 4DMNA 2Q3SA 2VWKA 4ID5A 3LWMA 1NK5A 4KHSA 3RRGA 4B8CA 3VQ7A 4NYNA 5CYQA 3OYIA 4ELVA 5JS2A 4Z4CA 3OYHA 5KI6A 4KTWA 1RT5A 4IG3A 4CJ4A 1C0TA 4M3XA 1RT2A 1IO2A 4C8MA 2PZSA 2Z1JA 1QE1A 4EP5A 3SI6A 2P5GA 3O3GA 2YNHA 3SQ4A 3JSMA 4OLAA 1F21A 4OJRA 3M8RA 1JLGA 1B92A 4KRFA 4DSEA 2HHXA 2EHGA 1S9EA 1KVCA 3V1OA 2OA8A 3AO4A 1VSFA 4LSLA 3VQ9A 1I39A 1UA0A 1O1WA 4DTXA 3H08A 3LANA 3MXJA 4OPJA 3AVBA 4RW6A 1UOCA 3ALYA 3MAQA 4K8ZA 3DLKA 1SKRA 4B3OA 4ZTJA 1T05A 4N76A 3O3FA 1SL1A 4FM0A 4F4KA 3AA3A 1RTHA 3ZSXA 4CEAA 1HYSA 3NH2A 1K6YA 1WSHA 3S3NA 1Q9XA 3MEDA 5HLFA 3KLEA 3HVRA 1EXQA 4FW1A 2YKNA 1WAFA 2FBTA 1TV6A 3AVNA 1VSEA 4CJEA 3AVKA 3RMDA 1KVAA 5HRRA 3O3HA 1TK0A 3QNNA 3AVLA 3DLGA 4FLUA 3RWUA 3OYBA 1C0MA 2D0AA 2ETJA 1FKOA 5KRTA 3EZ5A 3LZJA 2YNIA 1SV5A 2NUBA 2FBYA 4JS5A 4DTNA 4HCBA 5J2QA 4M41A 3VQ8A 4BE0A 4MFBA 3AA2A 1JLBA 3V4IA 4F2SA 1S5JA 1A5XA 3DOLA 4DSFA 1J9AA 3KLGA 1ASUA 4DF8A 5JS1A 2GV9A 4M3YA 3V9ZA 2F8TA 4J2BA 2VG6A 1RT4A 1SUQA 3OYEA 5HROA 3THVA 3A2FA 2LSNA 1RDBA 3AO2A 1NK7A 3RMBA 4Z4FA 5C24A 4BACA 1Z26A 3TR8A 3V9XA 4FZZA 4F3OA 5HRSA 1EX4A 4FLWA 4DQSA 2HHUA 1DTTA 1NKBA 3DLRA 2KTQA 3T3FA 3U6FA 1VSDA 1VSKA 3M8SA 4J2DA 3ISNC 1REVA 2E4LA 4DTRA 3NF8A 3I0RA 4AHSA 4FLVA 3SZ2A 4FZXC 1HPZA 2BGGA 2FC0A 4DF4A 4TSXA 2HVHA 3PX0A 4O55A 3WNFA 1JL2A 1GOAA 1XHXA 4FW2A 4RW7A 5CZ1A 4E89A 1LWFA 3B6OA 4F3TA 2QKKA 3C6UA 4B9NA 2YV0X 3HT3A 3ITHA 3SQ0A 3HP6A 4Z4EA 3DRRA 2O4GA 2IC3A 3NAEA 1QTMA 3V9SA 4O4GA 1IKWA 2XO7A 1LV5A 1JXBA 4W5QA 4DSKA 3V81A 4BDZA 3BGRA 3PX6A 2WONA 4C8LA 3K5LA 2XY7A 4J2EA 3PV8A 1TVRA 1L3VA 3ZT4A 5HRPA 4CE9A 2X6NA 5DMRA 1T7PA 1QSYA 4PQUA 1RNHA 1RTIA 3NE6A 2D0CA 4M45A 1ZBHA 4DQRA 3FFIA 1NJXA 4QAGA 1U04A 4LH5A 3QEIA 4W5RA 4CJFA 1RTJA 2HNDA 1MU2A 1S6QA 4B8AB 2E6LA 3HPOA 3RMAA 3VQQA 3ZT1A 3P83D 3SUOA 5J1EA 1KVBA 3MXIA 3VQEA 2DFFA 4IDKA 4CK1A 5J2MA 3OYJA 2Y1IA 4CGGA 3WNHA 3HK2A 4AHTA 4KB0A 2HHVA 1S9GA 2B5JA 3VQ6A 4HHTA 4KHUA 1JLCA 3OYKA 1T8EA 4FYDA 4CEEA 1BHLA 3TANA 2VG7A 4AHCA 3OYGA 3RRHA 3V6DA 1NK0A 3CYMA 4KV8A 4KI4A 1NJYA 1VSMA 3VQDA 5E41A 3DLHA 4FJLA 3LPTA 4M3ZA 4FM1A 3SNNA 4PWDA 1LWEA 1LAVA 3DRPA 4HUEA 4BE2A 4DQPA 2G8IA 3KD1E 3KLHA 1YTUA 4OLBA 4W5OA 4IKFA 3OYLA 4HUGA 1UA1A 1U45A 3SCXA 4CEOA 2X6SA 1JLAA 3QEWA 1TKTA 1XI1A 3PX4A 4E7KA 1L5UA 2G8WA 2FBXA 1FXXA 3LDSA 3CQ8A 4B9TA 1HQEA 4QOZB 3HP9A 3L2VA 4CF2A 1TAQA 1UAXA 4HCCA 4FJGA 1WSEA 4CK3A 5T7BA 4CJRA 3SUNA 1S1XA 4DQIA 4KHQA 2Y1JA 4DU3A 2B6AA 4RG8A 4YNQA 1TAUA 4DTJA 1X9MA 1WLJA 4DSJA 4HTUA 3QIPA 2IDOA 2RPIA 1RDDA 3TAGA 3OJSA 4BDPA 3HSTB 1RDAA 4ID1A 4BWMA 3TAPA 2YHBA 3KK1A 2OPPA 3UIQA 1S1UA 3O4NA 3IS9A 1C1CA 3L3UA 3M8PA 4RW8A 2HNZA 3LP0A 3CFOA 1Y97A 4FJKA 3F9KA 4KKOA 3NGZA 4FVMA 3E01A 3ZSOA 3AVFA 4DS4A 1W0HA 2DFHA 3TARA 4N41A 2ZQBA 3P1GA 4O0IA 3ZSWA 1XHZA 1U49A 1NK4A 2OPRA 4OVLA 4B9MA 3OVNA 5C25A 4M3UA 2DFEA 3NF6A 3P5JA 1ZBLA 5DK5A 3MXMA 4DLGA 4E7JA 4FK4A 1VSLA 2HW3A 3DOKA 3WNGA 4KHYA 1B9FA 4L8RB 2QKBA 4FLXA 1KTQA 1RT6A 5J2NA 4LD0A 4CERA 2AJQA 3AVGA 4CJQA 1CLQA 1X9SA 2JLEA 4FZYA 3HYFA 3QERA 3K58A 3U3YA 4HUFA 4CHOA 4E19A 4C8KA 5SZTA 4DTUA 1NKCA 3DMJA 4N47A 3AVHA 2KFZA 1S1TA 2ATQA 4NCAA 4NCGA 2D5RA 2WOMA 3AVCA 2PYJA 3SUPA 4HVJA 2IAJA 2P51A 5C42A 4C8OA 4CIGA 3NH0A 3S3OA 1RILA 4O44A 4FJMA 4B08A 1NOYA 3KTQA 4M42A 3CM5A 1BISA 4N5SA 3VA0A 3TAQA 3AVMA 3MEEA 3ULDA 3AA5X 2ITGA 3L2RA 1NJWA 4CJSA 1Z25A 4IBNA 4CCHA 4DLEA 4KHNA 2OZMA 4H4OA 4Z4HA 3VQCA 1KCFA 1KLMA 2OPSA 3DM2A 3TI0A 1U48A 1SKSA 3NF9A 4ZHRA 1YVUA 4DWIA 4KHWA 5D3GA 4RW9A 3AVAA 4CGFA 1FK9A 3OY9A 4E7HA 4O0JA 1BL3A 3KLFA 3AO1A 1YTAA 3RTVA 3SPZA 3ZSRA 1G15A 1C6VA 4CEBA 3G10A 4O5BA 4DQQA 2HHQA 3K5NA 4CFBA 5FROA 3CFRA 2QK9A 3M8QA 1VSIA 3VQAA 4CESA 1SL2A 4ELUA 2DY4A 4AHRA 3IG1A 4CJUA 3DLEA 4LSNA 4OGCA 4CGIA 4CGHA 2W42A 4BDYA 1ITGA 1JLEA 3L3VA 4NYFA 4DSIA 2HHTA 1WAJA 3D45A 3NGIA 2IOCA 4CF8A 4CJPA 1NOZA 1HYVA 2X78A 4EP4A 4GW6A 2IGIA 3HVTA 5HRNA 1L3SA 3VQ4A 1Q8IA 3CG7A 1TKXA 1C1AA 1WSIA 1C1BA 4Q0BA 4CFDA 1RBVA 3QIOA 3QINA 4JRQA 2RF2A 3KK3A 2XY5A 1B9DA 3F73A 1LW2A 4C8NA 1BGXT 4I2PA 3SQ2A 4IFVA 3OYCA 3ASMA 4KPYA 4QCLA 4FJJA 3QLHA 4CIFA 3ZSYA 4OKKA 4AHVA 4CJKA 3QEXA 3SPYA 3L2QA 3NFAA 1ZBIA 4B9LA 4E3SA 2QXFA 3RR7A 5KRSA 1J54A 3OYMA 1CZBA 4FXDA 4CF9A 1RT7A 2BANA 4RW4A 3OS2A 2YNGA 3DRSA 2KW4A 2ZE2A 2HB5A 2P1JA 4CHNA 1ZYQA 3OYDA 3LP3A 3EYZA 2HHWA 1Q9YA 2G8VA 2A1SA 4KREA 2OZSA 4CGDA 4F2RA 1CZ9A 3ZT2A 3V1RA 3VQ5A 4R5PA 3L2WA 4KTQA 4Z4IA 1QQCA 1DTQA 4I7FA 4PUOA 3TAFA 5CZ2A 4FLYA 1SL0A 2O4IA 2HVIA 2VWJA 4E0DA 1VSJA 3QESA 1WN7A 2XRIA 2B4JA 1HRHA 1D8YA 4CJ3A 3LZIA 4FM2A 2GBZA 3O4QA 4CEDA 4OGEA 4H8KA 3SQ1A 3RMCA 4AHUA 3DLBA 2D0BA 4CEFA 4DSLA 3C94A 3QEVA 5KTQA 4FK2A 1N5YA 3K57A 3TWHA 1IKXA 3VA3A 5CY4A 3SJJA 1LWCA 3KIOA 3OS0A 1TKZA 1TK8A 4CHYA 3OYAA 1BI4B 2EX3A 2HNYA 3SV4A 1UWBA 3V1QA 4FJ7A 1A5VA 4E7IA 2PYLA 1HMVA 4FJ5A 1RT3A 3NDKA 3VN5A 2F96A 4KAZA 1VSHA 4DG1A 3SYZA 3S9HA 1TK5A 3I0SA 2G8KA 3MEGA 3LWLA 3IAYA 1QHTA 3K5MA 4UQGA 2Z1GA 3QEPA 3NF7A 1D9FA 2G8UA 2PY5A 3RR8A 5FRNA 4DFPA 1ZBUA 3S3MA 1ASVA 4KI6A 4KO0A 3T19A 2XHBA 4ELTA 5I42A 1TL3A 4LH4A 1NK9A 1DLOA 3CM6A 4OKEA 4OPKA 1KLNA 3KKRA 3MECA 4PA1A 1VRUA 1RBSA 4ZTFA 1NJZA 1KRPA 5KGWA 2DTUA 3TAEA 1QSSA 3KJVA 4JLHA 2KFNA 1GOBA 3CFPA 1SKWA 3U3GA 2YHAA 3KLIA 3NGYA 4CEQA 4F8RA 4E1MA 3HXMA 3OYNA 4W5TA 3HO1A 1IKYA 2ZD1A 1QSLA 1J5OA 4M3WA 2KZMA 3NH1A 1S1VA 3PO5A 5K14A 4CJWA 3ZCMA 4FJ8A 5HP1A 1L3TA 4MQ3A 1W9HA 5HBMA 3V9WA 1VRTA 1KFSA 2Z1IA 1JXEA 1U4BA 4DU4A 1RBRA 5EU7A 4AH9A 3V9UA 5CYMA 4E1NA 5FDLA 4CECA 4BE1A 2Z1HA 1RTDA 1RBUA 3AV9A 4OKJA 3QETA 3EY1A 3QO9A 4CF1A 3HL8A 4H4MA 4W5NA 1NK6A 1BIZA 1ASWA 4FJXA 1GOCA 3T1AA 4CFCA 2R7YA 1CXQA 1EP4A 3LAKA 1WNSA 4CF0A 4B9VA 3LPUA 4AILC 4M3RA 3AA4A 5I3UA 5SWMA 4E7LA 4I9LA 3HM9A 1BQMA 3SUQA 2JGUA 3AO3A 1TGOA 3AVJA 1CXUA 3K5OA 4CHZA 3SV3A 1RCHA 1U47A 3AVIA 1JLQA 3L8BA 4DFMA 2BDPA 3VQPA 1JL1A 4G1QA 1D5AA 3VQBA 2A1RA 1LAWA 1VK0A 1NK8A 3HJFA 1TL1A 2YKMA 4CJTA 4LY7A 3LP2A 4Z4GA 1HNIA 3LAMA 4FJHA 4PY5A 1WSFA 1NKEA 1C0UA 4FJNA 3L2UA 1X9WA 4Y1DA 1WSGA 4YFUA 1HNVA 3AO5A 4FJIA 2XY8A 1BQNA 4CEZA 2HHSA 3TAMA 4J2AA 3KKSA 4BWJA 3ZSVA 3B6PA 3HPGA 4I2QA 4DTPA 4FLTA 4N56A 2I5JA 4Q5VA 1D9DA 2F8SA 1XWLA 5KGXA 3ZT3A 1RT1A 3ZSZA 4EZ6A 4NCBA 3C95A 4GVMA 4CJ5A 4CGJA 1RBTA 3K2PA 4CHPA 1YT3A 1BCOA 3K59A 5J2PA 2FBVA 4DFJA 4B9SA 4JS4A 2P5OA 1IH7A 3LALA 3NCIA 3HPHA 4DU1A 1TKDA 4IFYA 1R0AA 1BIUA 2KQ2A 1RDCA 1N6QA 3KK2A 1X1PA 1BI4A
chains in the Genus database with same CATH superfamily
4CK2A 4LF9K 3CQXA 3I8DA 4XIUA 1S1WA 2W6LA 1EKEA 3PY8A 1HKCA 4CIEA 5C10A 4GY2B 2O8CA 2XY6A 1QVGM 1LW0A 2UXCK 3PIOL 4I6MB 4Y1CA 4K8XA 4EHTA 2O8DA 4H5WA 1QS4A 4CJLA 1M1KO 1ZBFA 1BCMA 2X74A 4FPBA 3KWGA 5AQXA 2ASOA 2IS3A 4FJ9A 1MA9B 3H45C 1T44A 1HYZA 1JKHA 1KFDA 3B8AX 1I3AA 1QHAA 5MLCQ 2VWKA 4ID5A 1NK5A 4KHSA 4JKGB 3RRGA 2YJFA 4ELVA 5BR8K 4FWKA 5KI6A 3OYHA 1RT5A 4CJ4A 1C0TA 2VQFK 4CVNE 1IG8A 1RT2A 1IO2A 4C8MA 1QE1A 2P5GA 3O3GA 3JSMA 4BC5A 1JLGA 4DSEA 1IBLK 1HKBA 3EN9A 3AO4A 1VSFA 4JK9A 5LL6Z 4LSLA 4WQ5A 1O1WA 4PL8A 3LANA 2NRRA 4ISFA 5BRFA 3AVBA 1UOCA 3MAQA 3DLKA 4B3OA 4ZTJA 1NMDA 2BH1A 1HYSA 3NH2A 1Q9XA 2UXDK 5HLFA 4MLEA 3KLEA 3HVRA 1EXQA 3AVNA 1FJGK 3AVKA 3RMDA 2JWKA 4QS9A 3DLGA 2UYTA 2BUPA 1C0MA 1FKOA 1BDGA 2YNIA 3VGKA 3BZCA 3SLCA 4HCBA 4M41A 3VQ8A 4BE0A 2ZM6K 3I8BA 5AFUH 3VF2A 4DF8A 1TUUA 4M3YA 4AM7A 3V9ZA 4LFAK 3DWLA 4U67L 2VG6A 1RT4A 3OYEA 2D0OA 4A57A 3RMBA 1NK7A 5C24A 3TR8A 4F3OA 3CHWA 3O1BA 3Q7BA 1NKBA 3T3FA 1VSDA 4J2DA 4AHSA 4FZXC 3D6RA 3PX0A 3WNFA 4FPAA 3O5BA 4YORA 4E89A 1Q81O 4B9NA 2YV0X 3SQ0A 3OA9A 3SK3A 3NAEA 1P8ZA 4O4GA 1IKWA 1LV5A 4WFNL 4W5QA 2HMPA 3V81A 1LCUA 2WONA 1NJIO 3PV8A 2WTUA 4NLBA 1YJWN 4FWNA 1OH6A 5DMRA 4PQUA 1RTIA 1U04A 4LH5A 2YX6A 5BPMA 4B3RK 2HNDA 4M7XA 4B8AB 3HPOA 4AQYK 3RMAA 4MLHA 4IDKA 2Y1IA 4CGGA 1S9GA 2QWOA 3EO3A 4HHTA 4KHUA 3OYKA 1HX1A 4IDHA 4CEEA 1BHLA 3V6DA 3CYMA 4KV8A 1JCGA 1NJYA 2P9PA 5E41A 4M3ZA 1LWEA 4DUYK 1Q18A 5LMNK 4OLBA 4W5OA 3OYLA 3FZFA 1UA1A 1U45A 2OTJN 1L5UA 4GV6A 2J4RA 4FOIA 5LY3A 5IWAK 3L2VA 1UAXA 4GV9A 1IJJA 4HCCA 4CK3A 4CJRA 4KHQA 3CCVN 4DQIA 4DTJA 1X9MA 3TAGA 3QIPA 2RPIA 1XMOK 4BRPA 5EY4A 5DM6L 1G99A 2QWPA 2UU9K 3NGZA 3FR0A 3ZSOA 3AVFA 5AZIA 1XHZA 2IVNA 1U49A 2OPRA 4OVLA 4JI6K 3OVNA 1X3MA 2ASMA 2DFEA 3NF6A 3P5JA 4H0VB 5C15A 2D4WA 1VSLA 4IEEA 4FLXA 1KTQA 5J2NA 2GX9A 4GV3A 3VOVA 4CJQA 1X9SA 3HYFA 2A40A 4LF8K 3IKMA 4E19A 5FPDA 3CC2N 3AVHA 4U7BA 2KFZA 2D5RA 4CZHA 2PYJA 2IAJA 3TPQA 4BRIA 3NH0A 4CW7B 4LFBK 1K8KA 1NOYA 3KTQA 4M42A 4N5SA 2UUBK 2ITGA 1VQ7N 3CCJN 2OZMA 4H4OA 4Z4HA 1KCFA 1KLMA 5CHIA 3OY9A 4E7HA 3WT0A 4O0JA 2P9UB 2P9LA 3RTVA 1C6VA 4CFBA 3H3NO 2UXBK 4AHRA 4CJUA 4CGIA 3IUCA 4BDYA 3CCSN 2IOCA 2H3GX 3VMFB 4CJPA 3CC4N 1NOZA 1SAZA 3AGRA 4BRMA 4GW6A 2IGIA 3VQ4A 1Q8IA 1C1BA 2QWLA 4JI0K 4B1ZA 1N32K 1ATNA 4JRQA 2V51B 1NGBA 3H1VX 3WQTA 3F73A 1LW2A 4C8NA 3TSPA 1BGXT 3O4WA 1GLCG 4QCLA 3QLHA 3ZSYA 3NFAA 4JHDA 3RR7A 5KRSA 1S22A 3CCUN 3C0BA 3DRSA 3FZLA 2IIRA 1HUXA 1I94K 4DR4K 2E88A 4AF1A 2HHHK 3VQ5A 3G6EN 4I7FA 1RDWX 4K42A 4FLYA 3ZX0A 2ZF5O 2QA4N 2GBZA 1BA1A 3SAFA 4RCHA 3VPZA 3DLBA 3CCQN 1NG9A 1SQKA 4HTLA 4E1JA 3QEVA 1GLBG 4BQZA 3SMSA 2PBDA 3VA3A 3SJJA 3OS0A 3CCRN 4JYAK 3OYAA 3PLAA 1BU6O 2HNYA 5GAEP 4OPHA 4IJNA 2OTLN 2PY5A 2JWLA 3OHRA 3T19A 2XHBA 1KC8O 5I42A 1TL3A 1NK9A 1DLOA 5AQVA 2WFBA 1YJNN 5AQPA 2O8DB 5KGWA 1QSSA 4CZMA 1GOBA 3BY5A 1SKWA 5EXWA 1Q86O 1HJOA 3FFKB 3NGYA 4CEQA 4F8RA 1XC3A 3HO1A 5M1FA 2KZMA 5K14A 4CJWA 4GKJK 3GDQA 3L6QA 4MQ3A 1W9HA 5HBMA 3V9WA 4JI2K 1KFSA 2Z1IA 4AH9A 3V9UA 2Z1HA 1RBUA 3AV9A 3AARA 4BRLA 4KHPK 3HL8A 3MX2A 2O8EA 5AQFA 3G71N 1HPMA 1XNRK 1CXQA 3TTFA 4B9VA 3LPUA 4AILC 3MX5A 3HZ6A 5I3UA 4YOXA 4E7LA 2JGUA 3ZX3A 4CHZA 1U47A 5M1KA 3SV3A 3AVIA 4DFMA 1TYQA 1NGCA 4DQ8A 4DV7K 2HBLA 1NK8A 4BRFA 2YKMA 2D0PA 4WFAL 1WSFA 1C0UA 2CH5A 4A5AA 1DEJA 1X9WA 4XH1A 5AZJA 4YFUA 3VEZA 3EE9A 2XY8A 2HHSA 3GBTA 4J2AA 3B6PA 3HPGA 2QWRA 4N56A 3FZHA 3J80O 3ZSZA 3C95A 4CJ5A 5AQYA 4M7YA 3K2PA 1YT3A 1KXPA 2P9KA 4B9SA 4RWTA 3NCIA 4R79A 4FOEA 3HPHA 4LF7K 3EE8A 4DV3K 1KAYA 2QWQA 4PKHA 1R0AA 3KK2A 3ENOA 1KQSM 5AQNA 3KD5E 2FF3B 4X62K 1N34K 2OPQA 3IRXA 3G0ZA 1A5WA 3KWIA 3OS1A 4WE1A 2G8FA 4B9UA 3R8EA 1J53A 1V4TA 1NU0A 3CJAA 3PO4A 1JLFA 4KB1A 5BRDA 2GUIA 3PUFA 2P9SA 4JRPA 4CHQA 4FCYA 1OH8A 4KH4A 3D0PA 3PSIA 1NGHA 2FXUA 2E6MA 2VG5A 4CFAA 5M1PA 1XC9A 4EZ9A 4I9QA 1HQUA 3CCMN 2YNFA 4OPAA 1IKVA 4ISGA 3U8XA 2G8HA 3ZSQA 2WBNA 4K43A 4DV4K 3VQ7A 5CYQA 4XH4A 4BRDA 5JS2A 4Z4CA 3E66A 4V19S 3CJ7A 2GTDA 3WXLA 3SI6A 1K8AO 3SQ4A 3HTVA 3JS6A 4OJRA 1B92A 2E20A 2HHXA 1S9EA 1KVCA 4DV5K 3KHYA 1C0FA 3VQ9A 1UA0A 4OPJA 3MXJA 2O8FA 4RW6A 3W0LA 4FM0A 3AA3A 3ZSXA 4CEAA 2NZTA 1K6YA 2FLOA 2P9PB 3MEDA 1NLVA 3FZKA 4L3QA 4YOUA 2YKNA 1WAFA 3R3LA 3ENHA 3O3HA 1DT9A 4RTFD 4FLUA 5KRTA 3LZJA 1OH7A 1GLFO 4DTNA 2FBYA 1JLBA 4IJAA 1J9AA 4HWIA 4Z4FA 5KQDA 1VQMN 3C6AA 1EX4A 2HHUA 4DCHA 2ZJPL 3DLRA 3U6FA 1VSKA 3M8SA 5M1NA 5AZIB 1X3NA 4DTRA 4JN4A 4FLVA 4Z94A 5AQKA 1HPZA 2FC0A 4G9ZA 4DF4A 3P39A 3DLLL 3J8AA 1M90O 1NGIA 1JL2A 4WFBL 1LWFA 3B6OA 3C7NA 5AQGA 3HP6A 4Z4EA 1QTMA 2XO7A 5ADXA 1QQMA 2VYPA 3U9DA 4DSKA 4BDZA 4BVPA 4C8LA 1VQON 3K5LA 1MWKA 1L3VA 2F9WA 5HRPA 4CE9A 2X6NA 3WUHA 1QSYA 1U6ZA 1HKGA 2D0CA 3NE6A 1K8KB 4QAGA 1KAZA 3LDNA 2QW9A 1MU2A 1S6QA 4ILGB 2QEXN 2E6LA 4JD2A 3SUOA 3P83D 5E84A 3VQEA 4CZEA 2P9LB 3MCPA 3CERA 4KB0A 2B5JA 3VQ6A 3W3DA 1T8EA 4AHCA 3OYGA 3RRHA 4DR1K 3LPTA 4FM1A 3SNNA 2YHYA 4DQPA 3OBWA 1YTUA 1YJ9N 4IKFA 4ILHA 3SCXA 1JLAA 3E9OA 1RFQA 3QEWA 3PX4A 3J81O 1HNXK 4B9TA 2E2PA 4FJGA 3IFRA 2UUCK 2Y1JA 2B6AA 1TAUA 4DSJA 4JV5K 4BDPA 5BR9A 4CD3A 4BWMA 2YHBA 2OPPA 3UIQA 4JHDB 1Y97A 4FWPA 1NNEA 3RVCA 4BRNA 2ZQBA 3P1GA 1NK4A 3ZSWA 4A2BA 5F0XA 4B9MA 1HNWK 4MO5A 4LF4K 3P4IA 3AGKA 3ZX2A 3MXMA 4FK4A 2E1ZA 4BGAA 2HW3A 4BRHA 3WNGA 1B9FA 1NM1A 4JKHA 4KH6A 3L4IA 3WEEB 3WXKA 2NNWA 4HUFA 4N47A 1YIJN 1ILYA 3MN9A 3O9RA 2ATQA 3ZEUA 1OH5A 3SUPA 5C42A 2GELA 4C8OA 3S3OA 5DM7L 1T6DA 1JJ2M 4FJMA 5CR4A 3VA0A 3AVMA 4JKCA 3MEEA 5AQWA 1NJWA 1Z25A 4IBNA 4CCHA 3TI0A 3Q7CA 1U48A 4KHWA 5C12A 4RW9A 3AVAA 3CPEA 3AO1A 1YTAA 3SPZA 3ZSRA 1G15A 3G4SN 4DQQA 3K5NA 3M8QA 3HI0A 2DY4A 3DLEA 4LSNA 4BR9A 1JLEA 4YOYA 5AQRA 3ID8A 4FWLA 2HHTA 2GWKA 5GIPA 5AQJA 4CF8A 3ATUA 5HRNA 3HVTA 4PHTX 2VQEK 2CGJA 3CG7A 1TKXA 1C1AA 1R59O 4CFDA 4B3MK 2O8EB 4FO0A 4H03B 2ITMA 5BPLA 2Q1NA 4I2PA 4BG8A 2V7YA 3OYCA 4KPYA 4CIFA 3N4PA 2A41A 3THWA 1KAXA 4JI1K 1TYQB 1ZBIA 4B9LA 2QXFA 1J54A 4PKIA 3LM2A 2KW4A 3UB5A 2HHWA 1EQYA 5AZJB 3ZYYX 2G8VA 4KREA 4BR7A 3LDQA 1CZ9A 3ZT2A 4BQLA 4R5PA 4Z4IA 1DTQA 4PUOA 3TAFA 2HVIA 2VWJA 4E0DA 3OTOK 3LZIA 3MMVA 4CEDA 2P9KB 4OGEA 5GAGP 4AHUA 1GLEG 4B1YB 1LOTB 3JAMO 1N5YA 4FWOA 1IKXA 1TK8A 4CHYA 3EL2A 3V1QA 4FJ7A 4LF6K 4E7IA 1RT3A 4BRGA 3LWLA 3IAYA 2Q36A 1ATSA 4JNEA 2FSJA 4JKEA 4DFPA 2E8AA 2WUSA 4ELTA 2HF4A 3VTIA 4LH4A 5AQIA 3THXA 1KRPA 4ZTFA 4O5FA 4FVUA 2VWBA 3M6GA 1H1VA 2P9SB 2GEMA 3KLIA 4BVOA 4W5TA 1QSLA 4DB3A 4JI4K 1J5OA 3NH1A 3OW2M 1NGGA 2YI1A 1L3TA 4B1WB 1JCEA 3CMAN 5FDLA 3O8MA 5JMVA 4JKDA 2ZWHA 2Q2RA 4W5NA 1VQ9N 5BRHA 4M3RA 5SWMA 3HM9A 1BQMA 5AR0A 1TGOA 3AVJA 3DXMA 3O1WA 4PL7A 4G1QA 2A1RA 1VK0A 3M3ZA 3K9JA 2O8FB 3LP2A 4Z4GA 4PY5A 1NKEA 4FJNA 4PKGA 2ZGYA 3L2UA 4CJ7A 2WC9A 4QS8A 1NMNA 3TAMA 4I2QA 3F9MA 4FLTA 2I5JA 2F8SA 1RT1A 4NCBA 3ID6A 1RBTA 1J6ZA 4FWQA 5LMUK 3LDPA 3CJ1A 3DJCA 3K59A 4LFCK 1Q82O 4YY3K 5AJ3K 3CJBA 4A5BA 4IFYA 1E3MA 1BWFO 3A5LC 4BR4A 2ZJRL 1X1PA 3O6WA 4JK8A 1N33K 5KPZA 1BI4A 5KPRA 3HOSA 4JAXA 1KSPA 4DFKA 5JVGL 2OANA 4DTOA 2P9NA 3EEQA 2OYQA 4DS5A 4FLZA 4DTSA 3VEVA 4KTZA 4DTMA 3NHGA 3THYA 2W41A 5B8HA 2YHWA 3DYAA 3O9UA 1VHXA 3TABA 3C7NB 2ZJQL 2HMIA 4JKAA 4DR2K 1WSJA 4KFBA 1S6PA 5KPTA 3QNOA 3JYTA 4FL9A 1T03A 4FWMA 3H3OB 3LP1A 3NMUA 4BRQA 2CGKA 3LWMA 4NYNA 3OYIA 2A42A 4KTWA 4DHYA 2Z1JA 3J7YP 1NBWA 2YNHA 5JLFA 2O8CB 4BC2A 4OO1J 3V1OA 2OA8A 4DUZK 2QWMA 4IFEA 1P90A 3VF4A 5GAHP 4K8ZA 1SL1A 3CJCA 3A0IX 1RTHA 3EKSA 1WSHA 3S3NA 3G25A 4FW1A 2QXLA 3BP8A 5A2QO 1TK0A 5TKWA 3OYBA 2ETJA 1SV5A 2NUBA 5J2QA 1MDUB 5BREA 4F2SA 1S5JA 3KLGA 5JS1A 2F8TA 4H5RA 5HROA 3THVA 2LSNA 1RDBA 2CH6A 2IVOA 1Z26A 4BREA 3V9XA 3CMEN 2EWSA 3MK6A 4FLWA 4DQSA 3QICA 3S41A 2E4LA 3HSCA 2GWJA 4H5NA 4TSXA 2HVHA 5AQZA 4O55A 5FLXO 1XHXA 4FW2A 4WF9L 4F3TA 2QKKA 3I33A 1BO5O 3HT3A 3ITHA 2O4GA 2IC3A 1U2VA 3V9SA 2VCPA 1JXBA 3DXKA 5LJWA 4MDAA 3UKUA 2HSTA 4GVEA 3ZEUB 1TVRA 1NJXA 1IBMK 2P9IA 2Q0RA 4W5RA 4BROA 3VEOA 2FSNA 1EO1A 3TTDA 3VQQA 3ZT1A 1KVBA 3MXIA 5J2MA 2DFFA 2IVPA 3OYJA 3WNHA 4AHTA 5FPMA 3O9QA 4CZIA 4FYDA 3DAWA 2VG7A 3CCEN 4KI4A 5AQTA 1VSMA 3DLHA 4FJLA 4PWDA 5BN8A 3DRPA 4HUEA 2G8IA 3J7AP 3UKRA 3WXMB 5AFUA 3BF3A 3QBWA 5AQOA 5BN9A 4HUGA 1RGIA 1N36K 4CEOA 2X6SA 3SJHA 1XI1A 2G8WA 2W6KA 2FBXA 3CQ8A 4QOZB 4CF2A 1WSEA 4H5TA 4X64K 3SUNA 3OBYA 4DU3A 2NRWA 4HTUA 3H46O 2IDOA 1RDDA 3OJSA 1RDAA 4ID1A 2I7NA 4C23A 5KQ8A 3R1XA 3THWB 3D2EA 1S1UA 3O4NA 3IS9A 3M8PA 4DV1K 1XUPO 2HNZA 3F9KA 4NXMK 4IOCL 3E01A 4DS4A 3TARA 4N41A 4M3UA 1NGFA 3O9TA 3HM8A 3M5RA 1ATRA 3BEXA 4DLGA 3A5MC 1GLDG 3DOKA 3BF1A 4KHYA 3CF5L 1VQKN 1J5EK 4LD0A 2AJQA 3AVGA 4IZ9A 2JLEA 4FZYA 3QERA 2F4VK 4DTUA 1NKCA 3DMJA 1S1TA 4NCGA 3AVCA 5AQQA 3AAQA 2YHXA 3SMPA 1RILA 4O44A 2FSKA 1VQ6N 4B08A 4H0PA 3CM5A 3O08A 3TAQA 3VTHA 3ULDA 4NB4A 4CJSA 3QB0A 4KHNA 2NLXA 2OPSA 3DM2A 4DWIA 3AAPA 3NF9A 3L4QA 4C1NK 3THXB 3CPWM 4CEBA 2HHQA 3O80A 1OVQA 5FROA 3CFRA 4CESA 5IT9O 5E26A 1SL2A 4ELUA 4CGHA 1ITGA 3L3VA 2F7TA 1WAJA 2O8BA 3ATVA 2NRXA 4BRAA 1HYVA 2X78A 4EP4A 3QFUA 3P38A 1L3SA 1WSIA 3O9SA 4Q0BA 1Z6RA 1VQ4N 1B9DA 1BA0A 4A2AA 1T6CA 2OCEA 3T1HK 4BC3A 3SQ2A 4IFVA 3ASMA 2YCHA 3DXMB 3TTCA 4AHVA 1E4FT 4B3TK 3L2QA 4BC4A 4QS7A 4NXNK 4E3SA 4FXDA 4FWRA 1RT7A 2YNGA 2ZE2A 3ULEA 2P1JA 1ZYQA 4DV2K 4A62A 3EYZA 4B1UB 2W40A 1X9JA 3VERA 2OZSA 2BTFA 3L2WA 5FPNA 1QZ5A 3ZETA 1D8YA 3QESA 1WN7A 2XRIA 3CCLN 4CJ3A 3CXCM 4CZGA 1NGDA 4YDUC 5EX5A 4H8KA 5BPNA 1TUYA 3VEWA 3K0SA 4CEFA 4DSLA 3C94A 3IMXA 1VQ5N 3PIPL 3K57A 4FSVA 3TWHA 3H6EA 5CY4A 1LWCA 3KIOA 1WBBA 1BI4B 2EX3A 4YOTA 3SV4A 5M1OA 1YUWA 1ZXOA 1A5VA 1HMVA 4FJ5A 3NDKA 4IO8A 2F96A 3D2FA 1VSHA 3VN5A 3SYZA 2G8KA 4KAZA 3I0SA 2P9NB 1QVFM 4UQGA 1D9FA 3NF7A 3RR8A 4CBXA 1ASVA 3THYB 3S3MA 4NLCA 1WUAA 4OKEA 2NRVA 3CM6A 3WQUA 3MECA 1NJZA 1RBSA 3KVGA 3KJVA 4YHHK 3U3GA 3OYNA 4M3WA 1S1VA 3F2KA 3ZCMA 4FJ8A 5HP1A 2A3ZA 1VRTA 4CI6A 3MDQA 5EU7A 5CYMA 1W97L 1RTDA 3VETA 1RDUA 4DR6K 4OKJA 3QETA 3EY1A 4CF1A 2V52B 1NK6A 4O8KA 4ISEA 1GOCA 4BGBA 3T1AA 4CFCA 5C2FA 2R7YA 3E9PA 1WNSA 4CF0A 1SS6A 3I55N 2E5LK 4YDUA 4I9LA 2F9TA 5F2RA 3SUQA 3VGMA 1RCHA 1K73O 1Z05A 2RHKA 2BDPA 3VQPA 1JL1A 3VQBA 3HJFA 4CJTA 4WCEL 1VQLN 4FJHA 1WSGA 4AM6A 1HNVA 3AO5A 4FJIA 4CEZA 3CIPA 4BWJA 1Q7YO 3ZSVA 4DTPA 4Q5VA 1D9DA 1XWLA 4EZ6A 1C0GA 4BR0A 4CD1A 2NRHA 4CHPA 5J2PA 1IH7A 5AQMA 5AQSA 4DU1A 1TKDA 2KQ2A 2NRZA 2KLAA 4H0OA 1XMQK 1NGEA 3BDPA 4H0XB 4JI7K 4IG0A 4JI8K 3LM9A 3OYFA 3CETA 3OJUA 4CJVA 3DI6A 1IBKK 3T69A 4DV0K 1WB9A 4YOWA 2BE2A 4EIAA 1FKPA 5GINA 2E2OA 4ICLA 4Z0UA 1BOTO 3ZT0A 2VGNA 4FK0A 3L0QA 1L3UA 3RSEA 2ASPA 3FLCO 3C6TA 1XQSC 5FRMA 3WNEA 1T3VA 1HJRA 3NBPA 1IG9A 1BG3A 2KZZA 1U2VB 2RE2A 4IEIA 4M3TA 2VGMA 3DXKB 4EHUA 2RKIA 3AY9A 3UKUB 4GMJB 2RN2A 1EETA 4DMNA 2Q3SA 2HBJA 3VGLA 5ADXH 4B8CA 4IWVA 4O8UA 4IG3A 5I9EB 4M3XA 2P9IB 2PZSA 4EP5A 4A61A 4OLAA 1F21A 4K41A 3M8RA 3R6MA 4XEIA 4KRFA 5JLHA 3VF6A 2EHGA 2V7ZA 1VQNN 1E4GT 1I39A 4DTXA 3TSQA 3H08A 3NVMA 3ALYA 1SKRA 2A5XA 3EKUA 1T05A 4N76A 3O3FA 1VAZA 4F4KA 5M1QA 1GLLO 3QFPA 5AQHA 4GNIA 2FBTA 1TV6A 4CZJA 1VSEA 3UKRB 4CJEA 1KD1O 2QM1A 5EOYA 1KVAA 4CZLA 5HRRA 4IOXA 3QNNA 3AVLA 2Q0UA 3RWUA 3LDOA 2D0AA 3EZ5A 4NO7A 4JS5A 4MFBA 3AA2A 3V4IA 2QWNA 1K9MO 1A5XA 3DOLA 5FPEA 4DSFA 1EWRA 1ASUA 2GV9A 4J2BA 1ZBSA 1SUQA 3A2FA 3AO2A 4XH5A 4BACA 4FZZA 3D2EB 5HRSA 4JI5K 1DTTA 2KTQA 3HBTA 3HRGA 3ISNC 3CJ9A 1REVA 1V4SA 4ILJA 3NVKA 3NF8A 3ZLJA 3I0RA 3ENBA 3SZ2A 2HOEA 2BGGA 3MWPA 4I6MA 3QBXA 1GOAA 2HF3A 5CZ1A 4RW7A 3C6UA 3TSUA 3DRRA 4JI3K 3SBTA 3TU5A 4DV6K 3BGRA 3PX6A 3KK7A 2XY7A 4J2EA 4LF5K 2E2NA 2I7PA 3VEXA 4JKGA 2E1YA 3ZT4A 1T7PA 1MWMA 4A59A 1RNHA 3SAGA 4M45A 3D7EO 1ZBHA 4DQRA 3FFIA 3U4LA 3FGUA 4B9QA 1YITN 3QEIA 4IXCA 1NGJA 4CJFA 1RTJA 3HOTA 1NWKA 4B1VA 1W7AA 1S3XA 4WQ4C 3MWTA 5J1EA 4CK1A 3HK2A 2NRTA 2HHVA 3E9LA 4K25A 2FF6A 1JLCA 3CI5A 3SBGA 1ESVA 5GADP 3TANA 4M63C 2GUPA 1NK0A 4BRCA 3VQDA 2AA4A 3BUZB 5HOOA 2O8BB 1LAVA 2KHOA 4BE2A 3M1FA 3KD1E 3KLHA 1WOQA 4CZKA 1YXQA 4KBOA 1GLAG 4BG9A 1DKGD 1TKTA 4E7KA 1FXXA 3LDSA 1HQEA 3HP9A 1YI2N 1TAQA 4BRKA 3WEEA 4B1XB 4EFHA 5T7BA 1S1XA 4JD2B 4RG8A 4YNQA 4CZFA 1WLJA 3HSTB 3TAPA 3KK1A 3GOIA 3H1QA 1C1CA 3L3UA 4RW8A 3LP0A 3CFOA 3I56N 4FJKA 3U9ZA 4KKOA 1W2BM 4FVMA 2ZGZA 3ULEB 3QMLA 1W0HA 2DFHA 4O0IA 3C6HA 4MO4A 1NGAA 5C25A 1ZBLA 1N8RO 5DK5A 4DR5K 4WQ4A 4E7JA 3ZETB 4L8RB 2QKBA 1RT6A 3J7ZO 2Q31A 4CERA 4X65K 5H1SQ 4X66K 1CLQA 3CC7N 2Q97A 3T7ZA 3K58A 3U3YA 4BR5A 3PSFA 3BZKA 4CHOA 4C8KA 1ZC6A 1IV0A 5SZTA 3CD6N 3C65A 1Y64A 4NCAA 2WOMA 4UY8O 4HVJA 2P51A 4CIGA 3K9KA 3D2FB 2HBMA 1BISA 3WXIA 3AA5X 3L2RA 4DLEA 3SAHA 3VQCA 1SKSA 1HR0K 4ZHRA 1YVUA 5D3GA 4CGFA 1FK9A 3WXJA 1BL3A 3KLFA 3FE1A 3FZMA 3G10A 4O5BA 2CGLA 2QK9A 5AQLA 1VSIA 3VQAA 3IG1A 4IO9L 4OGCA 2W42A 3MN6A 4NYFA 4DSIA 3D45A 3KZBA 3NGIA 4OX9K 1YF5L 1S72N 3GE1A 4CBWA 1RBVA 3QIOA 3QINA 2RF2A 3KK3A 2XY5A 3VEYA 1O13A 4B3SK 2PFUA 1VQPN 3GG4A 4FJJA 4OKKA 4CJKA 5CE3A 3QEXA 3SPYA 4JK7A 3LDLA 3OYMA 4BY9C 1CZBA 4CF9A 3OS2A 2BANA 4RW4A 2HB5A 4CHNA 3OYDA 2AP1A 3LP3A 5TKYA 1JCFA 1Q9YA 2A1SA 4CGDA 4F2RA 4MDBA 4JEPA 3V1RA 1QQNA 4KTQA 4JKFA 4GKKK 1QQCA 1YHQN 5CZ2A 1SL0A 2O4IA 1VSJA 2E2QA 4FWSA 2B4JA 1HRHA 1CZAN 4FM2A 3O4QA 3SQ1A 3RMCA 2D0BA 3UE5A 3GL1A 1EWQA 5KTQA 5JICA 4EAHD 4FK2A 1QQOA 1TKZA 4BR2A 2QI2A 5AQUA 1UWBA 3A8YA 2PYLA 1GLJO 2YJEA 4DG1A 3S9HA 5F1XA 1TK5A 3MEGA 1QHTA 3K5MA 2Z1GA 3N4QA 3QEPA 2G8UA 5FRNA 3E1YA 1ZBUA 4YOVA 3MN7A 4KI6A 4KO0A 3A5OC 4WYBA 3P31A 2P9UA 4OPKA 1KLNA 3KKRA 4PA1A 1VRUA 2DTUA 3RSEB 3TAEA 2KFNA 4JLHA 1FW6A 3CFPA 2YHAA 4KH5A 4E1MA 3VENA 3HXMA 3T1YK 1IKYA 2ZD1A 1HNZK 3PO5A 4H5VA 1OVYA 5EVZA 1JXEA 1U4BA 4DU4A 1RBRA 4K0KK 1QZ6A 3MN5A 4E1NA 4BE1A 4CECA 4LC9B 2HBKA 2D1KA 1XNQK 2QTDA 3QO9A 4H4MA 1BIZA 1ASWA 4FJXA 4Y0WA 1EP4A 2DPNA 3LAKA 4H0TB 3AA4A 5ELZA 1BUPA 3VESA 4JKBA 3R9PA 5JVHL 1DGKN 3AO3A 1CXUA 3K5OA 2PAVA 1JLQA 3L8BA 1D5AA 4C1NI 1LAWA 1YAGA 1TL1A 4DKWA 2KKZA 4LY7A 1HNIA 3LAMA 5GIOA 1WBDA 4Y1DA 1VQ8N 5HL7L 1HLUA 1OKJA 4IOAL 1BQNA 3KKSA 4CBUA 5KGXA 4DR3K 3ZT3A 4GVMA 3LL3A 3IDHA 4CGJA 5LJVA 1YVNA 1BCOA 1SZ2A 2FBVA 5C2DA 4DR7K 3EZWA 2UUAK 4DFJA 5C0YA 4JS4A 2P5OA 3LALA 1D4XA 3CQYA 3F5TA 3MCAB 4H0YB 2A6AA 3JXUA 1BIUA 3A5NC 4WQ5C 4F9OA 1N6QA 1RDCA 3QDKA 4J8FA
chains in the Genus database with same CATH topology
4CK2A 3KD5E 3BDPA 2OPQA 4IG0A 1KSPA 4DFKA 3IRXA 3G0ZA 1A5WA 3OS1A 3OYFA 3I8DA 4WE1A 4XIUA 4DTOA 1S1WA 2G8FA 3OJUA 1EKEA 4CJVA 2OYQA 3PY8A 4CIEA 3DI6A 4B9UA 4DS5A 4FLZA 4DTSA 4KTZA 4DTMA 3NHGA 2BE2A 1J53A 1FKPA 2XY6A 4ICLA 4Z0UA 1LW0A 3ZT0A 4FK0A 4Y1CA 1L3UA 4K8XA 3PO4A 1JLFA 4KB1A 3TABA 3DYAA 3C6TA 2GUIA 1QS4A 3PUFA 4CJLA 3WNEA 1ZBFA 1BCMA 4JRPA 2HMIA 4CHQA 4FCYA 5FRMA 1HJRA 3NBPA 1WSJA 2X74A 3D0PA 4KFBA 1IG9A 2KZZA 2E6MA 2VG5A 4CFAA 2IS3A 1XC9A 4EZ9A 4I9QA 1HQUA 1S6PA 4FJ9A 2YNFA 3QNOA 4M3TA 3JYTA 1IKVA 1T03A 1HYZA 1JKHA 2RKIA 2G8HA 1KFDA 3ZSQA 1I3AA 3LP1A 4GMJB 2RN2A 1EETA 4DMNA 2Q3SA 2VWKA 4ID5A 3LWMA 1NK5A 4KHSA 3RRGA 4B8CA 3VQ7A 4NYNA 5CYQA 3OYIA 4ELVA 5JS2A 4Z4CA 3OYHA 5KI6A 4KTWA 1RT5A 4IG3A 4CJ4A 1C0TA 4M3XA 1RT2A 1IO2A 4C8MA 2PZSA 2Z1JA 1QE1A 4EP5A 3SI6A 2P5GA 3O3GA 2YNHA 3SQ4A 3JSMA 4OLAA 1F21A 4OJRA 3M8RA 1JLGA 1B92A 4KRFA 4DSEA 2HHXA 2EHGA 1S9EA 1KVCA 3V1OA 2OA8A 3AO4A 1VSFA 4LSLA 3VQ9A 1I39A 1UA0A 1O1WA 4DTXA 3H08A 3LANA 3MXJA 4OPJA 3AVBA 4RW6A 1UOCA 3ALYA 3MAQA 4K8ZA 3DLKA 1SKRA 4B3OA 4ZTJA 1T05A 4N76A 3O3FA 1SL1A 4FM0A 4F4KA 3AA3A 1RTHA 3ZSXA 4CEAA 1HYSA 3NH2A 1K6YA 1WSHA 3S3NA 1Q9XA 3MEDA 5HLFA 3KLEA 3HVRA 1EXQA 4FW1A 2YKNA 1WAFA 2FBTA 1TV6A 3AVNA 1VSEA 4CJEA 3AVKA 3RMDA 1KVAA 5HRRA 3O3HA 1TK0A 3QNNA 3AVLA 3DLGA 4FLUA 3RWUA 3OYBA 1C0MA 2D0AA 2ETJA 1FKOA 5KRTA 3EZ5A 3LZJA 2YNIA 1SV5A 2NUBA 2FBYA 4JS5A 4DTNA 4HCBA 5J2QA 4M41A 3VQ8A 4BE0A 4MFBA 3AA2A 1JLBA 3V4IA 4F2SA 1S5JA 1A5XA 3DOLA 4DSFA 1J9AA 3KLGA 1ASUA 4DF8A 5JS1A 2GV9A 4M3YA 3V9ZA 2F8TA 4J2BA 2VG6A 1RT4A 1SUQA 3OYEA 5HROA 3THVA 3A2FA 2LSNA 1RDBA 3AO2A 1NK7A 3RMBA 4Z4FA 5C24A 4BACA 1Z26A 3TR8A 3V9XA 4FZZA 4F3OA 5HRSA 1EX4A 4FLWA 4DQSA 2HHUA 1DTTA 1NKBA 3DLRA 2KTQA 3T3FA 3U6FA 1VSDA 1VSKA 3M8SA 4J2DA 3ISNC 1REVA 2E4LA 4DTRA 3NF8A 3I0RA 4AHSA 4FLVA 3SZ2A 4FZXC 1HPZA 2BGGA 2FC0A 4DF4A 4TSXA 2HVHA 3PX0A 4O55A 3WNFA 1JL2A 1GOAA 1XHXA 4FW2A 4RW7A 5CZ1A 4E89A 1LWFA 3B6OA 4F3TA 2QKKA 3C6UA 4B9NA 2YV0X 3HT3A 3ITHA 3SQ0A 3HP6A 4Z4EA 3DRRA 2O4GA 2IC3A 3NAEA 1QTMA 3V9SA 4O4GA 1IKWA 2XO7A 1LV5A 1JXBA 4W5QA 4DSKA 3V81A 4BDZA 3BGRA 3PX6A 2WONA 4C8LA 3K5LA 2XY7A 4J2EA 3PV8A 1TVRA 1L3VA 3ZT4A 5HRPA 4CE9A 2X6NA 5DMRA 1T7PA 1QSYA 4PQUA 1RNHA 1RTIA 3NE6A 2D0CA 4M45A 1ZBHA 4DQRA 3FFIA 1NJXA 4QAGA 1U04A 4LH5A 3QEIA 4W5RA 4CJFA 1RTJA 2HNDA 1MU2A 1S6QA 4B8AB 2E6LA 3HPOA 3RMAA 3VQQA 3ZT1A 3P83D 3SUOA 5J1EA 1KVBA 3MXIA 3VQEA 2DFFA 4IDKA 4CK1A 5J2MA 3OYJA 2Y1IA 4CGGA 3WNHA 3HK2A 4AHTA 4KB0A 2HHVA 1S9GA 2B5JA 3VQ6A 4HHTA 4KHUA 1JLCA 3OYKA 1T8EA 4FYDA 4CEEA 1BHLA 3TANA 2VG7A 4AHCA 3OYGA 3RRHA 3V6DA 1NK0A 3CYMA 4KV8A 4KI4A 1NJYA 1VSMA 3VQDA 5E41A 3DLHA 4FJLA 3LPTA 4M3ZA 4FM1A 3SNNA 4PWDA 1LWEA 1LAVA 3DRPA 4HUEA 4BE2A 4DQPA 2G8IA 3KD1E 3KLHA 1YTUA 4OLBA 4W5OA 4IKFA 3OYLA 4HUGA 1UA1A 1U45A 3SCXA 4CEOA 2X6SA 1JLAA 3QEWA 1TKTA 1XI1A 3PX4A 4E7KA 1L5UA 2G8WA 2FBXA 1FXXA 3LDSA 3CQ8A 4B9TA 1HQEA 4QOZB 3HP9A 3L2VA 4CF2A 1TAQA 1UAXA 4HCCA 4FJGA 1WSEA 4CK3A 5T7BA 4CJRA 3SUNA 1S1XA 4DQIA 4KHQA 2Y1JA 4DU3A 2B6AA 4RG8A 4YNQA 1TAUA 4DTJA 1X9MA 1WLJA 4DSJA 4HTUA 3QIPA 2IDOA 2RPIA 1RDDA 3TAGA 3OJSA 4BDPA 3HSTB 1RDAA 4ID1A 4BWMA 3TAPA 2YHBA 3KK1A 2OPPA 3UIQA 1S1UA 3O4NA 3IS9A 1C1CA 3L3UA 3M8PA 4RW8A 2HNZA 3LP0A 3CFOA 1Y97A 4FJKA 3F9KA 4KKOA 3NGZA 4FVMA 3E01A 3ZSOA 3AVFA 4DS4A 1W0HA 2DFHA 3TARA 4N41A 2ZQBA 3P1GA 4O0IA 3ZSWA 1XHZA 1U49A 1NK4A 2OPRA 4OVLA 4B9MA 3OVNA 5C25A 4M3UA 2DFEA 3NF6A 3P5JA 1ZBLA 5DK5A 3MXMA 4DLGA 4E7JA 4FK4A 1VSLA 2HW3A 3DOKA 3WNGA 4KHYA 1B9FA 4L8RB 2QKBA 4FLXA 1KTQA 1RT6A 5J2NA 4LD0A 4CERA 2AJQA 3AVGA 4CJQA 1CLQA 1X9SA 2JLEA 4FZYA 3HYFA 3QERA 3K58A 3U3YA 4HUFA 4CHOA 4E19A 4C8KA 5SZTA 4DTUA 1NKCA 3DMJA 4N47A 3AVHA 2KFZA 1S1TA 2ATQA 4NCAA 4NCGA 2D5RA 2WOMA 3AVCA 2PYJA 3SUPA 4HVJA 2IAJA 2P51A 5C42A 4C8OA 4CIGA 3NH0A 3S3OA 1RILA 4O44A 4FJMA 4B08A 1NOYA 3KTQA 4M42A 3CM5A 1BISA 4N5SA 3VA0A 3TAQA 3AVMA 3MEEA 3ULDA 3AA5X 2ITGA 3L2RA 1NJWA 4CJSA 1Z25A 4IBNA 4CCHA 4DLEA 4KHNA 2OZMA 4H4OA 4Z4HA 3VQCA 1KCFA 1KLMA 2OPSA 3DM2A 3TI0A 1U48A 1SKSA 3NF9A 4ZHRA 1YVUA 4DWIA 4KHWA 5D3GA 4RW9A 3AVAA 4CGFA 1FK9A 3OY9A 4E7HA 4O0JA 1BL3A 3KLFA 3AO1A 1YTAA 3RTVA 3SPZA 3ZSRA 1G15A 1C6VA 4CEBA 3G10A 4O5BA 4DQQA 2HHQA 3K5NA 4CFBA 5FROA 3CFRA 2QK9A 3M8QA 1VSIA 3VQAA 4CESA 1SL2A 4ELUA 2DY4A 4AHRA 3IG1A 4CJUA 3DLEA 4LSNA 4OGCA 4CGIA 4CGHA 2W42A 4BDYA 1ITGA 1JLEA 3L3VA 4NYFA 4DSIA 2HHTA 1WAJA 3D45A 3NGIA 2IOCA 4CF8A 4CJPA 1NOZA 1HYVA 2X78A 4EP4A 4GW6A 2IGIA 3HVTA 5HRNA 1L3SA 3VQ4A 1Q8IA 3CG7A 1TKXA 1C1AA 1WSIA 1C1BA 4Q0BA 4CFDA 1RBVA 3QIOA 3QINA 4JRQA 2RF2A 3KK3A 2XY5A 1B9DA 3F73A 1LW2A 4C8NA 1BGXT 4I2PA 3SQ2A 4IFVA 3OYCA 3ASMA 4KPYA 4QCLA 4FJJA 3QLHA 4CIFA 3ZSYA 4OKKA 4AHVA 4CJKA 3QEXA 3SPYA 3L2QA 3NFAA 1ZBIA 4B9LA 4E3SA 2QXFA 3RR7A 5KRSA 1J54A 3OYMA 1CZBA 4FXDA 4CF9A 1RT7A 2BANA 4RW4A 3OS2A 2YNGA 3DRSA 2KW4A 2ZE2A 2HB5A 2P1JA 4CHNA 1ZYQA 3OYDA 3LP3A 3EYZA 2HHWA 1Q9YA 2G8VA 2A1SA 4KREA 2OZSA 4CGDA 4F2RA 1CZ9A 3ZT2A 3V1RA 3VQ5A 4R5PA 3L2WA 4KTQA 4Z4IA 1QQCA 1DTQA 4I7FA 4PUOA 3TAFA 5CZ2A 4FLYA 1SL0A 2O4IA 2HVIA 2VWJA 4E0DA 1VSJA 3QESA 1WN7A 2XRIA 2B4JA 1HRHA 1D8YA 4CJ3A 3LZIA 4FM2A 2GBZA 3O4QA 4CEDA 4OGEA 4H8KA 3SQ1A 3RMCA 4AHUA 3DLBA 2D0BA 4CEFA 4DSLA 3C94A 3QEVA 5KTQA 4FK2A 1N5YA 3K57A 3TWHA 1IKXA 3VA3A 5CY4A 3SJJA 1LWCA 3KIOA 3OS0A 1TKZA 1TK8A 4CHYA 3OYAA 1BI4B 2EX3A 2HNYA 3SV4A 1UWBA 3V1QA 4FJ7A 1A5VA 4E7IA 2PYLA 1HMVA 4FJ5A 1RT3A 3NDKA 3VN5A 2F96A 4KAZA 1VSHA 4DG1A 3SYZA 3S9HA 1TK5A 3I0SA 2G8KA 3MEGA 3LWLA 3IAYA 1QHTA 3K5MA 4UQGA 2Z1GA 3QEPA 3NF7A 1D9FA 2G8UA 2PY5A 3RR8A 5FRNA 4DFPA 1ZBUA 3S3MA 1ASVA 4KI6A 4KO0A 3T19A 2XHBA 4ELTA 5I42A 1TL3A 4LH4A 1NK9A 1DLOA 3CM6A 4OKEA 4OPKA 1KLNA 3KKRA 3MECA 4PA1A 1VRUA 1RBSA 4ZTFA 1NJZA 1KRPA 5KGWA 2DTUA 3TAEA 1QSSA 3KJVA 4JLHA 2KFNA 1GOBA 3CFPA 1SKWA 3U3GA 2YHAA 3KLIA 3NGYA 4CEQA 4F8RA 4E1MA 3HXMA 3OYNA 4W5TA 3HO1A 1IKYA 2ZD1A 1QSLA 1J5OA 4M3WA 2KZMA 3NH1A 1S1VA 3PO5A 5K14A 4CJWA 3ZCMA 4FJ8A 5HP1A 1L3TA 4MQ3A 1W9HA 5HBMA 3V9WA 1VRTA 1KFSA 2Z1IA 1JXEA 1U4BA 4DU4A 1RBRA 5EU7A 4AH9A 3V9UA 5CYMA 4E1NA 5FDLA 4CECA 4BE1A 2Z1HA 1RTDA 1RBUA 3AV9A 4OKJA 3QETA 3EY1A 3QO9A 4CF1A 3HL8A 4H4MA 4W5NA 1NK6A 1BIZA 1ASWA 4FJXA 1GOCA 3T1AA 4CFCA 2R7YA 1CXQA 1EP4A 3LAKA 1WNSA 4CF0A 4B9VA 3LPUA 4AILC 4M3RA 3AA4A 5I3UA 5SWMA 4E7LA 4I9LA 3HM9A 1BQMA 3SUQA 2JGUA 3AO3A 1TGOA 3AVJA 1CXUA 3K5OA 4CHZA 3SV3A 1RCHA 1U47A 3AVIA 1JLQA 3L8BA 4DFMA 2BDPA 3VQPA 1JL1A 4G1QA 1D5AA 3VQBA 2A1RA 1LAWA 1VK0A 1NK8A 3HJFA 1TL1A 2YKMA 4CJTA 4LY7A 3LP2A 4Z4GA 1HNIA 3LAMA 4FJHA 4PY5A 1WSFA 1NKEA 1C0UA 4FJNA 3L2UA 1X9WA 4Y1DA 1WSGA 4YFUA 1HNVA 3AO5A 4FJIA 2XY8A 1BQNA 4CEZA 2HHSA 3TAMA 4J2AA 3KKSA 4BWJA 3ZSVA 3B6PA 3HPGA 4I2QA 4DTPA 4FLTA 4N56A 2I5JA 4Q5VA 1D9DA 2F8SA 1XWLA 5KGXA 3ZT3A 1RT1A 3ZSZA 4EZ6A 4NCBA 3C95A 4GVMA 4CJ5A 4CGJA 1RBTA 3K2PA 4CHPA 1YT3A 1BCOA 3K59A 5J2PA 2FBVA 4DFJA 4B9SA 4JS4A 2P5OA 1IH7A 3LALA 3NCIA 3HPHA 4DU1A 1TKDA 4IFYA 1R0AA 1BIUA 2KQ2A 1RDCA 1N6QA 3KK2A 1X1PA 1BI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CK2 A;  3KD5 E;  3BDP A;  2OPQ A;  4IG0 A;  1KSP A;  4DFK A;  3IRX A;  3G0Z A;  1A5W A;  3OS1 A;  3OYF A;  3I8D A;  4WE1 A;  4XIU A;  4DTO A;  1S1W A;  2G8F A;  3OJU A;  1EKE A;  4CJV A;  2OYQ A;  3PY8 A;  4CIE A;  3DI6 A;  4B9U A;  4DS5 A;  4FLZ A;  4DTS A;  4KTZ A;  4DTM A;  3NHG A;  2BE2 A;  1J53 A;  1FKP A;  2XY6 A;  4ICL A;  4Z0U A;  1LW0 A;  3ZT0 A;  4FK0 A;  4Y1C A;  1L3U A;  4K8X A;  3PO4 A;  1JLF A;  4KB1 A;  3TAB A;  3DYA A;  3C6T A;  2GUI A;  1QS4 A;  3PUF A;  4CJL A;  3WNE A;  1ZBF A;  1BCM A;  4JRP A;  2HMI A;  4CHQ A;  4FCY A;  5FRM A;  1HJR A;  3NBP A;  1WSJ A;  2X74 A;  3D0P A;  4KFB A;  1IG9 A;  2KZZ A;  2E6M A;  2VG5 A;  4CFA A;  2IS3 A;  1XC9 A;  4EZ9 A;  4I9Q A;  1HQU A;  1S6P A;  4FJ9 A;  2YNF A;  3QNO A;  4M3T A;  3JYT A;  1IKV A;  1T03 A;  1HYZ A;  1JKH A;  2RKI A;  2G8H A;  1KFD A;  3ZSQ A;  1I3A A;  3LP1 A;  4GMJ B;  2RN2 A;  1EET A;  4DMN A;  2Q3S A;  2VWK A;  4ID5 A;  3LWM A;  1NK5 A;  4KHS A;  3RRG A;  4B8C A;  3VQ7 A;  4NYN A;  5CYQ A;  3OYI A;  4ELV A;  5JS2 A;  4Z4C A;  3OYH A;  5KI6 A;  4KTW A;  1RT5 A;  4IG3 A;  4CJ4 A;  1C0T A;  4M3X A;  1RT2 A;  1IO2 A;  4C8M A;  2PZS A;  2Z1J A;  1QE1 A;  4EP5 A;  3SI6 A;  2P5G A;  3O3G A;  2YNH A;  3SQ4 A;  3JSM A;  4OLA A;  1F21 A;  4OJR A;  3M8R A;  1JLG A;  1B92 A;  4KRF A;  4DSE A;  2HHX A;  2EHG A;  1S9E A;  1KVC A;  3V1O A;  2OA8 A;  3AO4 A;  1VSF A;  4LSL A;  3VQ9 A;  1I39 A;  1UA0 A;  1O1W A;  4DTX A;  3H08 A;  3LAN A;  3MXJ A;  4OPJ A;  3AVB A;  4RW6 A;  1UOC A;  3ALY A;  3MAQ A;  4K8Z A;  3DLK A;  1SKR A;  4B3O A;  4ZTJ A;  1T05 A;  4N76 A;  3O3F A;  1SL1 A;  4FM0 A;  4F4K A;  3AA3 A;  1RTH A;  3ZSX A;  4CEA A;  1HYS A;  3NH2 A;  1K6Y A;  1WSH A;  3S3N A;  1Q9X A;  3MED A;  5HLF A;  3KLE A;  3HVR A;  1EXQ A;  4FW1 A;  2YKN A;  1WAF A;  2FBT A;  1TV6 A;  3AVN A;  1VSE A;  4CJE A;  3AVK A;  3RMD A;  1KVA A;  5HRR A;  3O3H A;  1TK0 A;  3QNN A;  3AVL A;  3DLG A;  4FLU A;  3RWU A;  3OYB A;  1C0M A;  2D0A A;  2ETJ A;  1FKO A;  5KRT A;  3EZ5 A;  3LZJ A;  2YNI A;  1SV5 A;  2NUB A;  2FBY A;  4JS5 A;  4DTN A;  4HCB A;  5J2Q A;  4M41 A;  3VQ8 A;  4BE0 A;  4MFB A;  3AA2 A;  1JLB A;  3V4I A;  4F2S A;  1S5J A;  1A5X A;  3DOL A;  4DSF A;  1J9A A;  3KLG A;  1ASU A;  4DF8 A;  5JS1 A;  2GV9 A;  4M3Y A;  3V9Z A;  2F8T A;  4J2B A;  2VG6 A;  1RT4 A;  1SUQ A;  3OYE A;  5HRO A;  3THV A;  3A2F A;  2LSN A;  1RDB A;  3AO2 A;  1NK7 A;  3RMB A;  4Z4F A;  5C24 A;  4BAC A;  1Z26 A;  3TR8 A;  3V9X A;  4FZZ A;  4F3O A;  5HRS A;  1EX4 A;  4FLW A;  4DQS A;  2HHU A;  1DTT A;  1NKB A;  3DLR A;  2KTQ A;  3T3F A;  3U6F A;  1VSD A;  1VSK A;  3M8S A;  4J2D A;  3ISN C;  1REV A;  2E4L A;  4DTR A;  3NF8 A;  3I0R A;  4AHS A;  4FLV A;  3SZ2 A;  4FZX C;  1HPZ A;  2BGG A;  2FC0 A;  4DF4 A;  4TSX A;  2HVH A;  3PX0 A;  4O55 A;  3WNF A;  1JL2 A;  1GOA A;  1XHX A;  4FW2 A;  4RW7 A;  5CZ1 A;  4E89 A;  1LWF A;  3B6O A;  4F3T A;  2QKK A;  3C6U A;  4B9N A;  2YV0 X;  3HT3 A;  3ITH A;  3SQ0 A;  3HP6 A;  4Z4E A;  3DRR A;  2O4G A;  2IC3 A;  3NAE A;  1QTM A;  3V9S A;  4O4G A;  1IKW A;  2XO7 A;  1LV5 A;  1JXB A;  4W5Q A;  4DSK A;  3V81 A;  4BDZ A;  3BGR A;  3PX6 A;  2WON A;  4C8L A;  3K5L A;  2XY7 A;  4J2E A;  3PV8 A;  1TVR A;  1L3V A;  3ZT4 A;  5HRP A;  4CE9 A;  2X6N A;  5DMR A;  1T7P A;  1QSY A;  4PQU A;  1RNH A;  1RTI A;  3NE6 A;  2D0C A;  4M45 A;  1ZBH A;  4DQR A;  3FFI A;  1NJX A;  4QAG A;  1U04 A;  4LH5 A;  3QEI A;  4W5R A;  4CJF A;  1RTJ A;  2HND A;  1MU2 A;  1S6Q A;  4B8A B;  2E6L A;  3HPO A;  3RMA A;  3VQQ A;  3ZT1 A;  3P83 D;  3SUO A;  5J1E A;  1KVB A;  3MXI A;  3VQE A;  2DFF A;  4IDK A;  4CK1 A;  5J2M A;  3OYJ A;  2Y1I A;  4CGG A;  3WNH A;  3HK2 A;  4AHT A;  4KB0 A;  2HHV A;  1S9G A;  2B5J A;  3VQ6 A;  4HHT A;  4KHU A;  1JLC A;  3OYK A;  1T8E A;  4FYD A;  4CEE A;  1BHL A;  3TAN A;  2VG7 A;  4AHC A;  3OYG A;  3RRH A;  3V6D A;  1NK0 A;  3CYM A;  4KV8 A;  4KI4 A;  1NJY A;  1VSM A;  3VQD A;  5E41 A;  3DLH A;  4FJL A;  3LPT A;  4M3Z A;  4FM1 A;  3SNN A;  4PWD A;  1LWE A;  1LAV A;  3DRP A;  4HUE A;  4BE2 A;  4DQP A;  2G8I A;  3KD1 E;  3KLH A;  1YTU A;  4OLB A;  4W5O A;  4IKF A;  3OYL A;  4HUG A;  1UA1 A;  1U45 A;  3SCX A;  4CEO A;  2X6S A;  1JLA A;  3QEW A;  1TKT A;  1XI1 A;  3PX4 A;  4E7K A;  1L5U A;  2G8W A;  2FBX A;  1FXX A;  3LDS A;  3CQ8 A;  4B9T A;  1HQE A;  4QOZ B;  3HP9 A;  3L2V A;  4CF2 A;  1TAQ A;  1UAX A;  4HCC A;  4FJG A;  1WSE A;  4CK3 A;  5T7B A;  4CJR A;  3SUN A;  1S1X A;  4DQI A;  4KHQ A;  2Y1J A;  4DU3 A;  2B6A A;  4RG8 A;  4YNQ A;  1TAU A;  4DTJ A;  1X9M A;  1WLJ A;  4DSJ A;  4HTU A;  3QIP A;  2IDO A;  2RPI A;  1RDD A;  3TAG A;  3OJS A;  4BDP A;  3HST B;  1RDA A;  4ID1 A;  4BWM A;  3TAP A;  2YHB A;  3KK1 A;  2OPP A;  3UIQ A;  1S1U A;  3O4N A;  3IS9 A;  1C1C A;  3L3U A;  3M8P A;  4RW8 A;  2HNZ A;  3LP0 A;  3CFO A;  1Y97 A;  4FJK A;  3F9K A;  4KKO A;  3NGZ A;  4FVM A;  3E01 A;  3ZSO A;  3AVF A;  4DS4 A;  1W0H A;  2DFH A;  3TAR A;  4N41 A;  2ZQB A;  3P1G A;  4O0I A;  3ZSW A;  1XHZ A;  1U49 A;  1NK4 A;  2OPR A;  4OVL A;  4B9M A;  3OVN A;  5C25 A;  4M3U A;  2DFE A;  3NF6 A;  3P5J A;  1ZBL A;  5DK5 A;  3MXM A;  4DLG A;  4E7J A;  4FK4 A;  1VSL A;  2HW3 A;  3DOK A;  3WNG A;  4KHY A;  1B9F A;  4L8R B;  2QKB A;  4FLX A;  1KTQ A;  1RT6 A;  5J2N A;  4LD0 A;  4CER A;  2AJQ A;  3AVG A;  4CJQ A;  1CLQ A;  1X9S A;  2JLE A;  4FZY A;  3HYF A;  3QER A;  3K58 A;  3U3Y A;  4HUF A;  4CHO A;  4E19 A;  4C8K A;  5SZT A;  4DTU A;  1NKC A;  3DMJ A;  4N47 A;  3AVH A;  2KFZ A;  1S1T A;  2ATQ A;  4NCA A;  4NCG A;  2D5R A;  2WOM A;  3AVC A;  2PYJ A;  3SUP A;  4HVJ A;  2IAJ A;  2P51 A;  5C42 A;  4C8O A;  4CIG A;  3NH0 A;  3S3O A;  1RIL A;  4O44 A;  4FJM A;  4B08 A;  1NOY A;  3KTQ A;  4M42 A;  3CM5 A;  1BIS A;  4N5S A;  3VA0 A;  3TAQ A;  3AVM A;  3MEE A;  3ULD A;  3AA5 X;  2ITG A;  3L2R A;  1NJW A;  4CJS A;  1Z25 A;  4IBN A;  4CCH A;  4DLE A;  4KHN A;  2OZM A;  4H4O A;  4Z4H A;  3VQC A;  1KCF A;  1KLM A;  2OPS A;  3DM2 A;  3TI0 A;  1U48 A;  1SKS A;  3NF9 A;  4ZHR A;  1YVU A;  4DWI A;  4KHW A;  5D3G A;  4RW9 A;  3AVA A;  4CGF A;  1FK9 A;  3OY9 A;  4E7H A;  4O0J A;  1BL3 A;  3KLF A;  3AO1 A;  1YTA A;  3RTV A;  3SPZ A;  3ZSR A;  1G15 A;  1C6V A;  4CEB A;  3G10 A;  4O5B A;  4DQQ A;  2HHQ A;  3K5N A;  4CFB A;  5FRO A;  3CFR A;  2QK9 A;  3M8Q A;  1VSI A;  3VQA A;  4CES A;  1SL2 A;  4ELU A;  2DY4 A;  4AHR A;  3IG1 A;  4CJU A;  3DLE A;  4LSN A;  4OGC A;  4CGI A;  4CGH A;  2W42 A;  4BDY A;  1ITG A;  1JLE A;  3L3V A;  4NYF A;  4DSI A;  2HHT A;  1WAJ A;  3D45 A;  3NGI A;  2IOC A;  4CF8 A;  4CJP A;  1NOZ A;  1HYV A;  2X78 A;  4EP4 A;  4GW6 A;  2IGI A;  3HVT A;  5HRN A;  1L3S A;  3VQ4 A;  1Q8I A;  3CG7 A;  1TKX A;  1C1A A;  1WSI A;  1C1B A;  4Q0B A;  4CFD A;  1RBV A;  3QIO A;  3QIN A;  4JRQ A;  2RF2 A;  3KK3 A;  2XY5 A;  1B9D A;  3F73 A;  1LW2 A;  4C8N A;  1BGX T;  4I2P A;  3SQ2 A;  4IFV A;  3OYC A;  3ASM A;  4KPY A;  4QCL A;  4FJJ A;  3QLH A;  4CIF A;  3ZSY A;  4OKK A;  4AHV A;  4CJK A;  3QEX A;  3SPY A;  3L2Q A;  3NFA A;  1ZBI A;  4B9L A;  4E3S A;  2QXF A;  3RR7 A;  5KRS A;  1J54 A;  3OYM A;  1CZB A;  4FXD A;  4CF9 A;  1RT7 A;  2BAN A;  4RW4 A;  3OS2 A;  2YNG A;  3DRS A;  2KW4 A;  2ZE2 A;  2HB5 A;  2P1J A;  4CHN A;  1ZYQ A;  3OYD A;  3LP3 A;  3EYZ A;  2HHW A;  1Q9Y A;  2G8V A;  2A1S A;  4KRE A;  2OZS A;  4CGD A;  4F2R A;  1CZ9 A;  3ZT2 A;  3V1R A;  3VQ5 A;  4R5P A;  3L2W A;  4KTQ A;  4Z4I A;  1QQC A;  1DTQ A;  4I7F A;  4PUO A;  3TAF A;  5CZ2 A;  4FLY A;  1SL0 A;  2O4I A;  2HVI A;  2VWJ A;  4E0D A;  1VSJ A;  3QES A;  1WN7 A;  2XRI A;  2B4J A;  1HRH A;  1D8Y A;  4CJ3 A;  3LZI A;  4FM2 A;  2GBZ A;  3O4Q A;  4CED A;  4OGE A;  4H8K A;  3SQ1 A;  3RMC A;  4AHU A;  3DLB A;  2D0B A;  4CEF A;  4DSL A;  3C94 A;  3QEV A;  5KTQ A;  4FK2 A;  1N5Y A;  3K57 A;  3TWH A;  1IKX A;  3VA3 A;  5CY4 A;  3SJJ A;  1LWC A;  3KIO A;  3OS0 A;  1TKZ A;  1TK8 A;  4CHY A;  3OYA A;  1BI4 B;  2EX3 A;  2HNY A;  3SV4 A;  1UWB A;  3V1Q A;  4FJ7 A;  1A5V A;  4E7I A;  2PYL A;  1HMV A;  4FJ5 A;  1RT3 A;  3NDK A;  3VN5 A;  2F96 A;  4KAZ A;  1VSH A;  4DG1 A;  3SYZ A;  3S9H A;  1TK5 A;  3I0S A;  2G8K A;  3MEG A;  3LWL A;  3IAY A;  1QHT A;  3K5M A;  4UQG A;  2Z1G A;  3QEP A;  3NF7 A;  1D9F A;  2G8U A;  2PY5 A;  3RR8 A;  5FRN A;  4DFP A;  1ZBU A;  3S3M A;  1ASV A;  4KI6 A;  4KO0 A;  3T19 A;  2XHB A;  4ELT A;  5I42 A;  1TL3 A;  4LH4 A;  1NK9 A;  1DLO A;  3CM6 A;  4OKE A;  4OPK A;  1KLN A;  3KKR A;  3MEC A;  4PA1 A;  1VRU A;  1RBS A;  4ZTF A;  1NJZ A;  1KRP A;  5KGW A;  2DTU A;  3TAE A;  1QSS A;  3KJV A;  4JLH A;  2KFN A;  1GOB A;  3CFP A;  1SKW A;  3U3G A;  2YHA A;  3KLI A;  3NGY A;  4CEQ A;  4F8R A;  4E1M A;  3HXM A;  3OYN A;  4W5T A;  3HO1 A;  1IKY A;  2ZD1 A;  1QSL A;  1J5O A;  4M3W A;  2KZM A;  3NH1 A;  1S1V A;  3PO5 A;  5K14 A;  4CJW A;  3ZCM A;  4FJ8 A;  5HP1 A;  1L3T A;  4MQ3 A;  1W9H A;  5HBM A;  3V9W A;  1VRT A;  1KFS A;  2Z1I A;  1JXE A;  1U4B A;  4DU4 A;  1RBR A;  5EU7 A;  4AH9 A;  3V9U A;  5CYM A;  4E1N A;  5FDL A;  4CEC A;  4BE1 A;  2Z1H A;  1RTD A;  1RBU A;  3AV9 A;  4OKJ A;  3QET A;  3EY1 A;  3QO9 A;  4CF1 A;  3HL8 A;  4H4M A;  4W5N A;  1NK6 A;  1BIZ A;  1ASW A;  4FJX A;  1GOC A;  3T1A A;  4CFC A;  2R7Y A;  1CXQ A;  1EP4 A;  3LAK A;  1WNS A;  4CF0 A;  4B9V A;  3LPU A;  4AIL C;  4M3R A;  3AA4 A;  5I3U A;  5SWM A;  4E7L A;  4I9L A;  3HM9 A;  1BQM A;  3SUQ A;  2JGU A;  3AO3 A;  1TGO A;  3AVJ A;  1CXU A;  3K5O A;  4CHZ A;  3SV3 A;  1RCH A;  1U47 A;  3AVI A;  1JLQ A;  3L8B A;  4DFM A;  2BDP A;  3VQP A;  1JL1 A;  4G1Q A;  1D5A A;  3VQB A;  2A1R A;  1LAW A;  1VK0 A;  1NK8 A;  3HJF A;  1TL1 A;  2YKM A;  4CJT A;  4LY7 A;  3LP2 A;  4Z4G A;  1HNI A;  3LAM A;  4FJH A;  4PY5 A;  1WSF A;  1NKE A;  1C0U A;  4FJN A;  3L2U A;  1X9W A;  4Y1D A;  1WSG A;  4YFU A;  1HNV A;  3AO5 A;  4FJI A;  2XY8 A;  1BQN A;  4CEZ A;  2HHS A;  3TAM A;  4J2A A;  3KKS A;  4BWJ A;  3ZSV A;  3B6P A;  3HPG A;  4I2Q A;  4DTP A;  4FLT A;  4N56 A;  2I5J A;  4Q5V A;  1D9D A;  2F8S A;  1XWL A;  5KGX A;  3ZT3 A;  1RT1 A;  3ZSZ A;  4EZ6 A;  4NCB A;  3C95 A;  4GVM A;  4CJ5 A;  4CGJ A;  1RBT A;  3K2P A;  4CHP A;  1YT3 A;  1BCO A;  3K59 A;  5J2P A;  2FBV A;  4DFJ A;  4B9S A;  4JS4 A;  2P5O A;  1IH7 A;  3LAL A;  3NCI A;  3HPH A;  4DU1 A;  1TKD A;  4IFY A;  1R0A A;  1BIU A;  2KQ2 A;  1RDC A;  1N6Q A;  3KK2 A;  1X1P A;  1BI4 A; 
#chains in the Genus database with same CATH topology
 4CK2 A;  4LF9 K;  3CQX A;  3I8D A;  4XIU A;  1S1W A;  2W6L A;  1EKE A;  3PY8 A;  1HKC A;  4CIE A;  5C10 A;  4GY2 B;  2O8C A;  2XY6 A;  1QVG M;  1LW0 A;  2UXC K;  3PIO L;  4I6M B;  4Y1C A;  4K8X A;  4EHT A;  2O8D A;  4H5W A;  1QS4 A;  4CJL A;  1M1K O;  1ZBF A;  1BCM A;  2X74 A;  4FPB A;  3KWG A;  5AQX A;  2ASO A;  2IS3 A;  4FJ9 A;  1MA9 B;  3H45 C;  1T44 A;  1HYZ A;  1JKH A;  1KFD A;  3B8A X;  1I3A A;  1QHA A;  5MLC Q;  2VWK A;  4ID5 A;  1NK5 A;  4KHS A;  4JKG B;  3RRG A;  2YJF A;  4ELV A;  5BR8 K;  4FWK A;  5KI6 A;  3OYH A;  1RT5 A;  4CJ4 A;  1C0T A;  2VQF K;  4CVN E;  1IG8 A;  1RT2 A;  1IO2 A;  4C8M A;  1QE1 A;  2P5G A;  3O3G A;  3JSM A;  4BC5 A;  1JLG A;  4DSE A;  1IBL K;  1HKB A;  3EN9 A;  3AO4 A;  1VSF A;  4JK9 A;  5LL6 Z;  4LSL A;  4WQ5 A;  1O1W A;  4PL8 A;  3LAN A;  2NRR A;  4ISF A;  5BRF A;  3AVB A;  1UOC A;  3MAQ A;  3DLK A;  4B3O A;  4ZTJ A;  1NMD A;  2BH1 A;  1HYS A;  3NH2 A;  1Q9X A;  2UXD K;  5HLF A;  4MLE A;  3KLE A;  3HVR A;  1EXQ A;  3AVN A;  1FJG K;  3AVK A;  3RMD A;  2JWK A;  4QS9 A;  3DLG A;  2UYT A;  2BUP A;  1C0M A;  1FKO A;  1BDG A;  2YNI A;  3VGK A;  3BZC A;  3SLC A;  4HCB A;  4M41 A;  3VQ8 A;  4BE0 A;  2ZM6 K;  3I8B A;  5AFU H;  3VF2 A;  4DF8 A;  1TUU A;  4M3Y A;  4AM7 A;  3V9Z A;  4LFA K;  3DWL A;  4U67 L;  2VG6 A;  1RT4 A;  3OYE A;  2D0O A;  4A57 A;  3RMB A;  1NK7 A;  5C24 A;  3TR8 A;  4F3O A;  3CHW A;  3O1B A;  3Q7B A;  1NKB A;  3T3F A;  1VSD A;  4J2D A;  4AHS A;  4FZX C;  3D6R A;  3PX0 A;  3WNF A;  4FPA A;  3O5B A;  4YOR A;  4E89 A;  1Q81 O;  4B9N A;  2YV0 X;  3SQ0 A;  3OA9 A;  3SK3 A;  3NAE A;  1P8Z A;  4O4G A;  1IKW A;  1LV5 A;  4WFN L;  4W5Q A;  2HMP A;  3V81 A;  1LCU A;  2WON A;  1NJI O;  3PV8 A;  2WTU A;  4NLB A;  1YJW N;  4FWN A;  1OH6 A;  5DMR A;  4PQU A;  1RTI A;  1U04 A;  4LH5 A;  2YX6 A;  5BPM A;  4B3R K;  2HND A;  4M7X A;  4B8A B;  3HPO A;  4AQY K;  3RMA A;  4MLH A;  4IDK A;  2Y1I A;  4CGG A;  1S9G A;  2QWO A;  3EO3 A;  4HHT A;  4KHU A;  3OYK A;  1HX1 A;  4IDH A;  4CEE A;  1BHL A;  3V6D A;  3CYM A;  4KV8 A;  1JCG A;  1NJY A;  2P9P A;  5E41 A;  4M3Z A;  1LWE A;  4DUY K;  1Q18 A;  5LMN K;  4OLB A;  4W5O A;  3OYL A;  3FZF A;  1UA1 A;  1U45 A;  2OTJ N;  1L5U A;  4GV6 A;  2J4R A;  4FOI A;  5LY3 A;  5IWA K;  3L2V A;  1UAX A;  4GV9 A;  1IJJ A;  4HCC A;  4CK3 A;  4CJR A;  4KHQ A;  3CCV N;  4DQI A;  4DTJ A;  1X9M A;  3TAG A;  3QIP A;  2RPI A;  1XMO K;  4BRP A;  5EY4 A;  5DM6 L;  1G99 A;  2QWP A;  2UU9 K;  3NGZ A;  3FR0 A;  3ZSO A;  3AVF A;  5AZI A;  1XHZ A;  2IVN A;  1U49 A;  2OPR A;  4OVL A;  4JI6 K;  3OVN A;  1X3M A;  2ASM A;  2DFE A;  3NF6 A;  3P5J A;  4H0V B;  5C15 A;  2D4W A;  1VSL A;  4IEE A;  4FLX A;  1KTQ A;  5J2N A;  2GX9 A;  4GV3 A;  3VOV A;  4CJQ A;  1X9S A;  3HYF A;  2A40 A;  4LF8 K;  3IKM A;  4E19 A;  5FPD A;  3CC2 N;  3AVH A;  4U7B A;  2KFZ A;  2D5R A;  4CZH A;  2PYJ A;  2IAJ A;  3TPQ A;  4BRI A;  3NH0 A;  4CW7 B;  4LFB K;  1K8K A;  1NOY A;  3KTQ A;  4M42 A;  4N5S A;  2UUB K;  2ITG A;  1VQ7 N;  3CCJ N;  2OZM A;  4H4O A;  4Z4H A;  1KCF A;  1KLM A;  5CHI A;  3OY9 A;  4E7H A;  3WT0 A;  4O0J A;  2P9U B;  2P9L A;  3RTV A;  1C6V A;  4CFB A;  3H3N O;  2UXB K;  4AHR A;  4CJU A;  4CGI A;  3IUC A;  4BDY A;  3CCS N;  2IOC A;  2H3G X;  3VMF B;  4CJP A;  3CC4 N;  1NOZ A;  1SAZ A;  3AGR A;  4BRM A;  4GW6 A;  2IGI A;  3VQ4 A;  1Q8I A;  1C1B A;  2QWL A;  4JI0 K;  4B1Z A;  1N32 K;  1ATN A;  4JRQ A;  2V51 B;  1NGB A;  3H1V X;  3WQT A;  3F73 A;  1LW2 A;  4C8N A;  3TSP A;  1BGX T;  3O4W A;  1GLC G;  4QCL A;  3QLH A;  3ZSY A;  3NFA A;  4JHD A;  3RR7 A;  5KRS A;  1S22 A;  3CCU N;  3C0B A;  3DRS A;  3FZL A;  2IIR A;  1HUX A;  1I94 K;  4DR4 K;  2E88 A;  4AF1 A;  2HHH K;  3VQ5 A;  3G6E N;  4I7F A;  1RDW X;  4K42 A;  4FLY A;  3ZX0 A;  2ZF5 O;  2QA4 N;  2GBZ A;  1BA1 A;  3SAF A;  4RCH A;  3VPZ A;  3DLB A;  3CCQ N;  1NG9 A;  1SQK A;  4HTL A;  4E1J A;  3QEV A;  1GLB G;  4BQZ A;  3SMS A;  2PBD A;  3VA3 A;  3SJJ A;  3OS0 A;  3CCR N;  4JYA K;  3OYA A;  3PLA A;  1BU6 O;  2HNY A;  5GAE P;  4OPH A;  4IJN A;  2OTL N;  2PY5 A;  2JWL A;  3OHR A;  3T19 A;  2XHB A;  1KC8 O;  5I42 A;  1TL3 A;  1NK9 A;  1DLO A;  5AQV A;  2WFB A;  1YJN N;  5AQP A;  2O8D B;  5KGW A;  1QSS A;  4CZM A;  1GOB A;  3BY5 A;  1SKW A;  5EXW A;  1Q86 O;  1HJO A;  3FFK B;  3NGY A;  4CEQ A;  4F8R A;  1XC3 A;  3HO1 A;  5M1F A;  2KZM A;  5K14 A;  4CJW A;  4GKJ K;  3GDQ A;  3L6Q A;  4MQ3 A;  1W9H A;  5HBM A;  3V9W A;  4JI2 K;  1KFS A;  2Z1I A;  4AH9 A;  3V9U A;  2Z1H A;  1RBU A;  3AV9 A;  3AAR A;  4BRL A;  4KHP K;  3HL8 A;  3MX2 A;  2O8E A;  5AQF A;  3G71 N;  1HPM A;  1XNR K;  1CXQ A;  3TTF A;  4B9V A;  3LPU A;  4AIL C;  3MX5 A;  3HZ6 A;  5I3U A;  4YOX A;  4E7L A;  2JGU A;  3ZX3 A;  4CHZ A;  1U47 A;  5M1K A;  3SV3 A;  3AVI A;  4DFM A;  1TYQ A;  1NGC A;  4DQ8 A;  4DV7 K;  2HBL A;  1NK8 A;  4BRF A;  2YKM A;  2D0P A;  4WFA L;  1WSF A;  1C0U A;  2CH5 A;  4A5A A;  1DEJ A;  1X9W A;  4XH1 A;  5AZJ A;  4YFU A;  3VEZ A;  3EE9 A;  2XY8 A;  2HHS A;  3GBT A;  4J2A A;  3B6P A;  3HPG A;  2QWR A;  4N56 A;  3FZH A;  3J80 O;  3ZSZ A;  3C95 A;  4CJ5 A;  5AQY A;  4M7Y A;  3K2P A;  1YT3 A;  1KXP A;  2P9K A;  4B9S A;  4RWT A;  3NCI A;  4R79 A;  4FOE A;  3HPH A;  4LF7 K;  3EE8 A;  4DV3 K;  1KAY A;  2QWQ A;  4PKH A;  1R0A A;  3KK2 A;  3ENO A;  1KQS M;  5AQN A;  3KD5 E;  2FF3 B;  4X62 K;  1N34 K;  2OPQ A;  3IRX A;  3G0Z A;  1A5W A;  3KWI A;  3OS1 A;  4WE1 A;  2G8F A;  4B9U A;  3R8E A;  1J53 A;  1V4T A;  1NU0 A;  3CJA A;  3PO4 A;  1JLF A;  4KB1 A;  5BRD A;  2GUI A;  3PUF A;  2P9S A;  4JRP A;  4CHQ A;  4FCY A;  1OH8 A;  4KH4 A;  3D0P A;  3PSI A;  1NGH A;  2FXU A;  2E6M A;  2VG5 A;  4CFA A;  5M1P A;  1XC9 A;  4EZ9 A;  4I9Q A;  1HQU A;  3CCM N;  2YNF A;  4OPA A;  1IKV A;  4ISG A;  3U8X A;  2G8H A;  3ZSQ A;  2WBN A;  4K43 A;  4DV4 K;  3VQ7 A;  5CYQ A;  4XH4 A;  4BRD A;  5JS2 A;  4Z4C A;  3E66 A;  4V19 S;  3CJ7 A;  2GTD A;  3WXL A;  3SI6 A;  1K8A O;  3SQ4 A;  3HTV A;  3JS6 A;  4OJR A;  1B92 A;  2E20 A;  2HHX A;  1S9E A;  1KVC A;  4DV5 K;  3KHY A;  1C0F A;  3VQ9 A;  1UA0 A;  4OPJ A;  3MXJ A;  2O8F A;  4RW6 A;  3W0L A;  4FM0 A;  3AA3 A;  3ZSX A;  4CEA A;  2NZT A;  1K6Y A;  2FLO A;  2P9P B;  3MED A;  1NLV A;  3FZK A;  4L3Q A;  4YOU A;  2YKN A;  1WAF A;  3R3L A;  3ENH A;  3O3H A;  1DT9 A;  4RTF D;  4FLU A;  5KRT A;  3LZJ A;  1OH7 A;  1GLF O;  4DTN A;  2FBY A;  1JLB A;  4IJA A;  1J9A A;  4HWI A;  4Z4F A;  5KQD A;  1VQM N;  3C6A A;  1EX4 A;  2HHU A;  4DCH A;  2ZJP L;  3DLR A;  3U6F A;  1VSK A;  3M8S A;  5M1N A;  5AZI B;  1X3N A;  4DTR A;  4JN4 A;  4FLV A;  4Z94 A;  5AQK A;  1HPZ A;  2FC0 A;  4G9Z A;  4DF4 A;  3P39 A;  3DLL L;  3J8A A;  1M90 O;  1NGI A;  1JL2 A;  4WFB L;  1LWF A;  3B6O A;  3C7N A;  5AQG A;  3HP6 A;  4Z4E A;  1QTM A;  2XO7 A;  5ADX A;  1QQM A;  2VYP A;  3U9D A;  4DSK A;  4BDZ A;  4BVP A;  4C8L A;  1VQO N;  3K5L A;  1MWK A;  1L3V A;  2F9W A;  5HRP A;  4CE9 A;  2X6N A;  3WUH A;  1QSY A;  1U6Z A;  1HKG A;  2D0C A;  3NE6 A;  1K8K B;  4QAG A;  1KAZ A;  3LDN A;  2QW9 A;  1MU2 A;  1S6Q A;  4ILG B;  2QEX N;  2E6L A;  4JD2 A;  3SUO A;  3P83 D;  5E84 A;  3VQE A;  4CZE A;  2P9L B;  3MCP A;  3CER A;  4KB0 A;  2B5J A;  3VQ6 A;  3W3D A;  1T8E A;  4AHC A;  3OYG A;  3RRH A;  4DR1 K;  3LPT A;  4FM1 A;  3SNN A;  2YHY A;  4DQP A;  3OBW A;  1YTU A;  1YJ9 N;  4IKF A;  4ILH A;  3SCX A;  1JLA A;  3E9O A;  1RFQ A;  3QEW A;  3PX4 A;  3J81 O;  1HNX K;  4B9T A;  2E2P A;  4FJG A;  3IFR A;  2UUC K;  2Y1J A;  2B6A A;  1TAU A;  4DSJ A;  4JV5 K;  4BDP A;  5BR9 A;  4CD3 A;  4BWM A;  2YHB A;  2OPP A;  3UIQ A;  4JHD B;  1Y97 A;  4FWP A;  1NNE A;  3RVC A;  4BRN A;  2ZQB A;  3P1G A;  1NK4 A;  3ZSW A;  4A2B A;  5F0X A;  4B9M A;  1HNW K;  4MO5 A;  4LF4 K;  3P4I A;  3AGK A;  3ZX2 A;  3MXM A;  4FK4 A;  2E1Z A;  4BGA A;  2HW3 A;  4BRH A;  3WNG A;  1B9F A;  1NM1 A;  4JKH A;  4KH6 A;  3L4I A;  3WEE B;  3WXK A;  2NNW A;  4HUF A;  4N47 A;  1YIJ N;  1ILY A;  3MN9 A;  3O9R A;  2ATQ A;  3ZEU A;  1OH5 A;  3SUP A;  5C42 A;  2GEL A;  4C8O A;  3S3O A;  5DM7 L;  1T6D A;  1JJ2 M;  4FJM A;  5CR4 A;  3VA0 A;  3AVM A;  4JKC A;  3MEE A;  5AQW A;  1NJW A;  1Z25 A;  4IBN A;  4CCH A;  3TI0 A;  3Q7C A;  1U48 A;  4KHW A;  5C12 A;  4RW9 A;  3AVA A;  3CPE A;  3AO1 A;  1YTA A;  3SPZ A;  3ZSR A;  1G15 A;  3G4S N;  4DQQ A;  3K5N A;  3M8Q A;  3HI0 A;  2DY4 A;  3DLE A;  4LSN A;  4BR9 A;  1JLE A;  4YOY A;  5AQR A;  3ID8 A;  4FWL A;  2HHT A;  2GWK A;  5GIP A;  5AQJ A;  4CF8 A;  3ATU A;  5HRN A;  3HVT A;  4PHT X;  2VQE K;  2CGJ A;  3CG7 A;  1TKX A;  1C1A A;  1R59 O;  4CFD A;  4B3M K;  2O8E B;  4FO0 A;  4H03 B;  2ITM A;  5BPL A;  2Q1N A;  4I2P A;  4BG8 A;  2V7Y A;  3OYC A;  4KPY A;  4CIF A;  3N4P A;  2A41 A;  3THW A;  1KAX A;  4JI1 K;  1TYQ B;  1ZBI A;  4B9L A;  2QXF A;  1J54 A;  4PKI A;  3LM2 A;  2KW4 A;  3UB5 A;  2HHW A;  1EQY A;  5AZJ B;  3ZYY X;  2G8V A;  4KRE A;  4BR7 A;  3LDQ A;  1CZ9 A;  3ZT2 A;  4BQL A;  4R5P A;  4Z4I A;  1DTQ A;  4PUO A;  3TAF A;  2HVI A;  2VWJ A;  4E0D A;  3OTO K;  3LZI A;  3MMV A;  4CED A;  2P9K B;  4OGE A;  5GAG P;  4AHU A;  1GLE G;  4B1Y B;  1LOT B;  3JAM O;  1N5Y A;  4FWO A;  1IKX A;  1TK8 A;  4CHY A;  3EL2 A;  3V1Q A;  4FJ7 A;  4LF6 K;  4E7I A;  1RT3 A;  4BRG A;  3LWL A;  3IAY A;  2Q36 A;  1ATS A;  4JNE A;  2FSJ A;  4JKE A;  4DFP A;  2E8A A;  2WUS A;  4ELT A;  2HF4 A;  3VTI A;  4LH4 A;  5AQI A;  3THX A;  1KRP A;  4ZTF A;  4O5F A;  4FVU A;  2VWB A;  3M6G A;  1H1V A;  2P9S B;  2GEM A;  3KLI A;  4BVO A;  4W5T A;  1QSL A;  4DB3 A;  4JI4 K;  1J5O A;  3NH1 A;  3OW2 M;  1NGG A;  2YI1 A;  1L3T A;  4B1W B;  1JCE A;  3CMA N;  5FDL A;  3O8M A;  5JMV A;  4JKD A;  2ZWH A;  2Q2R A;  4W5N A;  1VQ9 N;  5BRH A;  4M3R A;  5SWM A;  3HM9 A;  1BQM A;  5AR0 A;  1TGO A;  3AVJ A;  3DXM A;  3O1W A;  4PL7 A;  4G1Q A;  2A1R A;  1VK0 A;  3M3Z A;  3K9J A;  2O8F B;  3LP2 A;  4Z4G A;  4PY5 A;  1NKE A;  4FJN A;  4PKG A;  2ZGY A;  3L2U A;  4CJ7 A;  2WC9 A;  4QS8 A;  1NMN A;  3TAM A;  4I2Q A;  3F9M A;  4FLT A;  2I5J A;  2F8S A;  1RT1 A;  4NCB A;  3ID6 A;  1RBT A;  1J6Z A;  4FWQ A;  5LMU K;  3LDP A;  3CJ1 A;  3DJC A;  3K59 A;  4LFC K;  1Q82 O;  4YY3 K;  5AJ3 K;  3CJB A;  4A5B A;  4IFY A;  1E3M A;  1BWF O;  3A5L C;  4BR4 A;  2ZJR L;  1X1P A;  3O6W A;  4JK8 A;  1N33 K;  5KPZ A;  1BI4 A;  5KPR A;  3HOS A;  4JAX A;  1KSP A;  4DFK A;  5JVG L;  2OAN A;  4DTO A;  2P9N A;  3EEQ A;  2OYQ A;  4DS5 A;  4FLZ A;  4DTS A;  3VEV A;  4KTZ A;  4DTM A;  3NHG A;  3THY A;  2W41 A;  5B8H A;  2YHW A;  3DYA A;  3O9U A;  1VHX A;  3TAB A;  3C7N B;  2ZJQ L;  2HMI A;  4JKA A;  4DR2 K;  1WSJ A;  4KFB A;  1S6P A;  5KPT A;  3QNO A;  3JYT A;  4FL9 A;  1T03 A;  4FWM A;  3H3O B;  3LP1 A;  3NMU A;  4BRQ A;  2CGK A;  3LWM A;  4NYN A;  3OYI A;  2A42 A;  4KTW A;  4DHY A;  2Z1J A;  3J7Y P;  1NBW A;  2YNH A;  5JLF A;  2O8C B;  4BC2 A;  4OO1 J;  3V1O A;  2OA8 A;  4DUZ K;  2QWM A;  4IFE A;  1P90 A;  3VF4 A;  5GAH P;  4K8Z A;  1SL1 A;  3CJC A;  3A0I X;  1RTH A;  3EKS A;  1WSH A;  3S3N A;  3G25 A;  4FW1 A;  2QXL A;  3BP8 A;  5A2Q O;  1TK0 A;  5TKW A;  3OYB A;  2ETJ A;  1SV5 A;  2NUB A;  5J2Q A;  1MDU B;  5BRE A;  4F2S A;  1S5J A;  3KLG A;  5JS1 A;  2F8T A;  4H5R A;  5HRO A;  3THV A;  2LSN A;  1RDB A;  2CH6 A;  2IVO A;  1Z26 A;  4BRE A;  3V9X A;  3CME N;  2EWS A;  3MK6 A;  4FLW A;  4DQS A;  3QIC A;  3S41 A;  2E4L A;  3HSC A;  2GWJ A;  4H5N A;  4TSX A;  2HVH A;  5AQZ A;  4O55 A;  5FLX O;  1XHX A;  4FW2 A;  4WF9 L;  4F3T A;  2QKK A;  3I33 A;  1BO5 O;  3HT3 A;  3ITH A;  2O4G A;  2IC3 A;  1U2V A;  3V9S A;  2VCP A;  1JXB A;  3DXK A;  5LJW A;  4MDA A;  3UKU A;  2HST A;  4GVE A;  3ZEU B;  1TVR A;  1NJX A;  1IBM K;  2P9I A;  2Q0R A;  4W5R A;  4BRO A;  3VEO A;  2FSN A;  1EO1 A;  3TTD A;  3VQQ A;  3ZT1 A;  1KVB A;  3MXI A;  5J2M A;  2DFF A;  2IVP A;  3OYJ A;  3WNH A;  4AHT A;  5FPM A;  3O9Q A;  4CZI A;  4FYD A;  3DAW A;  2VG7 A;  3CCE N;  4KI4 A;  5AQT A;  1VSM A;  3DLH A;  4FJL A;  4PWD A;  5BN8 A;  3DRP A;  4HUE A;  2G8I A;  3J7A P;  3UKR A;  3WXM B;  5AFU A;  3BF3 A;  3QBW A;  5AQO A;  5BN9 A;  4HUG A;  1RGI A;  1N36 K;  4CEO A;  2X6S A;  3SJH A;  1XI1 A;  2G8W A;  2W6K A;  2FBX A;  3CQ8 A;  4QOZ B;  4CF2 A;  1WSE A;  4H5T A;  4X64 K;  3SUN A;  3OBY A;  4DU3 A;  2NRW A;  4HTU A;  3H46 O;  2IDO A;  1RDD A;  3OJS A;  1RDA A;  4ID1 A;  2I7N A;  4C23 A;  5KQ8 A;  3R1X A;  3THW B;  3D2E A;  1S1U A;  3O4N A;  3IS9 A;  3M8P A;  4DV1 K;  1XUP O;  2HNZ A;  3F9K A;  4NXM K;  4IOC L;  3E01 A;  4DS4 A;  3TAR A;  4N41 A;  4M3U A;  1NGF A;  3O9T A;  3HM8 A;  3M5R A;  1ATR A;  3BEX A;  4DLG A;  3A5M C;  1GLD G;  3DOK A;  3BF1 A;  4KHY A;  3CF5 L;  1VQK N;  1J5E K;  4LD0 A;  2AJQ A;  3AVG A;  4IZ9 A;  2JLE A;  4FZY A;  3QER A;  2F4V K;  4DTU A;  1NKC A;  3DMJ A;  1S1T A;  4NCG A;  3AVC A;  5AQQ A;  3AAQ A;  2YHX A;  3SMP A;  1RIL A;  4O44 A;  2FSK A;  1VQ6 N;  4B08 A;  4H0P A;  3CM5 A;  3O08 A;  3TAQ A;  3VTH A;  3ULD A;  4NB4 A;  4CJS A;  3QB0 A;  4KHN A;  2NLX A;  2OPS A;  3DM2 A;  4DWI A;  3AAP A;  3NF9 A;  3L4Q A;  4C1N K;  3THX B;  3CPW M;  4CEB A;  2HHQ A;  3O80 A;  1OVQ A;  5FRO A;  3CFR A;  4CES A;  5IT9 O;  5E26 A;  1SL2 A;  4ELU A;  4CGH A;  1ITG A;  3L3V A;  2F7T A;  1WAJ A;  2O8B A;  3ATV A;  2NRX A;  4BRA A;  1HYV A;  2X78 A;  4EP4 A;  3QFU A;  3P38 A;  1L3S A;  1WSI A;  3O9S A;  4Q0B A;  1Z6R A;  1VQ4 N;  1B9D A;  1BA0 A;  4A2A A;  1T6C A;  2OCE A;  3T1H K;  4BC3 A;  3SQ2 A;  4IFV A;  3ASM A;  2YCH A;  3DXM B;  3TTC A;  4AHV A;  1E4F T;  4B3T K;  3L2Q A;  4BC4 A;  4QS7 A;  4NXN K;  4E3S A;  4FXD A;  4FWR A;  1RT7 A;  2YNG A;  2ZE2 A;  3ULE A;  2P1J A;  1ZYQ A;  4DV2 K;  4A62 A;  3EYZ A;  4B1U B;  2W40 A;  1X9J A;  3VER A;  2OZS A;  2BTF A;  3L2W A;  5FPN A;  1QZ5 A;  3ZET A;  1D8Y A;  3QES A;  1WN7 A;  2XRI A;  3CCL N;  4CJ3 A;  3CXC M;  4CZG A;  1NGD A;  4YDU C;  5EX5 A;  4H8K A;  5BPN A;  1TUY A;  3VEW A;  3K0S A;  4CEF A;  4DSL A;  3C94 A;  3IMX A;  1VQ5 N;  3PIP L;  3K57 A;  4FSV A;  3TWH A;  3H6E A;  5CY4 A;  1LWC A;  3KIO A;  1WBB A;  1BI4 B;  2EX3 A;  4YOT A;  3SV4 A;  5M1O A;  1YUW A;  1ZXO A;  1A5V A;  1HMV A;  4FJ5 A;  3NDK A;  4IO8 A;  2F96 A;  3D2F A;  1VSH A;  3VN5 A;  3SYZ A;  2G8K A;  4KAZ A;  3I0S A;  2P9N B;  1QVF M;  4UQG A;  1D9F A;  3NF7 A;  3RR8 A;  4CBX A;  1ASV A;  3THY B;  3S3M A;  4NLC A;  1WUA A;  4OKE A;  2NRV A;  3CM6 A;  3WQU A;  3MEC A;  1NJZ A;  1RBS A;  3KVG A;  3KJV A;  4YHH K;  3U3G A;  3OYN A;  4M3W A;  1S1V A;  3F2K A;  3ZCM A;  4FJ8 A;  5HP1 A;  2A3Z A;  1VRT A;  4CI6 A;  3MDQ A;  5EU7 A;  5CYM A;  1W97 L;  1RTD A;  3VET A;  1RDU A;  4DR6 K;  4OKJ A;  3QET A;  3EY1 A;  4CF1 A;  2V52 B;  1NK6 A;  4O8K A;  4ISE A;  1GOC A;  4BGB A;  3T1A A;  4CFC A;  5C2F A;  2R7Y A;  3E9P A;  1WNS A;  4CF0 A;  1SS6 A;  3I55 N;  2E5L K;  4YDU A;  4I9L A;  2F9T A;  5F2R A;  3SUQ A;  3VGM A;  1RCH A;  1K73 O;  1Z05 A;  2RHK A;  2BDP A;  3VQP A;  1JL1 A;  3VQB A;  3HJF A;  4CJT A;  4WCE L;  1VQL N;  4FJH A;  1WSG A;  4AM6 A;  1HNV A;  3AO5 A;  4FJI A;  4CEZ A;  3CIP A;  4BWJ A;  1Q7Y O;  3ZSV A;  4DTP A;  4Q5V A;  1D9D A;  1XWL A;  4EZ6 A;  1C0G A;  4BR0 A;  4CD1 A;  2NRH A;  4CHP A;  5J2P A;  1IH7 A;  5AQM A;  5AQS A;  4DU1 A;  1TKD A;  2KQ2 A;  2NRZ A;  2KLA A;  4H0O A;  1XMQ K;  1NGE A;  3BDP A;  4H0X B;  4JI7 K;  4IG0 A;  4JI8 K;  3LM9 A;  3OYF A;  3CET A;  3OJU A;  4CJV A;  3DI6 A;  1IBK K;  3T69 A;  4DV0 K;  1WB9 A;  4YOW A;  2BE2 A;  4EIA A;  1FKP A;  5GIN A;  2E2O A;  4ICL A;  4Z0U A;  1BOT O;  3ZT0 A;  2VGN A;  4FK0 A;  3L0Q A;  1L3U A;  3RSE A;  2ASP A;  3FLC O;  3C6T A;  1XQS C;  5FRM A;  3WNE A;  1T3V A;  1HJR A;  3NBP A;  1IG9 A;  1BG3 A;  2KZZ A;  1U2V B;  2RE2 A;  4IEI A;  4M3T A;  2VGM A;  3DXK B;  4EHU A;  2RKI A;  3AY9 A;  3UKU B;  4GMJ B;  2RN2 A;  1EET A;  4DMN A;  2Q3S A;  2HBJ A;  3VGL A;  5ADX H;  4B8C A;  4IWV A;  4O8U A;  4IG3 A;  5I9E B;  4M3X A;  2P9I B;  2PZS A;  4EP5 A;  4A61 A;  4OLA A;  1F21 A;  4K41 A;  3M8R A;  3R6M A;  4XEI A;  4KRF A;  5JLH A;  3VF6 A;  2EHG A;  2V7Z A;  1VQN N;  1E4G T;  1I39 A;  4DTX A;  3TSQ A;  3H08 A;  3NVM A;  3ALY A;  1SKR A;  2A5X A;  3EKU A;  1T05 A;  4N76 A;  3O3F A;  1VAZ A;  4F4K A;  5M1Q A;  1GLL O;  3QFP A;  5AQH A;  4GNI A;  2FBT A;  1TV6 A;  4CZJ A;  1VSE A;  3UKR B;  4CJE A;  1KD1 O;  2QM1 A;  5EOY A;  1KVA A;  4CZL A;  5HRR A;  4IOX A;  3QNN A;  3AVL A;  2Q0U A;  3RWU A;  3LDO A;  2D0A A;  3EZ5 A;  4NO7 A;  4JS5 A;  4MFB A;  3AA2 A;  3V4I A;  2QWN A;  1K9M O;  1A5X A;  3DOL A;  5FPE A;  4DSF A;  1EWR A;  1ASU A;  2GV9 A;  4J2B A;  1ZBS A;  1SUQ A;  3A2F A;  3AO2 A;  4XH5 A;  4BAC A;  4FZZ A;  3D2E B;  5HRS A;  4JI5 K;  1DTT A;  2KTQ A;  3HBT A;  3HRG A;  3ISN C;  3CJ9 A;  1REV A;  1V4S A;  4ILJ A;  3NVK A;  3NF8 A;  3ZLJ A;  3I0R A;  3ENB A;  3SZ2 A;  2HOE A;  2BGG A;  3MWP A;  4I6M A;  3QBX A;  1GOA A;  2HF3 A;  5CZ1 A;  4RW7 A;  3C6U A;  3TSU A;  3DRR A;  4JI3 K;  3SBT A;  3TU5 A;  4DV6 K;  3BGR A;  3PX6 A;  3KK7 A;  2XY7 A;  4J2E A;  4LF5 K;  2E2N A;  2I7P A;  3VEX A;  4JKG A;  2E1Y A;  3ZT4 A;  1T7P A;  1MWM A;  4A59 A;  1RNH A;  3SAG A;  4M45 A;  3D7E O;  1ZBH A;  4DQR A;  3FFI A;  3U4L A;  3FGU A;  4B9Q A;  1YIT N;  3QEI A;  4IXC A;  1NGJ A;  4CJF A;  1RTJ A;  3HOT A;  1NWK A;  4B1V A;  1W7A A;  1S3X A;  4WQ4 C;  3MWT A;  5J1E A;  4CK1 A;  3HK2 A;  2NRT A;  2HHV A;  3E9L A;  4K25 A;  2FF6 A;  1JLC A;  3CI5 A;  3SBG A;  1ESV A;  5GAD P;  3TAN A;  4M63 C;  2GUP A;  1NK0 A;  4BRC A;  3VQD A;  2AA4 A;  3BUZ B;  5HOO A;  2O8B B;  1LAV A;  2KHO A;  4BE2 A;  3M1F A;  3KD1 E;  3KLH A;  1WOQ A;  4CZK A;  1YXQ A;  4KBO A;  1GLA G;  4BG9 A;  1DKG D;  1TKT A;  4E7K A;  1FXX A;  3LDS A;  1HQE A;  3HP9 A;  1YI2 N;  1TAQ A;  4BRK A;  3WEE A;  4B1X B;  4EFH A;  5T7B A;  1S1X A;  4JD2 B;  4RG8 A;  4YNQ A;  4CZF A;  1WLJ A;  3HST B;  3TAP A;  3KK1 A;  3GOI A;  3H1Q A;  1C1C A;  3L3U A;  4RW8 A;  3LP0 A;  3CFO A;  3I56 N;  4FJK A;  3U9Z A;  4KKO A;  1W2B M;  4FVM A;  2ZGZ A;  3ULE B;  3QML A;  1W0H A;  2DFH A;  4O0I A;  3C6H A;  4MO4 A;  1NGA A;  5C25 A;  1ZBL A;  1N8R O;  5DK5 A;  4DR5 K;  4WQ4 A;  4E7J A;  3ZET B;  4L8R B;  2QKB A;  1RT6 A;  3J7Z O;  2Q31 A;  4CER A;  4X65 K;  5H1S Q;  4X66 K;  1CLQ A;  3CC7 N;  2Q97 A;  3T7Z A;  3K58 A;  3U3Y A;  4BR5 A;  3PSF A;  3BZK A;  4CHO A;  4C8K A;  1ZC6 A;  1IV0 A;  5SZT A;  3CD6 N;  3C65 A;  1Y64 A;  4NCA A;  2WOM A;  4UY8 O;  4HVJ A;  2P51 A;  4CIG A;  3K9K A;  3D2F B;  2HBM A;  1BIS A;  3WXI A;  3AA5 X;  3L2R A;  4DLE A;  3SAH A;  3VQC A;  1SKS A;  1HR0 K;  4ZHR A;  1YVU A;  5D3G A;  4CGF A;  1FK9 A;  3WXJ A;  1BL3 A;  3KLF A;  3FE1 A;  3FZM A;  3G10 A;  4O5B A;  2CGL A;  2QK9 A;  5AQL A;  1VSI A;  3VQA A;  3IG1 A;  4IO9 L;  4OGC A;  2W42 A;  3MN6 A;  4NYF A;  4DSI A;  3D45 A;  3KZB A;  3NGI A;  4OX9 K;  1YF5 L;  1S72 N;  3GE1 A;  4CBW A;  1RBV A;  3QIO A;  3QIN A;  2RF2 A;  3KK3 A;  2XY5 A;  3VEY A;  1O13 A;  4B3S K;  2PFU A;  1VQP N;  3GG4 A;  4FJJ A;  4OKK A;  4CJK A;  5CE3 A;  3QEX A;  3SPY A;  4JK7 A;  3LDL A;  3OYM A;  4BY9 C;  1CZB A;  4CF9 A;  3OS2 A;  2BAN A;  4RW4 A;  2HB5 A;  4CHN A;  3OYD A;  2AP1 A;  3LP3 A;  5TKY A;  1JCF A;  1Q9Y A;  2A1S A;  4CGD A;  4F2R A;  4MDB A;  4JEP A;  3V1R A;  1QQN A;  4KTQ A;  4JKF A;  4GKK K;  1QQC A;  1YHQ N;  5CZ2 A;  1SL0 A;  2O4I A;  1VSJ A;  2E2Q A;  4FWS A;  2B4J A;  1HRH A;  1CZA N;  4FM2 A;  3O4Q A;  3SQ1 A;  3RMC A;  2D0B A;  3UE5 A;  3GL1 A;  1EWQ A;  5KTQ A;  5JIC A;  4EAH D;  4FK2 A;  1QQO A;  1TKZ A;  4BR2 A;  2QI2 A;  5AQU A;  1UWB A;  3A8Y A;  2PYL A;  1GLJ O;  2YJE A;  4DG1 A;  3S9H A;  5F1X A;  1TK5 A;  3MEG A;  1QHT A;  3K5M A;  2Z1G A;  3N4Q A;  3QEP A;  2G8U A;  5FRN A;  3E1Y A;  1ZBU A;  4YOV A;  3MN7 A;  4KI6 A;  4KO0 A;  3A5O C;  4WYB A;  3P31 A;  2P9U A;  4OPK A;  1KLN A;  3KKR A;  4PA1 A;  1VRU A;  2DTU A;  3RSE B;  3TAE A;  2KFN A;  4JLH A;  1FW6 A;  3CFP A;  2YHA A;  4KH5 A;  4E1M A;  3VEN A;  3HXM A;  3T1Y K;  1IKY A;  2ZD1 A;  1HNZ K;  3PO5 A;  4H5V A;  1OVY A;  5EVZ A;  1JXE A;  1U4B A;  4DU4 A;  1RBR A;  4K0K K;  1QZ6 A;  3MN5 A;  4E1N A;  4BE1 A;  4CEC A;  4LC9 B;  2HBK A;  2D1K A;  1XNQ K;  2QTD A;  3QO9 A;  4H4M A;  1BIZ A;  1ASW A;  4FJX A;  4Y0W A;  1EP4 A;  2DPN A;  3LAK A;  4H0T B;  3AA4 A;  5ELZ A;  1BUP A;  3VES A;  4JKB A;  3R9P A;  5JVH L;  1DGK N;  3AO3 A;  1CXU A;  3K5O A;  2PAV A;  1JLQ A;  3L8B A;  1D5A A;  4C1N I;  1LAW A;  1YAG A;  1TL1 A;  4DKW A;  2KKZ A;  4LY7 A;  1HNI A;  3LAM A;  5GIO A;  1WBD A;  4Y1D A;  1VQ8 N;  5HL7 L;  1HLU A;  1OKJ A;  4IOA L;  1BQN A;  3KKS A;  4CBU A;  5KGX A;  4DR3 K;  3ZT3 A;  4GVM A;  3LL3 A;  3IDH A;  4CGJ A;  5LJV A;  1YVN A;  1BCO A;  1SZ2 A;  2FBV A;  5C2D A;  4DR7 K;  3EZW A;  2UUA K;  4DFJ A;  5C0Y A;  4JS4 A;  2P5O A;  3LAL A;  1D4X A;  3CQY A;  3F5T A;  3MCA B;  4H0Y B;  2A6A A;  3JXU A;  1BIU A;  3A5N C;  4WQ5 C;  4F9O A;  1N6Q A;  1RDC A;  3QDK A;  4J8F A; 
#chains in the Genus database with same CATH homology
 4CK2 A;  3KD5 E;  3BDP A;  2OPQ A;  4IG0 A;  1KSP A;  4DFK A;  3IRX A;  3G0Z A;  1A5W A;  3OS1 A;  3OYF A;  3I8D A;  4WE1 A;  4XIU A;  4DTO A;  1S1W A;  2G8F A;  3OJU A;  1EKE A;  4CJV A;  2OYQ A;  3PY8 A;  4CIE A;  3DI6 A;  4B9U A;  4DS5 A;  4FLZ A;  4DTS A;  4KTZ A;  4DTM A;  3NHG A;  2BE2 A;  1J53 A;  1FKP A;  2XY6 A;  4ICL A;  4Z0U A;  1LW0 A;  3ZT0 A;  4FK0 A;  4Y1C A;  1L3U A;  4K8X A;  3PO4 A;  1JLF A;  4KB1 A;  3TAB A;  3DYA A;  3C6T A;  2GUI A;  1QS4 A;  3PUF A;  4CJL A;  3WNE A;  1ZBF A;  1BCM A;  4JRP A;  2HMI A;  4CHQ A;  4FCY A;  5FRM A;  1HJR A;  3NBP A;  1WSJ A;  2X74 A;  3D0P A;  4KFB A;  1IG9 A;  2KZZ A;  2E6M A;  2VG5 A;  4CFA A;  2IS3 A;  1XC9 A;  4EZ9 A;  4I9Q A;  1HQU A;  1S6P A;  4FJ9 A;  2YNF A;  3QNO A;  4M3T A;  3JYT A;  1IKV A;  1T03 A;  1HYZ A;  1JKH A;  2RKI A;  2G8H A;  1KFD A;  3ZSQ A;  1I3A A;  3LP1 A;  4GMJ B;  2RN2 A;  1EET A;  4DMN A;  2Q3S A;  2VWK A;  4ID5 A;  3LWM A;  1NK5 A;  4KHS A;  3RRG A;  4B8C A;  3VQ7 A;  4NYN A;  5CYQ A;  3OYI A;  4ELV A;  5JS2 A;  4Z4C A;  3OYH A;  5KI6 A;  4KTW A;  1RT5 A;  4IG3 A;  4CJ4 A;  1C0T A;  4M3X A;  1RT2 A;  1IO2 A;  4C8M A;  2PZS A;  2Z1J A;  1QE1 A;  4EP5 A;  3SI6 A;  2P5G A;  3O3G A;  2YNH A;  3SQ4 A;  3JSM A;  4OLA A;  1F21 A;  4OJR A;  3M8R A;  1JLG A;  1B92 A;  4KRF A;  4DSE A;  2HHX A;  2EHG A;  1S9E A;  1KVC A;  3V1O A;  2OA8 A;  3AO4 A;  1VSF A;  4LSL A;  3VQ9 A;  1I39 A;  1UA0 A;  1O1W A;  4DTX A;  3H08 A;  3LAN A;  3MXJ A;  4OPJ A;  3AVB A;  4RW6 A;  1UOC A;  3ALY A;  3MAQ A;  4K8Z A;  3DLK A;  1SKR A;  4B3O A;  4ZTJ A;  1T05 A;  4N76 A;  3O3F A;  1SL1 A;  4FM0 A;  4F4K A;  3AA3 A;  1RTH A;  3ZSX A;  4CEA A;  1HYS A;  3NH2 A;  1K6Y A;  1WSH A;  3S3N A;  1Q9X A;  3MED A;  5HLF A;  3KLE A;  3HVR A;  1EXQ A;  4FW1 A;  2YKN A;  1WAF A;  2FBT A;  1TV6 A;  3AVN A;  1VSE A;  4CJE A;  3AVK A;  3RMD A;  1KVA A;  5HRR A;  3O3H A;  1TK0 A;  3QNN A;  3AVL A;  3DLG A;  4FLU A;  3RWU A;  3OYB A;  1C0M A;  2D0A A;  2ETJ A;  1FKO A;  5KRT A;  3EZ5 A;  3LZJ A;  2YNI A;  1SV5 A;  2NUB A;  2FBY A;  4JS5 A;  4DTN A;  4HCB A;  5J2Q A;  4M41 A;  3VQ8 A;  4BE0 A;  4MFB A;  3AA2 A;  1JLB A;  3V4I A;  4F2S A;  1S5J A;  1A5X A;  3DOL A;  4DSF A;  1J9A A;  3KLG A;  1ASU A;  4DF8 A;  5JS1 A;  2GV9 A;  4M3Y A;  3V9Z A;  2F8T A;  4J2B A;  2VG6 A;  1RT4 A;  1SUQ A;  3OYE A;  5HRO A;  3THV A;  3A2F A;  2LSN A;  1RDB A;  3AO2 A;  1NK7 A;  3RMB A;  4Z4F A;  5C24 A;  4BAC A;  1Z26 A;  3TR8 A;  3V9X A;  4FZZ A;  4F3O A;  5HRS A;  1EX4 A;  4FLW A;  4DQS A;  2HHU A;  1DTT A;  1NKB A;  3DLR A;  2KTQ A;  3T3F A;  3U6F A;  1VSD A;  1VSK A;  3M8S A;  4J2D A;  3ISN C;  1REV A;  2E4L A;  4DTR A;  3NF8 A;  3I0R A;  4AHS A;  4FLV A;  3SZ2 A;  4FZX C;  1HPZ A;  2BGG A;  2FC0 A;  4DF4 A;  4TSX A;  2HVH A;  3PX0 A;  4O55 A;  3WNF A;  1JL2 A;  1GOA A;  1XHX A;  4FW2 A;  4RW7 A;  5CZ1 A;  4E89 A;  1LWF A;  3B6O A;  4F3T A;  2QKK A;  3C6U A;  4B9N A;  2YV0 X;  3HT3 A;  3ITH A;  3SQ0 A;  3HP6 A;  4Z4E A;  3DRR A;  2O4G A;  2IC3 A;  3NAE A;  1QTM A;  3V9S A;  4O4G A;  1IKW A;  2XO7 A;  1LV5 A;  1JXB A;  4W5Q A;  4DSK A;  3V81 A;  4BDZ A;  3BGR A;  3PX6 A;  2WON A;  4C8L A;  3K5L A;  2XY7 A;  4J2E A;  3PV8 A;  1TVR A;  1L3V A;  3ZT4 A;  5HRP A;  4CE9 A;  2X6N A;  5DMR A;  1T7P A;  1QSY A;  4PQU A;  1RNH A;  1RTI A;  3NE6 A;  2D0C A;  4M45 A;  1ZBH A;  4DQR A;  3FFI A;  1NJX A;  4QAG A;  1U04 A;  4LH5 A;  3QEI A;  4W5R A;  4CJF A;  1RTJ A;  2HND A;  1MU2 A;  1S6Q A;  4B8A B;  2E6L A;  3HPO A;  3RMA A;  3VQQ A;  3ZT1 A;  3P83 D;  3SUO A;  5J1E A;  1KVB A;  3MXI A;  3VQE A;  2DFF A;  4IDK A;  4CK1 A;  5J2M A;  3OYJ A;  2Y1I A;  4CGG A;  3WNH A;  3HK2 A;  4AHT A;  4KB0 A;  2HHV A;  1S9G A;  2B5J A;  3VQ6 A;  4HHT A;  4KHU A;  1JLC A;  3OYK A;  1T8E A;  4FYD A;  4CEE A;  1BHL A;  3TAN A;  2VG7 A;  4AHC A;  3OYG A;  3RRH A;  3V6D A;  1NK0 A;  3CYM A;  4KV8 A;  4KI4 A;  1NJY A;  1VSM A;  3VQD A;  5E41 A;  3DLH A;  4FJL A;  3LPT A;  4M3Z A;  4FM1 A;  3SNN A;  4PWD A;  1LWE A;  1LAV A;  3DRP A;  4HUE A;  4BE2 A;  4DQP A;  2G8I A;  3KD1 E;  3KLH A;  1YTU A;  4OLB A;  4W5O A;  4IKF A;  3OYL A;  4HUG A;  1UA1 A;  1U45 A;  3SCX A;  4CEO A;  2X6S A;  1JLA A;  3QEW A;  1TKT A;  1XI1 A;  3PX4 A;  4E7K A;  1L5U A;  2G8W A;  2FBX A;  1FXX A;  3LDS A;  3CQ8 A;  4B9T A;  1HQE A;  4QOZ B;  3HP9 A;  3L2V A;  4CF2 A;  1TAQ A;  1UAX A;  4HCC A;  4FJG A;  1WSE A;  4CK3 A;  5T7B A;  4CJR A;  3SUN A;  1S1X A;  4DQI A;  4KHQ A;  2Y1J A;  4DU3 A;  2B6A A;  4RG8 A;  4YNQ A;  1TAU A;  4DTJ A;  1X9M A;  1WLJ A;  4DSJ A;  4HTU A;  3QIP A;  2IDO A;  2RPI A;  1RDD A;  3TAG A;  3OJS A;  4BDP A;  3HST B;  1RDA A;  4ID1 A;  4BWM A;  3TAP A;  2YHB A;  3KK1 A;  2OPP A;  3UIQ A;  1S1U A;  3O4N A;  3IS9 A;  1C1C A;  3L3U A;  3M8P A;  4RW8 A;  2HNZ A;  3LP0 A;  3CFO A;  1Y97 A;  4FJK A;  3F9K A;  4KKO A;  3NGZ A;  4FVM A;  3E01 A;  3ZSO A;  3AVF A;  4DS4 A;  1W0H A;  2DFH A;  3TAR A;  4N41 A;  2ZQB A;  3P1G A;  4O0I A;  3ZSW A;  1XHZ A;  1U49 A;  1NK4 A;  2OPR A;  4OVL A;  4B9M A;  3OVN A;  5C25 A;  4M3U A;  2DFE A;  3NF6 A;  3P5J A;  1ZBL A;  5DK5 A;  3MXM A;  4DLG A;  4E7J A;  4FK4 A;  1VSL A;  2HW3 A;  3DOK A;  3WNG A;  4KHY A;  1B9F A;  4L8R B;  2QKB A;  4FLX A;  1KTQ A;  1RT6 A;  5J2N A;  4LD0 A;  4CER A;  2AJQ A;  3AVG A;  4CJQ A;  1CLQ A;  1X9S A;  2JLE A;  4FZY A;  3HYF A;  3QER A;  3K58 A;  3U3Y A;  4HUF A;  4CHO A;  4E19 A;  4C8K A;  5SZT A;  4DTU A;  1NKC A;  3DMJ A;  4N47 A;  3AVH A;  2KFZ A;  1S1T A;  2ATQ A;  4NCA A;  4NCG A;  2D5R A;  2WOM A;  3AVC A;  2PYJ A;  3SUP A;  4HVJ A;  2IAJ A;  2P51 A;  5C42 A;  4C8O A;  4CIG A;  3NH0 A;  3S3O A;  1RIL A;  4O44 A;  4FJM A;  4B08 A;  1NOY A;  3KTQ A;  4M42 A;  3CM5 A;  1BIS A;  4N5S A;  3VA0 A;  3TAQ A;  3AVM A;  3MEE A;  3ULD A;  3AA5 X;  2ITG A;  3L2R A;  1NJW A;  4CJS A;  1Z25 A;  4IBN A;  4CCH A;  4DLE A;  4KHN A;  2OZM A;  4H4O A;  4Z4H A;  3VQC A;  1KCF A;  1KLM A;  2OPS A;  3DM2 A;  3TI0 A;  1U48 A;  1SKS A;  3NF9 A;  4ZHR A;  1YVU A;  4DWI A;  4KHW A;  5D3G A;  4RW9 A;  3AVA A;  4CGF A;  1FK9 A;  3OY9 A;  4E7H A;  4O0J A;  1BL3 A;  3KLF A;  3AO1 A;  1YTA A;  3RTV A;  3SPZ A;  3ZSR A;  1G15 A;  1C6V A;  4CEB A;  3G10 A;  4O5B A;  4DQQ A;  2HHQ A;  3K5N A;  4CFB A;  5FRO A;  3CFR A;  2QK9 A;  3M8Q A;  1VSI A;  3VQA A;  4CES A;  1SL2 A;  4ELU A;  2DY4 A;  4AHR A;  3IG1 A;  4CJU A;  3DLE A;  4LSN A;  4OGC A;  4CGI A;  4CGH A;  2W42 A;  4BDY A;  1ITG A;  1JLE A;  3L3V A;  4NYF A;  4DSI A;  2HHT A;  1WAJ A;  3D45 A;  3NGI A;  2IOC A;  4CF8 A;  4CJP A;  1NOZ A;  1HYV A;  2X78 A;  4EP4 A;  4GW6 A;  2IGI A;  3HVT A;  5HRN A;  1L3S A;  3VQ4 A;  1Q8I A;  3CG7 A;  1TKX A;  1C1A A;  1WSI A;  1C1B A;  4Q0B A;  4CFD A;  1RBV A;  3QIO A;  3QIN A;  4JRQ A;  2RF2 A;  3KK3 A;  2XY5 A;  1B9D A;  3F73 A;  1LW2 A;  4C8N A;  1BGX T;  4I2P A;  3SQ2 A;  4IFV A;  3OYC A;  3ASM A;  4KPY A;  4QCL A;  4FJJ A;  3QLH A;  4CIF A;  3ZSY A;  4OKK A;  4AHV A;  4CJK A;  3QEX A;  3SPY A;  3L2Q A;  3NFA A;  1ZBI A;  4B9L A;  4E3S A;  2QXF A;  3RR7 A;  5KRS A;  1J54 A;  3OYM A;  1CZB A;  4FXD A;  4CF9 A;  1RT7 A;  2BAN A;  4RW4 A;  3OS2 A;  2YNG A;  3DRS A;  2KW4 A;  2ZE2 A;  2HB5 A;  2P1J A;  4CHN A;  1ZYQ A;  3OYD A;  3LP3 A;  3EYZ A;  2HHW A;  1Q9Y A;  2G8V A;  2A1S A;  4KRE A;  2OZS A;  4CGD A;  4F2R A;  1CZ9 A;  3ZT2 A;  3V1R A;  3VQ5 A;  4R5P A;  3L2W A;  4KTQ A;  4Z4I A;  1QQC A;  1DTQ A;  4I7F A;  4PUO A;  3TAF A;  5CZ2 A;  4FLY A;  1SL0 A;  2O4I A;  2HVI A;  2VWJ A;  4E0D A;  1VSJ A;  3QES A;  1WN7 A;  2XRI A;  2B4J A;  1HRH A;  1D8Y A;  4CJ3 A;  3LZI A;  4FM2 A;  2GBZ A;  3O4Q A;  4CED A;  4OGE A;  4H8K A;  3SQ1 A;  3RMC A;  4AHU A;  3DLB A;  2D0B A;  4CEF A;  4DSL A;  3C94 A;  3QEV A;  5KTQ A;  4FK2 A;  1N5Y A;  3K57 A;  3TWH A;  1IKX A;  3VA3 A;  5CY4 A;  3SJJ A;  1LWC A;  3KIO A;  3OS0 A;  1TKZ A;  1TK8 A;  4CHY A;  3OYA A;  1BI4 B;  2EX3 A;  2HNY A;  3SV4 A;  1UWB A;  3V1Q A;  4FJ7 A;  1A5V A;  4E7I A;  2PYL A;  1HMV A;  4FJ5 A;  1RT3 A;  3NDK A;  3VN5 A;  2F96 A;  4KAZ A;  1VSH A;  4DG1 A;  3SYZ A;  3S9H A;  1TK5 A;  3I0S A;  2G8K A;  3MEG A;  3LWL A;  3IAY A;  1QHT A;  3K5M A;  4UQG A;  2Z1G A;  3QEP A;  3NF7 A;  1D9F A;  2G8U A;  2PY5 A;  3RR8 A;  5FRN A;  4DFP A;  1ZBU A;  3S3M A;  1ASV A;  4KI6 A;  4KO0 A;  3T19 A;  2XHB A;  4ELT A;  5I42 A;  1TL3 A;  4LH4 A;  1NK9 A;  1DLO A;  3CM6 A;  4OKE A;  4OPK A;  1KLN A;  3KKR A;  3MEC A;  4PA1 A;  1VRU A;  1RBS A;  4ZTF A;  1NJZ A;  1KRP A;  5KGW A;  2DTU A;  3TAE A;  1QSS A;  3KJV A;  4JLH A;  2KFN A;  1GOB A;  3CFP A;  1SKW A;  3U3G A;  2YHA A;  3KLI A;  3NGY A;  4CEQ A;  4F8R A;  4E1M A;  3HXM A;  3OYN A;  4W5T A;  3HO1 A;  1IKY A;  2ZD1 A;  1QSL A;  1J5O A;  4M3W A;  2KZM A;  3NH1 A;  1S1V A;  3PO5 A;  5K14 A;  4CJW A;  3ZCM A;  4FJ8 A;  5HP1 A;  1L3T A;  4MQ3 A;  1W9H A;  5HBM A;  3V9W A;  1VRT A;  1KFS A;  2Z1I A;  1JXE A;  1U4B A;  4DU4 A;  1RBR A;  5EU7 A;  4AH9 A;  3V9U A;  5CYM A;  4E1N A;  5FDL A;  4CEC A;  4BE1 A;  2Z1H A;  1RTD A;  1RBU A;  3AV9 A;  4OKJ A;  3QET A;  3EY1 A;  3QO9 A;  4CF1 A;  3HL8 A;  4H4M A;  4W5N A;  1NK6 A;  1BIZ A;  1ASW A;  4FJX A;  1GOC A;  3T1A A;  4CFC A;  2R7Y A;  1CXQ A;  1EP4 A;  3LAK A;  1WNS A;  4CF0 A;  4B9V A;  3LPU A;  4AIL C;  4M3R A;  3AA4 A;  5I3U A;  5SWM A;  4E7L A;  4I9L A;  3HM9 A;  1BQM A;  3SUQ A;  2JGU A;  3AO3 A;  1TGO A;  3AVJ A;  1CXU A;  3K5O A;  4CHZ A;  3SV3 A;  1RCH A;  1U47 A;  3AVI A;  1JLQ A;  3L8B A;  4DFM A;  2BDP A;  3VQP A;  1JL1 A;  4G1Q A;  1D5A A;  3VQB A;  2A1R A;  1LAW A;  1VK0 A;  1NK8 A;  3HJF A;  1TL1 A;  2YKM A;  4CJT A;  4LY7 A;  3LP2 A;  4Z4G A;  1HNI A;  3LAM A;  4FJH A;  4PY5 A;  1WSF A;  1NKE A;  1C0U A;  4FJN A;  3L2U A;  1X9W A;  4Y1D A;  1WSG A;  4YFU A;  1HNV A;  3AO5 A;  4FJI A;  2XY8 A;  1BQN A;  4CEZ A;  2HHS A;  3TAM A;  4J2A A;  3KKS A;  4BWJ A;  3ZSV A;  3B6P A;  3HPG A;  4I2Q A;  4DTP A;  4FLT A;  4N56 A;  2I5J A;  4Q5V A;  1D9D A;  2F8S A;  1XWL A;  5KGX A;  3ZT3 A;  1RT1 A;  3ZSZ A;  4EZ6 A;  4NCB A;  3C95 A;  4GVM A;  4CJ5 A;  4CGJ A;  1RBT A;  3K2P A;  4CHP A;  1YT3 A;  1BCO A;  3K59 A;  5J2P A;  2FBV A;  4DFJ A;  4B9S A;  4JS4 A;  2P5O A;  1IH7 A;  3LAL A;  3NCI A;  3HPH A;  4DU1 A;  1TKD A;  4IFY A;  1R0A A;  1BIU A;  2KQ2 A;  1RDC A;  1N6Q A;  3KK2 A;  1X1P A;  1BI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...