3VQQA

Hiv-1 integrase core domain in complex with 2,1,3-benzothiadiazol-4-amine
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
152
structure length
144
Chain Sequence
SPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACDWAGIKQEDGIPYNPMNKELKKIIGQVRDQAEHLKTAVQMAVFIHNHKRKGGIGGYSAGERIVDIIATDI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Parallel screening of low molecular weight fragment libraries: do differences in methodology affect hit identification?
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Transferase/transferase inhibitor
molecule keywords POL polyprotein
total genus 53
structure length 144
sequence length 152
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00665 rve Integrase core domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3vqqA00
2XY7A 3NH2A 1T05A 5FRMA 4LSLA 1BQNA 2YNHA 3TR8A 2RN2A 3MEGA 3KLFA 3SPYA 4DTNA 5J1EA 1TKXA 1BL3A 4CF9A 4LY7A 1CXQA 5SZTA 3LZJA 1S9GA 4M42A 3VQ8A 5C42A 3NF6A 4CIFA 1QS4A 4FZZA 3LPUA 2G8IA 4CGIA 1RTJA 2YKNA 1WN7A 3PUFA 1WSEA 3ZSVA 4DG1A 4KHNA 3EZ5A 4DU3A 1VSHA 4HUGA 2DTUA 4DWIA 1QSYA 3ZT4A 3DLKA 3PX4A 1IKVA 3FFIA 4CJWA 3MXMA 4W5OA 4GVMA 2WOMA 5J2PA 3CFPA 2BDPA 4C8LA 1KVBA 5CYMA 3AVFA 4KTZA 4CGGA 1EKEA 3SV4A 2GBZA 2QXFA 3TABA 4I9LA 2EX3A 4W5QA 3WNFA 1SKRA 1NOYA 1VSIA 3NDKA 1TK8A 4C8KA 1IKYA 1B9FA 4BDPA 1MU2A 4CHPA 3NE6A 4FZYA 3KLHA 1DTTA 3PY8A 2IS3A 3EYZA 4HCBA 4LD0A 4B9VA 1RILA 4CFAA 4E3SA 1L3SA 4B9LA 4CHYA 4N76A 2HHQA 4FJJA 1BCMA 3C6TA 1REVA 1U48A 4F8RA 1TK0A 4C8MA 4OGEA 4CEQA 3RTVA 2Q3SA 4LSNA 3O4NA 1LWEA 4CJUA 3DLHA 3NGYA 3JSMA 3MEEA 1JLQA 3QEXA 3K5OA 5HBMA 3KIOA 4AHUA 2P5GA 1S6PA 2DFHA 2KZZA 4M3TA 4BACA 5JS2A 1NK0A 1U4BA 2I5JA 2D0CA 3VQAA 2D0BA 4BE2A 3KLEA 1RT3A 4C8NA 4E0DA 2F8TA 4W5RA 4KKOA 3VQ5A 4DFMA 2KTQA 1J9AA 1JLFA 4KFBA 4O0JA 3S3OA 1CZBA 2ZD1A 1J54A 4E7JA 3TAFA 1SL1A 4N5SA 3HVRA 3AVJA 1HJRA 2LSNA 4ZTFA 4CJ4A 3O3HA 1A5WA 1KTQA 4AH9A 4R5PA 2AJQA 4B3OA 2ZQBA 1TKZA 1S6QA 2ETJA 3AA3A 4G1QA 1GOCA 4N56A 1KVCA 1B92A 4CEBA 1ZBFA 4JLHA 1X9SA 4CJPA 3VA3A 5C25A 3HYFA 5CYQA 3HL8A 5HLFA 1ZBLA 2XY5A 1NK4A 1X9WA 4DSKA 1NK7A 4Z0UA 1IG9A 2OPQA 1JKHA 2B4JA 3LP0A 2FC0A 4FJIA 4I9QA 3QINA 1ASVA 4FJ5A 3NFAA 2R7YA 1S1UA 3HVTA 4DSJA 4Z4IA 4RW9A 3LWMA 2IC3A 1T8EA 2A1SA 3SUOA 3QO9A 1RT1A 1L3VA 4CGFA 4CGJA 1T7PA 4RW6A 2G8KA 4DQRA 4FLZA 3CM5A 1O1WA 3M8QA 5HROA 3MXIA 4B9SA 4QOZB 2OPRA 4OLBA 1WSFA 3DRRA 1NJZA 1L3TA 4M3ZA 4CJVA 1RT7A 5C24A 4AHTA 5K14A 3JYTA 2FBVA 3KK2A 3K5NA 4DQSA 4FJHA 3MECA 2G8HA 5HRRA 3CG7A 2F8SA 2FBXA 4Q0BA 2JLEA 3V9SA 4I7FA 2BANA 1I39A 1IH7A 3NF8A 4DSLA 1XHXA 4DLGA 3NAEA 5KGWA 5I3UA 5D3GA 3NH0A 3K5LA 3SZ2A 3WNEA 1RCHA 1L3UA 3M8RA 1T03A 1EX4A 2Z1IA 3DLRA 4DS5A 3RR8A 4FLTA 1TKTA 3OYEA 3HPHA 4DF8A 2FBTA 1DLOA 1S1VA 2NUBA 1RT6A 1NK8A 4EP5A 1JLBA 3ALYA 2P5OA 3NBPA 2Y1JA 4Q5VA 1NKBA 3WNGA 4MQ3A 4IBNA 3DI6A 1KRPA 3DLGA 3OYKA 3LPTA 5T7BA 4H4OA 1C1CA 4B8CA 4B08A 3VQDA 1RBUA 1G15A 2E6MA 2HHTA 4FM2A 3AO4A 1RBRA 1BHLA 2HB5A 3LALA 3LP2A 4JS5A 3QEVA 3V81A 3AVGA 2QKKA 1U45A 1YTUA 1ASWA 4L8RB 1HNVA 3HT3A 1S1TA 1EXQA 1KCFA 1VSLA 4DFKA 1L5UA 1W9HA 2RF2A 1TL3A 4H4MA 1TGOA 3SYZA 3VA0A 2OYQA 3V9UA 2HHUA 4NCGA 3ZT1A 4CIGA 1TL1A 2XO7A 3LAKA 2IOCA 5DK5A 3KTQA 1K6YA 3F9KA 3P1GA 4CJ5A 3OYMA 1NK6A 2IDOA 3HPGA 3U3GA 1NKEA 1S1WA 4KPYA 1FXXA 1IO2A 4M3UA 3DYAA 1VRTA 3ZSWA 4HVJA 1RDCA 4PWDA 1LAWA 4H8KA 4OVLA 3DMJA 2RKIA 3K58A 1KVAA 3QETA 1LW0A 1JL1A 1YVUA 4ID5A 5DMRA 3KD5E 3TAPA 4CK2A 3LZIA 3SQ0A 1BQMA 3AO2A 2VG5A 4IDKA 3QEIA 1XI1A 4B9NA 5CY4A 5FDLA 4CHNA 2D0AA 3AVMA 3F73A 4CJRA 3OYIA 5J2QA 4ELVA 4DU4A 5HRNA 1KFSA 2P51A 3L2UA 4OKKA 3OYDA 3DOLA 4N47A 1UOCA 4AHVA 3L2WA 4EZ9A 4FJLA 3NGZA 3QEWA 1EP4A 2DFFA 3S9HA 1Q9YA 4CFBA 5KI6A 2XY6A 4FJXA 3PX0A 3T19A 3OJSA 4KI4A 3O4QA 3ZT2A 3VQQA 4KB1A 4TSXA 4RW7A 5KRSA 1D9FA 3VQ7A 3VQBA 4DLEA 4DS4A 1DTQA 4DTOA 3V1QA 3DM2A 1C0TA 2VWKA 3V9XA 4Z4CA 3I8DA 5KGXA 5E41A 4IFVA 5HRSA 4ID1A 2QK9A 3B6OA 1W0HA 2EHGA 4E19A 4DTJA 4J2AA 5FROA 4DF4A 4KHWA 3AV9A 3TARA 1SUQA 1LV5A 4CF0A 4FJ7A 1QSLA 4PUOA 2XRIA 4M45A 1C0MA 1C6VA 4EZ6A 3NH1A 4PY5A 3HXMA 3H08A 4FLVA 1U04A 1WNSA 4AHSA 1J5OA 2G8UA 4OPKA 1UAXA 3SJJA 4JRQA 1RTDA 3ZSOA 1XWLA 3TI0A 3OS0A 4FYDA 2ZE2A 3S3NA 3AO1A 4XIUA 4CEZA 4F3TA 4BWJA 3VQEA 4FLXA 3QEPA 3TAMA 4AILC 4O44A 1WSJA 1JXBA 3CQ8A 1UA1A 3M8PA 1R0AA 3VQ6A 3ZSZA 3AVBA 4DFPA 1QTMA 3QNOA 3OYHA 3HSTB 4HHTA 2HNYA 4RG8A 4CE9A 1GOBA 4ZHRA 3VQ4A 1NK5A 2F96A 1NOZA 2OZSA 1NKCA 3IAYA 2PYJA 1WAJA 4DTRA 1QSSA 1D8YA 3SQ1A 3ZSYA 1RBSA 1QQCA 3OYAA 4K8XA 4M3WA 3V6DA 1WSGA 3TWHA 1HYVA 1UA0A 4Z4GA 3QERA 4GW6A 4QCLA 3U3YA 4ELTA 2X74A 3ITHA 4FW2A 4CEEA 4PA1A 3SI6A 3V9WA 4DTMA 3LP1A 3NCIA 2A1RA 3RR7A 4CGHA 4CGDA 2HNZA 2OPSA 3O3FA 2YNIA 4GMJB 1J53A 3QIPA 1RT5A 1BGXT 1JLGA 1VSJA 1S5JA 1D5AA 1S1XA 1VRUA 4LH5A 4CJEA 1X1PA 5HRPA 4DSFA 4QAGA 1FKOA 4KTWA 3AVIA 4DQQA 1WSIA 1HPZA 2Z1HA 1C0UA 3DLEA 3V1OA 1RDDA 4HUEA 3IG1A 3SNNA 4DTXA 4KHQA 3RWUA 4OPJA 1HQUA 4C8OA 4FJMA 3RMCA 3RMAA 2HMIA 1QE1A 3DRSA 3OVNA 4KB0A 3OYBA 1C1AA 4CFDA 3OS2A 4E1NA 3L8BA 2KZMA 4ICLA 4CJLA 2OPPA 3KJVA 1SKSA 1F21A 3P83D 1Y97A 1TV6A 4W5TA 3DLBA 5CZ2A 1QHTA 4J2DA 3L2RA 4CEFA 1BISA 4Y1DA 1ZYQA 2KFZA 4CJFA 3QESA 3KD1E 4E1MA 3ZSXA 4N41A 3LAMA 3QLHA 4DTPA 3BDPA 5J2NA 4Y1CA 1WSHA 3T1AA 4KV8A 4OKEA 3OYFA 3PX6A 3CFOA 4B9UA 4I2PA 3OS1A 2G8FA 3CYMA 3V1RA 1FK9A 3QNNA 1BI4A 1HYZA 4DQIA 3AA5X 4CEAA 3HM9A 2X6NA 4O4GA 3BGRA 1RBVA 1EETA 3L2QA 3SUPA 4FK0A 4FJ9A 1NJXA 1RBTA 3ZCMA 2ITGA 1BIUA 1HNIA 4O0IA 1HRHA 1WAFA 3LWLA 3K2PA 2XHBA 3RMBA 3P5JA 3RMDA 3AO3A 3E01A 3SCXA 1JLAA 1CXUA 1NJWA 1U49A 3AVCA 4BE1A 3RRGA 3AVAA 3OYLA 4CHQA 4YFUA 3KKRA 2VG7A 1KFDA 2IAJA 2BE2A 4CHOA 4I2QA 5SWMA 3NGIA 1HYSA 3AO5A 3AVLA 3DRPA 4FW1A 4UQGA 1SKWA 2D5RA 4FLWA 2Z1GA 3C94A 3VQ9A 2WONA 4DMNA 4E89A 2PZSA 4IFYA 4K8ZA 2HHVA 1IKWA 4E7KA 1BI4B 3C95A 4BDZA 1Z26A 4CFCA 4E7IA 4FM0A 4M3YA 2KFNA 4DTSA 3UIQA 4FZXC 1RTIA 2B6AA 3U6FA 1SL0A 2HVHA 3ZT0A 3DOKA 4BWMA 4FJKA 3L3UA 2GV9A 4AHCA 3AVHA 4LH4A 4HUFA 4FJ8A 3G0ZA 1U47A 4IKFA 1NJYA 4DQPA 4MFBA 3HPOA 2YNGA 2FBYA 2Z1JA 4IG3A 4M3RA 5KRTA 4FK2A 1VSKA 5EU7A 3KK1A 4KHSA 3ULDA 4CF1A 4CIEA 1BCOA 4J2EA 4CEDA 3MXJA 3THVA 4NCAA 3HK2A 4KRFA 4E7HA 1TAQA 3VN5A 3TAGA 4RW8A 1XHZA 4Z4FA 2YHAA 4KAZA 1ITGA 3A2FA 1VSDA 2HW3A 4W5NA 3SUQA 4FXDA 4Z4EA 4OKJA 4F4KA 4FCYA 1LW2A 4DFJA 1LWCA 4BDYA 2PYLA 2E6LA 4NYFA 3L3VA 1RTHA 3S3MA 4CF8A 4CJQA 4B8AB 3NHGA 3AA4A 1TKDA 4CEOA 3OY9A 2KQ2A 1ZBHA 2B5JA 4FLYA 4F2RA 4B9MA 3LP3A 3SQ2A 3C6UA 3G10A 3SPZA 2PY5A 4NCBA 3ISNC 1N6QA 3WNHA 1HQEA 3LDSA 2HHWA 2GUIA 5J2MA 4E7LA 3HJFA 3NF9A 1S9EA 3OYNA 1RDBA 3VQPA 4B9TA 1JL2A 1SV5A 1FKPA 4DTUA 4KTQA 4CJKA 3NF7A 4CJTA 1C1BA 4O55A 4WE1A 4F3OA 3V4IA 1VSEA 4FVMA 1Q8IA 3SUNA 3O3GA 3LANA 1NK9A 4FJNA 3HP9A 3QIOA 5I42A 1D9DA 1TK5A 1TVRA 1B9DA 1BIZA 3CM6A 3KLGA 1GOAA 3PO5A 3SV3A 1JLCA 3V9ZA 3PV8A 4OJRA 5HP1A 3OJUA 1CLQA 2YNFA 4ZTJA 1TAUA 4HCCA 4FLUA 3K57A 2G8VA 5KTQA 2JGUA 2OZMA 4KREA 3AVNA 3ZSQA 2VWJA 4EP4A 4JRPA 2KW4A 1VK0A 3OYGA 3T3FA 3B6PA 1JXEA 2DY4A 3OYJA 3IS9A 1VSFA 3I0RA 2E4LA 3HP6A 3KKSA 1RT2A 3AVKA 2VG6A 1LWFA 1RNHA 4CECA 4FK4A 3MAQA 2G8WA 1ZBIA 3ZSRA 3M8SA 4KO0A 4O5BA 4CCHA 1X9MA 1YTAA 4M3XA 4PQUA 3L2VA 3D0PA 4IG0A 1Q9XA 5FRNA 4NYNA 4DSEA 4DU1A 2BGGA 1VSMA 3VQCA 2HHSA 3HO1A 1LAVA 4OGCA 4CK1A 2ATQA 2X78A 1HMVA 4CERA 2Y1IA 2W42A 1KLMA 2OA8A 4KHUA 4CJ3A 3OYCA 1KSPA 4YNQA 2IGIA 3KK3A 3K59A 1JLEA 1YT3A 1Z25A 4OLAA 2O4IA 3ASMA 2HNDA 1N5YA 2YHBA 1UWBA 1IKXA 2O4GA 3IRXA 4CJSA 3TAQA 1RT4A 1KLNA 4HTUA 3RRHA 4KI6A 5JS1A 4ELUA 2P1JA 4RW4A 4FM1A 1XC9A 2DFEA 3TANA 3TAEA 4JS4A 3KLIA 1ASUA 2YKMA 4F2SA 1CZ9A 4BE0A 3SQ4A 4AHRA 4KHYA 1WLJA 2YV0X 4CK3A 1ZBUA 1SL2A 5CZ1A 3K5MA 2QKBA 4CHZA 4J2BA 2XY8A 1RDAA 2HVIA 1A5VA 4M41A 2X6SA 3AA2A 4CF2A 3I0SA 1A5XA 3CFRA 3D45A 2RPIA 3ZT3A 4FJGA 3MEDA 4DSIA 4Z4HA 3PO4A 2HHXA 4CESA 1I3AA 3EY1A
chains in the Genus database with same CATH superfamily
5FRMA 2YNHA 3MEGA 3WQUA 3VERA 3HOTA 1TKXA 1BL3A 4X64K 4CF9A 5AQZA 3BF3A 4LY7A 5SZTA 2ZM6K 3G6EN 3VQ8A 3NF6A 4G9ZA 1KXPA 4BRAA 2G8IA 1RTJA 1WN7A 3ZSVA 1WSEA 4IOAL 3WXLA 3AY9A 4CJWA 2OCEA 4GVMA 3T1HK 2BDPA 4C8LA 4LFAK 1ATRA 3E9LA 4CGGA 1EKEA 2V7YA 1BWFO 4I9LA 1U2VB 1VSIA 1IKYA 3NE6A 4BRMA 4FZYA 3KLHA 3U9DA 3PY8A 3EYZA 4HCBA 4CFAA 4QS8A 4FJJA 3C6TA 4O8UA 1REVA 4F8RA 3RTVA 4B3TK 2Q3SA 3MN5A 1GLCG 3K5OA 3H3OB 4AHUA 2E1ZA 3F9MA 2KZZA 2DFHA 2BUPA 4A57A 1U4BA 1N33K 2P9NA 2D0CA 5M1QA 4BE2A 3KLEA 4C8NA 4B3RK 4E0DA 2KTQA 1J9AA 1JLFA 1BO5O 1CZBA 2ZD1A 4E7JA 3TAFA 1YJWN 3HVRA 2LSNA 3QB0A 3O3HA 1A5WA 1NGDA 2AJQA 4B3OA 4KH4A 2ZQBA 5LMUK 4G1QA 4CEBA 4DCHA 1ZBFA 4CBUA 3BP8A 5CYQA 1WB9A 2XY5A 2BTFA 2I7NA 1NK7A 1JKHA 1HKGA 2FC0A 1ASVA 2R7YA 1SAZA 2IIRA 1T8EA 1RT1A 2E2PA 1T7PA 4RW6A 3CERA 3MXIA 2I7PA 4A5BA 1WSFA 4CJVA 1RT7A 5K14A 4K43A 3KK2A 2ZJRL 1VQKN 4DQSA 2E20A 2BH1A 3CG7A 4LF5K 2NNWA 2FBXA 4BRLA 1IH7A 3NF8A 4DSLA 4DLGA 3H1QA 3NAEA 4UY8O 5KGWA 4BC4A 1YUWA 2O8CA 4H0PA 1WBBA 3IDHA 1T03A 1TKTA 3G4SN 2FBTA 4JI1K 3P4IA 4BRIA 1NK8A 3P39A 4EP5A 5CR4A 4MQ3A 1Z05A 3DI6A 3BZCA 4IOCL 1NM1A 3VQDA 1G15A 2HHTA 1RBRA 1U45A 1HNVA 1EXQA 3OHRA 2O8DA 2P9UB 2ZF5O 1TL3A 2W41A 3SYZA 1QQMA 4DV5K 4NCGA 3R9PA 2XO7A 4PKGA 5M1OA 3P1GA 4LF4K 3WXMB 4JI7K 3HPGA 3U3GA 5IWAK 4FOIA 1BOTO 3CJBA 1NWKA 1VRTA 3D2FB 1LAWA 2RKIA 3LM9A 1LW0A 1YVUA 5DMRA 4ID5A 3J7YP 4CK2A 3SQ0A 1BQMA 3DXKA 5BRHA 5CY4A 4CHNA 2YHYA 4CZHA 3PLAA 4DU4A 4LC9B 1FW6A 4AHVA 3L2WA 1Q7YO 4EZ9A 1IG8A 4FJLA 4OO1J 1KD1O 2DFFA 5KQ8A 5AQVA 4CFBA 5KI6A 1C0FA 4H0XB 3ZT2A 4KB1A 3O6WA 5AQOA 3V1QA 3DM2A 3I8DA 5KGXA 5E41A 3M5RA 2QK9A 5F1XA 3G25A 1W0HA 4DTJA 4E19A 3OBYA 5FROA 4KHWA 3TARA 1SUQA 4FJ7A 4PY5A 2UUAK 2O8EA 4BRNA 4JRQA 1RTDA 1XWLA 4DR6K 3SJHA 4CEZA 4F3TA 3TAMA 4AILC 1GLDG 2QW9A 1JXBA 3CQ8A 2VQEK 3B8AX 2IVPA 3VQ6A 1QTMA 4H5WA 3TSQA 2PFUA 2HNYA 4RG8A 3UB5A 4CE9A 4ZHRA 3VQ4A 1NK5A 4CJ7A 4JN4A 2O8BA 5TKYA 3SQ1A 3ZSYA 3OYAA 3CCSN 1WSGA 5AQQA 3TSPA 4MLEA 3ZEUA 4ELTA 3THYB 4DUYK 4CEEA 3N4QA 4PA1A 1T6CA 4EHTA 2HNZA 3O3FA 3JXUA 5M1FA 3QBWA 4YOUA 1JLGA 3SI6A 1KRPA 4CJEA 2H3GX 2UU9K 4DQQA 3TTCA 4JD2B 4JK8A 3QFUA 1NGGA 4OPJA 1HQUA 4C8OA 4FJMA 1S22A 3RMCA 4PL8A 3LDOA 1W7AA 3OVNA 3DRSA 4KB0A 4J8FA 5KPRA 3KVGA 5FPEA 4JHDB 1DT9A 4JHDA 2OPPA 2F4VK 4CZIA 2NRVA 4W5TA 2E2QA 3C7NA 4B3MK 4ILGB 1BISA 3LDLA 1EO1A 5C2DA 3ZSXA 3MDQA 2FLOA 3BDPA 3W3DA 5J2NA 4Y1CA 4OKEA 3OYFA 3PX6A 4I2PA 3V1RA 4DQIA 1H1VA 4JKFA 1BDGA 2X6NA 3Q7BA 1RBVA 3CC4N 3SUPA 2GTDA 2OTJN 1NJXA 1HLUA 1HRHA 3RMBA 3AO3A 5GINA 3E01A 3SCXA 1JLAA 2FXUA 4PKIA 3OYLA 4CHQA 1T6DA 3D7EO 4YFUA 3GDQA 4I2QA 5SWMA 3KZBA 3MN6A 4C1NK 5E84A 4CZLA 3C94A 2E2NA 4E89A 5BPMA 1IKWA 3R3LA 4FO0A 2HVHA 3KWIA 3ZT0A 3ID6A 1OVYA 3G0ZA 1NJYA 3MCAB 4MFBA 4DQPA 2W6LA 4RTFD 2FBYA 4M3RA 4IO8A 3DXKB 1QQNA 3C6AA 1RDUA 1OH8A 1JJ2M 4J2EA 2QTDA 4NCAA 4CZEA 2WFBA 4RW8A 4KAZA 1ITGA 2HW3A 3SUQA 4Z4EA 2CGLA 4F4KA 4FCYA 4DFJA 5DM7L 1YXQA 3CJAA 2PYLA 3BEXA 4B1XB 4FSVA 4CF8A 3D2EB 4IXCA 1TKDA 3MX2A 4CEOA 3JAMO 1QZ5A 2KQ2A 2B5JA 2P9LB 3SPZA 4NCBA 3ISNC 2HHWA 2GUIA 3NF9A 5JICA 1RDBA 4B9TA 1JL2A 4KTQA 1U2VA 2HSTA 1C1BA 2QWRA 3SK3A 5GIOA 3V4IA 5BN9A 3LANA 1VQLN 3CJ7A 3THWB 3T1YK 3UKRA 1D9DA 1B9DA 5MLCQ 1T44A 3SV3A 4JKAA 5AQPA 5HP1A 1GLEG 4DUZK 4ZTJA 2A3ZA 2O8CB 1NGIA 1MWMA 2W40A 3ZSQA 3F5TA 2KW4A 1VK0A 3EE8A 3T3FA 2DY4A 2O8BB 4YDUA 3CCQN 4K42A 4YORA 3EKUA 4BG8A 1TUUA 3DXMB 1RT2A 3ENHA 3HP6A 4Z4GA 3MAQA 3M8SA 4YOXA 4CCHA 5FRNA 4CW7B 4OGCA 1HMVA 4KH6A 3UKUA 2FSJA 2O8DB 3DLLL 4KHUA 4CJ3A 3OYCA 3KK3A 3K59A 1JLEA 1YT3A 5FLXO 2HNDA 1N5YA 1V4TA 4CJSA 3TAQA 4JKBA 1NG9A 3BY5A 4RW4A 1ASUA 1NMNA 4WFBL 4F2SA 1CZ9A 3SQ4A 2VQFK 1SL2A 1ZBUA 2GWJA 3VESA 3HSCA 4CHZA 2QKBA 2XY8A 4X65K 4CF2A 4H0YB 1A5XA 4ILJA 3CFRA 3CHWA 3CC2N 4Z4HA 4OX9K 2HHXA 4H0OA 3WXKA 2XY7A 5KPTA 2D1KA 3NH2A 1T05A 4MDBA 3KLFA 3SPYA 1OH6A 3O1BA 4M42A 4BVOA 1QS4A 3OTOK 2A5XA 2W6KA 1ATNA 4BC3A 1X3NA 4DU3A 1VSHA 2DTUA 4DWIA 1QSYA 3DLKA 3PX4A 1YJNN 3MXMA 3R8EA 5J2PA 3E9PA 4KTZA 2GBZA 2EX3A 3AAPA 3WNFA 1XNRK 3MN9A 4BDPA 1MU2A 4CHPA 1J6ZA 1DTTA 5AQHA 4LD0A 4B9VA 4B9LA 4E3SA 3VGKA 3D2EA 4LSNA 1R59O 1LWEA 3JSMA 3MEEA 1JLQA 5HBMA 3KIOA 3M6GA 3IMXA 4WFAL 5DM6L 4BACA 5JS2A 1X3MA 3AARA 2P9NB 2D0BA 2F7TA 4FWLA 3VQ5A 4DB3A 1Y64A 2D4WA 1ZC6A 1SL1A 4BRFA 1BA1A 4CJ4A 4DR7K 2YJFA 3O9RA 4AH9A 4R5PA 4PL7A 2Q97A 1TKZA 2ETJA 3ENBA 4N56A 3O4WA 4CJPA 2RE2A 1KC8O 5HLFA 1X9WA 4DSKA 4BQZA 5AQNA 2FF6A 4Z0UA 2OPQA 4I9QA 2B4JA 1YJ9N 4LF9K 1S1UA 2E88A 3EE9A 2IC3A 1L3VA 2P9PB 4CGFA 2G8KA 5ADXA 4BR2A 3CM5A 1O1WA 3M8QA 4B9SA 4QOZB 4WCEL 3GL1A 2A40A 3WQTA 3SAFA 3DRRA 4U67L 5AZJA 1L3TA 5C24A 2A6AA 4AHTA 3JYTA 2FBVA 1VQPN 1BU6O 2F8SA 3CCJN 3V9SA 3FZMA 2QXLA 2BANA 3O9SA 4KBOA 1XHXA 5D3GA 5BR8K 3WNEA 1L3UA 2P9PA 4FLTA 1DLOA 1S1VA 2QWMA 4IO9L 2P5OA 4Q5VA 3WNGA 3LM2A 4LF8K 3DLGA 3LPTA 5T7BA 3S41A 1C1CA 3PSFA 3AO4A 3UKRB 3ATVA 4JKHA 4R79A 1U6ZA 3HT3A 4O8KA 1KCFA 1YI2N 1K6YA 3F9KA 2D0PA 1ZBSA 4CJ5A 2IDOA 2D0OA 1JCGA 1QHAA 1FXXA 2VCPA 4M3UA 3SLCA 4PWDA 1RDCA 4OVLA 4GKKK 3K58A 3KD5E 3EL2A 3LZIA 4IDKA 3QEIA 1XI1A 4B9NA 3WXJA 5LJVA 3QDKA 3AVMA 5J2QA 4ELVA 1KFSA 4OKKA 4N47A 3MN7A 4M7XA 5EX5A 1MDUB 4DR1K 4EHUA 1X9JA 1K8AO 2ASPA 2QA4N 2XY6A 3VENA 3FZFA 1WBDA 3T19A 5KQDA 3EN9A 3O4QA 3VQQA 3R1XA 2HBKA 1DTQA 3V9XA 2HOEA 3B6OA 2EHGA 3T7ZA 4DF4A 3AV9A 3AGRA 3U4LA 3THWA 1QSLA 4IZ9A 5EXWA 5GADP 1VQON 3H08A 1U04A 1UAXA 3ZSOA 1N8RO 1VQ5N 3S3NA 4B1UB 2GELA 3AO1A 3FZKA 4XH1A 4XIUA 4FLXA 3IKMA 4O44A 1WSJA 4H5RA 3M8PA 5E26A 3QNOA 3HSTB 4HHTA 1NOZA 3DJCA 3J81O 1NKCA 2OZSA 1XNQK 1NGFA 1WAJA 5FPDA 1NJIO 3TWHA 1HR0K 4KHPK 1NMDA 4GW6A 1HNZK 3GBTA 1Z6RA 4EFHA 5AJ3K 3UKUB 3NCIA 3RR7A 4FVUA 4BRGA 2OPSA 4CGDA 3QIPA 5AFUH 1YVNA 1BGXT 4DSFA 4Y0WA 2O8FB 1SZ2A 1HPZA 3V1OA 5BRDA 2UUBK 4JD2A 3J80O 5LMNK 5BR9A 4KHQA 3E1YA 4FWNA 3WEEA 3J7AP 1QE1A 3OYBA 3OS2A 3KJVA 1SKSA 1F21A 3A8YA 1Y97A 1TV6A 4I6MA 4I6MB 3M3ZA 4DQ8A 3QESA 4JK9A 3LAMA 2QWLA 4DTPA 3E66A 4KV8A 2G8FA 3VTHA 3DWLA 3CYMA 4L3QA 3CI5A 4O4GA 1TYQB 2P9SB 3THXB 1RBTA 3G71N 1HNIA 1WAFA 3K2PA 4DV1K 3P5JA 4FPAA 1KAZA 3RRGA 1BG3A 1KFDA 4BRQA 4CHOA 3NGIA 4FW1A 1SKWA 2D5RA 2QM1A 2Z1GA 4DMNA 4K8ZA 2HHVA 4E7KA 4GY2B 4E7IA 2KFNA 4DHYA 4DTSA 3UIQA 1D4XA 4FZXC 5C0YA 3WUHA 2IVOA 4AHCA 3AVHA 3VGLA 4FJ8A 1U47A 4IKFA 4FOEA 1E4GT 2Z1JA 5KRTA 4FK2A 3C0BA 3ULDA 4KHSA 4GNIA 1BCOA 3VTIA 4NLBA 3MXJA 2Q0RA 1TAQA 3TAGA 1XHZA 1HJOA 1LW2A 1VQ7N 4BDYA 2E6LA 3L3VA 1RTHA 3NHGA 2NRHA 2A41A 1QQOA 3CCLN 1HNWK 3TU5A 4FLYA 4BR9A 4B9MA 2UUCK 3SQ2A 2PY5A 3O9TA 3K9JA 2NRXA 1N6QA 3I8BA 4E7LA 3CMEN 3HJFA 2NRZA 3OYNA 2OANA 2E2OA 1TUYA 3VQPA 4DTUA 4CJTA 4DV0K 4O55A 1K8KA 3ULEA 4FJNA 3HP9A 5I42A 1TVRA 3CJ9A 3KLGA 3PO5A 2Q1NA 1P90A 4OJRA 3OJUA 1CLQA 1MA9B 1TAUA 4HCCA 3K57A 2ZJPL 2G8VA 5AQXA 4KREA 2OZMA 2DPNA 2VWJA 3GOIA 3H46O 3OYJA 5KPZA 3IS9A 3I56N 3I0RA 3KKSA 1LWFA 3QFPA 3ZSRA 4KO0A 4O5BA 1X9MA 1YTAA 4IG0A 4CZJA 1Q9XA 4NYNA 1VSMA 5LJWA 4CK1A 1JCEA 2ATQA 2X78A 3LDQA 1XUPO 1KSPA 3CETA 2YJEA 3ZETB 3IRXA 1XQSC 4GVEA 5M1PA 4C23A 5JS1A 3TANA 4BE0A 4KHYA 4CK3A 3DXMA 5C15A 2ASOA 3GG4A 2Q36A 1VQ6N 3I0SA 4K41A 2RPIA 3H6EA 1NGJA 3P31A 2E8AA 2QEXN 4K0KK 5J1EA 2A42A 1K73O 1CXQA 3ZETA 5C42A 4CIFA 3I33A 4NLCA 1FJGK 3ZYYX 3A5NC 1ATSA 5GAEP 1ZXOA 3WEEB 4KHNA 5EY4A 1NGAA 4HUGA 3CC7N 3ZT4A 3FFIA 5FPNA 4WYBA 2FSNA 1KVBA 5AZIA 4GV3A 5F0XA 3TABA 3RSEA 3FGUA 1NOYA 3NDKA 1TK8A 4C8KA 1RGIA 4JI3K 2IS3A 3SBGA 2HHQA 4N76A 4CHYA 4JEPA 1BCMA 1TK0A 4C8MA 4CEQA 4DV3K 1O13A 4BVPA 3DLHA 3TPQA 3OW2M 2P9KA 3QEXA 2P5GA 3D2FA 4M3TA 3ENOA 2I5JA 2QWPA 3CCEN 2F8TA 1RT3A 3BUZB 2YHXA 3AVJA 4JI5K 5F2RA 2ZGYA 2GX9A 3PSIA 1S6QA 3FR0A 1Q86O 3AA3A 4MO5A 1KVCA 1X9SA 4BR4A 3VA3A 5C25A 3HL8A 4H03B 2ASMA 3CD6N 3VEYA 3QINA 2GEMA 4H0VB 1HX1A 4DSJA 4Z4IA 4BR0A 4RW9A 2A1SA 4WQ4A 3QO9A 4CZFA 5LY3A 4DV2K 4XH4A 4CGJA 4FWQA 3CCVN 4FLZA 5HROA 5EOYA 3FZHA 1GLJO 2OPRA 1OH5A 4FWSA 1NJZA 3TSUA 4FJHA 2G8HA 5HRRA 3PIPL 2RHKA 2PBDA 1VQ4N 4AM7A 4Q0BA 4A5AA 1I39A 2CGJA 5H1SQ 3K5LA 3SZ2A 4FWRA 4FWOA 1RCHA 2Z1IA 2OTLN 3DLRA 4DS5A 3RR8A 5AQRA 5BREA 3HPHA 4DF8A 2NUBA 1RT6A 1JLBA 4JKDA 3ALYA 2PAVA 1NKBA 3O1WA 1DKGD 4CBXA 4B8CA 2E6MA 3A0IX 4FM2A 3V81A 1BHLA 3LP2A 5HL7L 4JS5A 3AVGA 2QKKA 1YTUA 1ASWA 4L8RB 3QICA 4IFEA 4DFKA 1L5UA 4AF1A 1W9HA 2RF2A 3VA0A 2HHUA 3L0QA 3ZT1A 4CIGA 1TL1A 5GIPA 5JVGL 3LAKA 2IOCA 5DK5A 3KTQA 1QVFM 1RFQA 3OYMA 1YIJN 1NKEA 1S1WA 4KPYA 4BRPA 3DYAA 3ZSWA 1HKBA 3DMJA 3JS6A 1KVAA 4PKHA 1JL1A 2UXCK 3TAPA 1NJWA 5AQGA 5FDLA 2NRRA 2D0AA 1GLFO 1K8KB 3ULEB 4CJRA 3OYIA 2O8EB 2P51A 1NGEA 4BRKA 3OYDA 5AQIA 1UOCA 2WUSA 3QEWA 1EP4A 3S9HA 2NLXA 2VWBA 3VF6A 1Q9YA 3SMPA 1ESVA 3EKSA 4EAHD 3C65A 4RW7A 1D9FA 3H45C 1OVQA 4DS4A 3QMLA 3NMUA 4Z4CA 3CMAN 1LV5A 4CF0A 4PUOA 3ZEUB 4M45A 1C6VA 4EZ6A 4CZKA 1J5OA 2Q2RA 3ZLJA 2ZWHA 3SJJA 2KLAA 4JI6K 3TI0A 4NO7A 3HRGA 3QEPA 3CPEA 4WF9L 5C12A 3CCRN 4BC5A 5B8HA 1R0AA 3AVBA 4DFPA 3RVCA 1HNXK 2F96A 3IAYA 2PYJA 3CXCM 4DTRA 1QSSA 1D8YA 4M3WA 1RBSA 4K8XA 1UA0A 1KQSM 4QCLA 4FWKA 2X74A 3ITHA 4DTMA 3LP1A 2A1RA 1J53A 4LH5A 4OPKA 4GV9A 1VSJA 1VRUA 1D5AA 1S1XA 2P9UA 5HRPA 4A2AA 1X1PA 4QAGA 1BA0A 4KTWA 3AVIA 5GAHP 2Z1HA 4A62A 1C0UA 3KHYA 3DLEA 4HWIA 4HUEA 2YI1A 3SNNA 1DEJA 5AQYA 2HMIA 3KWGA 3L8BA 4CFDA 2KZMA 4E1NA 1W97L 3BF1A 3IFRA 3E9OA 3DLBA 5CZ2A 5CHIA 4K25A 3VF4A 3OBWA 4JYAK 4J2DA 3L2RA 4Y1DA 1ZYQA 2KFZA 4QS9A 4BC2A 3O08A 3KD1E 3LL3A 4E1MA 3NVMA 3QLHA 4LFBK 1VQMN 5AQLA 4BR7A 3T1AA 4B9UA 1BI4A 1HYZA 1NGHA 4CEAA 1DGKN 3HM9A 2JWLA 1EETA 3L2QA 4FK0A 4FJ9A 2ITGA 1BIUA 4O0IA 1E3MA 2XHBA 5M1KA 3SAHA 1U49A 4BE1A 3AVAA 4QS7A 3A5OC 3KKRA 2IAJA 2BE2A 3C6HA 4UQGA 5FPMA 3DAWA 3GE1A 3VQ9A 2WONA 2PZSA 1ILYA 3C95A 1Z26A 4CFCA 2NRWA 4FM0A 2GWKA 2B6AA 3THXA 1M1KO 1XC3A 3VEOA 1SL0A 2CH6A 3DOKA 4BWMA 4FJKA 2GV9A 4LH4A 4HUFA 2WBNA 4CD1A 2YNGA 3P38A 3MCPA 1NBWA 2AA4A 5AFUA 4H5NA 4CIEA 3VEVA 3OA9A 4YOYA 3THVA 1N34K 3HK2A 4KRFA 4E7HA 2YCHA 3VN5A 4OPAA 1W2BM 4W5NA 1N32K 1J5EK 4FXDA 4OKJA 4OPHA 3THYA 1S72N 1LWCA 4XH5A 3VETA 4YY3K 3O8MA 4B8AB 2GUPA 3OY9A 4U7BA 4BRDA 2QWNA 5AQJA 3VEZA 4F2RA 3LP3A 3C6UA 1S3XA 1EQYA 3HTVA 4JI0K 4H5TA 3ID8A 4CJKA 3NF7A 4WE1A 1VSEA 4FVMA 1Q8IA 2UYTA 3SUNA 1NK9A 4IJNA 1TK5A 1BIZA 4DKWA 1JLCA 3PV8A 2VGMA 2YNFA 4FLUA 4FWPA 4X62K 5C10A 4BGBA 4DR3K 2JGUA 2HF4A 3LDNA 1KAXA 5BRFA 1K9MO 1VSFA 1VQ9N 2E4LA 4YOWA 4FK4A 5ELZA 2G8WA 1ZBIA 3HZ6A 3BZKA 4M3XA 2ZJQL 4PQUA 3L2VA 3D0PA 3CCMN 2BGGA 2HHSA 3VQCA 1Q81O 3HO1A 1LAVA 3EEQA 4CERA 3N4PA 2Y1IA 4BRHA 2W42A 2CH5A 1KLMA 2OA8A 5TKWA 2O8FA 4OLAA 1Z25A 4CD3A 4JI8K 1E4FT 2YHBA 1UWBA 1IKXA 4CZGA 2YX6A 3PIOL 4HTUA 1IJJA 2Q31A 3J7ZO 4B9QA 2FF3B 2FSKA 2P1JA 4FM1A 3TAEA 2YKMA 4AHRA 5CZ1A 5A2QO 4J2BA 4GV6A 1NGBA 2HVIA 4Z94A 1NLVA 3FFKB 2V51B 2X6SA 3AA2A 4NB4A 2QWQA 1NNEA 3MEDA 1HKCA 3PO4A 1I3AA 3EY1A 5JLHA 3FLCO 4LSLA 1BQNA 3TR8A 2RN2A 4DTNA 1XMQK 3CIPA 3LZJA 1S9GA 4WQ4C 2P9KB 4FZZA 2ZGZA 3O9QA 2HBMA 3LPUA 4CGIA 2ITMA 2YKNA 3PUFA 2Q0UA 3M1FA 1MWKA 4DG1A 1NGCA 2P9IB 3EZ5A 1LOTB 1YAGA 1IKVA 4W5OA 2WOMA 3CFPA 1I94K 1HPMA 5CYMA 4YHHK 3AVFA 3SV4A 4JKEA 2QXFA 3RSEB 2F9TA 4W5QA 1SKRA 2YHWA 1B9FA 3U8XA 1V4SA 1Q82O 4A61A 5AQUA 1RILA 1L3SA 1U48A 1EWRA 4OGEA 3O4NA 4CJUA 3NGYA 5I9EB 3TTFA 5IT9O 1S6PA 4WFNL 1RDWX 1NK0A 1IBKK 3R6MA 2F9WA 3VQAA 4KH5A 4W5RA 4KKOA 4KFBA 4JKGB 4O0JA 3S3OA 1J54A 2QI2A 4N5SA 4ZTFA 1HJRA 4LF7K 4B1YB 1QVGM 1KTQA 1OH7A 3TTDA 1GOCA 1B92A 4JLHA 3HYFA 1ZBLA 1NK4A 1IG9A 3LP0A 4FJIA 4FJ5A 3VEXA 3NFAA 4ILHA 2E5LK 1N36K 3HVTA 4C1NI 3LWMA 1BUPA 3SUOA 3K9KA 4DQRA 2E1YA 4JK7A 4JKGA 4H0TB 4OLBA 1GLBG 5BN8A 4RCHA 5AZJB 4M3ZA 5AQTA 4M63C 3K5NA 3CPWM 2HBLA 3MECA 4HTLA 2JLEA 4I7FA 3CJCA 5I3UA 3HBTA 3NH0A 3L6QA 2J4RA 2UXDK 3M8RA 1EX4A 4PHTX 3OYEA 3Q7CA 1GLAG 3NBPA 2Y1JA 3CJ1A 4IBNA 3OYKA 4IWVA 4H4OA 4B08A 1RBUA 5AQFA 2HB5A 3QEVA 1CZAN 3LALA 5AQMA 1S1TA 1SQKA 1VSLA 4H4MA 1TGOA 2OYQA 2WC9A 3V9UA 3MK6A 4JV5K 5AQKA 4M7YA 4B3SK 4DV7K 1YHQN 4DR2K 4BRCA 1NK6A 2P9LA 1YF5L 3O9UA 4BREA 1IO2A 4WQ5A 5HOOA 3ATUA 4HVJA 4H8KA 3QETA 4BGAA 4AQYK 1XMOK 3AO2A 2VG5A 4WQ5C 3I55N 3L4QA 3F73A 5C2FA 5JVHL 5HRNA 4JAXA 3L2UA 5M1NA 2AP1A 3DOLA 4CI6A 3FE1A 3NGZA 2NRTA 3UE5A 4FJXA 4FL9A 3PX0A 4JI2K 4KI4A 3OJSA 2QWOA 3SMSA 2WTUA 4ISGA 1SS6A 4TSXA 5KRSA 3VQ7A 3VQBA 4DLEA 4RWTA 1HUXA 4DTOA 3J8AA 1C0TA 2VWKA 3F2KA 1T3VA 4IFVA 5HRSA 4ID1A 2HBJA 4J2AA 3LDPA 1YITN 4LFCK 2XRIA 3O80A 1C0MA 3NH1A 3HXMA 4FLVA 1WNSA 4AHSA 2G8UA 3CQYA 3OS0A 4X66K 1OKJA 2ZE2A 4FYDA 4BWJA 3VQEA 2HHHK 1UA1A 3H3NO 1M90O 3ZSZA 4B1VA 4IOXA 5AR0A 3OYHA 1GOBA 3FZLA 4MO4A 4BG9A 5BPNA 4YOTA 1QQCA 3HM8A 1WOQA 3V6DA 1HYVA 3QERA 4IEEA 3U3YA 4FW2A 3CQXA 4CZMA 3A5LC 4A59A 1KAYA 3V9WA 4YOVA 4CGHA 3EO3A 4E1JA 2YNIA 4GMJB 3AAQA 1RT5A 4DFMA 1S5JA 4MLHA 1FKOA 3O5BA 4A2BA 1WSIA 1RDDA 4F9OA 3IG1A 4DTXA 3RWUA 3RMAA 2P9IA 5GAGP 1C1AA 4GKJK 4ICLA 4CJLA 4LF6K 3P83D 3C7NB 1QHTA 3H1VX 4CEFA 3L4IA 1Q18A 4CJFA 2VYPA 4N41A 3ZX0A 1WSHA 3EZWA 3KK7A 3CFOA 3OS1A 1FK9A 3QNNA 5LL6Z 1JCFA 4JKCA 3AA5X 1NU0A 1LCUA 3BGRA 3MX5A 1G99A 3ZX2A 2V52B 3ZCMA 4AM6A 3LWLA 5AQWA 2JWKA 4BR5A 3U9ZA 3CF5L 3RMDA 3ZX3A 1VQNN 4O5FA 2KKZA 1CXUA 3AVCA 4IEIA 2VG7A 3VGMA 2HMPA 2V7ZA 4EIAA 4DR4K 3W0LA 1HYSA 3AO5A 3AVLA 3DRPA 4FLWA 3MWPA 4IFYA 2KHOA 1BI4B 4BDZA 3K0SA 4BQLA 4DR5K 4M3YA 4XEIA 1RTIA 3U6FA 2CGKA 3VOVA 4DV4K 3L3UA 3VF2A 3MWTA 5EVZA 1IBLK 3HPOA 3AGKA 4B1ZA 4IG3A 4JI4K 5AQSA 1VSKA 5EU7A 3KK1A 4CF1A 3SBTA 4NXMK 1QZ6A 4CEDA 4Z4FA 2YHAA 3A2FA 1VSDA 3T69A 5JMVA 2HF3A 4FPBA 4ISFA 4NYFA 4CBWA 3VPZA 3S3MA 4CJQA 3AA4A 3WT0A 1WUAA 1C0GA 1ZBHA 3G10A 3MMVA 3WNHA 1IBMK 1HQEA 3LDSA 5J2MA 5AZIB 2NZTA 1S9EA 4JNEA 1SV5A 1FKPA 3D6RA 4V19S 3VEWA 2EWSA 5ADXH 3VMFB 4BROA 4F3OA 1GLLO 3O3GA 1VHXA 3QIOA 2UXBK 3WXIA 3CM6A 1GOAA 3V9ZA 4ISEA 1VQ8N 3IUCA 3HI0A 3HOSA 3QBXA 5KTQA 5BPLA 3AVNA 4JRPA 4EP4A 5JLFA 3OYGA 3B6PA 1JXEA 4H5VA 3CCUN 1VAZA 1EWQA 4CECA 2VG6A 3AVKA 1RNHA 1IV0A 4CVNE 4DSEA 4DU1A 1P8ZA 3A5MC 4YNQA 2IGIA 4IDHA 3NVKA 2O4IA 3ASMA 4FWMA 3SAGA 4NXNK 2O4GA 1RT4A 1KLNA 3RRHA 4KI6A 1TYQA 2P9SA 4MDAA 4BY9C 4ELUA 1XC9A 2DFEA 4JS4A 3KLIA 2IVNA 4IJAA 4YDUC 1WLJA 2YV0X 5CE3A 4B1WB 3K5MA 1RDAA 1A5VA 4M41A 3D45A 3ZT3A 4DV6K 4FJGA 4DSIA 2VGNA 4CESA
chains in the Genus database with same CATH topology
2XY7A 3NH2A 1T05A 5FRMA 4LSLA 1BQNA 2YNHA 3TR8A 2RN2A 3MEGA 3KLFA 3SPYA 4DTNA 5J1EA 1TKXA 1BL3A 4CF9A 4LY7A 1CXQA 5SZTA 3LZJA 1S9GA 4M42A 3VQ8A 5C42A 3NF6A 4CIFA 1QS4A 4FZZA 3LPUA 2G8IA 4CGIA 1RTJA 2YKNA 1WN7A 3PUFA 1WSEA 3ZSVA 4DG1A 4KHNA 3EZ5A 4DU3A 1VSHA 4HUGA 2DTUA 4DWIA 1QSYA 3ZT4A 3DLKA 3PX4A 1IKVA 3FFIA 4CJWA 3MXMA 4W5OA 4GVMA 2WOMA 5J2PA 3CFPA 2BDPA 4C8LA 1KVBA 5CYMA 3AVFA 4KTZA 4CGGA 1EKEA 3SV4A 2GBZA 2QXFA 3TABA 4I9LA 2EX3A 4W5QA 3WNFA 1SKRA 1NOYA 1VSIA 3NDKA 1TK8A 4C8KA 1IKYA 1B9FA 4BDPA 1MU2A 4CHPA 3NE6A 4FZYA 3KLHA 1DTTA 3PY8A 2IS3A 3EYZA 4HCBA 4LD0A 4B9VA 1RILA 4CFAA 4E3SA 1L3SA 4B9LA 4CHYA 4N76A 2HHQA 4FJJA 1BCMA 3C6TA 1REVA 1U48A 4F8RA 1TK0A 4C8MA 4OGEA 4CEQA 3RTVA 2Q3SA 4LSNA 3O4NA 1LWEA 4CJUA 3DLHA 3NGYA 3JSMA 3MEEA 1JLQA 3QEXA 3K5OA 5HBMA 3KIOA 4AHUA 2P5GA 1S6PA 2DFHA 2KZZA 4M3TA 4BACA 5JS2A 1NK0A 1U4BA 2I5JA 2D0CA 3VQAA 2D0BA 4BE2A 3KLEA 1RT3A 4C8NA 4E0DA 2F8TA 4W5RA 4KKOA 3VQ5A 4DFMA 2KTQA 1J9AA 1JLFA 4KFBA 4O0JA 3S3OA 1CZBA 2ZD1A 1J54A 4E7JA 3TAFA 1SL1A 4N5SA 3HVRA 3AVJA 1HJRA 2LSNA 4ZTFA 4CJ4A 3O3HA 1A5WA 1KTQA 4AH9A 4R5PA 2AJQA 4B3OA 2ZQBA 1TKZA 1S6QA 2ETJA 3AA3A 4G1QA 1GOCA 4N56A 1KVCA 1B92A 4CEBA 1ZBFA 4JLHA 1X9SA 4CJPA 3VA3A 5C25A 3HYFA 5CYQA 3HL8A 5HLFA 1ZBLA 2XY5A 1NK4A 1X9WA 4DSKA 1NK7A 4Z0UA 1IG9A 2OPQA 1JKHA 2B4JA 3LP0A 2FC0A 4FJIA 4I9QA 3QINA 1ASVA 4FJ5A 3NFAA 2R7YA 1S1UA 3HVTA 4DSJA 4Z4IA 4RW9A 3LWMA 2IC3A 1T8EA 2A1SA 3SUOA 3QO9A 1RT1A 1L3VA 4CGFA 4CGJA 1T7PA 4RW6A 2G8KA 4DQRA 4FLZA 3CM5A 1O1WA 3M8QA 5HROA 3MXIA 4B9SA 4QOZB 2OPRA 4OLBA 1WSFA 3DRRA 1NJZA 1L3TA 4M3ZA 4CJVA 1RT7A 5C24A 4AHTA 5K14A 3JYTA 2FBVA 3KK2A 3K5NA 4DQSA 4FJHA 3MECA 2G8HA 5HRRA 3CG7A 2F8SA 2FBXA 4Q0BA 2JLEA 3V9SA 4I7FA 2BANA 1I39A 1IH7A 3NF8A 4DSLA 1XHXA 4DLGA 3NAEA 5KGWA 5I3UA 5D3GA 3NH0A 3K5LA 3SZ2A 3WNEA 1RCHA 1L3UA 3M8RA 1T03A 1EX4A 2Z1IA 3DLRA 4DS5A 3RR8A 4FLTA 1TKTA 3OYEA 3HPHA 4DF8A 2FBTA 1DLOA 1S1VA 2NUBA 1RT6A 1NK8A 4EP5A 1JLBA 3ALYA 2P5OA 3NBPA 2Y1JA 4Q5VA 1NKBA 3WNGA 4MQ3A 4IBNA 3DI6A 1KRPA 3DLGA 3OYKA 3LPTA 5T7BA 4H4OA 1C1CA 4B8CA 4B08A 3VQDA 1RBUA 1G15A 2E6MA 2HHTA 4FM2A 3AO4A 1RBRA 1BHLA 2HB5A 3LALA 3LP2A 4JS5A 3QEVA 3V81A 3AVGA 2QKKA 1U45A 1YTUA 1ASWA 4L8RB 1HNVA 3HT3A 1S1TA 1EXQA 1KCFA 1VSLA 4DFKA 1L5UA 1W9HA 2RF2A 1TL3A 4H4MA 1TGOA 3SYZA 3VA0A 2OYQA 3V9UA 2HHUA 4NCGA 3ZT1A 4CIGA 1TL1A 2XO7A 3LAKA 2IOCA 5DK5A 3KTQA 1K6YA 3F9KA 3P1GA 4CJ5A 3OYMA 1NK6A 2IDOA 3HPGA 3U3GA 1NKEA 1S1WA 4KPYA 1FXXA 1IO2A 4M3UA 3DYAA 1VRTA 3ZSWA 4HVJA 1RDCA 4PWDA 1LAWA 4H8KA 4OVLA 3DMJA 2RKIA 3K58A 1KVAA 3QETA 1LW0A 1JL1A 1YVUA 4ID5A 5DMRA 3KD5E 3TAPA 4CK2A 3LZIA 3SQ0A 1BQMA 3AO2A 2VG5A 4IDKA 3QEIA 1XI1A 4B9NA 5CY4A 5FDLA 4CHNA 2D0AA 3AVMA 3F73A 4CJRA 3OYIA 5J2QA 4ELVA 4DU4A 5HRNA 1KFSA 2P51A 3L2UA 4OKKA 3OYDA 3DOLA 4N47A 1UOCA 4AHVA 3L2WA 4EZ9A 4FJLA 3NGZA 3QEWA 1EP4A 2DFFA 3S9HA 1Q9YA 4CFBA 5KI6A 2XY6A 4FJXA 3PX0A 3T19A 3OJSA 4KI4A 3O4QA 3ZT2A 3VQQA 4KB1A 4TSXA 4RW7A 5KRSA 1D9FA 3VQ7A 3VQBA 4DLEA 4DS4A 1DTQA 4DTOA 3V1QA 3DM2A 1C0TA 2VWKA 3V9XA 4Z4CA 3I8DA 5KGXA 5E41A 4IFVA 5HRSA 4ID1A 2QK9A 3B6OA 1W0HA 2EHGA 4E19A 4DTJA 4J2AA 5FROA 4DF4A 4KHWA 3AV9A 3TARA 1SUQA 1LV5A 4CF0A 4FJ7A 1QSLA 4PUOA 2XRIA 4M45A 1C0MA 1C6VA 4EZ6A 3NH1A 4PY5A 3HXMA 3H08A 4FLVA 1U04A 1WNSA 4AHSA 1J5OA 2G8UA 4OPKA 1UAXA 3SJJA 4JRQA 1RTDA 3ZSOA 1XWLA 3TI0A 3OS0A 4FYDA 2ZE2A 3S3NA 3AO1A 4XIUA 4CEZA 4F3TA 4BWJA 3VQEA 4FLXA 3QEPA 3TAMA 4AILC 4O44A 1WSJA 1JXBA 3CQ8A 1UA1A 3M8PA 1R0AA 3VQ6A 3ZSZA 3AVBA 4DFPA 1QTMA 3QNOA 3OYHA 3HSTB 4HHTA 2HNYA 4RG8A 4CE9A 1GOBA 4ZHRA 3VQ4A 1NK5A 2F96A 1NOZA 2OZSA 1NKCA 3IAYA 2PYJA 1WAJA 4DTRA 1QSSA 1D8YA 3SQ1A 3ZSYA 1RBSA 1QQCA 3OYAA 4K8XA 4M3WA 3V6DA 1WSGA 3TWHA 1HYVA 1UA0A 4Z4GA 3QERA 4GW6A 4QCLA 3U3YA 4ELTA 2X74A 3ITHA 4FW2A 4CEEA 4PA1A 3SI6A 3V9WA 4DTMA 3LP1A 3NCIA 2A1RA 3RR7A 4CGHA 4CGDA 2HNZA 2OPSA 3O3FA 2YNIA 4GMJB 1J53A 3QIPA 1RT5A 1BGXT 1JLGA 1VSJA 1S5JA 1D5AA 1S1XA 1VRUA 4LH5A 4CJEA 1X1PA 5HRPA 4DSFA 4QAGA 1FKOA 4KTWA 3AVIA 4DQQA 1WSIA 1HPZA 2Z1HA 1C0UA 3DLEA 3V1OA 1RDDA 4HUEA 3IG1A 3SNNA 4DTXA 4KHQA 3RWUA 4OPJA 1HQUA 4C8OA 4FJMA 3RMCA 3RMAA 2HMIA 1QE1A 3DRSA 3OVNA 4KB0A 3OYBA 1C1AA 4CFDA 3OS2A 4E1NA 3L8BA 2KZMA 4ICLA 4CJLA 2OPPA 3KJVA 1SKSA 1F21A 3P83D 1Y97A 1TV6A 4W5TA 3DLBA 5CZ2A 1QHTA 4J2DA 3L2RA 4CEFA 1BISA 4Y1DA 1ZYQA 2KFZA 4CJFA 3QESA 3KD1E 4E1MA 3ZSXA 4N41A 3LAMA 3QLHA 4DTPA 3BDPA 5J2NA 4Y1CA 1WSHA 3T1AA 4KV8A 4OKEA 3OYFA 3PX6A 3CFOA 4B9UA 4I2PA 3OS1A 2G8FA 3CYMA 3V1RA 1FK9A 3QNNA 1BI4A 1HYZA 4DQIA 3AA5X 4CEAA 3HM9A 2X6NA 4O4GA 3BGRA 1RBVA 1EETA 3L2QA 3SUPA 4FK0A 4FJ9A 1NJXA 1RBTA 3ZCMA 2ITGA 1BIUA 1HNIA 4O0IA 1HRHA 1WAFA 3LWLA 3K2PA 2XHBA 3RMBA 3P5JA 3RMDA 3AO3A 3E01A 3SCXA 1JLAA 1CXUA 1NJWA 1U49A 3AVCA 4BE1A 3RRGA 3AVAA 3OYLA 4CHQA 4YFUA 3KKRA 2VG7A 1KFDA 2IAJA 2BE2A 4CHOA 4I2QA 5SWMA 3NGIA 1HYSA 3AO5A 3AVLA 3DRPA 4FW1A 4UQGA 1SKWA 2D5RA 4FLWA 2Z1GA 3C94A 3VQ9A 2WONA 4DMNA 4E89A 2PZSA 4IFYA 4K8ZA 2HHVA 1IKWA 4E7KA 1BI4B 3C95A 4BDZA 1Z26A 4CFCA 4E7IA 4FM0A 4M3YA 2KFNA 4DTSA 3UIQA 4FZXC 1RTIA 2B6AA 3U6FA 1SL0A 2HVHA 3ZT0A 3DOKA 4BWMA 4FJKA 3L3UA 2GV9A 4AHCA 3AVHA 4LH4A 4HUFA 4FJ8A 3G0ZA 1U47A 4IKFA 1NJYA 4DQPA 4MFBA 3HPOA 2YNGA 2FBYA 2Z1JA 4IG3A 4M3RA 5KRTA 4FK2A 1VSKA 5EU7A 3KK1A 4KHSA 3ULDA 4CF1A 4CIEA 1BCOA 4J2EA 4CEDA 3MXJA 3THVA 4NCAA 3HK2A 4KRFA 4E7HA 1TAQA 3VN5A 3TAGA 4RW8A 1XHZA 4Z4FA 2YHAA 4KAZA 1ITGA 3A2FA 1VSDA 2HW3A 4W5NA 3SUQA 4FXDA 4Z4EA 4OKJA 4F4KA 4FCYA 1LW2A 4DFJA 1LWCA 4BDYA 2PYLA 2E6LA 4NYFA 3L3VA 1RTHA 3S3MA 4CF8A 4CJQA 4B8AB 3NHGA 3AA4A 1TKDA 4CEOA 3OY9A 2KQ2A 1ZBHA 2B5JA 4FLYA 4F2RA 4B9MA 3LP3A 3SQ2A 3C6UA 3G10A 3SPZA 2PY5A 4NCBA 3ISNC 1N6QA 3WNHA 1HQEA 3LDSA 2HHWA 2GUIA 5J2MA 4E7LA 3HJFA 3NF9A 1S9EA 3OYNA 1RDBA 3VQPA 4B9TA 1JL2A 1SV5A 1FKPA 4DTUA 4KTQA 4CJKA 3NF7A 4CJTA 1C1BA 4O55A 4WE1A 4F3OA 3V4IA 1VSEA 4FVMA 1Q8IA 3SUNA 3O3GA 3LANA 1NK9A 4FJNA 3HP9A 3QIOA 5I42A 1D9DA 1TK5A 1TVRA 1B9DA 1BIZA 3CM6A 3KLGA 1GOAA 3PO5A 3SV3A 1JLCA 3V9ZA 3PV8A 4OJRA 5HP1A 3OJUA 1CLQA 2YNFA 4ZTJA 1TAUA 4HCCA 4FLUA 3K57A 2G8VA 5KTQA 2JGUA 2OZMA 4KREA 3AVNA 3ZSQA 2VWJA 4EP4A 4JRPA 2KW4A 1VK0A 3OYGA 3T3FA 3B6PA 1JXEA 2DY4A 3OYJA 3IS9A 1VSFA 3I0RA 2E4LA 3HP6A 3KKSA 1RT2A 3AVKA 2VG6A 1LWFA 1RNHA 4CECA 4FK4A 3MAQA 2G8WA 1ZBIA 3ZSRA 3M8SA 4KO0A 4O5BA 4CCHA 1X9MA 1YTAA 4M3XA 4PQUA 3L2VA 3D0PA 4IG0A 1Q9XA 5FRNA 4NYNA 4DSEA 4DU1A 2BGGA 1VSMA 3VQCA 2HHSA 3HO1A 1LAVA 4OGCA 4CK1A 2ATQA 2X78A 1HMVA 4CERA 2Y1IA 2W42A 1KLMA 2OA8A 4KHUA 4CJ3A 3OYCA 1KSPA 4YNQA 2IGIA 3KK3A 3K59A 1JLEA 1YT3A 1Z25A 4OLAA 2O4IA 3ASMA 2HNDA 1N5YA 2YHBA 1UWBA 1IKXA 2O4GA 3IRXA 4CJSA 3TAQA 1RT4A 1KLNA 4HTUA 3RRHA 4KI6A 5JS1A 4ELUA 2P1JA 4RW4A 4FM1A 1XC9A 2DFEA 3TANA 3TAEA 4JS4A 3KLIA 1ASUA 2YKMA 4F2SA 1CZ9A 4BE0A 3SQ4A 4AHRA 4KHYA 1WLJA 2YV0X 4CK3A 1ZBUA 1SL2A 5CZ1A 3K5MA 2QKBA 4CHZA 4J2BA 2XY8A 1RDAA 2HVIA 1A5VA 4M41A 2X6SA 3AA2A 4CF2A 3I0SA 1A5XA 3CFRA 3D45A 2RPIA 3ZT3A 4FJGA 3MEDA 4DSIA 4Z4HA 3PO4A 2HHXA 4CESA 1I3AA 3EY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XY7 A;  3NH2 A;  1T05 A;  5FRM A;  4LSL A;  1BQN A;  2YNH A;  3TR8 A;  2RN2 A;  3MEG A;  3KLF A;  3SPY A;  4DTN A;  5J1E A;  1TKX A;  1BL3 A;  4CF9 A;  4LY7 A;  1CXQ A;  5SZT A;  3LZJ A;  1S9G A;  4M42 A;  3VQ8 A;  5C42 A;  3NF6 A;  4CIF A;  1QS4 A;  4FZZ A;  3LPU A;  2G8I A;  4CGI A;  1RTJ A;  2YKN A;  1WN7 A;  3PUF A;  1WSE A;  3ZSV A;  4DG1 A;  4KHN A;  3EZ5 A;  4DU3 A;  1VSH A;  4HUG A;  2DTU A;  4DWI A;  1QSY A;  3ZT4 A;  3DLK A;  3PX4 A;  1IKV A;  3FFI A;  4CJW A;  3MXM A;  4W5O A;  4GVM A;  2WOM A;  5J2P A;  3CFP A;  2BDP A;  4C8L A;  1KVB A;  5CYM A;  3AVF A;  4KTZ A;  4CGG A;  1EKE A;  3SV4 A;  2GBZ A;  2QXF A;  3TAB A;  4I9L A;  2EX3 A;  4W5Q A;  3WNF A;  1SKR A;  1NOY A;  1VSI A;  3NDK A;  1TK8 A;  4C8K A;  1IKY A;  1B9F A;  4BDP A;  1MU2 A;  4CHP A;  3NE6 A;  4FZY A;  3KLH A;  1DTT A;  3PY8 A;  2IS3 A;  3EYZ A;  4HCB A;  4LD0 A;  4B9V A;  1RIL A;  4CFA A;  4E3S A;  1L3S A;  4B9L A;  4CHY A;  4N76 A;  2HHQ A;  4FJJ A;  1BCM A;  3C6T A;  1REV A;  1U48 A;  4F8R A;  1TK0 A;  4C8M A;  4OGE A;  4CEQ A;  3RTV A;  2Q3S A;  4LSN A;  3O4N A;  1LWE A;  4CJU A;  3DLH A;  3NGY A;  3JSM A;  3MEE A;  1JLQ A;  3QEX A;  3K5O A;  5HBM A;  3KIO A;  4AHU A;  2P5G A;  1S6P A;  2DFH A;  2KZZ A;  4M3T A;  4BAC A;  5JS2 A;  1NK0 A;  1U4B A;  2I5J A;  2D0C A;  3VQA A;  2D0B A;  4BE2 A;  3KLE A;  1RT3 A;  4C8N A;  4E0D A;  2F8T A;  4W5R A;  4KKO A;  3VQ5 A;  4DFM A;  2KTQ A;  1J9A A;  1JLF A;  4KFB A;  4O0J A;  3S3O A;  1CZB A;  2ZD1 A;  1J54 A;  4E7J A;  3TAF A;  1SL1 A;  4N5S A;  3HVR A;  3AVJ A;  1HJR A;  2LSN A;  4ZTF A;  4CJ4 A;  3O3H A;  1A5W A;  1KTQ A;  4AH9 A;  4R5P A;  2AJQ A;  4B3O A;  2ZQB A;  1TKZ A;  1S6Q A;  2ETJ A;  3AA3 A;  4G1Q A;  1GOC A;  4N56 A;  1KVC A;  1B92 A;  4CEB A;  1ZBF A;  4JLH A;  1X9S A;  4CJP A;  3VA3 A;  5C25 A;  3HYF A;  5CYQ A;  3HL8 A;  5HLF A;  1ZBL A;  2XY5 A;  1NK4 A;  1X9W A;  4DSK A;  1NK7 A;  4Z0U A;  1IG9 A;  2OPQ A;  1JKH A;  2B4J A;  3LP0 A;  2FC0 A;  4FJI A;  4I9Q A;  3QIN A;  1ASV A;  4FJ5 A;  3NFA A;  2R7Y A;  1S1U A;  3HVT A;  4DSJ A;  4Z4I A;  4RW9 A;  3LWM A;  2IC3 A;  1T8E A;  2A1S A;  3SUO A;  3QO9 A;  1RT1 A;  1L3V A;  4CGF A;  4CGJ A;  1T7P A;  4RW6 A;  2G8K A;  4DQR A;  4FLZ A;  3CM5 A;  1O1W A;  3M8Q A;  5HRO A;  3MXI A;  4B9S A;  4QOZ B;  2OPR A;  4OLB A;  1WSF A;  3DRR A;  1NJZ A;  1L3T A;  4M3Z A;  4CJV A;  1RT7 A;  5C24 A;  4AHT A;  5K14 A;  3JYT A;  2FBV A;  3KK2 A;  3K5N A;  4DQS A;  4FJH A;  3MEC A;  2G8H A;  5HRR A;  3CG7 A;  2F8S A;  2FBX A;  4Q0B A;  2JLE A;  3V9S A;  4I7F A;  2BAN A;  1I39 A;  1IH7 A;  3NF8 A;  4DSL A;  1XHX A;  4DLG A;  3NAE A;  5KGW A;  5I3U A;  5D3G A;  3NH0 A;  3K5L A;  3SZ2 A;  3WNE A;  1RCH A;  1L3U A;  3M8R A;  1T03 A;  1EX4 A;  2Z1I A;  3DLR A;  4DS5 A;  3RR8 A;  4FLT A;  1TKT A;  3OYE A;  3HPH A;  4DF8 A;  2FBT A;  1DLO A;  1S1V A;  2NUB A;  1RT6 A;  1NK8 A;  4EP5 A;  1JLB A;  3ALY A;  2P5O A;  3NBP A;  2Y1J A;  4Q5V A;  1NKB A;  3WNG A;  4MQ3 A;  4IBN A;  3DI6 A;  1KRP A;  3DLG A;  3OYK A;  3LPT A;  5T7B A;  4H4O A;  1C1C A;  4B8C A;  4B08 A;  3VQD A;  1RBU A;  1G15 A;  2E6M A;  2HHT A;  4FM2 A;  3AO4 A;  1RBR A;  1BHL A;  2HB5 A;  3LAL A;  3LP2 A;  4JS5 A;  3QEV A;  3V81 A;  3AVG A;  2QKK A;  1U45 A;  1YTU A;  1ASW A;  4L8R B;  1HNV A;  3HT3 A;  1S1T A;  1EXQ A;  1KCF A;  1VSL A;  4DFK A;  1L5U A;  1W9H A;  2RF2 A;  1TL3 A;  4H4M A;  1TGO A;  3SYZ A;  3VA0 A;  2OYQ A;  3V9U A;  2HHU A;  4NCG A;  3ZT1 A;  4CIG A;  1TL1 A;  2XO7 A;  3LAK A;  2IOC A;  5DK5 A;  3KTQ A;  1K6Y A;  3F9K A;  3P1G A;  4CJ5 A;  3OYM A;  1NK6 A;  2IDO A;  3HPG A;  3U3G A;  1NKE A;  1S1W A;  4KPY A;  1FXX A;  1IO2 A;  4M3U A;  3DYA A;  1VRT A;  3ZSW A;  4HVJ A;  1RDC A;  4PWD A;  1LAW A;  4H8K A;  4OVL A;  3DMJ A;  2RKI A;  3K58 A;  1KVA A;  3QET A;  1LW0 A;  1JL1 A;  1YVU A;  4ID5 A;  5DMR A;  3KD5 E;  3TAP A;  4CK2 A;  3LZI A;  3SQ0 A;  1BQM A;  3AO2 A;  2VG5 A;  4IDK A;  3QEI A;  1XI1 A;  4B9N A;  5CY4 A;  5FDL A;  4CHN A;  2D0A A;  3AVM A;  3F73 A;  4CJR A;  3OYI A;  5J2Q A;  4ELV A;  4DU4 A;  5HRN A;  1KFS A;  2P51 A;  3L2U A;  4OKK A;  3OYD A;  3DOL A;  4N47 A;  1UOC A;  4AHV A;  3L2W A;  4EZ9 A;  4FJL A;  3NGZ A;  3QEW A;  1EP4 A;  2DFF A;  3S9H A;  1Q9Y A;  4CFB A;  5KI6 A;  2XY6 A;  4FJX A;  3PX0 A;  3T19 A;  3OJS A;  4KI4 A;  3O4Q A;  3ZT2 A;  3VQQ A;  4KB1 A;  4TSX A;  4RW7 A;  5KRS A;  1D9F A;  3VQ7 A;  3VQB A;  4DLE A;  4DS4 A;  1DTQ A;  4DTO A;  3V1Q A;  3DM2 A;  1C0T A;  2VWK A;  3V9X A;  4Z4C A;  3I8D A;  5KGX A;  5E41 A;  4IFV A;  5HRS A;  4ID1 A;  2QK9 A;  3B6O A;  1W0H A;  2EHG A;  4E19 A;  4DTJ A;  4J2A A;  5FRO A;  4DF4 A;  4KHW A;  3AV9 A;  3TAR A;  1SUQ A;  1LV5 A;  4CF0 A;  4FJ7 A;  1QSL A;  4PUO A;  2XRI A;  4M45 A;  1C0M A;  1C6V A;  4EZ6 A;  3NH1 A;  4PY5 A;  3HXM A;  3H08 A;  4FLV A;  1U04 A;  1WNS A;  4AHS A;  1J5O A;  2G8U A;  4OPK A;  1UAX A;  3SJJ A;  4JRQ A;  1RTD A;  3ZSO A;  1XWL A;  3TI0 A;  3OS0 A;  4FYD A;  2ZE2 A;  3S3N A;  3AO1 A;  4XIU A;  4CEZ A;  4F3T A;  4BWJ A;  3VQE A;  4FLX A;  3QEP A;  3TAM A;  4AIL C;  4O44 A;  1WSJ A;  1JXB A;  3CQ8 A;  1UA1 A;  3M8P A;  1R0A A;  3VQ6 A;  3ZSZ A;  3AVB A;  4DFP A;  1QTM A;  3QNO A;  3OYH A;  3HST B;  4HHT A;  2HNY A;  4RG8 A;  4CE9 A;  1GOB A;  4ZHR A;  3VQ4 A;  1NK5 A;  2F96 A;  1NOZ A;  2OZS A;  1NKC A;  3IAY A;  2PYJ A;  1WAJ A;  4DTR A;  1QSS A;  1D8Y A;  3SQ1 A;  3ZSY A;  1RBS A;  1QQC A;  3OYA A;  4K8X A;  4M3W A;  3V6D A;  1WSG A;  3TWH A;  1HYV A;  1UA0 A;  4Z4G A;  3QER A;  4GW6 A;  4QCL A;  3U3Y A;  4ELT A;  2X74 A;  3ITH A;  4FW2 A;  4CEE A;  4PA1 A;  3SI6 A;  3V9W A;  4DTM A;  3LP1 A;  3NCI A;  2A1R A;  3RR7 A;  4CGH A;  4CGD A;  2HNZ A;  2OPS A;  3O3F A;  2YNI A;  4GMJ B;  1J53 A;  3QIP A;  1RT5 A;  1BGX T;  1JLG A;  1VSJ A;  1S5J A;  1D5A A;  1S1X A;  1VRU A;  4LH5 A;  4CJE A;  1X1P A;  5HRP A;  4DSF A;  4QAG A;  1FKO A;  4KTW A;  3AVI A;  4DQQ A;  1WSI A;  1HPZ A;  2Z1H A;  1C0U A;  3DLE A;  3V1O A;  1RDD A;  4HUE A;  3IG1 A;  3SNN A;  4DTX A;  4KHQ A;  3RWU A;  4OPJ A;  1HQU A;  4C8O A;  4FJM A;  3RMC A;  3RMA A;  2HMI A;  1QE1 A;  3DRS A;  3OVN A;  4KB0 A;  3OYB A;  1C1A A;  4CFD A;  3OS2 A;  4E1N A;  3L8B A;  2KZM A;  4ICL A;  4CJL A;  2OPP A;  3KJV A;  1SKS A;  1F21 A;  3P83 D;  1Y97 A;  1TV6 A;  4W5T A;  3DLB A;  5CZ2 A;  1QHT A;  4J2D A;  3L2R A;  4CEF A;  1BIS A;  4Y1D A;  1ZYQ A;  2KFZ A;  4CJF A;  3QES A;  3KD1 E;  4E1M A;  3ZSX A;  4N41 A;  3LAM A;  3QLH A;  4DTP A;  3BDP A;  5J2N A;  4Y1C A;  1WSH A;  3T1A A;  4KV8 A;  4OKE A;  3OYF A;  3PX6 A;  3CFO A;  4B9U A;  4I2P A;  3OS1 A;  2G8F A;  3CYM A;  3V1R A;  1FK9 A;  3QNN A;  1BI4 A;  1HYZ A;  4DQI A;  3AA5 X;  4CEA A;  3HM9 A;  2X6N A;  4O4G A;  3BGR A;  1RBV A;  1EET A;  3L2Q A;  3SUP A;  4FK0 A;  4FJ9 A;  1NJX A;  1RBT A;  3ZCM A;  2ITG A;  1BIU A;  1HNI A;  4O0I A;  1HRH A;  1WAF A;  3LWL A;  3K2P A;  2XHB A;  3RMB A;  3P5J A;  3RMD A;  3AO3 A;  3E01 A;  3SCX A;  1JLA A;  1CXU A;  1NJW A;  1U49 A;  3AVC A;  4BE1 A;  3RRG A;  3AVA A;  3OYL A;  4CHQ A;  4YFU A;  3KKR A;  2VG7 A;  1KFD A;  2IAJ A;  2BE2 A;  4CHO A;  4I2Q A;  5SWM A;  3NGI A;  1HYS A;  3AO5 A;  3AVL A;  3DRP A;  4FW1 A;  4UQG A;  1SKW A;  2D5R A;  4FLW A;  2Z1G A;  3C94 A;  3VQ9 A;  2WON A;  4DMN A;  4E89 A;  2PZS A;  4IFY A;  4K8Z A;  2HHV A;  1IKW A;  4E7K A;  1BI4 B;  3C95 A;  4BDZ A;  1Z26 A;  4CFC A;  4E7I A;  4FM0 A;  4M3Y A;  2KFN A;  4DTS A;  3UIQ A;  4FZX C;  1RTI A;  2B6A A;  3U6F A;  1SL0 A;  2HVH A;  3ZT0 A;  3DOK A;  4BWM A;  4FJK A;  3L3U A;  2GV9 A;  4AHC A;  3AVH A;  4LH4 A;  4HUF A;  4FJ8 A;  3G0Z A;  1U47 A;  4IKF A;  1NJY A;  4DQP A;  4MFB A;  3HPO A;  2YNG A;  2FBY A;  2Z1J A;  4IG3 A;  4M3R A;  5KRT A;  4FK2 A;  1VSK A;  5EU7 A;  3KK1 A;  4KHS A;  3ULD A;  4CF1 A;  4CIE A;  1BCO A;  4J2E A;  4CED A;  3MXJ A;  3THV A;  4NCA A;  3HK2 A;  4KRF A;  4E7H A;  1TAQ A;  3VN5 A;  3TAG A;  4RW8 A;  1XHZ A;  4Z4F A;  2YHA A;  4KAZ A;  1ITG A;  3A2F A;  1VSD A;  2HW3 A;  4W5N A;  3SUQ A;  4FXD A;  4Z4E A;  4OKJ A;  4F4K A;  4FCY A;  1LW2 A;  4DFJ A;  1LWC A;  4BDY A;  2PYL A;  2E6L A;  4NYF A;  3L3V A;  1RTH A;  3S3M A;  4CF8 A;  4CJQ A;  4B8A B;  3NHG A;  3AA4 A;  1TKD A;  4CEO A;  3OY9 A;  2KQ2 A;  1ZBH A;  2B5J A;  4FLY A;  4F2R A;  4B9M A;  3LP3 A;  3SQ2 A;  3C6U A;  3G10 A;  3SPZ A;  2PY5 A;  4NCB A;  3ISN C;  1N6Q A;  3WNH A;  1HQE A;  3LDS A;  2HHW A;  2GUI A;  5J2M A;  4E7L A;  3HJF A;  3NF9 A;  1S9E A;  3OYN A;  1RDB A;  3VQP A;  4B9T A;  1JL2 A;  1SV5 A;  1FKP A;  4DTU A;  4KTQ A;  4CJK A;  3NF7 A;  4CJT A;  1C1B A;  4O55 A;  4WE1 A;  4F3O A;  3V4I A;  1VSE A;  4FVM A;  1Q8I A;  3SUN A;  3O3G A;  3LAN A;  1NK9 A;  4FJN A;  3HP9 A;  3QIO A;  5I42 A;  1D9D A;  1TK5 A;  1TVR A;  1B9D A;  1BIZ A;  3CM6 A;  3KLG A;  1GOA A;  3PO5 A;  3SV3 A;  1JLC A;  3V9Z A;  3PV8 A;  4OJR A;  5HP1 A;  3OJU A;  1CLQ A;  2YNF A;  4ZTJ A;  1TAU A;  4HCC A;  4FLU A;  3K57 A;  2G8V A;  5KTQ A;  2JGU A;  2OZM A;  4KRE A;  3AVN A;  3ZSQ A;  2VWJ A;  4EP4 A;  4JRP A;  2KW4 A;  1VK0 A;  3OYG A;  3T3F A;  3B6P A;  1JXE A;  2DY4 A;  3OYJ A;  3IS9 A;  1VSF A;  3I0R A;  2E4L A;  3HP6 A;  3KKS A;  1RT2 A;  3AVK A;  2VG6 A;  1LWF A;  1RNH A;  4CEC A;  4FK4 A;  3MAQ A;  2G8W A;  1ZBI A;  3ZSR A;  3M8S A;  4KO0 A;  4O5B A;  4CCH A;  1X9M A;  1YTA A;  4M3X A;  4PQU A;  3L2V A;  3D0P A;  4IG0 A;  1Q9X A;  5FRN A;  4NYN A;  4DSE A;  4DU1 A;  2BGG A;  1VSM A;  3VQC A;  2HHS A;  3HO1 A;  1LAV A;  4OGC A;  4CK1 A;  2ATQ A;  2X78 A;  1HMV A;  4CER A;  2Y1I A;  2W42 A;  1KLM A;  2OA8 A;  4KHU A;  4CJ3 A;  3OYC A;  1KSP A;  4YNQ A;  2IGI A;  3KK3 A;  3K59 A;  1JLE A;  1YT3 A;  1Z25 A;  4OLA A;  2O4I A;  3ASM A;  2HND A;  1N5Y A;  2YHB A;  1UWB A;  1IKX A;  2O4G A;  3IRX A;  4CJS A;  3TAQ A;  1RT4 A;  1KLN A;  4HTU A;  3RRH A;  4KI6 A;  5JS1 A;  4ELU A;  2P1J A;  4RW4 A;  4FM1 A;  1XC9 A;  2DFE A;  3TAN A;  3TAE A;  4JS4 A;  3KLI A;  1ASU A;  2YKM A;  4F2S A;  1CZ9 A;  4BE0 A;  3SQ4 A;  4AHR A;  4KHY A;  1WLJ A;  2YV0 X;  4CK3 A;  1ZBU A;  1SL2 A;  5CZ1 A;  3K5M A;  2QKB A;  4CHZ A;  4J2B A;  2XY8 A;  1RDA A;  2HVI A;  1A5V A;  4M41 A;  2X6S A;  3AA2 A;  4CF2 A;  3I0S A;  1A5X A;  3CFR A;  3D45 A;  2RPI A;  3ZT3 A;  4FJG A;  3MED A;  4DSI A;  4Z4H A;  3PO4 A;  2HHX A;  4CES A;  1I3A A;  3EY1 A; 
#chains in the Genus database with same CATH topology
 5FRM A;  2YNH A;  3MEG A;  3WQU A;  3VER A;  3HOT A;  1TKX A;  1BL3 A;  4X64 K;  4CF9 A;  5AQZ A;  3BF3 A;  4LY7 A;  5SZT A;  2ZM6 K;  3G6E N;  3VQ8 A;  3NF6 A;  4G9Z A;  1KXP A;  4BRA A;  2G8I A;  1RTJ A;  1WN7 A;  3ZSV A;  1WSE A;  4IOA L;  3WXL A;  3AY9 A;  4CJW A;  2OCE A;  4GVM A;  3T1H K;  2BDP A;  4C8L A;  4LFA K;  1ATR A;  3E9L A;  4CGG A;  1EKE A;  2V7Y A;  1BWF O;  4I9L A;  1U2V B;  1VSI A;  1IKY A;  3NE6 A;  4BRM A;  4FZY A;  3KLH A;  3U9D A;  3PY8 A;  3EYZ A;  4HCB A;  4CFA A;  4QS8 A;  4FJJ A;  3C6T A;  4O8U A;  1REV A;  4F8R A;  3RTV A;  4B3T K;  2Q3S A;  3MN5 A;  1GLC G;  3K5O A;  3H3O B;  4AHU A;  2E1Z A;  3F9M A;  2KZZ A;  2DFH A;  2BUP A;  4A57 A;  1U4B A;  1N33 K;  2P9N A;  2D0C A;  5M1Q A;  4BE2 A;  3KLE A;  4C8N A;  4B3R K;  4E0D A;  2KTQ A;  1J9A A;  1JLF A;  1BO5 O;  1CZB A;  2ZD1 A;  4E7J A;  3TAF A;  1YJW N;  3HVR A;  2LSN A;  3QB0 A;  3O3H A;  1A5W A;  1NGD A;  2AJQ A;  4B3O A;  4KH4 A;  2ZQB A;  5LMU K;  4G1Q A;  4CEB A;  4DCH A;  1ZBF A;  4CBU A;  3BP8 A;  5CYQ A;  1WB9 A;  2XY5 A;  2BTF A;  2I7N A;  1NK7 A;  1JKH A;  1HKG A;  2FC0 A;  1ASV A;  2R7Y A;  1SAZ A;  2IIR A;  1T8E A;  1RT1 A;  2E2P A;  1T7P A;  4RW6 A;  3CER A;  3MXI A;  2I7P A;  4A5B A;  1WSF A;  4CJV A;  1RT7 A;  5K14 A;  4K43 A;  3KK2 A;  2ZJR L;  1VQK N;  4DQS A;  2E20 A;  2BH1 A;  3CG7 A;  4LF5 K;  2NNW A;  2FBX A;  4BRL A;  1IH7 A;  3NF8 A;  4DSL A;  4DLG A;  3H1Q A;  3NAE A;  4UY8 O;  5KGW A;  4BC4 A;  1YUW A;  2O8C A;  4H0P A;  1WBB A;  3IDH A;  1T03 A;  1TKT A;  3G4S N;  2FBT A;  4JI1 K;  3P4I A;  4BRI A;  1NK8 A;  3P39 A;  4EP5 A;  5CR4 A;  4MQ3 A;  1Z05 A;  3DI6 A;  3BZC A;  4IOC L;  1NM1 A;  3VQD A;  1G15 A;  2HHT A;  1RBR A;  1U45 A;  1HNV A;  1EXQ A;  3OHR A;  2O8D A;  2P9U B;  2ZF5 O;  1TL3 A;  2W41 A;  3SYZ A;  1QQM A;  4DV5 K;  4NCG A;  3R9P A;  2XO7 A;  4PKG A;  5M1O A;  3P1G A;  4LF4 K;  3WXM B;  4JI7 K;  3HPG A;  3U3G A;  5IWA K;  4FOI A;  1BOT O;  3CJB A;  1NWK A;  1VRT A;  3D2F B;  1LAW A;  2RKI A;  3LM9 A;  1LW0 A;  1YVU A;  5DMR A;  4ID5 A;  3J7Y P;  4CK2 A;  3SQ0 A;  1BQM A;  3DXK A;  5BRH A;  5CY4 A;  4CHN A;  2YHY A;  4CZH A;  3PLA A;  4DU4 A;  4LC9 B;  1FW6 A;  4AHV A;  3L2W A;  1Q7Y O;  4EZ9 A;  1IG8 A;  4FJL A;  4OO1 J;  1KD1 O;  2DFF A;  5KQ8 A;  5AQV A;  4CFB A;  5KI6 A;  1C0F A;  4H0X B;  3ZT2 A;  4KB1 A;  3O6W A;  5AQO A;  3V1Q A;  3DM2 A;  3I8D A;  5KGX A;  5E41 A;  3M5R A;  2QK9 A;  5F1X A;  3G25 A;  1W0H A;  4DTJ A;  4E19 A;  3OBY A;  5FRO A;  4KHW A;  3TAR A;  1SUQ A;  4FJ7 A;  4PY5 A;  2UUA K;  2O8E A;  4BRN A;  4JRQ A;  1RTD A;  1XWL A;  4DR6 K;  3SJH A;  4CEZ A;  4F3T A;  3TAM A;  4AIL C;  1GLD G;  2QW9 A;  1JXB A;  3CQ8 A;  2VQE K;  3B8A X;  2IVP A;  3VQ6 A;  1QTM A;  4H5W A;  3TSQ A;  2PFU A;  2HNY A;  4RG8 A;  3UB5 A;  4CE9 A;  4ZHR A;  3VQ4 A;  1NK5 A;  4CJ7 A;  4JN4 A;  2O8B A;  5TKY A;  3SQ1 A;  3ZSY A;  3OYA A;  3CCS N;  1WSG A;  5AQQ A;  3TSP A;  4MLE A;  3ZEU A;  4ELT A;  3THY B;  4DUY K;  4CEE A;  3N4Q A;  4PA1 A;  1T6C A;  4EHT A;  2HNZ A;  3O3F A;  3JXU A;  5M1F A;  3QBW A;  4YOU A;  1JLG A;  3SI6 A;  1KRP A;  4CJE A;  2H3G X;  2UU9 K;  4DQQ A;  3TTC A;  4JD2 B;  4JK8 A;  3QFU A;  1NGG A;  4OPJ A;  1HQU A;  4C8O A;  4FJM A;  1S22 A;  3RMC A;  4PL8 A;  3LDO A;  1W7A A;  3OVN A;  3DRS A;  4KB0 A;  4J8F A;  5KPR A;  3KVG A;  5FPE A;  4JHD B;  1DT9 A;  4JHD A;  2OPP A;  2F4V K;  4CZI A;  2NRV A;  4W5T A;  2E2Q A;  3C7N A;  4B3M K;  4ILG B;  1BIS A;  3LDL A;  1EO1 A;  5C2D A;  3ZSX A;  3MDQ A;  2FLO A;  3BDP A;  3W3D A;  5J2N A;  4Y1C A;  4OKE A;  3OYF A;  3PX6 A;  4I2P A;  3V1R A;  4DQI A;  1H1V A;  4JKF A;  1BDG A;  2X6N A;  3Q7B A;  1RBV A;  3CC4 N;  3SUP A;  2GTD A;  2OTJ N;  1NJX A;  1HLU A;  1HRH A;  3RMB A;  3AO3 A;  5GIN A;  3E01 A;  3SCX A;  1JLA A;  2FXU A;  4PKI A;  3OYL A;  4CHQ A;  1T6D A;  3D7E O;  4YFU A;  3GDQ A;  4I2Q A;  5SWM A;  3KZB A;  3MN6 A;  4C1N K;  5E84 A;  4CZL A;  3C94 A;  2E2N A;  4E89 A;  5BPM A;  1IKW A;  3R3L A;  4FO0 A;  2HVH A;  3KWI A;  3ZT0 A;  3ID6 A;  1OVY A;  3G0Z A;  1NJY A;  3MCA B;  4MFB A;  4DQP A;  2W6L A;  4RTF D;  2FBY A;  4M3R A;  4IO8 A;  3DXK B;  1QQN A;  3C6A A;  1RDU A;  1OH8 A;  1JJ2 M;  4J2E A;  2QTD A;  4NCA A;  4CZE A;  2WFB A;  4RW8 A;  4KAZ A;  1ITG A;  2HW3 A;  3SUQ A;  4Z4E A;  2CGL A;  4F4K A;  4FCY A;  4DFJ A;  5DM7 L;  1YXQ A;  3CJA A;  2PYL A;  3BEX A;  4B1X B;  4FSV A;  4CF8 A;  3D2E B;  4IXC A;  1TKD A;  3MX2 A;  4CEO A;  3JAM O;  1QZ5 A;  2KQ2 A;  2B5J A;  2P9L B;  3SPZ A;  4NCB A;  3ISN C;  2HHW A;  2GUI A;  3NF9 A;  5JIC A;  1RDB A;  4B9T A;  1JL2 A;  4KTQ A;  1U2V A;  2HST A;  1C1B A;  2QWR A;  3SK3 A;  5GIO A;  3V4I A;  5BN9 A;  3LAN A;  1VQL N;  3CJ7 A;  3THW B;  3T1Y K;  3UKR A;  1D9D A;  1B9D A;  5MLC Q;  1T44 A;  3SV3 A;  4JKA A;  5AQP A;  5HP1 A;  1GLE G;  4DUZ K;  4ZTJ A;  2A3Z A;  2O8C B;  1NGI A;  1MWM A;  2W40 A;  3ZSQ A;  3F5T A;  2KW4 A;  1VK0 A;  3EE8 A;  3T3F A;  2DY4 A;  2O8B B;  4YDU A;  3CCQ N;  4K42 A;  4YOR A;  3EKU A;  4BG8 A;  1TUU A;  3DXM B;  1RT2 A;  3ENH A;  3HP6 A;  4Z4G A;  3MAQ A;  3M8S A;  4YOX A;  4CCH A;  5FRN A;  4CW7 B;  4OGC A;  1HMV A;  4KH6 A;  3UKU A;  2FSJ A;  2O8D B;  3DLL L;  4KHU A;  4CJ3 A;  3OYC A;  3KK3 A;  3K59 A;  1JLE A;  1YT3 A;  5FLX O;  2HND A;  1N5Y A;  1V4T A;  4CJS A;  3TAQ A;  4JKB A;  1NG9 A;  3BY5 A;  4RW4 A;  1ASU A;  1NMN A;  4WFB L;  4F2S A;  1CZ9 A;  3SQ4 A;  2VQF K;  1SL2 A;  1ZBU A;  2GWJ A;  3VES A;  3HSC A;  4CHZ A;  2QKB A;  2XY8 A;  4X65 K;  4CF2 A;  4H0Y B;  1A5X A;  4ILJ A;  3CFR A;  3CHW A;  3CC2 N;  4Z4H A;  4OX9 K;  2HHX A;  4H0O A;  3WXK A;  2XY7 A;  5KPT A;  2D1K A;  3NH2 A;  1T05 A;  4MDB A;  3KLF A;  3SPY A;  1OH6 A;  3O1B A;  4M42 A;  4BVO A;  1QS4 A;  3OTO K;  2A5X A;  2W6K A;  1ATN A;  4BC3 A;  1X3N A;  4DU3 A;  1VSH A;  2DTU A;  4DWI A;  1QSY A;  3DLK A;  3PX4 A;  1YJN N;  3MXM A;  3R8E A;  5J2P A;  3E9P A;  4KTZ A;  2GBZ A;  2EX3 A;  3AAP A;  3WNF A;  1XNR K;  3MN9 A;  4BDP A;  1MU2 A;  4CHP A;  1J6Z A;  1DTT A;  5AQH A;  4LD0 A;  4B9V A;  4B9L A;  4E3S A;  3VGK A;  3D2E A;  4LSN A;  1R59 O;  1LWE A;  3JSM A;  3MEE A;  1JLQ A;  5HBM A;  3KIO A;  3M6G A;  3IMX A;  4WFA L;  5DM6 L;  4BAC A;  5JS2 A;  1X3M A;  3AAR A;  2P9N B;  2D0B A;  2F7T A;  4FWL A;  3VQ5 A;  4DB3 A;  1Y64 A;  2D4W A;  1ZC6 A;  1SL1 A;  4BRF A;  1BA1 A;  4CJ4 A;  4DR7 K;  2YJF A;  3O9R A;  4AH9 A;  4R5P A;  4PL7 A;  2Q97 A;  1TKZ A;  2ETJ A;  3ENB A;  4N56 A;  3O4W A;  4CJP A;  2RE2 A;  1KC8 O;  5HLF A;  1X9W A;  4DSK A;  4BQZ A;  5AQN A;  2FF6 A;  4Z0U A;  2OPQ A;  4I9Q A;  2B4J A;  1YJ9 N;  4LF9 K;  1S1U A;  2E88 A;  3EE9 A;  2IC3 A;  1L3V A;  2P9P B;  4CGF A;  2G8K A;  5ADX A;  4BR2 A;  3CM5 A;  1O1W A;  3M8Q A;  4B9S A;  4QOZ B;  4WCE L;  3GL1 A;  2A40 A;  3WQT A;  3SAF A;  3DRR A;  4U67 L;  5AZJ A;  1L3T A;  5C24 A;  2A6A A;  4AHT A;  3JYT A;  2FBV A;  1VQP N;  1BU6 O;  2F8S A;  3CCJ N;  3V9S A;  3FZM A;  2QXL A;  2BAN A;  3O9S A;  4KBO A;  1XHX A;  5D3G A;  5BR8 K;  3WNE A;  1L3U A;  2P9P A;  4FLT A;  1DLO A;  1S1V A;  2QWM A;  4IO9 L;  2P5O A;  4Q5V A;  3WNG A;  3LM2 A;  4LF8 K;  3DLG A;  3LPT A;  5T7B A;  3S41 A;  1C1C A;  3PSF A;  3AO4 A;  3UKR B;  3ATV A;  4JKH A;  4R79 A;  1U6Z A;  3HT3 A;  4O8K A;  1KCF A;  1YI2 N;  1K6Y A;  3F9K A;  2D0P A;  1ZBS A;  4CJ5 A;  2IDO A;  2D0O A;  1JCG A;  1QHA A;  1FXX A;  2VCP A;  4M3U A;  3SLC A;  4PWD A;  1RDC A;  4OVL A;  4GKK K;  3K58 A;  3KD5 E;  3EL2 A;  3LZI A;  4IDK A;  3QEI A;  1XI1 A;  4B9N A;  3WXJ A;  5LJV A;  3QDK A;  3AVM A;  5J2Q A;  4ELV A;  1KFS A;  4OKK A;  4N47 A;  3MN7 A;  4M7X A;  5EX5 A;  1MDU B;  4DR1 K;  4EHU A;  1X9J A;  1K8A O;  2ASP A;  2QA4 N;  2XY6 A;  3VEN A;  3FZF A;  1WBD A;  3T19 A;  5KQD A;  3EN9 A;  3O4Q A;  3VQQ A;  3R1X A;  2HBK A;  1DTQ A;  3V9X A;  2HOE A;  3B6O A;  2EHG A;  3T7Z A;  4DF4 A;  3AV9 A;  3AGR A;  3U4L A;  3THW A;  1QSL A;  4IZ9 A;  5EXW A;  5GAD P;  1VQO N;  3H08 A;  1U04 A;  1UAX A;  3ZSO A;  1N8R O;  1VQ5 N;  3S3N A;  4B1U B;  2GEL A;  3AO1 A;  3FZK A;  4XH1 A;  4XIU A;  4FLX A;  3IKM A;  4O44 A;  1WSJ A;  4H5R A;  3M8P A;  5E26 A;  3QNO A;  3HST B;  4HHT A;  1NOZ A;  3DJC A;  3J81 O;  1NKC A;  2OZS A;  1XNQ K;  1NGF A;  1WAJ A;  5FPD A;  1NJI O;  3TWH A;  1HR0 K;  4KHP K;  1NMD A;  4GW6 A;  1HNZ K;  3GBT A;  1Z6R A;  4EFH A;  5AJ3 K;  3UKU B;  3NCI A;  3RR7 A;  4FVU A;  4BRG A;  2OPS A;  4CGD A;  3QIP A;  5AFU H;  1YVN A;  1BGX T;  4DSF A;  4Y0W A;  2O8F B;  1SZ2 A;  1HPZ A;  3V1O A;  5BRD A;  2UUB K;  4JD2 A;  3J80 O;  5LMN K;  5BR9 A;  4KHQ A;  3E1Y A;  4FWN A;  3WEE A;  3J7A P;  1QE1 A;  3OYB A;  3OS2 A;  3KJV A;  1SKS A;  1F21 A;  3A8Y A;  1Y97 A;  1TV6 A;  4I6M A;  4I6M B;  3M3Z A;  4DQ8 A;  3QES A;  4JK9 A;  3LAM A;  2QWL A;  4DTP A;  3E66 A;  4KV8 A;  2G8F A;  3VTH A;  3DWL A;  3CYM A;  4L3Q A;  3CI5 A;  4O4G A;  1TYQ B;  2P9S B;  3THX B;  1RBT A;  3G71 N;  1HNI A;  1WAF A;  3K2P A;  4DV1 K;  3P5J A;  4FPA A;  1KAZ A;  3RRG A;  1BG3 A;  1KFD A;  4BRQ A;  4CHO A;  3NGI A;  4FW1 A;  1SKW A;  2D5R A;  2QM1 A;  2Z1G A;  4DMN A;  4K8Z A;  2HHV A;  4E7K A;  4GY2 B;  4E7I A;  2KFN A;  4DHY A;  4DTS A;  3UIQ A;  1D4X A;  4FZX C;  5C0Y A;  3WUH A;  2IVO A;  4AHC A;  3AVH A;  3VGL A;  4FJ8 A;  1U47 A;  4IKF A;  4FOE A;  1E4G T;  2Z1J A;  5KRT A;  4FK2 A;  3C0B A;  3ULD A;  4KHS A;  4GNI A;  1BCO A;  3VTI A;  4NLB A;  3MXJ A;  2Q0R A;  1TAQ A;  3TAG A;  1XHZ A;  1HJO A;  1LW2 A;  1VQ7 N;  4BDY A;  2E6L A;  3L3V A;  1RTH A;  3NHG A;  2NRH A;  2A41 A;  1QQO A;  3CCL N;  1HNW K;  3TU5 A;  4FLY A;  4BR9 A;  4B9M A;  2UUC K;  3SQ2 A;  2PY5 A;  3O9T A;  3K9J A;  2NRX A;  1N6Q A;  3I8B A;  4E7L A;  3CME N;  3HJF A;  2NRZ A;  3OYN A;  2OAN A;  2E2O A;  1TUY A;  3VQP A;  4DTU A;  4CJT A;  4DV0 K;  4O55 A;  1K8K A;  3ULE A;  4FJN A;  3HP9 A;  5I42 A;  1TVR A;  3CJ9 A;  3KLG A;  3PO5 A;  2Q1N A;  1P90 A;  4OJR A;  3OJU A;  1CLQ A;  1MA9 B;  1TAU A;  4HCC A;  3K57 A;  2ZJP L;  2G8V A;  5AQX A;  4KRE A;  2OZM A;  2DPN A;  2VWJ A;  3GOI A;  3H46 O;  3OYJ A;  5KPZ A;  3IS9 A;  3I56 N;  3I0R A;  3KKS A;  1LWF A;  3QFP A;  3ZSR A;  4KO0 A;  4O5B A;  1X9M A;  1YTA A;  4IG0 A;  4CZJ A;  1Q9X A;  4NYN A;  1VSM A;  5LJW A;  4CK1 A;  1JCE A;  2ATQ A;  2X78 A;  3LDQ A;  1XUP O;  1KSP A;  3CET A;  2YJE A;  3ZET B;  3IRX A;  1XQS C;  4GVE A;  5M1P A;  4C23 A;  5JS1 A;  3TAN A;  4BE0 A;  4KHY A;  4CK3 A;  3DXM A;  5C15 A;  2ASO A;  3GG4 A;  2Q36 A;  1VQ6 N;  3I0S A;  4K41 A;  2RPI A;  3H6E A;  1NGJ A;  3P31 A;  2E8A A;  2QEX N;  4K0K K;  5J1E A;  2A42 A;  1K73 O;  1CXQ A;  3ZET A;  5C42 A;  4CIF A;  3I33 A;  4NLC A;  1FJG K;  3ZYY X;  3A5N C;  1ATS A;  5GAE P;  1ZXO A;  3WEE B;  4KHN A;  5EY4 A;  1NGA A;  4HUG A;  3CC7 N;  3ZT4 A;  3FFI A;  5FPN A;  4WYB A;  2FSN A;  1KVB A;  5AZI A;  4GV3 A;  5F0X A;  3TAB A;  3RSE A;  3FGU A;  1NOY A;  3NDK A;  1TK8 A;  4C8K A;  1RGI A;  4JI3 K;  2IS3 A;  3SBG A;  2HHQ A;  4N76 A;  4CHY A;  4JEP A;  1BCM A;  1TK0 A;  4C8M A;  4CEQ A;  4DV3 K;  1O13 A;  4BVP A;  3DLH A;  3TPQ A;  3OW2 M;  2P9K A;  3QEX A;  2P5G A;  3D2F A;  4M3T A;  3ENO A;  2I5J A;  2QWP A;  3CCE N;  2F8T A;  1RT3 A;  3BUZ B;  2YHX A;  3AVJ A;  4JI5 K;  5F2R A;  2ZGY A;  2GX9 A;  3PSI A;  1S6Q A;  3FR0 A;  1Q86 O;  3AA3 A;  4MO5 A;  1KVC A;  1X9S A;  4BR4 A;  3VA3 A;  5C25 A;  3HL8 A;  4H03 B;  2ASM A;  3CD6 N;  3VEY A;  3QIN A;  2GEM A;  4H0V B;  1HX1 A;  4DSJ A;  4Z4I A;  4BR0 A;  4RW9 A;  2A1S A;  4WQ4 A;  3QO9 A;  4CZF A;  5LY3 A;  4DV2 K;  4XH4 A;  4CGJ A;  4FWQ A;  3CCV N;  4FLZ A;  5HRO A;  5EOY A;  3FZH A;  1GLJ O;  2OPR A;  1OH5 A;  4FWS A;  1NJZ A;  3TSU A;  4FJH A;  2G8H A;  5HRR A;  3PIP L;  2RHK A;  2PBD A;  1VQ4 N;  4AM7 A;  4Q0B A;  4A5A A;  1I39 A;  2CGJ A;  5H1S Q;  3K5L A;  3SZ2 A;  4FWR A;  4FWO A;  1RCH A;  2Z1I A;  2OTL N;  3DLR A;  4DS5 A;  3RR8 A;  5AQR A;  5BRE A;  3HPH A;  4DF8 A;  2NUB A;  1RT6 A;  1JLB A;  4JKD A;  3ALY A;  2PAV A;  1NKB A;  3O1W A;  1DKG D;  4CBX A;  4B8C A;  2E6M A;  3A0I X;  4FM2 A;  3V81 A;  1BHL A;  3LP2 A;  5HL7 L;  4JS5 A;  3AVG A;  2QKK A;  1YTU A;  1ASW A;  4L8R B;  3QIC A;  4IFE A;  4DFK A;  1L5U A;  4AF1 A;  1W9H A;  2RF2 A;  3VA0 A;  2HHU A;  3L0Q A;  3ZT1 A;  4CIG A;  1TL1 A;  5GIP A;  5JVG L;  3LAK A;  2IOC A;  5DK5 A;  3KTQ A;  1QVF M;  1RFQ A;  3OYM A;  1YIJ N;  1NKE A;  1S1W A;  4KPY A;  4BRP A;  3DYA A;  3ZSW A;  1HKB A;  3DMJ A;  3JS6 A;  1KVA A;  4PKH A;  1JL1 A;  2UXC K;  3TAP A;  1NJW A;  5AQG A;  5FDL A;  2NRR A;  2D0A A;  1GLF O;  1K8K B;  3ULE B;  4CJR A;  3OYI A;  2O8E B;  2P51 A;  1NGE A;  4BRK A;  3OYD A;  5AQI A;  1UOC A;  2WUS A;  3QEW A;  1EP4 A;  3S9H A;  2NLX A;  2VWB A;  3VF6 A;  1Q9Y A;  3SMP A;  1ESV A;  3EKS A;  4EAH D;  3C65 A;  4RW7 A;  1D9F A;  3H45 C;  1OVQ A;  4DS4 A;  3QML A;  3NMU A;  4Z4C A;  3CMA N;  1LV5 A;  4CF0 A;  4PUO A;  3ZEU B;  4M45 A;  1C6V A;  4EZ6 A;  4CZK A;  1J5O A;  2Q2R A;  3ZLJ A;  2ZWH A;  3SJJ A;  2KLA A;  4JI6 K;  3TI0 A;  4NO7 A;  3HRG A;  3QEP A;  3CPE A;  4WF9 L;  5C12 A;  3CCR N;  4BC5 A;  5B8H A;  1R0A A;  3AVB A;  4DFP A;  3RVC A;  1HNX K;  2F96 A;  3IAY A;  2PYJ A;  3CXC M;  4DTR A;  1QSS A;  1D8Y A;  4M3W A;  1RBS A;  4K8X A;  1UA0 A;  1KQS M;  4QCL A;  4FWK A;  2X74 A;  3ITH A;  4DTM A;  3LP1 A;  2A1R A;  1J53 A;  4LH5 A;  4OPK A;  4GV9 A;  1VSJ A;  1VRU A;  1D5A A;  1S1X A;  2P9U A;  5HRP A;  4A2A A;  1X1P A;  4QAG A;  1BA0 A;  4KTW A;  3AVI A;  5GAH P;  2Z1H A;  4A62 A;  1C0U A;  3KHY A;  3DLE A;  4HWI A;  4HUE A;  2YI1 A;  3SNN A;  1DEJ A;  5AQY A;  2HMI A;  3KWG A;  3L8B A;  4CFD A;  2KZM A;  4E1N A;  1W97 L;  3BF1 A;  3IFR A;  3E9O A;  3DLB A;  5CZ2 A;  5CHI A;  4K25 A;  3VF4 A;  3OBW A;  4JYA K;  4J2D A;  3L2R A;  4Y1D A;  1ZYQ A;  2KFZ A;  4QS9 A;  4BC2 A;  3O08 A;  3KD1 E;  3LL3 A;  4E1M A;  3NVM A;  3QLH A;  4LFB K;  1VQM N;  5AQL A;  4BR7 A;  3T1A A;  4B9U A;  1BI4 A;  1HYZ A;  1NGH A;  4CEA A;  1DGK N;  3HM9 A;  2JWL A;  1EET A;  3L2Q A;  4FK0 A;  4FJ9 A;  2ITG A;  1BIU A;  4O0I A;  1E3M A;  2XHB A;  5M1K A;  3SAH A;  1U49 A;  4BE1 A;  3AVA A;  4QS7 A;  3A5O C;  3KKR A;  2IAJ A;  2BE2 A;  3C6H A;  4UQG A;  5FPM A;  3DAW A;  3GE1 A;  3VQ9 A;  2WON A;  2PZS A;  1ILY A;  3C95 A;  1Z26 A;  4CFC A;  2NRW A;  4FM0 A;  2GWK A;  2B6A A;  3THX A;  1M1K O;  1XC3 A;  3VEO A;  1SL0 A;  2CH6 A;  3DOK A;  4BWM A;  4FJK A;  2GV9 A;  4LH4 A;  4HUF A;  2WBN A;  4CD1 A;  2YNG A;  3P38 A;  3MCP A;  1NBW A;  2AA4 A;  5AFU A;  4H5N A;  4CIE A;  3VEV A;  3OA9 A;  4YOY A;  3THV A;  1N34 K;  3HK2 A;  4KRF A;  4E7H A;  2YCH A;  3VN5 A;  4OPA A;  1W2B M;  4W5N A;  1N32 K;  1J5E K;  4FXD A;  4OKJ A;  4OPH A;  3THY A;  1S72 N;  1LWC A;  4XH5 A;  3VET A;  4YY3 K;  3O8M A;  4B8A B;  2GUP A;  3OY9 A;  4U7B A;  4BRD A;  2QWN A;  5AQJ A;  3VEZ A;  4F2R A;  3LP3 A;  3C6U A;  1S3X A;  1EQY A;  3HTV A;  4JI0 K;  4H5T A;  3ID8 A;  4CJK A;  3NF7 A;  4WE1 A;  1VSE A;  4FVM A;  1Q8I A;  2UYT A;  3SUN A;  1NK9 A;  4IJN A;  1TK5 A;  1BIZ A;  4DKW A;  1JLC A;  3PV8 A;  2VGM A;  2YNF A;  4FLU A;  4FWP A;  4X62 K;  5C10 A;  4BGB A;  4DR3 K;  2JGU A;  2HF4 A;  3LDN A;  1KAX A;  5BRF A;  1K9M O;  1VSF A;  1VQ9 N;  2E4L A;  4YOW A;  4FK4 A;  5ELZ A;  2G8W A;  1ZBI A;  3HZ6 A;  3BZK A;  4M3X A;  2ZJQ L;  4PQU A;  3L2V A;  3D0P A;  3CCM N;  2BGG A;  2HHS A;  3VQC A;  1Q81 O;  3HO1 A;  1LAV A;  3EEQ A;  4CER A;  3N4P A;  2Y1I A;  4BRH A;  2W42 A;  2CH5 A;  1KLM A;  2OA8 A;  5TKW A;  2O8F A;  4OLA A;  1Z25 A;  4CD3 A;  4JI8 K;  1E4F T;  2YHB A;  1UWB A;  1IKX A;  4CZG A;  2YX6 A;  3PIO L;  4HTU A;  1IJJ A;  2Q31 A;  3J7Z O;  4B9Q A;  2FF3 B;  2FSK A;  2P1J A;  4FM1 A;  3TAE A;  2YKM A;  4AHR A;  5CZ1 A;  5A2Q O;  4J2B A;  4GV6 A;  1NGB A;  2HVI A;  4Z94 A;  1NLV A;  3FFK B;  2V51 B;  2X6S A;  3AA2 A;  4NB4 A;  2QWQ A;  1NNE A;  3MED A;  1HKC A;  3PO4 A;  1I3A A;  3EY1 A;  5JLH A;  3FLC O;  4LSL A;  1BQN A;  3TR8 A;  2RN2 A;  4DTN A;  1XMQ K;  3CIP A;  3LZJ A;  1S9G A;  4WQ4 C;  2P9K B;  4FZZ A;  2ZGZ A;  3O9Q A;  2HBM A;  3LPU A;  4CGI A;  2ITM A;  2YKN A;  3PUF A;  2Q0U A;  3M1F A;  1MWK A;  4DG1 A;  1NGC A;  2P9I B;  3EZ5 A;  1LOT B;  1YAG A;  1IKV A;  4W5O A;  2WOM A;  3CFP A;  1I94 K;  1HPM A;  5CYM A;  4YHH K;  3AVF A;  3SV4 A;  4JKE A;  2QXF A;  3RSE B;  2F9T A;  4W5Q A;  1SKR A;  2YHW A;  1B9F A;  3U8X A;  1V4S A;  1Q82 O;  4A61 A;  5AQU A;  1RIL A;  1L3S A;  1U48 A;  1EWR A;  4OGE A;  3O4N A;  4CJU A;  3NGY A;  5I9E B;  3TTF A;  5IT9 O;  1S6P A;  4WFN L;  1RDW X;  1NK0 A;  1IBK K;  3R6M A;  2F9W A;  3VQA A;  4KH5 A;  4W5R A;  4KKO A;  4KFB A;  4JKG B;  4O0J A;  3S3O A;  1J54 A;  2QI2 A;  4N5S A;  4ZTF A;  1HJR A;  4LF7 K;  4B1Y B;  1QVG M;  1KTQ A;  1OH7 A;  3TTD A;  1GOC A;  1B92 A;  4JLH A;  3HYF A;  1ZBL A;  1NK4 A;  1IG9 A;  3LP0 A;  4FJI A;  4FJ5 A;  3VEX A;  3NFA A;  4ILH A;  2E5L K;  1N36 K;  3HVT A;  4C1N I;  3LWM A;  1BUP A;  3SUO A;  3K9K A;  4DQR A;  2E1Y A;  4JK7 A;  4JKG A;  4H0T B;  4OLB A;  1GLB G;  5BN8 A;  4RCH A;  5AZJ B;  4M3Z A;  5AQT A;  4M63 C;  3K5N A;  3CPW M;  2HBL A;  3MEC A;  4HTL A;  2JLE A;  4I7F A;  3CJC A;  5I3U A;  3HBT A;  3NH0 A;  3L6Q A;  2J4R A;  2UXD K;  3M8R A;  1EX4 A;  4PHT X;  3OYE A;  3Q7C A;  1GLA G;  3NBP A;  2Y1J A;  3CJ1 A;  4IBN A;  3OYK A;  4IWV A;  4H4O A;  4B08 A;  1RBU A;  5AQF A;  2HB5 A;  3QEV A;  1CZA N;  3LAL A;  5AQM A;  1S1T A;  1SQK A;  1VSL A;  4H4M A;  1TGO A;  2OYQ A;  2WC9 A;  3V9U A;  3MK6 A;  4JV5 K;  5AQK A;  4M7Y A;  4B3S K;  4DV7 K;  1YHQ N;  4DR2 K;  4BRC A;  1NK6 A;  2P9L A;  1YF5 L;  3O9U A;  4BRE A;  1IO2 A;  4WQ5 A;  5HOO A;  3ATU A;  4HVJ A;  4H8K A;  3QET A;  4BGA A;  4AQY K;  1XMO K;  3AO2 A;  2VG5 A;  4WQ5 C;  3I55 N;  3L4Q A;  3F73 A;  5C2F A;  5JVH L;  5HRN A;  4JAX A;  3L2U A;  5M1N A;  2AP1 A;  3DOL A;  4CI6 A;  3FE1 A;  3NGZ A;  2NRT A;  3UE5 A;  4FJX A;  4FL9 A;  3PX0 A;  4JI2 K;  4KI4 A;  3OJS A;  2QWO A;  3SMS A;  2WTU A;  4ISG A;  1SS6 A;  4TSX A;  5KRS A;  3VQ7 A;  3VQB A;  4DLE A;  4RWT A;  1HUX A;  4DTO A;  3J8A A;  1C0T A;  2VWK A;  3F2K A;  1T3V A;  4IFV A;  5HRS A;  4ID1 A;  2HBJ A;  4J2A A;  3LDP A;  1YIT N;  4LFC K;  2XRI A;  3O80 A;  1C0M A;  3NH1 A;  3HXM A;  4FLV A;  1WNS A;  4AHS A;  2G8U A;  3CQY A;  3OS0 A;  4X66 K;  1OKJ A;  2ZE2 A;  4FYD A;  4BWJ A;  3VQE A;  2HHH K;  1UA1 A;  3H3N O;  1M90 O;  3ZSZ A;  4B1V A;  4IOX A;  5AR0 A;  3OYH A;  1GOB A;  3FZL A;  4MO4 A;  4BG9 A;  5BPN A;  4YOT A;  1QQC A;  3HM8 A;  1WOQ A;  3V6D A;  1HYV A;  3QER A;  4IEE A;  3U3Y A;  4FW2 A;  3CQX A;  4CZM A;  3A5L C;  4A59 A;  1KAY A;  3V9W A;  4YOV A;  4CGH A;  3EO3 A;  4E1J A;  2YNI A;  4GMJ B;  3AAQ A;  1RT5 A;  4DFM A;  1S5J A;  4MLH A;  1FKO A;  3O5B A;  4A2B A;  1WSI A;  1RDD A;  4F9O A;  3IG1 A;  4DTX A;  3RWU A;  3RMA A;  2P9I A;  5GAG P;  1C1A A;  4GKJ K;  4ICL A;  4CJL A;  4LF6 K;  3P83 D;  3C7N B;  1QHT A;  3H1V X;  4CEF A;  3L4I A;  1Q18 A;  4CJF A;  2VYP A;  4N41 A;  3ZX0 A;  1WSH A;  3EZW A;  3KK7 A;  3CFO A;  3OS1 A;  1FK9 A;  3QNN A;  5LL6 Z;  1JCF A;  4JKC A;  3AA5 X;  1NU0 A;  1LCU A;  3BGR A;  3MX5 A;  1G99 A;  3ZX2 A;  2V52 B;  3ZCM A;  4AM6 A;  3LWL A;  5AQW A;  2JWK A;  4BR5 A;  3U9Z A;  3CF5 L;  3RMD A;  3ZX3 A;  1VQN N;  4O5F A;  2KKZ A;  1CXU A;  3AVC A;  4IEI A;  2VG7 A;  3VGM A;  2HMP A;  2V7Z A;  4EIA A;  4DR4 K;  3W0L A;  1HYS A;  3AO5 A;  3AVL A;  3DRP A;  4FLW A;  3MWP A;  4IFY A;  2KHO A;  1BI4 B;  4BDZ A;  3K0S A;  4BQL A;  4DR5 K;  4M3Y A;  4XEI A;  1RTI A;  3U6F A;  2CGK A;  3VOV A;  4DV4 K;  3L3U A;  3VF2 A;  3MWT A;  5EVZ A;  1IBL K;  3HPO A;  3AGK A;  4B1Z A;  4IG3 A;  4JI4 K;  5AQS A;  1VSK A;  5EU7 A;  3KK1 A;  4CF1 A;  3SBT A;  4NXM K;  1QZ6 A;  4CED A;  4Z4F A;  2YHA A;  3A2F A;  1VSD A;  3T69 A;  5JMV A;  2HF3 A;  4FPB A;  4ISF A;  4NYF A;  4CBW A;  3VPZ A;  3S3M A;  4CJQ A;  3AA4 A;  3WT0 A;  1WUA A;  1C0G A;  1ZBH A;  3G10 A;  3MMV A;  3WNH A;  1IBM K;  1HQE A;  3LDS A;  5J2M A;  5AZI B;  2NZT A;  1S9E A;  4JNE A;  1SV5 A;  1FKP A;  3D6R A;  4V19 S;  3VEW A;  2EWS A;  5ADX H;  3VMF B;  4BRO A;  4F3O A;  1GLL O;  3O3G A;  1VHX A;  3QIO A;  2UXB K;  3WXI A;  3CM6 A;  1GOA A;  3V9Z A;  4ISE A;  1VQ8 N;  3IUC A;  3HI0 A;  3HOS A;  3QBX A;  5KTQ A;  5BPL A;  3AVN A;  4JRP A;  4EP4 A;  5JLF A;  3OYG A;  3B6P A;  1JXE A;  4H5V A;  3CCU N;  1VAZ A;  1EWQ A;  4CEC A;  2VG6 A;  3AVK A;  1RNH A;  1IV0 A;  4CVN E;  4DSE A;  4DU1 A;  1P8Z A;  3A5M C;  4YNQ A;  2IGI A;  4IDH A;  3NVK A;  2O4I A;  3ASM A;  4FWM A;  3SAG A;  4NXN K;  2O4G A;  1RT4 A;  1KLN A;  3RRH A;  4KI6 A;  1TYQ A;  2P9S A;  4MDA A;  4BY9 C;  4ELU A;  1XC9 A;  2DFE A;  4JS4 A;  3KLI A;  2IVN A;  4IJA A;  4YDU C;  1WLJ A;  2YV0 X;  5CE3 A;  4B1W B;  3K5M A;  1RDA A;  1A5V A;  4M41 A;  3D45 A;  3ZT3 A;  4DV6 K;  4FJG A;  4DSI A;  2VGN A;  4CES A; 
#chains in the Genus database with same CATH homology
 2XY7 A;  3NH2 A;  1T05 A;  5FRM A;  4LSL A;  1BQN A;  2YNH A;  3TR8 A;  2RN2 A;  3MEG A;  3KLF A;  3SPY A;  4DTN A;  5J1E A;  1TKX A;  1BL3 A;  4CF9 A;  4LY7 A;  1CXQ A;  5SZT A;  3LZJ A;  1S9G A;  4M42 A;  3VQ8 A;  5C42 A;  3NF6 A;  4CIF A;  1QS4 A;  4FZZ A;  3LPU A;  2G8I A;  4CGI A;  1RTJ A;  2YKN A;  1WN7 A;  3PUF A;  1WSE A;  3ZSV A;  4DG1 A;  4KHN A;  3EZ5 A;  4DU3 A;  1VSH A;  4HUG A;  2DTU A;  4DWI A;  1QSY A;  3ZT4 A;  3DLK A;  3PX4 A;  1IKV A;  3FFI A;  4CJW A;  3MXM A;  4W5O A;  4GVM A;  2WOM A;  5J2P A;  3CFP A;  2BDP A;  4C8L A;  1KVB A;  5CYM A;  3AVF A;  4KTZ A;  4CGG A;  1EKE A;  3SV4 A;  2GBZ A;  2QXF A;  3TAB A;  4I9L A;  2EX3 A;  4W5Q A;  3WNF A;  1SKR A;  1NOY A;  1VSI A;  3NDK A;  1TK8 A;  4C8K A;  1IKY A;  1B9F A;  4BDP A;  1MU2 A;  4CHP A;  3NE6 A;  4FZY A;  3KLH A;  1DTT A;  3PY8 A;  2IS3 A;  3EYZ A;  4HCB A;  4LD0 A;  4B9V A;  1RIL A;  4CFA A;  4E3S A;  1L3S A;  4B9L A;  4CHY A;  4N76 A;  2HHQ A;  4FJJ A;  1BCM A;  3C6T A;  1REV A;  1U48 A;  4F8R A;  1TK0 A;  4C8M A;  4OGE A;  4CEQ A;  3RTV A;  2Q3S A;  4LSN A;  3O4N A;  1LWE A;  4CJU A;  3DLH A;  3NGY A;  3JSM A;  3MEE A;  1JLQ A;  3QEX A;  3K5O A;  5HBM A;  3KIO A;  4AHU A;  2P5G A;  1S6P A;  2DFH A;  2KZZ A;  4M3T A;  4BAC A;  5JS2 A;  1NK0 A;  1U4B A;  2I5J A;  2D0C A;  3VQA A;  2D0B A;  4BE2 A;  3KLE A;  1RT3 A;  4C8N A;  4E0D A;  2F8T A;  4W5R A;  4KKO A;  3VQ5 A;  4DFM A;  2KTQ A;  1J9A A;  1JLF A;  4KFB A;  4O0J A;  3S3O A;  1CZB A;  2ZD1 A;  1J54 A;  4E7J A;  3TAF A;  1SL1 A;  4N5S A;  3HVR A;  3AVJ A;  1HJR A;  2LSN A;  4ZTF A;  4CJ4 A;  3O3H A;  1A5W A;  1KTQ A;  4AH9 A;  4R5P A;  2AJQ A;  4B3O A;  2ZQB A;  1TKZ A;  1S6Q A;  2ETJ A;  3AA3 A;  4G1Q A;  1GOC A;  4N56 A;  1KVC A;  1B92 A;  4CEB A;  1ZBF A;  4JLH A;  1X9S A;  4CJP A;  3VA3 A;  5C25 A;  3HYF A;  5CYQ A;  3HL8 A;  5HLF A;  1ZBL A;  2XY5 A;  1NK4 A;  1X9W A;  4DSK A;  1NK7 A;  4Z0U A;  1IG9 A;  2OPQ A;  1JKH A;  2B4J A;  3LP0 A;  2FC0 A;  4FJI A;  4I9Q A;  3QIN A;  1ASV A;  4FJ5 A;  3NFA A;  2R7Y A;  1S1U A;  3HVT A;  4DSJ A;  4Z4I A;  4RW9 A;  3LWM A;  2IC3 A;  1T8E A;  2A1S A;  3SUO A;  3QO9 A;  1RT1 A;  1L3V A;  4CGF A;  4CGJ A;  1T7P A;  4RW6 A;  2G8K A;  4DQR A;  4FLZ A;  3CM5 A;  1O1W A;  3M8Q A;  5HRO A;  3MXI A;  4B9S A;  4QOZ B;  2OPR A;  4OLB A;  1WSF A;  3DRR A;  1NJZ A;  1L3T A;  4M3Z A;  4CJV A;  1RT7 A;  5C24 A;  4AHT A;  5K14 A;  3JYT A;  2FBV A;  3KK2 A;  3K5N A;  4DQS A;  4FJH A;  3MEC A;  2G8H A;  5HRR A;  3CG7 A;  2F8S A;  2FBX A;  4Q0B A;  2JLE A;  3V9S A;  4I7F A;  2BAN A;  1I39 A;  1IH7 A;  3NF8 A;  4DSL A;  1XHX A;  4DLG A;  3NAE A;  5KGW A;  5I3U A;  5D3G A;  3NH0 A;  3K5L A;  3SZ2 A;  3WNE A;  1RCH A;  1L3U A;  3M8R A;  1T03 A;  1EX4 A;  2Z1I A;  3DLR A;  4DS5 A;  3RR8 A;  4FLT A;  1TKT A;  3OYE A;  3HPH A;  4DF8 A;  2FBT A;  1DLO A;  1S1V A;  2NUB A;  1RT6 A;  1NK8 A;  4EP5 A;  1JLB A;  3ALY A;  2P5O A;  3NBP A;  2Y1J A;  4Q5V A;  1NKB A;  3WNG A;  4MQ3 A;  4IBN A;  3DI6 A;  1KRP A;  3DLG A;  3OYK A;  3LPT A;  5T7B A;  4H4O A;  1C1C A;  4B8C A;  4B08 A;  3VQD A;  1RBU A;  1G15 A;  2E6M A;  2HHT A;  4FM2 A;  3AO4 A;  1RBR A;  1BHL A;  2HB5 A;  3LAL A;  3LP2 A;  4JS5 A;  3QEV A;  3V81 A;  3AVG A;  2QKK A;  1U45 A;  1YTU A;  1ASW A;  4L8R B;  1HNV A;  3HT3 A;  1S1T A;  1EXQ A;  1KCF A;  1VSL A;  4DFK A;  1L5U A;  1W9H A;  2RF2 A;  1TL3 A;  4H4M A;  1TGO A;  3SYZ A;  3VA0 A;  2OYQ A;  3V9U A;  2HHU A;  4NCG A;  3ZT1 A;  4CIG A;  1TL1 A;  2XO7 A;  3LAK A;  2IOC A;  5DK5 A;  3KTQ A;  1K6Y A;  3F9K A;  3P1G A;  4CJ5 A;  3OYM A;  1NK6 A;  2IDO A;  3HPG A;  3U3G A;  1NKE A;  1S1W A;  4KPY A;  1FXX A;  1IO2 A;  4M3U A;  3DYA A;  1VRT A;  3ZSW A;  4HVJ A;  1RDC A;  4PWD A;  1LAW A;  4H8K A;  4OVL A;  3DMJ A;  2RKI A;  3K58 A;  1KVA A;  3QET A;  1LW0 A;  1JL1 A;  1YVU A;  4ID5 A;  5DMR A;  3KD5 E;  3TAP A;  4CK2 A;  3LZI A;  3SQ0 A;  1BQM A;  3AO2 A;  2VG5 A;  4IDK A;  3QEI A;  1XI1 A;  4B9N A;  5CY4 A;  5FDL A;  4CHN A;  2D0A A;  3AVM A;  3F73 A;  4CJR A;  3OYI A;  5J2Q A;  4ELV A;  4DU4 A;  5HRN A;  1KFS A;  2P51 A;  3L2U A;  4OKK A;  3OYD A;  3DOL A;  4N47 A;  1UOC A;  4AHV A;  3L2W A;  4EZ9 A;  4FJL A;  3NGZ A;  3QEW A;  1EP4 A;  2DFF A;  3S9H A;  1Q9Y A;  4CFB A;  5KI6 A;  2XY6 A;  4FJX A;  3PX0 A;  3T19 A;  3OJS A;  4KI4 A;  3O4Q A;  3ZT2 A;  3VQQ A;  4KB1 A;  4TSX A;  4RW7 A;  5KRS A;  1D9F A;  3VQ7 A;  3VQB A;  4DLE A;  4DS4 A;  1DTQ A;  4DTO A;  3V1Q A;  3DM2 A;  1C0T A;  2VWK A;  3V9X A;  4Z4C A;  3I8D A;  5KGX A;  5E41 A;  4IFV A;  5HRS A;  4ID1 A;  2QK9 A;  3B6O A;  1W0H A;  2EHG A;  4E19 A;  4DTJ A;  4J2A A;  5FRO A;  4DF4 A;  4KHW A;  3AV9 A;  3TAR A;  1SUQ A;  1LV5 A;  4CF0 A;  4FJ7 A;  1QSL A;  4PUO A;  2XRI A;  4M45 A;  1C0M A;  1C6V A;  4EZ6 A;  3NH1 A;  4PY5 A;  3HXM A;  3H08 A;  4FLV A;  1U04 A;  1WNS A;  4AHS A;  1J5O A;  2G8U A;  4OPK A;  1UAX A;  3SJJ A;  4JRQ A;  1RTD A;  3ZSO A;  1XWL A;  3TI0 A;  3OS0 A;  4FYD A;  2ZE2 A;  3S3N A;  3AO1 A;  4XIU A;  4CEZ A;  4F3T A;  4BWJ A;  3VQE A;  4FLX A;  3QEP A;  3TAM A;  4AIL C;  4O44 A;  1WSJ A;  1JXB A;  3CQ8 A;  1UA1 A;  3M8P A;  1R0A A;  3VQ6 A;  3ZSZ A;  3AVB A;  4DFP A;  1QTM A;  3QNO A;  3OYH A;  3HST B;  4HHT A;  2HNY A;  4RG8 A;  4CE9 A;  1GOB A;  4ZHR A;  3VQ4 A;  1NK5 A;  2F96 A;  1NOZ A;  2OZS A;  1NKC A;  3IAY A;  2PYJ A;  1WAJ A;  4DTR A;  1QSS A;  1D8Y A;  3SQ1 A;  3ZSY A;  1RBS A;  1QQC A;  3OYA A;  4K8X A;  4M3W A;  3V6D A;  1WSG A;  3TWH A;  1HYV A;  1UA0 A;  4Z4G A;  3QER A;  4GW6 A;  4QCL A;  3U3Y A;  4ELT A;  2X74 A;  3ITH A;  4FW2 A;  4CEE A;  4PA1 A;  3SI6 A;  3V9W A;  4DTM A;  3LP1 A;  3NCI A;  2A1R A;  3RR7 A;  4CGH A;  4CGD A;  2HNZ A;  2OPS A;  3O3F A;  2YNI A;  4GMJ B;  1J53 A;  3QIP A;  1RT5 A;  1BGX T;  1JLG A;  1VSJ A;  1S5J A;  1D5A A;  1S1X A;  1VRU A;  4LH5 A;  4CJE A;  1X1P A;  5HRP A;  4DSF A;  4QAG A;  1FKO A;  4KTW A;  3AVI A;  4DQQ A;  1WSI A;  1HPZ A;  2Z1H A;  1C0U A;  3DLE A;  3V1O A;  1RDD A;  4HUE A;  3IG1 A;  3SNN A;  4DTX A;  4KHQ A;  3RWU A;  4OPJ A;  1HQU A;  4C8O A;  4FJM A;  3RMC A;  3RMA A;  2HMI A;  1QE1 A;  3DRS A;  3OVN A;  4KB0 A;  3OYB A;  1C1A A;  4CFD A;  3OS2 A;  4E1N A;  3L8B A;  2KZM A;  4ICL A;  4CJL A;  2OPP A;  3KJV A;  1SKS A;  1F21 A;  3P83 D;  1Y97 A;  1TV6 A;  4W5T A;  3DLB A;  5CZ2 A;  1QHT A;  4J2D A;  3L2R A;  4CEF A;  1BIS A;  4Y1D A;  1ZYQ A;  2KFZ A;  4CJF A;  3QES A;  3KD1 E;  4E1M A;  3ZSX A;  4N41 A;  3LAM A;  3QLH A;  4DTP A;  3BDP A;  5J2N A;  4Y1C A;  1WSH A;  3T1A A;  4KV8 A;  4OKE A;  3OYF A;  3PX6 A;  3CFO A;  4B9U A;  4I2P A;  3OS1 A;  2G8F A;  3CYM A;  3V1R A;  1FK9 A;  3QNN A;  1BI4 A;  1HYZ A;  4DQI A;  3AA5 X;  4CEA A;  3HM9 A;  2X6N A;  4O4G A;  3BGR A;  1RBV A;  1EET A;  3L2Q A;  3SUP A;  4FK0 A;  4FJ9 A;  1NJX A;  1RBT A;  3ZCM A;  2ITG A;  1BIU A;  1HNI A;  4O0I A;  1HRH A;  1WAF A;  3LWL A;  3K2P A;  2XHB A;  3RMB A;  3P5J A;  3RMD A;  3AO3 A;  3E01 A;  3SCX A;  1JLA A;  1CXU A;  1NJW A;  1U49 A;  3AVC A;  4BE1 A;  3RRG A;  3AVA A;  3OYL A;  4CHQ A;  4YFU A;  3KKR A;  2VG7 A;  1KFD A;  2IAJ A;  2BE2 A;  4CHO A;  4I2Q A;  5SWM A;  3NGI A;  1HYS A;  3AO5 A;  3AVL A;  3DRP A;  4FW1 A;  4UQG A;  1SKW A;  2D5R A;  4FLW A;  2Z1G A;  3C94 A;  3VQ9 A;  2WON A;  4DMN A;  4E89 A;  2PZS A;  4IFY A;  4K8Z A;  2HHV A;  1IKW A;  4E7K A;  1BI4 B;  3C95 A;  4BDZ A;  1Z26 A;  4CFC A;  4E7I A;  4FM0 A;  4M3Y A;  2KFN A;  4DTS A;  3UIQ A;  4FZX C;  1RTI A;  2B6A A;  3U6F A;  1SL0 A;  2HVH A;  3ZT0 A;  3DOK A;  4BWM A;  4FJK A;  3L3U A;  2GV9 A;  4AHC A;  3AVH A;  4LH4 A;  4HUF A;  4FJ8 A;  3G0Z A;  1U47 A;  4IKF A;  1NJY A;  4DQP A;  4MFB A;  3HPO A;  2YNG A;  2FBY A;  2Z1J A;  4IG3 A;  4M3R A;  5KRT A;  4FK2 A;  1VSK A;  5EU7 A;  3KK1 A;  4KHS A;  3ULD A;  4CF1 A;  4CIE A;  1BCO A;  4J2E A;  4CED A;  3MXJ A;  3THV A;  4NCA A;  3HK2 A;  4KRF A;  4E7H A;  1TAQ A;  3VN5 A;  3TAG A;  4RW8 A;  1XHZ A;  4Z4F A;  2YHA A;  4KAZ A;  1ITG A;  3A2F A;  1VSD A;  2HW3 A;  4W5N A;  3SUQ A;  4FXD A;  4Z4E A;  4OKJ A;  4F4K A;  4FCY A;  1LW2 A;  4DFJ A;  1LWC A;  4BDY A;  2PYL A;  2E6L A;  4NYF A;  3L3V A;  1RTH A;  3S3M A;  4CF8 A;  4CJQ A;  4B8A B;  3NHG A;  3AA4 A;  1TKD A;  4CEO A;  3OY9 A;  2KQ2 A;  1ZBH A;  2B5J A;  4FLY A;  4F2R A;  4B9M A;  3LP3 A;  3SQ2 A;  3C6U A;  3G10 A;  3SPZ A;  2PY5 A;  4NCB A;  3ISN C;  1N6Q A;  3WNH A;  1HQE A;  3LDS A;  2HHW A;  2GUI A;  5J2M A;  4E7L A;  3HJF A;  3NF9 A;  1S9E A;  3OYN A;  1RDB A;  3VQP A;  4B9T A;  1JL2 A;  1SV5 A;  1FKP A;  4DTU A;  4KTQ A;  4CJK A;  3NF7 A;  4CJT A;  1C1B A;  4O55 A;  4WE1 A;  4F3O A;  3V4I A;  1VSE A;  4FVM A;  1Q8I A;  3SUN A;  3O3G A;  3LAN A;  1NK9 A;  4FJN A;  3HP9 A;  3QIO A;  5I42 A;  1D9D A;  1TK5 A;  1TVR A;  1B9D A;  1BIZ A;  3CM6 A;  3KLG A;  1GOA A;  3PO5 A;  3SV3 A;  1JLC A;  3V9Z A;  3PV8 A;  4OJR A;  5HP1 A;  3OJU A;  1CLQ A;  2YNF A;  4ZTJ A;  1TAU A;  4HCC A;  4FLU A;  3K57 A;  2G8V A;  5KTQ A;  2JGU A;  2OZM A;  4KRE A;  3AVN A;  3ZSQ A;  2VWJ A;  4EP4 A;  4JRP A;  2KW4 A;  1VK0 A;  3OYG A;  3T3F A;  3B6P A;  1JXE A;  2DY4 A;  3OYJ A;  3IS9 A;  1VSF A;  3I0R A;  2E4L A;  3HP6 A;  3KKS A;  1RT2 A;  3AVK A;  2VG6 A;  1LWF A;  1RNH A;  4CEC A;  4FK4 A;  3MAQ A;  2G8W A;  1ZBI A;  3ZSR A;  3M8S A;  4KO0 A;  4O5B A;  4CCH A;  1X9M A;  1YTA A;  4M3X A;  4PQU A;  3L2V A;  3D0P A;  4IG0 A;  1Q9X A;  5FRN A;  4NYN A;  4DSE A;  4DU1 A;  2BGG A;  1VSM A;  3VQC A;  2HHS A;  3HO1 A;  1LAV A;  4OGC A;  4CK1 A;  2ATQ A;  2X78 A;  1HMV A;  4CER A;  2Y1I A;  2W42 A;  1KLM A;  2OA8 A;  4KHU A;  4CJ3 A;  3OYC A;  1KSP A;  4YNQ A;  2IGI A;  3KK3 A;  3K59 A;  1JLE A;  1YT3 A;  1Z25 A;  4OLA A;  2O4I A;  3ASM A;  2HND A;  1N5Y A;  2YHB A;  1UWB A;  1IKX A;  2O4G A;  3IRX A;  4CJS A;  3TAQ A;  1RT4 A;  1KLN A;  4HTU A;  3RRH A;  4KI6 A;  5JS1 A;  4ELU A;  2P1J A;  4RW4 A;  4FM1 A;  1XC9 A;  2DFE A;  3TAN A;  3TAE A;  4JS4 A;  3KLI A;  1ASU A;  2YKM A;  4F2S A;  1CZ9 A;  4BE0 A;  3SQ4 A;  4AHR A;  4KHY A;  1WLJ A;  2YV0 X;  4CK3 A;  1ZBU A;  1SL2 A;  5CZ1 A;  3K5M A;  2QKB A;  4CHZ A;  4J2B A;  2XY8 A;  1RDA A;  2HVI A;  1A5V A;  4M41 A;  2X6S A;  3AA2 A;  4CF2 A;  3I0S A;  1A5X A;  3CFR A;  3D45 A;  2RPI A;  3ZT3 A;  4FJG A;  3MED A;  4DSI A;  4Z4H A;  3PO4 A;  2HHX A;  4CES A;  1I3A A;  3EY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...