3VQZA

Crystal structure of metallo-beta-lactamase, smb-1, in a complex with mercaptoacetic acid
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
259
structure length
257
Chain Sequence
RDWSSPQQPFTIYGNTHYVGTGGISAVLLSSPQGHILVDGTTEKGAQVVAANIRAMGFKLSDVKYILSTHSHEDHAGGISAMQKLTGATVLAGAANVDTLRTGVSPKSDPQFGSNFPGSAKVRAVADGELVKLGPLAVKAHATPGHTEGGITWTWQSCEQGKCKDVVFADSLTAVSADSYRFSDHPEVVASLRGSFEAVEKLSCDIAIAAHPEVNDMWTRQQRAAKEGNSAYVDNGACRAIAAAGRKRLETRLASEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Metallo-beta-lactamase
publication title Structural Insights into the Subclass B3 Metallo-beta-Lactamase SMB-1 and the Mode of Inhibition by the Common Metallo- -Lactamase Inhibitor Mercaptoacetate
pubmed doi rcsb
source organism Serratia marcescens
molecule tags Hydrolase/hydrolase inhibitor
total genus 84
structure length 257
sequence length 259
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00753 Lactamase_B Metallo-beta-lactamase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 3vqzA00
3DHCA 4B87A 4NQ2A 2M5CA 4D02A 2AZ4A 2FHXB 2HB9A 4D1WA 4AD9A 4C1EA 1HLKA 2BFZB 2WHGA 2R2DA 2WYMA 4C1FA 2OHIA 4TYTA 5AXOA 5A87A 4DIKA 5FQBA 1KR3A 1YCHA 5ACQA 4FEKA 3LVZA 2NZFA 3KL7A 2BFLA 2A7MA 5EVKA 1E5DA 2YZ3A 4RAMA 5EV8A 2Q42A 1M2XA 2OHJA 2Y8AA 4ZO2A 1ZKPA 5HIOA 4UA4A 2GCUA 5KIKA 2UYXA 2WRSA 5LE1A 4EFZA 3BK2A 4ZO3A 2OHHA 2ZWRA 3BC2A 3ZNBA 5AEBA 5K4NA 5HISA 4BP0A 2YNVA 5ACWA 3T9MA 3SBLA 4Z60A 4EYFA 3ADRA 3I0VA 5LLDA 5LCAA 4FR7A 5AXRA 5LM6A 2E7YA 5K0WA 3I13A 2NYPA 5K4KA 2YNUA 3MD7A 1WUOA 1MQOA 3KNSA 5FQAA 1X8HA 4J5HA 2QINA 2WYMC 4DILA 2I7VA 4F6HA 2YNTB 3I11A 4U4LA 5AHOA 2FU8A 1Y44A 4YSKA 2GKLA 3T3OA 4HL2A 4AWYB 2FHXA 4EY2A 5LCHA 2BFKA 2YNWA 2BFZA 1L9YA 1WUPA 5AYAA 2Q0IA 4RBSA 1DXKA 2P18A 4RL0A 4C1DA 4TZBA 4GCWA 2Q9UA 2FK6A 1A8TA 4NQ6A 3IDZA 3ESHA 4TYFA 2I7XA 5HH5A 3DH8A 5LMCA 4V0HA 1JT1A 1XTOA 4D1VA 2Y8BA 5EVDA 1BVTA 1QH3A 2NXAA 1K07A 4WD6A 3S0ZA 4Z5ZA 5EWAA 3X30A 3R2UA 3AJ3A 4C09A 4UWSB 2FM6A 2YNTA 3F9OA 3DHBA 2ZZIA 5DPXA 1JJEA 5FQCA 4FSBA 3KNRA 1VGNA 5HIPA 2QJSA 3JXPA 2BG8B 4YSLA 2Y87A 4UWRB 2BR6A 1DDKA 3VQZA 2BMIA 5ACUA 1WW1A 5EV6A 1BC2A 4EXSA 1VJNA 4GYUA 3T3NA 3A4YA 4RM5A 4TZEA 5ACTA 4UWPB 4RAWA 1P9EA 1JJTA 3PG4A 5ACSA 5ACXA 2XR1A 3PY6A 3ZR9A 4C1CA 3IE2A 2BTNA 5EVBA 3BV6A 3IEKA 4Z67A 5AHRA 3SW3A 4Z6XA 3BK1A 1X8GA 1VMEA 3SRXA 4D1TA 5A5ZA 5KILA 3RKJA 2DOOA 1SMLA 4UWOB 4YSBA 2VW8A 3X2ZA 3SFPA 5HIQA 3FCZA 1X8IA 2Q0JA 3WXCA 4GYQA 2BG6A 5LSCA 5LCFA 3DHAA 2WYLA 2BG8A 3X2XA 1KO3A 4H0DA 4PVOA 2P4ZA 4P62A 4XUKA 4RL2A 4Z5YA 3AF5A 3IOFA 1ZNBA 4XWWA 2P1EA 3IELA 1YCGA 5B15A 4LE6A 3IOGA 2M5DA 5LS3A 5A0TA 4XWTA 1XM8A 4BZ3A 2ZO4A 3IEMA 4NQ5A 2XF4A 4KEPA 4J5FA 4ZNBA 3AF6A 2GFJA 3I14A 2GFKA 4CHLA 1YCFA 2FU9A 2I7TA 2NZEA 5EH9A 3H3EA 5B3RA 3Q6VA 2BGAA 3IE0A 4O98A 3FAIA 4KEQA 2FU7A 3SPUA 3VPEA 3G1PA 2BG2A 2DKFA 3RKKA 4PVTA 5B1UA 3ZWFA 5EW0A 4C1GA 2BC2A 4F6ZA 4Z7RA 5IQKA 2P97A 1DD6A 4ZEJA 4JO0A 2ZNBA 1WRAA 1ZTCA 2AIOA 4NQ4A 5ACRA 4TZFA 4TZ9A 4EXYA 3IE1A 1KO2A 3ZQ4A 1BMCA 5A0VA 3PY5A 3P2UA 4UAMA 2BG7A 4EYBA 3X2YA 2CBNA 5HH6A 5ACPA 5ACVA 2H6AA 4HL1A 2GMNA 2YNVB 5EHTA 1QH5A 2YCBA 3L6NA 5K4MA 3SD9A 3QH8A 4D1UA 2BIBA 1A7TA 2QDSA 4AX1B 4HKYA 4C1HA 2QEDA 4UBQA 3RPCA 3I15A 4EYLA 3TP9A 4AX0B 4AWZA 2FU6A 2QDTA 5HH4A
chains in the Genus database with same CATH superfamily
3DHCA 4B87A 4NQ2A 2M5CA 4D02A 2AZ4A 2FHXB 2HB9A 4D1WA 4AD9A 4C1EA 1HLKA 2BFZB 2WHGA 2R2DA 5A23A 2WYMA 4C1FA 2OHIA 4TYTA 5AXOA 5A87A 4DIKA 5FQBA 1KR3A 1YCHA 5ACQA 4FEKA 3LVZA 2NZFA 3KL7A 2BFLA 4PDXA 2A7MA 5EVKA 1E5DA 2YZ3A 4RAMA 5EV8A 2Q42A 1M2XA 2OHJA 2Y8AA 4ZO2A 1ZKPA 5HIOA 4UA4A 2GCUA 5KIKA 2UYXA 2WRSA 5LE1A 4EFZA 3BK2A 4ZO3A 2OHHA 2ZWRA 3BC2A 3ZNBA 5AEBA 5K4NA 5HISA 4BP0A 2YNVA 5ACWA 3T9MA 3SBLA 4Z60A 4EYFA 3ADRA 3I0VA 5LLDA 5LCAA 4FR7A 5AXRA 5LM6A 5AIJA 2E7YA 5K0WA 3I13A 2NYPA 5K4KA 2YNUA 3MD7A 1WUOA 1MQOA 3KNSA 5FQAA 1X8HA 4J5HA 2QINA 2WYMC 4DILA 2I7VA 4F6HA 2YNTB 3I11A 4U4LA 5AHOA 2FU8A 1Y44A 4YSKA 2GKLA 3T3OA 4HL2A 4AWYB 2FHXA 4EY2A 5LCHA 2BFKA 2YNWA 2BFZA 1L9YA 1WUPA 5AYAA 2Q0IA 4RBSA 1DXKA 2P18A 4RL0A 4C1DA 4TZBA 4GCWA 2Q9UA 2FK6A 1A8TA 4NQ6A 3IDZA 3ESHA 4TYFA 2I7XA 5HH5A 3DH8A 2CFZA 5LMCA 4V0HA 1JT1A 1XTOA 4D1VA 2Y8BA 5EVDA 1BVTA 1QH3A 2NXAA 1K07A 4WD6A 3S0ZA 4Z5ZA 5EWAA 3X30A 3R2UA 3AJ3A 4C09A 4UWSB 4NURA 2FM6A 2YNTA 3F9OA 3DHBA 2ZZIA 5DPXA 1JJEA 5FQCA 4FSBA 3KNRA 5AJLA 1VGNA 5HIPA 2QJSA 3JXPA 2BG8B 4YSLA 2Y87A 4UWRB 2BR6A 1DDKA 3VQZA 2BMIA 5ACUA 1WW1A 5EV6A 1BC2A 4EXSA 1VJNA 4GYUA 3T3NA 3A4YA 4RM5A 4TZEA 4AV7A 5ACTA 4UWPB 4RAWA 1P9EA 1JJTA 3PG4A 5ACSA 5ACXA 2XR1A 3PY6A 3ZR9A 2CG2A 4C1CA 3IE2A 2BTNA 5EVBA 3BV6A 3IEKA 4Z67A 5AHRA 3SW3A 4Z6XA 3BK1A 1X8GA 1VMEA 3SRXA 4D1TA 5A5ZA 5KILA 3RKJA 2DOOA 1SMLA 4AXHA 4UWOB 4YSBA 2VW8A 3X2ZA 3SFPA 5HIQA 3FCZA 1X8IA 2Q0JA 3WXCA 4GYQA 2BG6A 5LSCA 5LCFA 3DHAA 2WYLA 2BG8A 3X2XA 1KO3A 4H0DA 4PVOA 2P4ZA 4P62A 4XUKA 2YHEA 4RL2A 4Z5YA 3AF5A 3IOFA 1ZNBA 4XWWA 2P1EA 3IELA 1YCGA 5B15A 4LE6A 2CFUA 3IOGA 2M5DA 5LS3A 5A0TA 4XWTA 1XM8A 4BZ3A 2ZO4A 3IEMA 4NQ5A 2XF4A 4KEPA 4J5FA 4ZNBA 3AF6A 2GFJA 3I14A 2GFKA 4CHLA 2FU9A 1YCFA 2I7TA 2NZEA 5EH9A 3H3EA 5B3RA 3Q6VA 2BGAA 3IE0A 4O98A 3FAIA 4KEQA 2FU7A 3SPUA 3VPEA 3G1PA 2BG2A 2DKFA 3RKKA 4PVTA 5B1UA 3ZWFA 5EW0A 4C1GA 2BC2A 4F6ZA 4Z7RA 5IQKA 2P97A 1DD6A 4ZEJA 4JO0A 2ZNBA 1WRAA 1ZTCA 2AIOA 4NQ4A 5ACRA 4TZFA 4TZ9A 4EXYA 3IE1A 1KO2A 3ZQ4A 1BMCA 5A0VA 3PY5A 3P2UA 4UAMA 2BG7A 4EYBA 3X2YA 2CBNA 5HH6A 5ACPA 5ACVA 2H6AA 4HL1A 2GMNA 2YNVB 5EHTA 1QH5A 2YCBA 3L6NA 5K4MA 3SD9A 3QH8A 4D1UA 2BIBA 1A7TA 2QDSA 4AX1B 4HKYA 4C1HA 2QEDA 4UBQA 3RPCA 3I15A 4EYLA 3TP9A 2CG3A 4AX0B 4AWZA 2FU6A 2QDTA 5HH4A
chains in the Genus database with same CATH topology
3DHCA 4B87A 4NQ2A 2M5CA 4D02A 2AZ4A 2FHXB 2HB9A 4D1WA 4AD9A 4C1EA 1HLKA 2BFZB 2WHGA 2R2DA 2WYMA 4C1FA 2OHIA 4TYTA 5AXOA 5A87A 4DIKA 5FQBA 1KR3A 1YCHA 5ACQA 4FEKA 3LVZA 2NZFA 3KL7A 2BFLA 2A7MA 5EVKA 1E5DA 2YZ3A 4RAMA 5EV8A 2Q42A 1M2XA 2OHJA 2Y8AA 4ZO2A 1ZKPA 5HIOA 4UA4A 2GCUA 5KIKA 2UYXA 2WRSA 5LE1A 4EFZA 3BK2A 4ZO3A 2OHHA 2ZWRA 3BC2A 3ZNBA 5AEBA 5K4NA 5HISA 4BP0A 2YNVA 5ACWA 3T9MA 3SBLA 4Z60A 4EYFA 3ADRA 3I0VA 5LLDA 5LCAA 4FR7A 5AXRA 5LM6A 2E7YA 5K0WA 3I13A 2NYPA 5K4KA 2YNUA 3MD7A 1WUOA 1MQOA 3KNSA 5FQAA 1X8HA 4J5HA 2QINA 2WYMC 4DILA 2I7VA 4F6HA 2YNTB 3I11A 4U4LA 5AHOA 2FU8A 1Y44A 4YSKA 2GKLA 3T3OA 4HL2A 4AWYB 2FHXA 4EY2A 5LCHA 2BFKA 2YNWA 2BFZA 1L9YA 1WUPA 5AYAA 2Q0IA 4RBSA 1DXKA 2P18A 4RL0A 4C1DA 4TZBA 4GCWA 2Q9UA 2FK6A 1A8TA 4NQ6A 3IDZA 3ESHA 4TYFA 2I7XA 5HH5A 3DH8A 5LMCA 4V0HA 1JT1A 1XTOA 4D1VA 2Y8BA 5EVDA 1BVTA 1QH3A 2NXAA 1K07A 4WD6A 3S0ZA 4Z5ZA 5EWAA 3X30A 3R2UA 3AJ3A 4C09A 4UWSB 2FM6A 2YNTA 3F9OA 3DHBA 2ZZIA 5DPXA 1JJEA 5FQCA 4FSBA 3KNRA 1VGNA 5HIPA 2QJSA 3JXPA 2BG8B 4YSLA 2Y87A 4UWRB 2BR6A 1DDKA 3VQZA 2BMIA 5ACUA 1WW1A 5EV6A 1BC2A 4EXSA 1VJNA 4GYUA 3T3NA 3A4YA 4RM5A 4TZEA 5ACTA 4UWPB 4RAWA 1P9EA 1JJTA 3PG4A 5ACSA 5ACXA 2XR1A 3PY6A 3ZR9A 4C1CA 3IE2A 2BTNA 5EVBA 3BV6A 3IEKA 4Z67A 5AHRA 3SW3A 4Z6XA 3BK1A 1X8GA 1VMEA 3SRXA 4D1TA 5A5ZA 5KILA 3RKJA 2DOOA 1SMLA 4UWOB 4YSBA 2VW8A 3X2ZA 3SFPA 5HIQA 3FCZA 1X8IA 2Q0JA 3WXCA 4GYQA 2BG6A 5LSCA 5LCFA 3DHAA 2WYLA 2BG8A 3X2XA 1KO3A 4H0DA 4PVOA 2P4ZA 4P62A 4XUKA 4RL2A 4Z5YA 3AF5A 3IOFA 1ZNBA 4XWWA 2P1EA 3IELA 1YCGA 5B15A 4LE6A 3IOGA 2M5DA 5LS3A 5A0TA 4XWTA 1XM8A 4BZ3A 2ZO4A 3IEMA 4NQ5A 2XF4A 4KEPA 4J5FA 4ZNBA 3AF6A 2GFJA 3I14A 2GFKA 4CHLA 1YCFA 2FU9A 2I7TA 2NZEA 5EH9A 3H3EA 5B3RA 3Q6VA 2BGAA 3IE0A 4O98A 3FAIA 4KEQA 2FU7A 3SPUA 3VPEA 3G1PA 2BG2A 2DKFA 3RKKA 4PVTA 5B1UA 3ZWFA 5EW0A 4C1GA 2BC2A 4F6ZA 4Z7RA 5IQKA 2P97A 1DD6A 4ZEJA 4JO0A 2ZNBA 1WRAA 1ZTCA 2AIOA 4NQ4A 5ACRA 4TZFA 4TZ9A 4EXYA 3IE1A 1KO2A 3ZQ4A 1BMCA 5A0VA 3PY5A 3P2UA 4UAMA 2BG7A 4EYBA 3X2YA 2CBNA 5HH6A 5ACPA 5ACVA 2H6AA 4HL1A 2GMNA 2YNVB 5EHTA 1QH5A 2YCBA 3L6NA 5K4MA 3SD9A 3QH8A 4D1UA 2BIBA 1A7TA 2QDSA 4AX1B 4HKYA 4C1HA 2QEDA 4UBQA 3RPCA 3I15A 4EYLA 3TP9A 4AX0B 4AWZA 2FU6A 2QDTA 5HH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DHC A;  4B87 A;  4NQ2 A;  2M5C A;  4D02 A;  2AZ4 A;  2FHX B;  2HB9 A;  4D1W A;  4AD9 A;  4C1E A;  1HLK A;  2BFZ B;  2WHG A;  2R2D A;  2WYM A;  4C1F A;  2OHI A;  4TYT A;  5AXO A;  5A87 A;  4DIK A;  5FQB A;  1KR3 A;  1YCH A;  5ACQ A;  4FEK A;  3LVZ A;  2NZF A;  3KL7 A;  2BFL A;  2A7M A;  5EVK A;  1E5D A;  2YZ3 A;  4RAM A;  5EV8 A;  2Q42 A;  1M2X A;  2OHJ A;  2Y8A A;  4ZO2 A;  1ZKP A;  5HIO A;  4UA4 A;  2GCU A;  5KIK A;  2UYX A;  2WRS A;  5LE1 A;  4EFZ A;  3BK2 A;  4ZO3 A;  2OHH A;  2ZWR A;  3BC2 A;  3ZNB A;  5AEB A;  5K4N A;  5HIS A;  4BP0 A;  2YNV A;  5ACW A;  3T9M A;  3SBL A;  4Z60 A;  4EYF A;  3ADR A;  3I0V A;  5LLD A;  5LCA A;  4FR7 A;  5AXR A;  5LM6 A;  2E7Y A;  5K0W A;  3I13 A;  2NYP A;  5K4K A;  2YNU A;  3MD7 A;  1WUO A;  1MQO A;  3KNS A;  5FQA A;  1X8H A;  4J5H A;  2QIN A;  2WYM C;  4DIL A;  2I7V A;  4F6H A;  2YNT B;  3I11 A;  4U4L A;  5AHO A;  2FU8 A;  1Y44 A;  4YSK A;  2GKL A;  3T3O A;  4HL2 A;  4AWY B;  2FHX A;  4EY2 A;  5LCH A;  2BFK A;  2YNW A;  2BFZ A;  1L9Y A;  1WUP A;  5AYA A;  2Q0I A;  4RBS A;  1DXK A;  2P18 A;  4RL0 A;  4C1D A;  4TZB A;  4GCW A;  2Q9U A;  2FK6 A;  1A8T A;  4NQ6 A;  3IDZ A;  3ESH A;  4TYF A;  2I7X A;  5HH5 A;  3DH8 A;  5LMC A;  4V0H A;  1JT1 A;  1XTO A;  4D1V A;  2Y8B A;  5EVD A;  1BVT A;  1QH3 A;  2NXA A;  1K07 A;  4WD6 A;  3S0Z A;  4Z5Z A;  5EWA A;  3X30 A;  3R2U A;  3AJ3 A;  4C09 A;  4UWS B;  2FM6 A;  2YNT A;  3F9O A;  3DHB A;  2ZZI A;  5DPX A;  1JJE A;  5FQC A;  4FSB A;  3KNR A;  1VGN A;  5HIP A;  2QJS A;  3JXP A;  2BG8 B;  4YSL A;  2Y87 A;  4UWR B;  2BR6 A;  1DDK A;  3VQZ A;  2BMI A;  5ACU A;  1WW1 A;  5EV6 A;  1BC2 A;  4EXS A;  1VJN A;  4GYU A;  3T3N A;  3A4Y A;  4RM5 A;  4TZE A;  5ACT A;  4UWP B;  4RAW A;  1P9E A;  1JJT A;  3PG4 A;  5ACS A;  5ACX A;  2XR1 A;  3PY6 A;  3ZR9 A;  4C1C A;  3IE2 A;  2BTN A;  5EVB A;  3BV6 A;  3IEK A;  4Z67 A;  5AHR A;  3SW3 A;  4Z6X A;  3BK1 A;  1X8G A;  1VME A;  3SRX A;  4D1T A;  5A5Z A;  5KIL A;  3RKJ A;  2DOO A;  1SML A;  4UWO B;  4YSB A;  2VW8 A;  3X2Z A;  3SFP A;  5HIQ A;  3FCZ A;  1X8I A;  2Q0J A;  3WXC A;  4GYQ A;  2BG6 A;  5LSC A;  5LCF A;  3DHA A;  2WYL A;  2BG8 A;  3X2X A;  1KO3 A;  4H0D A;  4PVO A;  2P4Z A;  4P62 A;  4XUK A;  4RL2 A;  4Z5Y A;  3AF5 A;  3IOF A;  1ZNB A;  4XWW A;  2P1E A;  3IEL A;  1YCG A;  5B15 A;  4LE6 A;  3IOG A;  2M5D A;  5LS3 A;  5A0T A;  4XWT A;  1XM8 A;  4BZ3 A;  2ZO4 A;  3IEM A;  4NQ5 A;  2XF4 A;  4KEP A;  4J5F A;  4ZNB A;  3AF6 A;  2GFJ A;  3I14 A;  2GFK A;  4CHL A;  1YCF A;  2FU9 A;  2I7T A;  2NZE A;  5EH9 A;  3H3E A;  5B3R A;  3Q6V A;  2BGA A;  3IE0 A;  4O98 A;  3FAI A;  4KEQ A;  2FU7 A;  3SPU A;  3VPE A;  3G1P A;  2BG2 A;  2DKF A;  3RKK A;  4PVT A;  5B1U A;  3ZWF A;  5EW0 A;  4C1G A;  2BC2 A;  4F6Z A;  4Z7R A;  5IQK A;  2P97 A;  1DD6 A;  4ZEJ A;  4JO0 A;  2ZNB A;  1WRA A;  1ZTC A;  2AIO A;  4NQ4 A;  5ACR A;  4TZF A;  4TZ9 A;  4EXY A;  3IE1 A;  1KO2 A;  3ZQ4 A;  1BMC A;  5A0V A;  3PY5 A;  3P2U A;  4UAM A;  2BG7 A;  4EYB A;  3X2Y A;  2CBN A;  5HH6 A;  5ACP A;  5ACV A;  2H6A A;  4HL1 A;  2GMN A;  2YNV B;  5EHT A;  1QH5 A;  2YCB A;  3L6N A;  5K4M A;  3SD9 A;  3QH8 A;  4D1U A;  2BIB A;  1A7T A;  2QDS A;  4AX1 B;  4HKY A;  4C1H A;  2QED A;  4UBQ A;  3RPC A;  3I15 A;  4EYL A;  3TP9 A;  4AX0 B;  4AWZ A;  2FU6 A;  2QDT A;  5HH4 A; 
#chains in the Genus database with same CATH topology
 3DHC A;  4B87 A;  4NQ2 A;  2M5C A;  4D02 A;  2AZ4 A;  2FHX B;  2HB9 A;  4D1W A;  4AD9 A;  4C1E A;  1HLK A;  2BFZ B;  2WHG A;  2R2D A;  5A23 A;  2WYM A;  4C1F A;  2OHI A;  4TYT A;  5AXO A;  5A87 A;  4DIK A;  5FQB A;  1KR3 A;  1YCH A;  5ACQ A;  4FEK A;  3LVZ A;  2NZF A;  3KL7 A;  2BFL A;  4PDX A;  2A7M A;  5EVK A;  1E5D A;  2YZ3 A;  4RAM A;  5EV8 A;  2Q42 A;  1M2X A;  2OHJ A;  2Y8A A;  4ZO2 A;  1ZKP A;  5HIO A;  4UA4 A;  2GCU A;  5KIK A;  2UYX A;  2WRS A;  5LE1 A;  4EFZ A;  3BK2 A;  4ZO3 A;  2OHH A;  2ZWR A;  3BC2 A;  3ZNB A;  5AEB A;  5K4N A;  5HIS A;  4BP0 A;  2YNV A;  5ACW A;  3T9M A;  3SBL A;  4Z60 A;  4EYF A;  3ADR A;  3I0V A;  5LLD A;  5LCA A;  4FR7 A;  5AXR A;  5LM6 A;  5AIJ A;  2E7Y A;  5K0W A;  3I13 A;  2NYP A;  5K4K A;  2YNU A;  3MD7 A;  1WUO A;  1MQO A;  3KNS A;  5FQA A;  1X8H A;  4J5H A;  2QIN A;  2WYM C;  4DIL A;  2I7V A;  4F6H A;  2YNT B;  3I11 A;  4U4L A;  5AHO A;  2FU8 A;  1Y44 A;  4YSK A;  2GKL A;  3T3O A;  4HL2 A;  4AWY B;  2FHX A;  4EY2 A;  5LCH A;  2BFK A;  2YNW A;  2BFZ A;  1L9Y A;  1WUP A;  5AYA A;  2Q0I A;  4RBS A;  1DXK A;  2P18 A;  4RL0 A;  4C1D A;  4TZB A;  4GCW A;  2Q9U A;  2FK6 A;  1A8T A;  4NQ6 A;  3IDZ A;  3ESH A;  4TYF A;  2I7X A;  5HH5 A;  3DH8 A;  2CFZ A;  5LMC A;  4V0H A;  1JT1 A;  1XTO A;  4D1V A;  2Y8B A;  5EVD A;  1BVT A;  1QH3 A;  2NXA A;  1K07 A;  4WD6 A;  3S0Z A;  4Z5Z A;  5EWA A;  3X30 A;  3R2U A;  3AJ3 A;  4C09 A;  4UWS B;  4NUR A;  2FM6 A;  2YNT A;  3F9O A;  3DHB A;  2ZZI A;  5DPX A;  1JJE A;  5FQC A;  4FSB A;  3KNR A;  5AJL A;  1VGN A;  5HIP A;  2QJS A;  3JXP A;  2BG8 B;  4YSL A;  2Y87 A;  4UWR B;  2BR6 A;  1DDK A;  3VQZ A;  2BMI A;  5ACU A;  1WW1 A;  5EV6 A;  1BC2 A;  4EXS A;  1VJN A;  4GYU A;  3T3N A;  3A4Y A;  4RM5 A;  4TZE A;  4AV7 A;  5ACT A;  4UWP B;  4RAW A;  1P9E A;  1JJT A;  3PG4 A;  5ACS A;  5ACX A;  2XR1 A;  3PY6 A;  3ZR9 A;  2CG2 A;  4C1C A;  3IE2 A;  2BTN A;  5EVB A;  3BV6 A;  3IEK A;  4Z67 A;  5AHR A;  3SW3 A;  4Z6X A;  3BK1 A;  1X8G A;  1VME A;  3SRX A;  4D1T A;  5A5Z A;  5KIL A;  3RKJ A;  2DOO A;  1SML A;  4AXH A;  4UWO B;  4YSB A;  2VW8 A;  3X2Z A;  3SFP A;  5HIQ A;  3FCZ A;  1X8I A;  2Q0J A;  3WXC A;  4GYQ A;  2BG6 A;  5LSC A;  5LCF A;  3DHA A;  2WYL A;  2BG8 A;  3X2X A;  1KO3 A;  4H0D A;  4PVO A;  2P4Z A;  4P62 A;  4XUK A;  2YHE A;  4RL2 A;  4Z5Y A;  3AF5 A;  3IOF A;  1ZNB A;  4XWW A;  2P1E A;  3IEL A;  1YCG A;  5B15 A;  4LE6 A;  2CFU A;  3IOG A;  2M5D A;  5LS3 A;  5A0T A;  4XWT A;  1XM8 A;  4BZ3 A;  2ZO4 A;  3IEM A;  4NQ5 A;  2XF4 A;  4KEP A;  4J5F A;  4ZNB A;  3AF6 A;  2GFJ A;  3I14 A;  2GFK A;  4CHL A;  2FU9 A;  1YCF A;  2I7T A;  2NZE A;  5EH9 A;  3H3E A;  5B3R A;  3Q6V A;  2BGA A;  3IE0 A;  4O98 A;  3FAI A;  4KEQ A;  2FU7 A;  3SPU A;  3VPE A;  3G1P A;  2BG2 A;  2DKF A;  3RKK A;  4PVT A;  5B1U A;  3ZWF A;  5EW0 A;  4C1G A;  2BC2 A;  4F6Z A;  4Z7R A;  5IQK A;  2P97 A;  1DD6 A;  4ZEJ A;  4JO0 A;  2ZNB A;  1WRA A;  1ZTC A;  2AIO A;  4NQ4 A;  5ACR A;  4TZF A;  4TZ9 A;  4EXY A;  3IE1 A;  1KO2 A;  3ZQ4 A;  1BMC A;  5A0V A;  3PY5 A;  3P2U A;  4UAM A;  2BG7 A;  4EYB A;  3X2Y A;  2CBN A;  5HH6 A;  5ACP A;  5ACV A;  2H6A A;  4HL1 A;  2GMN A;  2YNV B;  5EHT A;  1QH5 A;  2YCB A;  3L6N A;  5K4M A;  3SD9 A;  3QH8 A;  4D1U A;  2BIB A;  1A7T A;  2QDS A;  4AX1 B;  4HKY A;  4C1H A;  2QED A;  4UBQ A;  3RPC A;  3I15 A;  4EYL A;  3TP9 A;  2CG3 A;  4AX0 B;  4AWZ A;  2FU6 A;  2QDT A;  5HH4 A; 
#chains in the Genus database with same CATH homology
 3DHC A;  4B87 A;  4NQ2 A;  2M5C A;  4D02 A;  2AZ4 A;  2FHX B;  2HB9 A;  4D1W A;  4AD9 A;  4C1E A;  1HLK A;  2BFZ B;  2WHG A;  2R2D A;  2WYM A;  4C1F A;  2OHI A;  4TYT A;  5AXO A;  5A87 A;  4DIK A;  5FQB A;  1KR3 A;  1YCH A;  5ACQ A;  4FEK A;  3LVZ A;  2NZF A;  3KL7 A;  2BFL A;  2A7M A;  5EVK A;  1E5D A;  2YZ3 A;  4RAM A;  5EV8 A;  2Q42 A;  1M2X A;  2OHJ A;  2Y8A A;  4ZO2 A;  1ZKP A;  5HIO A;  4UA4 A;  2GCU A;  5KIK A;  2UYX A;  2WRS A;  5LE1 A;  4EFZ A;  3BK2 A;  4ZO3 A;  2OHH A;  2ZWR A;  3BC2 A;  3ZNB A;  5AEB A;  5K4N A;  5HIS A;  4BP0 A;  2YNV A;  5ACW A;  3T9M A;  3SBL A;  4Z60 A;  4EYF A;  3ADR A;  3I0V A;  5LLD A;  5LCA A;  4FR7 A;  5AXR A;  5LM6 A;  2E7Y A;  5K0W A;  3I13 A;  2NYP A;  5K4K A;  2YNU A;  3MD7 A;  1WUO A;  1MQO A;  3KNS A;  5FQA A;  1X8H A;  4J5H A;  2QIN A;  2WYM C;  4DIL A;  2I7V A;  4F6H A;  2YNT B;  3I11 A;  4U4L A;  5AHO A;  2FU8 A;  1Y44 A;  4YSK A;  2GKL A;  3T3O A;  4HL2 A;  4AWY B;  2FHX A;  4EY2 A;  5LCH A;  2BFK A;  2YNW A;  2BFZ A;  1L9Y A;  1WUP A;  5AYA A;  2Q0I A;  4RBS A;  1DXK A;  2P18 A;  4RL0 A;  4C1D A;  4TZB A;  4GCW A;  2Q9U A;  2FK6 A;  1A8T A;  4NQ6 A;  3IDZ A;  3ESH A;  4TYF A;  2I7X A;  5HH5 A;  3DH8 A;  5LMC A;  4V0H A;  1JT1 A;  1XTO A;  4D1V A;  2Y8B A;  5EVD A;  1BVT A;  1QH3 A;  2NXA A;  1K07 A;  4WD6 A;  3S0Z A;  4Z5Z A;  5EWA A;  3X30 A;  3R2U A;  3AJ3 A;  4C09 A;  4UWS B;  2FM6 A;  2YNT A;  3F9O A;  3DHB A;  2ZZI A;  5DPX A;  1JJE A;  5FQC A;  4FSB A;  3KNR A;  1VGN A;  5HIP A;  2QJS A;  3JXP A;  2BG8 B;  4YSL A;  2Y87 A;  4UWR B;  2BR6 A;  1DDK A;  3VQZ A;  2BMI A;  5ACU A;  1WW1 A;  5EV6 A;  1BC2 A;  4EXS A;  1VJN A;  4GYU A;  3T3N A;  3A4Y A;  4RM5 A;  4TZE A;  5ACT A;  4UWP B;  4RAW A;  1P9E A;  1JJT A;  3PG4 A;  5ACS A;  5ACX A;  2XR1 A;  3PY6 A;  3ZR9 A;  4C1C A;  3IE2 A;  2BTN A;  5EVB A;  3BV6 A;  3IEK A;  4Z67 A;  5AHR A;  3SW3 A;  4Z6X A;  3BK1 A;  1X8G A;  1VME A;  3SRX A;  4D1T A;  5A5Z A;  5KIL A;  3RKJ A;  2DOO A;  1SML A;  4UWO B;  4YSB A;  2VW8 A;  3X2Z A;  3SFP A;  5HIQ A;  3FCZ A;  1X8I A;  2Q0J A;  3WXC A;  4GYQ A;  2BG6 A;  5LSC A;  5LCF A;  3DHA A;  2WYL A;  2BG8 A;  3X2X A;  1KO3 A;  4H0D A;  4PVO A;  2P4Z A;  4P62 A;  4XUK A;  4RL2 A;  4Z5Y A;  3AF5 A;  3IOF A;  1ZNB A;  4XWW A;  2P1E A;  3IEL A;  1YCG A;  5B15 A;  4LE6 A;  3IOG A;  2M5D A;  5LS3 A;  5A0T A;  4XWT A;  1XM8 A;  4BZ3 A;  2ZO4 A;  3IEM A;  4NQ5 A;  2XF4 A;  4KEP A;  4J5F A;  4ZNB A;  3AF6 A;  2GFJ A;  3I14 A;  2GFK A;  4CHL A;  1YCF A;  2FU9 A;  2I7T A;  2NZE A;  5EH9 A;  3H3E A;  5B3R A;  3Q6V A;  2BGA A;  3IE0 A;  4O98 A;  3FAI A;  4KEQ A;  2FU7 A;  3SPU A;  3VPE A;  3G1P A;  2BG2 A;  2DKF A;  3RKK A;  4PVT A;  5B1U A;  3ZWF A;  5EW0 A;  4C1G A;  2BC2 A;  4F6Z A;  4Z7R A;  5IQK A;  2P97 A;  1DD6 A;  4ZEJ A;  4JO0 A;  2ZNB A;  1WRA A;  1ZTC A;  2AIO A;  4NQ4 A;  5ACR A;  4TZF A;  4TZ9 A;  4EXY A;  3IE1 A;  1KO2 A;  3ZQ4 A;  1BMC A;  5A0V A;  3PY5 A;  3P2U A;  4UAM A;  2BG7 A;  4EYB A;  3X2Y A;  2CBN A;  5HH6 A;  5ACP A;  5ACV A;  2H6A A;  4HL1 A;  2GMN A;  2YNV B;  5EHT A;  1QH5 A;  2YCB A;  3L6N A;  5K4M A;  3SD9 A;  3QH8 A;  4D1U A;  2BIB A;  1A7T A;  2QDS A;  4AX1 B;  4HKY A;  4C1H A;  2QED A;  4UBQ A;  3RPC A;  3I15 A;  4EYL A;  3TP9 A;  4AX0 B;  4AWZ A;  2FU6 A;  2QDT A;  5HH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...