3VR8B

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Flavoprotein subunit of complex II
total genus 57
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vr8B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vr8B01
4HRSA 2ACZB 2DWQA 3HRDD 5G5HA 1FO4A 1N61A 2MJDA 1AYFA 1ZOYB 2LEKA 1YQ3B 1FMAD 1R7SA 2BS3B 5EE1A 3VRAB 3AB5A 2G1EA 1TYGB 2M19A 4USAA 1GAQB 1JW9D 1RYJA 1SIJA 1NYQA 3CWIA 3ETRA 3AE3B 1VJKA 3BIID 1QLBB 1ZP0B 4YTPB 3LXFA 2W55A 3LB8C 3P63A 3CF4A 1N63A 1GTEA 3AEEB 1DGJA 1QOAA 1WRIA 2WQYB 1I7HA 3VR8B 3AE5B 1E9MA 3HVZA 4C7ZA 3DWGC 2WDVB 2WS3B 2CU3A 3P4SB 1FFUA 2W3SA 3EUB2 1NI3A 2K5PA 4WWMA 3RPFC 3B2GA 3NVYA 3AE9B 1KFYB 2K9XA 2BS2B 2BS4B 3AEFB 1A70A 1N62A 2AX5A 4FXCA 1DOYA 1L6VA 1CZPA 3NVVA 2K22A 1WYGA 4JWUC 4C80A 1FXIA 3AE6B 1FIQA 1FRRA 3AE7B 1WWTA 3W9CB 3P4RB 1QOGA 1TKEA 1L5PA 2H88B 1XLQA 1TKYA 1E7PB 2W3RA 3FC4A 2WU5B 2WDRB 5C2TB 5C3JB 3L4PA 4YSXB 3AMZA 1H7WA 2MJEA 4YT0B 1B9RA 5AUKA 3VR9B 2KAJA 3ABVB 1ZXIA 2KMMA 1KF6B 3NVZA 1WGKA 1E0ZA 2L83A 2EKIA 3AEAB 3AEGB 3P4QB 4A9AA 4YXDB 4N6EB 5EE3A 3PO0A 5EE0A 1RWSA 1L6UA 3P4PB 2CJNA 4N59A 2WU2B 4P6VF 5EE9A 3SFDB 1RFKA 2WLBA 4N58A 1N5WA 2JQRB 1V8CA 1NYRA 3KWLA 3SR6A 2E3TA 1JWBD 5G5GA 3WCQA 1QOFA 2BT6A 3AH7A 3B2FA 4ZHPA 2N0SB 5H8YE 4YSZB 3AE1B 1RM6C 1WXQA 3DWMA 1JQ4A 1N5XA 1OQQA 2CJOA 2Y5CA 2L52A 1V97A 1H7XA 1JWAD 3P1MA 1PUTA 3NS1A 1JRPA 1SB3C 2Q5WD 1J7CA 3NRZA 3CIRB 1E6EB 2B76B 1NEKB 3AEBB 1PDXA 1VDVA 4ZOHC 1YJJA 1PFDA 1JALA 1OQRA 2JX5A 2PKOA 2QJLA 4KX6B 3W5UB 4LTUA 2M56B 2DBYA 1J7BA 5AUIA 1F0ZA 4ITKA 1FM0D 1QT9A 2W54A 4YTNB 3AM9A 2H89B 1ROEA 1UWMA 4US9A 1XLPA 5MPOA 1GT8A 5GXGB 2HTME 1GPXA 2PVOD 1FRDA 2OHFA 2PIAA 2QIEB 3AV8A 1JROA 4HROA 1DOXA 1AWDA 4YSYB 3AE4B 5H92C 3W5VB 3NVWA 3ZYYX 1FXAA 1T3QA 1DOIA 3HUIA 1L0VB 1ZUD2 1XLNA 1YQ4B 1IUEA 1N60A 1NVID 1KRHA 1E10A 1J7AA 2PVGC 3AECB 4JWSC 3SFEB 1GTHA 3FAHA 1TKGA 2MH7A 4C7YA 1QF6A 4YTMB 2MJ3A 4IDIA 2FBWB 3VRBB 3B9JA 2WP9B 3AE8B 2WDQB 1QOBA 1TJEA 1NENB 3AEDB 1VLBA 1XO3A 1CJEA 4JX1C 1EWYC 1SF0A 1FFVA 3AE2B 1OFFA 1XLOA 4US8A 4ZHOA 3AN1A 4WQMA 1YJIA
chains in the Genus database with same CATH superfamily
5IA7A 1N61A 4C4VA 1SBBB 3Q6BA 2JY6A 1F9JA 2VZKD 2KX0A 3ETRA 3N32A 2KXJA 3TL5A 4G11A 3Q2AC 1T5XD 3BVZA 2W9NA 3C8YA 3H8HA 1J19A 3PRPB 2AYOB 1G6JA 1DOYA 2Y5PA 2MCNB 1FXIA 1FRRA 3FILB 1K52A 2N9PC 4YSXB 4IKGA 1BMLC 1K53A 4ZDVA 1WGKA 3AEAB 3P2BA 5EE3A 2CJNA 3ZLZA 1SGHA 4K3BA 3PTFC 2WGSA 2E3TA 4A3OA 2XK5B 2FNJB 4MM3B 5E6OA 2IGGA 1Z2MA 2BKRB 3DVNV 1T0QC 2WXHA 1UGMA 1WJ6A 3NRZA 3RNBC 3WAOA 3JSVB 4M8NA 4W9GA 3PGEA 5DPSA 3QWZB 2FCMA 1ROEA 4FJYA 5E6JA 4US9A 2GBJA 3Q8AA 2QIEB 3EFCA 1V81A 5H92C 1P0RA 1HA5A 2D2QA 2QEJC 4IG7B 1KRHA 3ML9A 2ZCCA 2C7NB 3ZVVA 1TKGA 3KQ4A 4FULA 3AE8B 3R7QA 3U52E 2KANA 4PS3A 4HRSA 3BWUD 3Q8BA 5EE1A 3PHXB 2GBRA 2JSVX 2J52A 3RFZB 2IPKD 3QQ8B 3SHQA 4MH0E 2E6XA 3OJ4B 2JZPA 2MEKA 2LWPA 4S17A 3RPFC 3NVYA 1EM7A 5BMIA 4BVUC 2B3AA 2WXRA 4JWUC 1D5MC 3B0AA 1XLQA 2ZCBA 1VZ6A 3Q8FA 2LHDA 3V3XA 4B6WA 4H2AA 2KAJA 2YLMA 3T3NA 2I2YA 4MGKE 3VH4B 4P6VF 2WLBA 1N5WA 3ZXVA 3SR6A 3MJ5A 4G0NB 2K8BA 2L76A 3B2FA 2MRPA 1Q0WB 1SJHD 1JQ4A 1ET9A 2SAKA 4YWGG 3HM3A 4WWOA 2ZNVC 4OZCA 4BBNF 1VDVA 3KVFB 4JQWC 4MGIE 1UWXA 2XN9C 2M0XA 4HCNB 3U7ZA 4GXBA 3V6CB 2REXA 3URYA 4II3B 4YSYB 3AE4B 3ZYYX 5DCNA 1R4NI 4J3OD 1BT0A 3RNGC 1VD2A 3EC8A 2V4LA 4MM3A 1QILA 3A1QA 3VTWA 5TSSA 2WXKA 1P7FA 1N6ZA 2C9WB 2N7DA 2BB6A 4HJKA 3KLSX 2HJ1A 3BINA 2ZVOA 4DXGA 1M4VA 3PVLA 1YQ3B 2RPVA 2GB1A 2WXQA 1ZXHA 3Q3NC 3NS8A 2DAFA 1TTNA 5HKHA 3Q8CA 4BKSA 4YTPB 3PRZA 4HKZE 3R66C 1GTEA 4OHJA 1DGJA 1QOAA 3KH0A 2WQYB 1TY0A 3CMMB 3DWGC 2AQ1B 2M4NA 3GP7A 1KTKA 1TS2A 1UH6A 2GMIC 2HJ8A 1LXDA 1C4CA 3GS2A 1IGDA 1L5PA 1XXGA 4EZLA 4YL8A 3GB1A 1VZ8A 4I6PA 1XCTL 4I6NB 2J4XA 2KMMA 3MP9A 3VVWB 2IO2B 2WU2B 4EZKA 1WJUA 2INCC 3D32A 1I4PA 2VZKB 3U8ZA 2BYTA 4FA6A 1PUTA 4OVUA 4TQ1A 2B76B 1YQBA 2PKOA 3V60A 1PGXA 1STEA 2KT7A 2LGSA 2NCNA 1GOZA 2RDGA 4A6QA 4J6IA 1WJNA 3QCAA 3QIJA 4DBGA 2OHFA 4ZRKA 1T3QA 4ANXA 2KLCA 2MJ3A 4KSLC 3ZJTA 2QDFA 4TSSA 3AEDB 4HKQA 1FFVA 1B1ZA 2KDFB 2J0JA 4LJPB 2DHZA 3QHTA 3HRDD 4C56C 1IP9A 2RSUA 4AJWA 2BS3B 3PZ7A 3ZUNA 2KMAA 4MDKE 4NNJB 2M19A 4USAA 1R4NB 2L05A 1F52A 2BYFA 3O13A 2MBQA 3V61A 2ZW1A 3A9KA 2WS3B 1IYFA 5E6NA 4GB9A 1HEZE 2BS4B 4FXCA 2XNAC 2QC8A 3TJPA 3A4RA 1Y8RC 1MG4A 3TIXA 2DLBA 3MJWA 4BOSC 3R2IA 3IXSA 4TMAB 2N7JA 3VHTC 3L54A 1H7WA 1XEEA 2MJEA 2IYDB 4XC2A 4P1BC 3VR9B 3NVZA 4IWQA 2JU6X 4CHKA 3U4EG 4N59A 3SFDB 2LXCA 2K3UA 5CTRC 3DBLI 2BT6A 4PYUA 1ZE3D 2JPHA 2WX1A 1WM2A 5JH5C 3KW5B 1I4RA 1ESFA 3E9SA 3MC9A 2M17A 4K7UA 3K9PB 3BK1A 4ANUA 2I38A 3I63C 5BMHA 2V0GA 1YX6B 4A20A 1KJTA 2PVOD 4B9KA 1BXTA 2KWUB 3NZUA 1UGJA 3TEWA 4TQ0A 1ZUD2 3MC0B 2BGFA 4IWOA 1FCCC 2FBWB 3PLUA 4KIKA 1UBQA 2D11A 4FADA 2YEPB 5FKAC 1A5RA 1XLOA 1WSPA 2PJHA 1U4AA 2L0FA 2ACZB 4KGTA 5G5HA 4PYZA 1AYFA 4KZ0A 5T8IA 1WRIA 1XQQA 3X23A 2JRHA 2CU3A 3EUB2 1A70A 1GG3A 4ZRQA 2AQ2B 1T0SC 1FIQA 1WWTA 3CSFA 1UD7A 1GJZA 2K1FA 3R3MA 3VQIA 2CKHB 5C3JB 2ZPYA 4K3CA 3N3KB 2EMSA 4YT0B 1HZ6A 2FCSA 2KDIA 4W9FA 1C4PA 2N9EB 4HVBA 4FHJA 4N58A 3A9JB 1PYWD 1NI2A 3VTUA 2O2VB 1MG8A 4P16A 2N0SB 2J0MA 4YSZB 4NJ6A 1T0RC 2N9KA 1V5TA 1H7XA 5AEKB 1LFDA 2K6QA 1TT5B 2LD9A 2PTLA 3NZSA 1BUIC 1GUAB 3IT4B 1EU4A 1ZGUB 3RYTA 4XWWA 2KVZA 3AXCA 4OVZA 3QJZA 1K50A 1CQVA 4XYCA 1FCLA 5MPOA 2G3QB 3W5VB 4K1RB 3J9CA 2WNMA 2BQQA 1R4MB 2KN4A 2M0AA 2A4ZA 4RGMA 2JZ3B 4DHZE 3IT6B 1JWUD 1Q5WB 2INNE 2EELA 3VRBB 1F2RI 2TSSA 1Z5SB 3I3TB 1XO3A 1D3ZA 3PT2B 2V3SA 4ZHOA 4BKTA 5IO9A 4IM0A 4IC7B 2DAJA 2KJ6A 4R3DA 4EKUA 4CO7A 4ICVA 2IBIB 1GAQB 1RYJA 2D3GA 1NYQA 2KFKA 3DBRI 1VJKA 5L95C 1ZP0B 5LLIA 3MFGA 1I35A 1VCBA 3NZ3A 4LNOA 2W3SA 3IAM1 2FIFA 2HTHA 3NJTA 3N9YC 3UF8A 3PHWB 3NVVA 4C80A 2IO1B 2KK8A 2NVUI 4G3XB 4JGHB 3QAQA 4S0RA 2N4FA 4ACFA 2N9LA 1B9RA 5AUKA 2C7MB 1EWCA 5CHFA 1E7UA 2PLPA 1WI0A 1UZXB 1VZ7A 3M3JA 4MH8A 5HG2A 2L7RA 4XGAB 1J8CA 4UDUC 2BPSA 4CYEA 2MHJA 1MFWA 4B0EA 2ZEQA 2K8CA 4DXFA 5C23A 4P7IA 2D10A 2Z8LA 2IGHA 2PPHA 1TS3A 4HEA1 1FD6A 1KLGD 3PRMB 3ZXRA 5JHBA 2XBBC 1SIFA 1FM0D 5D7GA 2W54A 1TZOA 2V4IB 4RMAA 2DZKA 2LI5A 2VRRB 1DOIA 4AOFA 3DHIC 2D07B 2EKEC 4RNAA 2KC1A 1YMHE 3Q3MC 2GRIA 3NUHB 4N9F4 1V1PB 1ISNA 1CJEA 2KC2A 2K0PA 3O65B 5IAAC 2V9HA 3R7RA 2KQ4X 3HK0A 1E8ZA 3DVNU 1WGDA 1FMAD 3IBEA 2G1EA 4HDOA 4LNKA 4BAXA 1RRBA 5LNK1 4RM9A 2G4SA 1SIJA 1WE6A 1ET6A 3ZTDA 2W55A 2EMTA 1XF5L 3M63B 3Q3OC 2PE9A 5CHVC 3HVZA 4O1NA 2JT4B 3ML8A 2LRUA 1V1PA 4AJYB 1SE2A 5TR5A 4NAMA 3AE6B 2OEDA 4LJOB 1F77A 3N1ZC 5D2MB 3ZJUA 3DQVA 2G45B 2L00B 3PREA 2G4DB 2ZZPB 2JVCA 4NJCA 3ZIMA 2KQ7A 2JQRB 5CX3A 4NJ7A 4REZA 4EZJA 3N20C 1ZDXA 1P3QU 3AH7A 3WIMA 2LVPA 4ZHPA 3VUYA 4DDID 3AE1B 1WX8A 3GE8C 5HHDG 4AUQC 3GE3C 1OQQA 2KACA 4FJZA 2YEPF 2V3NA 1T0YA 3NS1A 4HK2A 4OZBA 3H7PB 1RFAA 1FNVA 1I42A 3RT3B 1PDXA 4ZOHC 1C3TA 1LO5D 5AUIA 4ITKA 2O6VB 3DVGY 1UWMA 2MP2B 4M8MA 5IP4D 3RN9C 2ASQA 2DYMA 2M8SA 2PIAA 2Y3AA 3VDZA 3MTNB 4F8CB 1L0VB 2KX3A 3DBRB 1V2YA 4BZAA 5FK9C 5DPRA 4WIPA 1K51A 3AECB 3SFEB 5AZHA 1I4HA 4IDIA 1YN3A 3W1YA 2GBKA 4LDTD 5J2RA 3OWEB 3BYTB 4JX1C 2LXAA 3H7SA 1MVKA 1MI0A 3LDZE 2GBMA 3LJ3A 2NS5A 3AB5A 1C78A 1SE4A 4ZRIA 3VTVA 3DVGX 3V6EB 1YNTE 3OAWA 3I9V1 2GBNA 1E9MA 4RH6A 2WXLA 3EFUA 2WDVB 4RFBA 1NI3A 2K5PA 2K9XA 3Q3FA 4KKIA 2K22A 2XK5A 1SE9A 1HXYD 4MGZE 1TKEA 3N30A 1LQBA 3KUDB 3MHZA 3N1XC 3LYYA 1WXVA 3BVGA 1V5OA 3WANA 4A9AA 4YXDB 4N6EB 4GOCA 2MBBB 3GZNI 1DYQA 3RCZA 2MBHA 2FUG1 3TUOA 3KWLA 1C76A 2FCQA 2KLGA 1UBIA 5FR6A 2BWFA 3RD2A 1Q10A 1EF1A 3EGRA 3GOEA 2HE7A 2CJOA 2BBCA 1K8RB 1WJ4A 2D3AA 2PEAA 2WXFA 2RPQA 3RUIB 2KN5A 1SXTA 1V49A 1NEKB 4P1CC 1LM8B 2K8HA 2AQ3B 3AM9A 2KMCA 4WWPA 5GXGB 4M02A 1P7EA 2LJ5A 4K7WA 3T8MA 3VUXA 2CS4A 4FLHA 1VR9A 2PVGC 4KGSA 3RNAC 3DHHC 2KTRB 1NENB 4ASWC 4LK0M 3H7PA 1QZEA 3Q69A 4ICUA 1D5XC 3RMKC 5CHWA 1D5ZC 5LXHA 2C60A 2MJDA 1ZOYB 1UELA 2O6VA 3CF6E 4ZRPA 1EU3A 4GDLB 3AE3B 4GMVA 1WRDB 1L4DB 4AP4C 4PK1A 2AL3A 1E90A 3B2GA 1YN4A 1E7VA 1Q1OA 4KIKB 1MPEA 2CR5A 1ZPSA 2WXNA 5C2TB 3L4PA 4JLCA 3RNEC 1KF6B 2J7QB 1E0ZA 2L83A 2EKIA 1OQYA 1MHHE 2LRWA 1TY2A 3PPAA 4Q2JA 1SJED 1WR6E 4HPLB 1V8CA 4JE3B 1YN5A 4W9IA 5BYRA 3DDCB 4EFOA 2LASA 3RNCC 3DWMA 4A90A 3QX1A 4IUMB 3L10B 3NOBA 1JWAD 3P1MA 4NAWB 4HJGE 4DQOC 2Q5WD 2AEHA 2LGIA 4FJVB 1PFDA 2MW5A 2JX5A 3W5UB 4ARCA 4YTNB 1HZ5A 1FPYA 5G55A 2HTME 5DPWA 3Q8EA 2BYEA 2WXJA 3APDA 1PQSA 1HTQA 1IUEA 4HLEA 1SEBD 2NTTA 4BFRA 2MH7A 1WIAA 1CK1A 2QHOA 4YTMB 4D2KA 5I4DA 2IZVB 1WH3A 3DCGA 4WJQA 1SF0A 2AL6A 3AE2B 2LGXA 3C19A 2L8JA 3UIPB 1L0YB 1ZW7A 3L0WB 2LJIA 3M62B 4NY0A 4GU2A 2RR9A 2KJHB 3PZ8A 1C77A 1NDDA 1I4XA 1L7YA 3LB8C 1N63A 1ENFA 2BWES 1WXAA 4C7ZA 2R2QA 3BZDB 4DDGD 2WHIA 3KYDD 1KH0A 1QQRA 3V05A 3ZGZA 4W9DA 3W9CB 3FC4A 1RLFA 3UIOB 3JVZX 2BF8B 2RMMA 3HM6X 1V1OA 5EE0A 1V80A 1L6UA 3P4PB 1P9DU 2ZVNA 3ZKJC 2MA9B 1L2NA 2KFKB 4F7ZA 2LGYA 1WR1A 3VH3B 4URKA 1JWBD 5EDSA 4LNIA 1JWMD 4XE0A 3EA6A 1WXQA 1X1MA 3UGBB 2W82A 2Y5CA 2L52A 3OJ3A 1TZ1A 2KDEB 1SB3C 1J7CA 4GLSC 1FNUA 3ZRFA 3X0WA 1GNUA 2X38A 1F0ZA 2C5LC 5KHOA 2DZIA 4G50A 1FRDA 1GC6A 3ZW3A 3TEYA 2OOBB 3E56A 3JYUA 2Z0EB 3IFWB 4XZ4A 4NAWA 2KWDA 2ZW0A 4BBNC 1JMLA 2WDTB 1NVID 3NHEB 2VH1A 3VXWA 1WGRA 2BB5A 5BO4B 2OJRA 3A4SC 1QOBA 5BYSA 2JXTA 1AW7A 1OEYJ 4MACA 4ZRJA 1IBXA 2KHWB 2MQJA 4GDLA 2ZJDA 3U2SC 2KKCA 4RCOA 1WXMA 3CWIA 5D94A 3BIID 3LXFA 4W9EA 3CF4A 4QAYA 1E8XA 1I7HA 2I1JA 2MP2A 1FFUA 2BYVE 5FR3A 1N62A 5J17A 2AX5A 2KWCA 1L6VA 2KNBA 3AU5A 3U30A 3H6NA 1WY8A 2D3CA 2KVRA 4C00A 3AULA 2ICIA 4L23A 1ZXIA 4E3CA 4WJNA 3TMPB 3NG0A 1HTOA 2RDBC 1F2RC 2PW9A 1P1AA 2BVCA 2NBVB 1S1QB 3NY5A 2LUMA 3I5JC 5D3DA 2LMCA 4KZCA 3VAWA 1QKZA 1IBXB 2IO0B 3VUWA 4W9CA 2MBOA 1KOTA 1IGCA 1JRPA 3K9OB 3BK2A 1H8CA 3CIRB 1WXSA 3AEBB 4M0WA 1YJJA 3UINB 4AQ7A 2DNFA 2DBYA 5D6JB 4MJSB 2G9HD 1TGZB 3FKYA 4ANVA 2UU7A 5HFYA 1Y56A 2QILA 5JHAA 4ANWA 1I4GA 1XLNA 1YQ4B 3WAPA 4XWTA 1E10A 4XX5A 2C7HA 3PLVA 4I6LB 3B1LX 2N1VA 5JXVA 1PGAA 2ZNVB 2ZPNA 1YJIA 2MLBA 1FO4A 2K25A 4MT5A 4FN2A 3IG3A 2NBUA 4L2YA 4W9JA 1QLBB 4MGYE 3OLMD 3Q3JA 3MHSD 4HDQA 4EE2A 3UI3A 2MSED 3P4SB 3KYCD 4F1SA 3AE9B 3QC8B 1TS4A 2UYZB 5C1ZA 2QSDA 1WYGA 1S3SG 1WZ0A 2W3RA 3AI5A 2KD0A 4FBJB 3A9JA 2XEWA 2GI9A 3C0RB 5IOIA 2KQSA 4NZLB 4ZYNA 2FUHB 4M00A 2PMVA 1PGBA 1T6BX 4KGRA 3PO0A 5JZEB 4NQLB 2FIDA 1ZKHA 2LHEA 2LVQA 5GMVA 1WGHA 3PSEB 1TBEA 2Z0DB 5IN7A 5D3IB 1WE7A 3WCQA 2IJ0A 1C79A 2BKFA 1RM6C 4PS7A 4LLGM 3TBLD 3ZNHB 4L1BA 1OGWA 2KJRA 2L1AA 4KSKC 4NPNA 5BMGA 2Y5BB 3RI7C 2DX5B 2BTEA 2IGDA 2K39A 4HXDA 1YOVB 4WURA 1YJ1A 2JXXA 2V1YA 1GPXA 3NVWA 3TEXA 1FXAA 4JPSA 3QARA 2JRIB 1J7AA 4OW0A 3FAHA 3AU4A 1M94A 3OG5A 3M95A 3IHPC 4B0MA 2O6VD 2WX0A 4BKGA 2QCZA 3TSSA 4DHJD 2LEKA 4BOZB 1VRAB 1GB1A 3KUCB 3SDLC 2N7EA 2M1MA 4EUTA 2IY1B 2NPTA 2JUOA 4W9LA 4HCPB 4M0WB 4WJPA 2WXGA 2DYOA 3SU8X 1E8YA 3ALBA 3DPDA 2IO3B 1V86A 1WFYA 2WXOA 2O2VA 4MSMB 2LZ6A 4EEWA 2ONQA 1UUPA 4II2B 3AMZA 2INDC 1NBFC 4WWNA 1V6EA 2NR2A 2KWVB 2L32A 3ABVB 4NQKE 2IDYA 1WF9A 3AEGB 2FE8A 2QMTA 2LUEA 1YX5B 2WWZA 1UNSA 5G5GA 4C4VB 1JWSD 4OVVA 3EHVA 2Z59B 3IVFA 3BVMA 4RM8A 1TS5A 3H1UA 3ZO5B 4HPMB 4GDKA 4HWIB 4ARIA 3ZQ4A 1JALA 1OQRA 4KX6B 4LTUA 2A5UA 3HVDA 2DYBA 4IM3A 2LVOA 1ZDVA 3WAMA 4WJOA 3A33B 3DBLB 3VFKA 1JCKB 3V62A 3UQBA 1D6EC 3P42A 4LNFA 1UF0A 4JWSC 4TKNA 3SD5A 1GC7A 1WMHA 2BW2A 3ZNZB 1R4MI 3DHGC 3DOWA 2OJWA 4AS1A 4IWPA 4WQMA 1AN8A 2AWTA 1R7SA 2JWZA 3VRAB 2NPTB 4KVGB 2RDHA 5BYQA 1JW9D 4M01A 4MELA 1RAXA 2WXMA 3P63A 3BYYB 4KKJA 1YIWA 3R8BA 3WALA 2WYQA 2JYTA 2GOWA 2MWSB 1E7PB 2CHWA 3QK0A 3DBHI 3I57A 1EF5A 4AWJA 5EE9A 1RFKA 4GSWA 3RZFA 4A8XC 4DHZB 3L08A 1FXTB 5HI1A 4K7SA 2J0KA 2R2OA 2JYEA 1QOFA 5H8YE 3PS6A 1WGGA 1TIFA 3ZDTA 4GDKB 4K81A 3APFA 2RGFA 5J18A 4RF0A 3ZRCA 4HPPA 1E6EB 4KV2A 1KLVA 3A1QB 2N9XA 3DBHB 4MEMA 3JW0X 4RGTA 1J7BA 1KLUD 4GN1A 1C1YB 4IM2A 3WA0A 2H89B 2I1KA 2NBWB 4PS8A 2L0TA 1GT8A 1OTRB 2KFJA 5AZFA 3AV8A 3MC8A 4XDCA 1AWDA 2INPE 3ZNID 3HUIA 5AZGA 1N60A 1ACCA 3SEBA 4DHJB 3JSVA 2WP9B 3RZWC 1XD3B 1EO6A 1VLBA 4DK5A 1EWYC 1OFFA 4XDDA 4US8A 2WXIA 3AN1A 4WH4A 4CQNA 3QA8A 2DWQA 2LFIA 3ZNGC 3KUZA 1TYGB 2RD0A 4DWFA 1IPGA 1HE8A 4MJSA 4IOIE 4KDLB 1I4QA 1JRUA 2PE6B 3TEZA 3L16A 4TUUA 5KHQA 4WAFA 3L13A 2BS2B 3AEFB 3HHMA 4WQOB 1WMHB 2SEBD 3Q14C 3AE7B 1YD8U 1QOGA 1TKYA 1WYWB 3ZJVA 4LDTB 1OEYA 2CHZA 2DZJA 1WGYA 2MX2A 1SSNA 4E71A 1H4RA 3P4QB 4GIVA 1RWSA 2LGDA 3EECA 3T9LA 1NYRA 3FILA 4JL9A 4GGQA 2FAZA 1N5XA 2D3BA 1V97A 3BY4B 3IAS1 1FEHA 1XT9B 2QJLA 2YVCA 1FNWA 2M56B 3PV1A 1QT9A 2KDBA 2N1WA 4W9KA 2CHXA 4RGNA 1XLPA 2KOXA 4A3PA 4BKSD 1JROA 1DOXA 1MHXA 1WM3A 3ONSA 3ZDMC 3DBSA 1GTHA 3UQAA 1V9JA 3KWVA 1L4ZB 4C7YA 2R61A 2KO3A 3CSTA 3B9JA 4DXAB 2WDQB 3N1YC 4KDIC 3W2DA 3T3OA 4PT5A 4FHKA 2UWQA 3PZDA 2J42A 4LNNA 1P98A 3U7DA 4RF1A 1XCQL 2JF5A 3TCAA 1LGRA 4MSQB 3AEEB 4JIOU 1WZ3A 3VR8B 3AE5B 4A55A 3ENEA 2ON8A 3HIZA 4WWMA 3A9KB 1WX9A 1KFYB 1SE3A 4WAAA 1CZPA 3H9DA 4TV3A 1D4BA 3P4RB 2H88B 2JZZA 1EUVB 2WU5B 3RNFC 2WDRB 5DPTA 1HQRD 2NMQA 1C4AA 2CU1A 2DZMA 4E74A 2DENB 3ZTCA 2WXPA 4LCDE 1AARA 1GB4A 3ECIA 2IY0B 4OZAA 5IKCM 2NTSA 3GZNB 3L17A 4RGOS 4X57B 1F1HA 4W9HA 1KM7A 4ZYSA 3S2AA 2KTRA 1E8WA 2HDEA 5E6PA 2L3ZA 2JWUA 1L0XB 2FCNA 3W1SC 5L83A 3APCA 2MBEA 1WX7A 3B08A 1C9FA 2VH2A 4HROA 2KTFA 2KDMA 2HD5B 3RULA 4B95A 4EOYA 2V3PA 2K6DB 5LXIB 1QF6A 2KYWA 1E5WA 2J53A 1MJDA 2KZRA 3W1SA 1CMXB 2X8XX 3R2TA 1TJEA 2D5GA 4IW0A 5G2NA 2GLSA 1J0GA
chains in the Genus database with same CATH topology
1D5XC 1D5ZC 3TSSA 2ACZB 4KGTA 5G5HA 1N61A 2MJDA 1AYFA 1ZOYB 2LEKA 1VRAB 1SBBB 1GB1A 2VZKD 5T8IA 4ZRPA 1EU3A 3ETRA 4GDLB 3AE3B 1T5XD 3BVZA 1WRIA 1L4DB 3C8YA 2WXGA 3H8HA 2DYOA 2CU3A 3EUB2 3B2GA 1DOYA 1YN4A 1A70A 2Y5PA 2WXOA 4ZRQA 1MPEA 2AQ2B 1FXIA 1FIQA 1WWTA 1FRRA 3FILB 1ZPSA 2WXNA 1K52A 2ONQA 1UUPA 5C2TB 5C3JB 3VQIA 3L4PA 4YSXB 3AMZA 4IKGA 1BMLC 4YT0B 1K53A 2L32A 3ABVB 1HZ6A 1KF6B 1WGKA 2IDYA 2L83A 2EKIA 3AEAB 3AEGB 1E0ZA 2FE8A 1MHHE 1C4PA 5EE3A 1TY2A 2CJNA 4Q2JA 4N58A 1SJED 2QMTA 4JE3B 1V8CA 1PYWD 1YN5A 1UNSA 5BYRA 2E3TA 4P16A 5G5GA 1JWSD 2N0SB 4YSZB 4MM3B 3DWMA 2IGGA 4A90A 2N9KA 3BVMA 1H7XA 1JWAD 3P1MA 4NAWB 4HJGE 4DQOC 1TS5A 2WXHA 2Q5WD 2LGIA 4ARIA 3ZQ4A 3NRZA 2PTLA 1PFDA 1BUIC 1JALA 1OQRA 2JX5A 4KX6B 3W5UB 3IT4B 4LTUA 1EU4A 3HVDA 4XWWA 4ARCA 4YTNB 1HZ5A 4OVZA 1ZDVA 1K50A 1ROEA 1CQVA 5E6JA 4US9A 1FCLA 5MPOA 2HTME 3Q8AA 2QIEB 1JCKB 3W5VB 3Q8EA 5H92C 3J9CA 2WXJA 1HA5A 2WNMA 2KN4A 2QEJC 1D6EC 1IUEA 3P42A 1KRHA 2M0AA 1SEBD 2NTTA 4JWSC 4RGMA 1TKGA 2MH7A 3IT6B 1CK1A 1JWUD 4YTMB 2INNE 2EELA 3KQ4A 4D2KA 5I4DA 3VRBB 1F2RI 2TSSA 3AE8B 2BW2A 1XO3A 1SF0A 3AE2B 3U52E 4ZHOA 4AS1A 4WQMA 1L0YB 4HRSA 3BWUD 3Q8BA 2LJIA 1AN8A 5EE1A 1R7SA 3VRAB 2JSVX 4R3DA 2J52A 3PZ8A 2RDHA 5BYQA 1GAQB 1JW9D 1RYJA 3RFZB 1NYQA 1C77A 1VJKA 2IPKD 1ZP0B 1I4XA 2WXMA 3LB8C 2E6XA 3BYYB 3P63A 1N63A 4KKJA 1ENFA 3MFGA 2JZPA 3NZ3A 2MEKA 4C7ZA 3BZDB 2W3SA 3RPFC 3IAM1 3NVYA 3R8BA 1EM7A 1KH0A 5BMIA 1QQRA 2JYTA 3N9YC 3V05A 3NVVA 2WXRA 4JWUC 4C80A 3ZGZA 1D5MC 3W9CB 3FC4A 1XLQA 1E7PB 1VZ6A 3Q8FA 2N9LA 2LHDA 3V3XA 4H2AA 1B9RA 5AUKA 1EWCA 2KAJA 3T3NA 2RMMA 2PLPA 3I57A 2I2YA 5EE0A 1V1OA 1VZ7A 4MH8A 5HG2A 1L6UA 3P4PB 4P6VF 5EE9A 2WLBA 1RFKA 4A8XC 4UDUC 1N5WA 5HI1A 3SR6A 3MJ5A 2JYEA 1JWBD 1QOFA 3B2FA 4XE0A 1JWMD 4B0EA 3EA6A 5H8YE 1WXQA 2W82A 1SJHD 1JQ4A 1ET9A 2SAKA 4GDKB 2Y5CA 4YWGG 2L52A 4DXFA 4RF0A 1SB3C 2Z8LA 2IGHA 4OZCA 1J7CA 1E6EB 1TS3A 1VDVA 4HEA1 1UWXA 2XN9C 1FD6A 4GLSC 1KLGD 1FNUA 3U7ZA 4RGTA 1J7BA 2X38A 1F0ZA 1FM0D 1KLUD 5D7GA 2W54A 1TZOA 2H89B 3URYA 2V4IB 1GT8A 1FRDA 3AV8A 3TEYA 3E56A 4XDCA 1AWDA 4YSYB 3AE4B 3ZYYX 2INPE 1DOIA 3HUIA 4J3OD 2KWDA 2ZW0A 1JMLA 1N60A 1NVID 1ACCA 3SEBA 4RNAA 1QILA 1YMHE 2BB5A 5TSSA 2WP9B 2GRIA 1QOBA 2WXKA 3NUHB 5BYSA 1V1PB 1P7FA 1VLBA 1CJEA 2JXTA 2K0PA 1EWYC 1AW7A 1OFFA 2BB6A 4XDDA 4US8A 2WXIA 3AN1A 3KLSX 4MACA 4WH4A 4CQNA 1IBXA 2KQ4X 2DWQA 2LFIA 1M4VA 4DXGA 1YQ3B 1FMAD 2GB1A 2RPVA 2WXQA 1ZXHA 3U2SC 2G1EA 1TYGB 4RCOA 5LNK1 3CWIA 3Q8CA 1SIJA 4IOIE 1ET6A 3BIID 1I4QA 3LXFA 4YTPB 2W55A 3CF4A 4HKZE 1GTEA 4OHJA 1XF5L 1DGJA 1QOAA 2WQYB 1I7HA 1TY0A 3TEZA 3HVZA 4O1NA 3DWGC 2AQ1B 3GP7A 1KTKA 1FFUA 1TS2A 4WAFA 5FR3A 1V1PA 2BS2B 3AEFB 1N62A 2AX5A 1SE2A 1L6VA 2SEBD 4NAMA 1C4CA 3GS2A 3AE6B 2OEDA 3AE7B 1IGDA 1QOGA 1L5PA 1XXGA 1F77A 1TKYA 3GB1A 3ZJVA 1VZ8A 3ZJUA 1XCTL 1SSNA 2ICIA 4L23A 2J4XA 1ZXIA 2KMMA 3MP9A 3P4QB 1RWSA 4NJCA 2WU2B 1F2RC 2PW9A 2JQRB 4REZA 1NYRA 1ZDXA 3FILA 2LUMA 3AH7A 4ZHPA 5D3DA 3AE1B 2LMCA 5HHDG 1QKZA 1N5XA 1I4PA 1OQQA 2KACA 1IBXB 1V97A 2YEPF 2V3NA 2VZKB 2BYTA 1IGCA 1PUTA 3IAS1 1JRPA 3NS1A 4OZBA 3BK2A 1FEHA 1FNVA 4TQ1A 3CIRB 2B76B 1PDXA 3AEBB 4M0WA 4ZOHC 1YJJA 1LO5D 4AQ7A 2PKOA 2QJLA 1FNWA 2M56B 1PGXA 2DBYA 1STEA 5AUIA 4ITKA 1QT9A 1GOZA 2RDGA 4A6QA 1UWMA 4RGNA 1XLPA 2G9HD 2DYMA 2OHFA 2PIAA 1JROA 1DOXA 5HFYA 2Y3AA 1T3QA 1Y56A 2QILA 1L0VB 1I4GA 1MHXA 5FK9C 1XLNA 1YQ4B 4WIPA 4XWTA 1K51A 1E10A 3AECB 3SFEB 1GTHA 3KWVA 1L4ZB 4C7YA 2R61A 2MJ3A 1I4HA 4IDIA 3ZJTA 3B9JA 1YN3A 2WDQB 4TSSA 3AEDB 3OWEB 3BYTB 4JX1C 5JXVA 4HKQA 1FFVA 1PGAA 1B1ZA 3W2DA 1YJIA 1MVKA 3T3OA 1MI0A 4PT5A 3HRDD 4C56C 1FO4A 2BS3B 3AB5A 1C78A 2J42A 1SE4A 3PZ7A 4MT5A 1YNTE 2M19A 4RF1A 3I9V1 4USAA 1XCQL 4L2YA 1QLBB 3O13A 3AEEB 4EE2A 2ZW1A 3VR8B 3AE5B 1E9MA 4RH6A 3UI3A 2WXLA 4A55A 2WDVB 2WS3B 2ON8A 3P4SB 4RFBA 4WWMA 1NI3A 2K5PA 3AE9B 1KFYB 1HEZE 1TS4A 2BS4B 2K9XA 1SE3A 4FXCA 2XNAC 2QSDA 1CZPA 4KKIA 2K22A 1WYGA 1HXYD 1D4BA 3P4RB 1TKEA 2H88B 2W3RA 2DLBA 2WU5B 3R2IA 2WDRB 3IXSA 2GI9A 3MHZA 2N7JA 4TMAB 4NZLB 1H7WA 1XEEA 2MJEA 1HQRD 2NMQA 3LYYA 3VR9B 1C4AA 2PMVA 1PGBA 3BVGA 3NVZA 1T6BX 2JU6X 4KGRA 4YXDB 4A9AA 4N6EB 3PO0A 3U4EG 4N59A 2LHEA 1DYQA 3SFDB 2FUG1 2K3UA 2WXPA 3TUOA 1C76A 3KWLA 5D3IB 1GB4A 3WCQA 2IJ0A 2BT6A 1C79A 1ZE3D 1Q10A 4OZAA 2NTSA 3EGRA 1RM6C 4LLGM 4RGOS 1I4RA 2CJOA 4L1BA 2BBCA 1ESFA 3E9SA 4ZYSA 2L1AA 2WXFA 5BMGA 1SXTA 1NEKB 2HDEA 2BTEA 2IGDA 3BK1A 2JWUA 2I38A 1L0XB 5BMHA 2AQ3B 2V0GA 4WURA 3AM9A 5GXGB 1GPXA 2PVOD 1C9FA 1BXTA 4HROA 2KDMA 1P7EA 3NVWA 3TEXA 1FXAA 1UGJA 3TEWA 4TQ0A 4JPSA 1ZUD2 3MC0B 2V3PA 1J7AA 1VR9A 2PVGC 4KGSA 4OW0A 3FAHA 1QF6A 2J53A 3W1SA 1FCCC 2FBWB 3R2TA 1TJEA 2D5GA 1NENB 4LK0M 2YEPB 5FKAC 4B0MA 1XLOA 1WSPA 3Q69A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HRS A;  2ACZ B;  2DWQ A;  3HRD D;  5G5H A;  1FO4 A;  1N61 A;  2MJD A;  1AYF A;  1ZOY B;  2LEK A;  1YQ3 B;  1FMA D;  1R7S A;  2BS3 B;  5EE1 A;  3VRA B;  3AB5 A;  2G1E A;  1TYG B;  2M19 A;  4USA A;  1GAQ B;  1JW9 D;  1RYJ A;  1SIJ A;  1NYQ A;  3CWI A;  3ETR A;  3AE3 B;  1VJK A;  3BII D;  1QLB B;  1ZP0 B;  4YTP B;  3LXF A;  2W55 A;  3LB8 C;  3P63 A;  3CF4 A;  1N63 A;  1GTE A;  3AEE B;  1DGJ A;  1QOA A;  1WRI A;  2WQY B;  1I7H A;  3VR8 B;  3AE5 B;  1E9M A;  3HVZ A;  4C7Z A;  3DWG C;  2WDV B;  2WS3 B;  2CU3 A;  3P4S B;  1FFU A;  2W3S A;  3EUB 2;  1NI3 A;  2K5P A;  4WWM A;  3RPF C;  3B2G A;  3NVY A;  3AE9 B;  1KFY B;  2K9X A;  2BS2 B;  2BS4 B;  3AEF B;  1A70 A;  1N62 A;  2AX5 A;  4FXC A;  1DOY A;  1L6V A;  1CZP A;  3NVV A;  2K22 A;  1WYG A;  4JWU C;  4C80 A;  1FXI A;  3AE6 B;  1FIQ A;  1FRR A;  3AE7 B;  1WWT A;  3W9C B;  3P4R B;  1QOG A;  1TKE A;  1L5P A;  2H88 B;  1XLQ A;  1TKY A;  1E7P B;  2W3R A;  3FC4 A;  2WU5 B;  2WDR B;  5C2T B;  5C3J B;  3L4P A;  4YSX B;  3AMZ A;  1H7W A;  2MJE A;  4YT0 B;  1B9R A;  5AUK A;  3VR9 B;  2KAJ A;  3ABV B;  1ZXI A;  2KMM A;  1KF6 B;  3NVZ A;  1WGK A;  1E0Z A;  2L83 A;  2EKI A;  3AEA B;  3AEG B;  3P4Q B;  4A9A A;  4YXD B;  4N6E B;  5EE3 A;  3PO0 A;  5EE0 A;  1RWS A;  1L6U A;  3P4P B;  2CJN A;  4N59 A;  2WU2 B;  4P6V F;  5EE9 A;  3SFD B;  1RFK A;  2WLB A;  4N58 A;  1N5W A;  2JQR B;  1V8C A;  1NYR A;  3KWL A;  3SR6 A;  2E3T A;  1JWB D;  5G5G A;  3WCQ A;  1QOF A;  2BT6 A;  3AH7 A;  3B2F A;  4ZHP A;  2N0S B;  5H8Y E;  4YSZ B;  3AE1 B;  1RM6 C;  1WXQ A;  3DWM A;  1JQ4 A;  1N5X A;  1OQQ A;  2CJO A;  2Y5C A;  2L52 A;  1V97 A;  1H7X A;  1JWA D;  3P1M A;  1PUT A;  3NS1 A;  1JRP A;  1SB3 C;  2Q5W D;  1J7C A;  3NRZ A;  3CIR B;  1E6E B;  2B76 B;  1NEK B;  3AEB B;  1PDX A;  1VDV A;  4ZOH C;  1YJJ A;  1PFD A;  1JAL A;  1OQR A;  2JX5 A;  2PKO A;  2QJL A;  4KX6 B;  3W5U B;  4LTU A;  2M56 B;  2DBY A;  1J7B A;  5AUI A;  1F0Z A;  4ITK A;  1FM0 D;  1QT9 A;  2W54 A;  4YTN B;  3AM9 A;  2H89 B;  1ROE A;  1UWM A;  4US9 A;  1XLP A;  5MPO A;  1GT8 A;  5GXG B;  2HTM E;  1GPX A;  2PVO D;  1FRD A;  2OHF A;  2PIA A;  2QIE B;  3AV8 A;  1JRO A;  4HRO A;  1DOX A;  1AWD A;  4YSY B;  3AE4 B;  5H92 C;  3W5V B;  3NVW A;  3ZYY X;  1FXA A;  1T3Q A;  1DOI A;  3HUI A;  1L0V B;  1ZUD 2;  1XLN A;  1YQ4 B;  1IUE A;  1N60 A;  1NVI D;  1KRH A;  1E10 A;  1J7A A;  2PVG C;  3AEC B;  4JWS C;  3SFE B;  1GTH A;  3FAH A;  1TKG A;  2MH7 A;  4C7Y A;  1QF6 A;  4YTM B;  2MJ3 A;  4IDI A;  2FBW B;  3VRB B;  3B9J A;  2WP9 B;  3AE8 B;  2WDQ B;  1QOB A;  1TJE A;  1NEN B;  3AED B;  1VLB A;  1XO3 A;  1CJE A;  4JX1 C;  1EWY C;  1SF0 A;  1FFV A;  3AE2 B;  1OFF A;  1XLO A;  4US8 A;  4ZHO A;  3AN1 A;  4WQM A;  1YJI A; 
#chains in the Genus database with same CATH topology
 5IA7 A;  1N61 A;  4C4V A;  1SBB B;  3Q6B A;  2JY6 A;  1F9J A;  2VZK D;  2KX0 A;  3ETR A;  3N32 A;  2KXJ A;  3TL5 A;  4G11 A;  3Q2A C;  1T5X D;  3BVZ A;  2W9N A;  3C8Y A;  3H8H A;  1J19 A;  3PRP B;  2AYO B;  1G6J A;  1DOY A;  2Y5P A;  2MCN B;  1FXI A;  1FRR A;  3FIL B;  1K52 A;  2N9P C;  4YSX B;  4IKG A;  1BML C;  1K53 A;  4ZDV A;  1WGK A;  3AEA B;  3P2B A;  5EE3 A;  2CJN A;  3ZLZ A;  1SGH A;  4K3B A;  3PTF C;  2WGS A;  2E3T A;  4A3O A;  2XK5 B;  2FNJ B;  4MM3 B;  5E6O A;  2IGG A;  1Z2M A;  2BKR B;  3DVN V;  1T0Q C;  2WXH A;  1UGM A;  1WJ6 A;  3NRZ A;  3RNB C;  3WAO A;  3JSV B;  4M8N A;  4W9G A;  3PGE A;  5DPS A;  3QWZ B;  2FCM A;  1ROE A;  4FJY A;  5E6J A;  4US9 A;  2GBJ A;  3Q8A A;  2QIE B;  3EFC A;  1V81 A;  5H92 C;  1P0R A;  1HA5 A;  2D2Q A;  2QEJ C;  4IG7 B;  1KRH A;  3ML9 A;  2ZCC A;  2C7N B;  3ZVV A;  1TKG A;  3KQ4 A;  4FUL A;  3AE8 B;  3R7Q A;  3U52 E;  2KAN A;  4PS3 A;  4HRS A;  3BWU D;  3Q8B A;  5EE1 A;  3PHX B;  2GBR A;  2JSV X;  2J52 A;  3RFZ B;  2IPK D;  3QQ8 B;  3SHQ A;  4MH0 E;  2E6X A;  3OJ4 B;  2JZP A;  2MEK A;  2LWP A;  4S17 A;  3RPF C;  3NVY A;  1EM7 A;  5BMI A;  4BVU C;  2B3A A;  2WXR A;  4JWU C;  1D5M C;  3B0A A;  1XLQ A;  2ZCB A;  1VZ6 A;  3Q8F A;  2LHD A;  3V3X A;  4B6W A;  4H2A A;  2KAJ A;  2YLM A;  3T3N A;  2I2Y A;  4MGK E;  3VH4 B;  4P6V F;  2WLB A;  1N5W A;  3ZXV A;  3SR6 A;  3MJ5 A;  4G0N B;  2K8B A;  2L76 A;  3B2F A;  2MRP A;  1Q0W B;  1SJH D;  1JQ4 A;  1ET9 A;  2SAK A;  4YWG G;  3HM3 A;  4WWO A;  2ZNV C;  4OZC A;  4BBN F;  1VDV A;  3KVF B;  4JQW C;  4MGI E;  1UWX A;  2XN9 C;  2M0X A;  4HCN B;  3U7Z A;  4GXB A;  3V6C B;  2REX A;  3URY A;  4II3 B;  4YSY B;  3AE4 B;  3ZYY X;  5DCN A;  1R4N I;  4J3O D;  1BT0 A;  3RNG C;  1VD2 A;  3EC8 A;  2V4L A;  4MM3 A;  1QIL A;  3A1Q A;  3VTW A;  5TSS A;  2WXK A;  1P7F A;  1N6Z A;  2C9W B;  2N7D A;  2BB6 A;  4HJK A;  3KLS X;  2HJ1 A;  3BIN A;  2ZVO A;  4DXG A;  1M4V A;  3PVL A;  1YQ3 B;  2RPV A;  2GB1 A;  2WXQ A;  1ZXH A;  3Q3N C;  3NS8 A;  2DAF A;  1TTN A;  5HKH A;  3Q8C A;  4BKS A;  4YTP B;  3PRZ A;  4HKZ E;  3R66 C;  1GTE A;  4OHJ A;  1DGJ A;  1QOA A;  3KH0 A;  2WQY B;  1TY0 A;  3CMM B;  3DWG C;  2AQ1 B;  2M4N A;  3GP7 A;  1KTK A;  1TS2 A;  1UH6 A;  2GMI C;  2HJ8 A;  1LXD A;  1C4C A;  3GS2 A;  1IGD A;  1L5P A;  1XXG A;  4EZL A;  4YL8 A;  3GB1 A;  1VZ8 A;  4I6P A;  1XCT L;  4I6N B;  2J4X A;  2KMM A;  3MP9 A;  3VVW B;  2IO2 B;  2WU2 B;  4EZK A;  1WJU A;  2INC C;  3D32 A;  1I4P A;  2VZK B;  3U8Z A;  2BYT A;  4FA6 A;  1PUT A;  4OVU A;  4TQ1 A;  2B76 B;  1YQB A;  2PKO A;  3V60 A;  1PGX A;  1STE A;  2KT7 A;  2LGS A;  2NCN A;  1GOZ A;  2RDG A;  4A6Q A;  4J6I A;  1WJN A;  3QCA A;  3QIJ A;  4DBG A;  2OHF A;  4ZRK A;  1T3Q A;  4ANX A;  2KLC A;  2MJ3 A;  4KSL C;  3ZJT A;  2QDF A;  4TSS A;  3AED B;  4HKQ A;  1FFV A;  1B1Z A;  2KDF B;  2J0J A;  4LJP B;  2DHZ A;  3QHT A;  3HRD D;  4C56 C;  1IP9 A;  2RSU A;  4AJW A;  2BS3 B;  3PZ7 A;  3ZUN A;  2KMA A;  4MDK E;  4NNJ B;  2M19 A;  4USA A;  1R4N B;  2L05 A;  1F52 A;  2BYF A;  3O13 A;  2MBQ A;  3V61 A;  2ZW1 A;  3A9K A;  2WS3 B;  1IYF A;  5E6N A;  4GB9 A;  1HEZ E;  2BS4 B;  4FXC A;  2XNA C;  2QC8 A;  3TJP A;  3A4R A;  1Y8R C;  1MG4 A;  3TIX A;  2DLB A;  3MJW A;  4BOS C;  3R2I A;  3IXS A;  4TMA B;  2N7J A;  3VHT C;  3L54 A;  1H7W A;  1XEE A;  2MJE A;  2IYD B;  4XC2 A;  4P1B C;  3VR9 B;  3NVZ A;  4IWQ A;  2JU6 X;  4CHK A;  3U4E G;  4N59 A;  3SFD B;  2LXC A;  2K3U A;  5CTR C;  3DBL I;  2BT6 A;  4PYU A;  1ZE3 D;  2JPH A;  2WX1 A;  1WM2 A;  5JH5 C;  3KW5 B;  1I4R A;  1ESF A;  3E9S A;  3MC9 A;  2M17 A;  4K7U A;  3K9P B;  3BK1 A;  4ANU A;  2I38 A;  3I63 C;  5BMH A;  2V0G A;  1YX6 B;  4A20 A;  1KJT A;  2PVO D;  4B9K A;  1BXT A;  2KWU B;  3NZU A;  1UGJ A;  3TEW A;  4TQ0 A;  1ZUD 2;  3MC0 B;  2BGF A;  4IWO A;  1FCC C;  2FBW B;  3PLU A;  4KIK A;  1UBQ A;  2D11 A;  4FAD A;  2YEP B;  5FKA C;  1A5R A;  1XLO A;  1WSP A;  2PJH A;  1U4A A;  2L0F A;  2ACZ B;  4KGT A;  5G5H A;  4PYZ A;  1AYF A;  4KZ0 A;  5T8I A;  1WRI A;  1XQQ A;  3X23 A;  2JRH A;  2CU3 A;  3EUB 2;  1A70 A;  1GG3 A;  4ZRQ A;  2AQ2 B;  1T0S C;  1FIQ A;  1WWT A;  3CSF A;  1UD7 A;  1GJZ A;  2K1F A;  3R3M A;  3VQI A;  2CKH B;  5C3J B;  2ZPY A;  4K3C A;  3N3K B;  2EMS A;  4YT0 B;  1HZ6 A;  2FCS A;  2KDI A;  4W9F A;  1C4P A;  2N9E B;  4HVB A;  4FHJ A;  4N58 A;  3A9J B;  1PYW D;  1NI2 A;  3VTU A;  2O2V B;  1MG8 A;  4P16 A;  2N0S B;  2J0M A;  4YSZ B;  4NJ6 A;  1T0R C;  2N9K A;  1V5T A;  1H7X A;  5AEK B;  1LFD A;  2K6Q A;  1TT5 B;  2LD9 A;  2PTL A;  3NZS A;  1BUI C;  1GUA B;  3IT4 B;  1EU4 A;  1ZGU B;  3RYT A;  4XWW A;  2KVZ A;  3AXC A;  4OVZ A;  3QJZ A;  1K50 A;  1CQV A;  4XYC A;  1FCL A;  5MPO A;  2G3Q B;  3W5V B;  4K1R B;  3J9C A;  2WNM A;  2BQQ A;  1R4M B;  2KN4 A;  2M0A A;  2A4Z A;  4RGM A;  2JZ3 B;  4DHZ E;  3IT6 B;  1JWU D;  1Q5W B;  2INN E;  2EEL A;  3VRB B;  1F2R I;  2TSS A;  1Z5S B;  3I3T B;  1XO3 A;  1D3Z A;  3PT2 B;  2V3S A;  4ZHO A;  4BKT A;  5IO9 A;  4IM0 A;  4IC7 B;  2DAJ A;  2KJ6 A;  4R3D A;  4EKU A;  4CO7 A;  4ICV A;  2IBI B;  1GAQ B;  1RYJ A;  2D3G A;  1NYQ A;  2KFK A;  3DBR I;  1VJK A;  5L95 C;  1ZP0 B;  5LLI A;  3MFG A;  1I35 A;  1VCB A;  3NZ3 A;  4LNO A;  2W3S A;  3IAM 1;  2FIF A;  2HTH A;  3NJT A;  3N9Y C;  3UF8 A;  3PHW B;  3NVV A;  4C80 A;  2IO1 B;  2KK8 A;  2NVU I;  4G3X B;  4JGH B;  3QAQ A;  4S0R A;  2N4F A;  4ACF A;  2N9L A;  1B9R A;  5AUK A;  2C7M B;  1EWC A;  5CHF A;  1E7U A;  2PLP A;  1WI0 A;  1UZX B;  1VZ7 A;  3M3J A;  4MH8 A;  5HG2 A;  2L7R A;  4XGA B;  1J8C A;  4UDU C;  2BPS A;  4CYE A;  2MHJ A;  1MFW A;  4B0E A;  2ZEQ A;  2K8C A;  4DXF A;  5C23 A;  4P7I A;  2D10 A;  2Z8L A;  2IGH A;  2PPH A;  1TS3 A;  4HEA 1;  1FD6 A;  1KLG D;  3PRM B;  3ZXR A;  5JHB A;  2XBB C;  1SIF A;  1FM0 D;  5D7G A;  2W54 A;  1TZO A;  2V4I B;  4RMA A;  2DZK A;  2LI5 A;  2VRR B;  1DOI A;  4AOF A;  3DHI C;  2D07 B;  2EKE C;  4RNA A;  2KC1 A;  1YMH E;  3Q3M C;  2GRI A;  3NUH B;  4N9F 4;  1V1P B;  1ISN A;  1CJE A;  2KC2 A;  2K0P A;  3O65 B;  5IAA C;  2V9H A;  3R7R A;  2KQ4 X;  3HK0 A;  1E8Z A;  3DVN U;  1WGD A;  1FMA D;  3IBE A;  2G1E A;  4HDO A;  4LNK A;  4BAX A;  1RRB A;  5LNK 1;  4RM9 A;  2G4S A;  1SIJ A;  1WE6 A;  1ET6 A;  3ZTD A;  2W55 A;  2EMT A;  1XF5 L;  3M63 B;  3Q3O C;  2PE9 A;  5CHV C;  3HVZ A;  4O1N A;  2JT4 B;  3ML8 A;  2LRU A;  1V1P A;  4AJY B;  1SE2 A;  5TR5 A;  4NAM A;  3AE6 B;  2OED A;  4LJO B;  1F77 A;  3N1Z C;  5D2M B;  3ZJU A;  3DQV A;  2G45 B;  2L00 B;  3PRE A;  2G4D B;  2ZZP B;  2JVC A;  4NJC A;  3ZIM A;  2KQ7 A;  2JQR B;  5CX3 A;  4NJ7 A;  4REZ A;  4EZJ A;  3N20 C;  1ZDX A;  1P3Q U;  3AH7 A;  3WIM A;  2LVP A;  4ZHP A;  3VUY A;  4DDI D;  3AE1 B;  1WX8 A;  3GE8 C;  5HHD G;  4AUQ C;  3GE3 C;  1OQQ A;  2KAC A;  4FJZ A;  2YEP F;  2V3N A;  1T0Y A;  3NS1 A;  4HK2 A;  4OZB A;  3H7P B;  1RFA A;  1FNV A;  1I42 A;  3RT3 B;  1PDX A;  4ZOH C;  1C3T A;  1LO5 D;  5AUI A;  4ITK A;  2O6V B;  3DVG Y;  1UWM A;  2MP2 B;  4M8M A;  5IP4 D;  3RN9 C;  2ASQ A;  2DYM A;  2M8S A;  2PIA A;  2Y3A A;  3VDZ A;  3MTN B;  4F8C B;  1L0V B;  2KX3 A;  3DBR B;  1V2Y A;  4BZA A;  5FK9 C;  5DPR A;  4WIP A;  1K51 A;  3AEC B;  3SFE B;  5AZH A;  1I4H A;  4IDI A;  1YN3 A;  3W1Y A;  2GBK A;  4LDT D;  5J2R A;  3OWE B;  3BYT B;  4JX1 C;  2LXA A;  3H7S A;  1MVK A;  1MI0 A;  3LDZ E;  2GBM A;  3LJ3 A;  2NS5 A;  3AB5 A;  1C78 A;  1SE4 A;  4ZRI A;  3VTV A;  3DVG X;  3V6E B;  1YNT E;  3OAW A;  3I9V 1;  2GBN A;  1E9M A;  4RH6 A;  2WXL A;  3EFU A;  2WDV B;  4RFB A;  1NI3 A;  2K5P A;  2K9X A;  3Q3F A;  4KKI A;  2K22 A;  2XK5 A;  1SE9 A;  1HXY D;  4MGZ E;  1TKE A;  3N30 A;  1LQB A;  3KUD B;  3MHZ A;  3N1X C;  3LYY A;  1WXV A;  3BVG A;  1V5O A;  3WAN A;  4A9A A;  4YXD B;  4N6E B;  4GOC A;  2MBB B;  3GZN I;  1DYQ A;  3RCZ A;  2MBH A;  2FUG 1;  3TUO A;  3KWL A;  1C76 A;  2FCQ A;  2KLG A;  1UBI A;  5FR6 A;  2BWF A;  3RD2 A;  1Q10 A;  1EF1 A;  3EGR A;  3GOE A;  2HE7 A;  2CJO A;  2BBC A;  1K8R B;  1WJ4 A;  2D3A A;  2PEA A;  2WXF A;  2RPQ A;  3RUI B;  2KN5 A;  1SXT A;  1V49 A;  1NEK B;  4P1C C;  1LM8 B;  2K8H A;  2AQ3 B;  3AM9 A;  2KMC A;  4WWP A;  5GXG B;  4M02 A;  1P7E A;  2LJ5 A;  4K7W A;  3T8M A;  3VUX A;  2CS4 A;  4FLH A;  1VR9 A;  2PVG C;  4KGS A;  3RNA C;  3DHH C;  2KTR B;  1NEN B;  4ASW C;  4LK0 M;  3H7P A;  1QZE A;  3Q69 A;  4ICU A;  1D5X C;  3RMK C;  5CHW A;  1D5Z C;  5LXH A;  2C60 A;  2MJD A;  1ZOY B;  1UEL A;  2O6V A;  3CF6 E;  4ZRP A;  1EU3 A;  4GDL B;  3AE3 B;  4GMV A;  1WRD B;  1L4D B;  4AP4 C;  4PK1 A;  2AL3 A;  1E90 A;  3B2G A;  1YN4 A;  1E7V A;  1Q1O A;  4KIK B;  1MPE A;  2CR5 A;  1ZPS A;  2WXN A;  5C2T B;  3L4P A;  4JLC A;  3RNE C;  1KF6 B;  2J7Q B;  1E0Z A;  2L83 A;  2EKI A;  1OQY A;  1MHH E;  2LRW A;  1TY2 A;  3PPA A;  4Q2J A;  1SJE D;  1WR6 E;  4HPL B;  1V8C A;  4JE3 B;  1YN5 A;  4W9I A;  5BYR A;  3DDC B;  4EFO A;  2LAS A;  3RNC C;  3DWM A;  4A90 A;  3QX1 A;  4IUM B;  3L10 B;  3NOB A;  1JWA D;  3P1M A;  4NAW B;  4HJG E;  4DQO C;  2Q5W D;  2AEH A;  2LGI A;  4FJV B;  1PFD A;  2MW5 A;  2JX5 A;  3W5U B;  4ARC A;  4YTN B;  1HZ5 A;  1FPY A;  5G55 A;  2HTM E;  5DPW A;  3Q8E A;  2BYE A;  2WXJ A;  3APD A;  1PQS A;  1HTQ A;  1IUE A;  4HLE A;  1SEB D;  2NTT A;  4BFR A;  2MH7 A;  1WIA A;  1CK1 A;  2QHO A;  4YTM B;  4D2K A;  5I4D A;  2IZV B;  1WH3 A;  3DCG A;  4WJQ A;  1SF0 A;  2AL6 A;  3AE2 B;  2LGX A;  3C19 A;  2L8J A;  3UIP B;  1L0Y B;  1ZW7 A;  3L0W B;  2LJI A;  3M62 B;  4NY0 A;  4GU2 A;  2RR9 A;  2KJH B;  3PZ8 A;  1C77 A;  1NDD A;  1I4X A;  1L7Y A;  3LB8 C;  1N63 A;  1ENF A;  2BWE S;  1WXA A;  4C7Z A;  2R2Q A;  3BZD B;  4DDG D;  2WHI A;  3KYD D;  1KH0 A;  1QQR A;  3V05 A;  3ZGZ A;  4W9D A;  3W9C B;  3FC4 A;  1RLF A;  3UIO B;  3JVZ X;  2BF8 B;  2RMM A;  3HM6 X;  1V1O A;  5EE0 A;  1V80 A;  1L6U A;  3P4P B;  1P9D U;  2ZVN A;  3ZKJ C;  2MA9 B;  1L2N A;  2KFK B;  4F7Z A;  2LGY A;  1WR1 A;  3VH3 B;  4URK A;  1JWB D;  5EDS A;  4LNI A;  1JWM D;  4XE0 A;  3EA6 A;  1WXQ A;  1X1M A;  3UGB B;  2W82 A;  2Y5C A;  2L52 A;  3OJ3 A;  1TZ1 A;  2KDE B;  1SB3 C;  1J7C A;  4GLS C;  1FNU A;  3ZRF A;  3X0W A;  1GNU A;  2X38 A;  1F0Z A;  2C5L C;  5KHO A;  2DZI A;  4G50 A;  1FRD A;  1GC6 A;  3ZW3 A;  3TEY A;  2OOB B;  3E56 A;  3JYU A;  2Z0E B;  3IFW B;  4XZ4 A;  4NAW A;  2KWD A;  2ZW0 A;  4BBN C;  1JML A;  2WDT B;  1NVI D;  3NHE B;  2VH1 A;  3VXW A;  1WGR A;  2BB5 A;  5BO4 B;  2OJR A;  3A4S C;  1QOB A;  5BYS A;  2JXT A;  1AW7 A;  1OEY J;  4MAC A;  4ZRJ A;  1IBX A;  2KHW B;  2MQJ A;  4GDL A;  2ZJD A;  3U2S C;  2KKC A;  4RCO A;  1WXM A;  3CWI A;  5D94 A;  3BII D;  3LXF A;  4W9E A;  3CF4 A;  4QAY A;  1E8X A;  1I7H A;  2I1J A;  2MP2 A;  1FFU A;  2BYV E;  5FR3 A;  1N62 A;  5J17 A;  2AX5 A;  2KWC A;  1L6V A;  2KNB A;  3AU5 A;  3U30 A;  3H6N A;  1WY8 A;  2D3C A;  2KVR A;  4C00 A;  3AUL A;  2ICI A;  4L23 A;  1ZXI A;  4E3C A;  4WJN A;  3TMP B;  3NG0 A;  1HTO A;  2RDB C;  1F2R C;  2PW9 A;  1P1A A;  2BVC A;  2NBV B;  1S1Q B;  3NY5 A;  2LUM A;  3I5J C;  5D3D A;  2LMC A;  4KZC A;  3VAW A;  1QKZ A;  1IBX B;  2IO0 B;  3VUW A;  4W9C A;  2MBO A;  1KOT A;  1IGC A;  1JRP A;  3K9O B;  3BK2 A;  1H8C A;  3CIR B;  1WXS A;  3AEB B;  4M0W A;  1YJJ A;  3UIN B;  4AQ7 A;  2DNF A;  2DBY A;  5D6J B;  4MJS B;  2G9H D;  1TGZ B;  3FKY A;  4ANV A;  2UU7 A;  5HFY A;  1Y56 A;  2QIL A;  5JHA A;  4ANW A;  1I4G A;  1XLN A;  1YQ4 B;  3WAP A;  4XWT A;  1E10 A;  4XX5 A;  2C7H A;  3PLV A;  4I6L B;  3B1L X;  2N1V A;  5JXV A;  1PGA A;  2ZNV B;  2ZPN A;  1YJI A;  2MLB A;  1FO4 A;  2K25 A;  4MT5 A;  4FN2 A;  3IG3 A;  2NBU A;  4L2Y A;  4W9J A;  1QLB B;  4MGY E;  3OLM D;  3Q3J A;  3MHS D;  4HDQ A;  4EE2 A;  3UI3 A;  2MSE D;  3P4S B;  3KYC D;  4F1S A;  3AE9 B;  3QC8 B;  1TS4 A;  2UYZ B;  5C1Z A;  2QSD A;  1WYG A;  1S3S G;  1WZ0 A;  2W3R A;  3AI5 A;  2KD0 A;  4FBJ B;  3A9J A;  2XEW A;  2GI9 A;  3C0R B;  5IOI A;  2KQS A;  4NZL B;  4ZYN A;  2FUH B;  4M00 A;  2PMV A;  1PGB A;  1T6B X;  4KGR A;  3PO0 A;  5JZE B;  4NQL B;  2FID A;  1ZKH A;  2LHE A;  2LVQ A;  5GMV A;  1WGH A;  3PSE B;  1TBE A;  2Z0D B;  5IN7 A;  5D3I B;  1WE7 A;  3WCQ A;  2IJ0 A;  1C79 A;  2BKF A;  1RM6 C;  4PS7 A;  4LLG M;  3TBL D;  3ZNH B;  4L1B A;  1OGW A;  2KJR A;  2L1A A;  4KSK C;  4NPN A;  5BMG A;  2Y5B B;  3RI7 C;  2DX5 B;  2BTE A;  2IGD A;  2K39 A;  4HXD A;  1YOV B;  4WUR A;  1YJ1 A;  2JXX A;  2V1Y A;  1GPX A;  3NVW A;  3TEX A;  1FXA A;  4JPS A;  3QAR A;  2JRI B;  1J7A A;  4OW0 A;  3FAH A;  3AU4 A;  1M94 A;  3OG5 A;  3M95 A;  3IHP C;  4B0M A;  2O6V D;  2WX0 A;  4BKG A;  2QCZ A;  3TSS A;  4DHJ D;  2LEK A;  4BOZ B;  1VRA B;  1GB1 A;  3KUC B;  3SDL C;  2N7E A;  2M1M A;  4EUT A;  2IY1 B;  2NPT A;  2JUO A;  4W9L A;  4HCP B;  4M0W B;  4WJP A;  2WXG A;  2DYO A;  3SU8 X;  1E8Y A;  3ALB A;  3DPD A;  2IO3 B;  1V86 A;  1WFY A;  2WXO A;  2O2V A;  4MSM B;  2LZ6 A;  4EEW A;  2ONQ A;  1UUP A;  4II2 B;  3AMZ A;  2IND C;  1NBF C;  4WWN A;  1V6E A;  2NR2 A;  2KWV B;  2L32 A;  3ABV B;  4NQK E;  2IDY A;  1WF9 A;  3AEG B;  2FE8 A;  2QMT A;  2LUE A;  1YX5 B;  2WWZ A;  1UNS A;  5G5G A;  4C4V B;  1JWS D;  4OVV A;  3EHV A;  2Z59 B;  3IVF A;  3BVM A;  4RM8 A;  1TS5 A;  3H1U A;  3ZO5 B;  4HPM B;  4GDK A;  4HWI B;  4ARI A;  3ZQ4 A;  1JAL A;  1OQR A;  4KX6 B;  4LTU A;  2A5U A;  3HVD A;  2DYB A;  4IM3 A;  2LVO A;  1ZDV A;  3WAM A;  4WJO A;  3A33 B;  3DBL B;  3VFK A;  1JCK B;  3V62 A;  3UQB A;  1D6E C;  3P42 A;  4LNF A;  1UF0 A;  4JWS C;  4TKN A;  3SD5 A;  1GC7 A;  1WMH A;  2BW2 A;  3ZNZ B;  1R4M I;  3DHG C;  3DOW A;  2OJW A;  4AS1 A;  4IWP A;  4WQM A;  1AN8 A;  2AWT A;  1R7S A;  2JWZ A;  3VRA B;  2NPT B;  4KVG B;  2RDH A;  5BYQ A;  1JW9 D;  4M01 A;  4MEL A;  1RAX A;  2WXM A;  3P63 A;  3BYY B;  4KKJ A;  1YIW A;  3R8B A;  3WAL A;  2WYQ A;  2JYT A;  2GOW A;  2MWS B;  1E7P B;  2CHW A;  3QK0 A;  3DBH I;  3I57 A;  1EF5 A;  4AWJ A;  5EE9 A;  1RFK A;  4GSW A;  3RZF A;  4A8X C;  4DHZ B;  3L08 A;  1FXT B;  5HI1 A;  4K7S A;  2J0K A;  2R2O A;  2JYE A;  1QOF A;  5H8Y E;  3PS6 A;  1WGG A;  1TIF A;  3ZDT A;  4GDK B;  4K81 A;  3APF A;  2RGF A;  5J18 A;  4RF0 A;  3ZRC A;  4HPP A;  1E6E B;  4KV2 A;  1KLV A;  3A1Q B;  2N9X A;  3DBH B;  4MEM A;  3JW0 X;  4RGT A;  1J7B A;  1KLU D;  4GN1 A;  1C1Y B;  4IM2 A;  3WA0 A;  2H89 B;  2I1K A;  2NBW B;  4PS8 A;  2L0T A;  1GT8 A;  1OTR B;  2KFJ A;  5AZF A;  3AV8 A;  3MC8 A;  4XDC A;  1AWD A;  2INP E;  3ZNI D;  3HUI A;  5AZG A;  1N60 A;  1ACC A;  3SEB A;  4DHJ B;  3JSV A;  2WP9 B;  3RZW C;  1XD3 B;  1EO6 A;  1VLB A;  4DK5 A;  1EWY C;  1OFF A;  4XDD A;  4US8 A;  2WXI A;  3AN1 A;  4WH4 A;  4CQN A;  3QA8 A;  2DWQ A;  2LFI A;  3ZNG C;  3KUZ A;  1TYG B;  2RD0 A;  4DWF A;  1IPG A;  1HE8 A;  4MJS A;  4IOI E;  4KDL B;  1I4Q A;  1JRU A;  2PE6 B;  3TEZ A;  3L16 A;  4TUU A;  5KHQ A;  4WAF A;  3L13 A;  2BS2 B;  3AEF B;  3HHM A;  4WQO B;  1WMH B;  2SEB D;  3Q14 C;  3AE7 B;  1YD8 U;  1QOG A;  1TKY A;  1WYW B;  3ZJV A;  4LDT B;  1OEY A;  2CHZ A;  2DZJ A;  1WGY A;  2MX2 A;  1SSN A;  4E71 A;  1H4R A;  3P4Q B;  4GIV A;  1RWS A;  2LGD A;  3EEC A;  3T9L A;  1NYR A;  3FIL A;  4JL9 A;  4GGQ A;  2FAZ A;  1N5X A;  2D3B A;  1V97 A;  3BY4 B;  3IAS 1;  1FEH A;  1XT9 B;  2QJL A;  2YVC A;  1FNW A;  2M56 B;  3PV1 A;  1QT9 A;  2KDB A;  2N1W A;  4W9K A;  2CHX A;  4RGN A;  1XLP A;  2KOX A;  4A3P A;  4BKS D;  1JRO A;  1DOX A;  1MHX A;  1WM3 A;  3ONS A;  3ZDM C;  3DBS A;  1GTH A;  3UQA A;  1V9J A;  3KWV A;  1L4Z B;  4C7Y A;  2R61 A;  2KO3 A;  3CST A;  3B9J A;  4DXA B;  2WDQ B;  3N1Y C;  4KDI C;  3W2D A;  3T3O A;  4PT5 A;  4FHK A;  2UWQ A;  3PZD A;  2J42 A;  4LNN A;  1P98 A;  3U7D A;  4RF1 A;  1XCQ L;  2JF5 A;  3TCA A;  1LGR A;  4MSQ B;  3AEE B;  4JIO U;  1WZ3 A;  3VR8 B;  3AE5 B;  4A55 A;  3ENE A;  2ON8 A;  3HIZ A;  4WWM A;  3A9K B;  1WX9 A;  1KFY B;  1SE3 A;  4WAA A;  1CZP A;  3H9D A;  4TV3 A;  1D4B A;  3P4R B;  2H88 B;  2JZZ A;  1EUV B;  2WU5 B;  3RNF C;  2WDR B;  5DPT A;  1HQR D;  2NMQ A;  1C4A A;  2CU1 A;  2DZM A;  4E74 A;  2DEN B;  3ZTC A;  2WXP A;  4LCD E;  1AAR A;  1GB4 A;  3ECI A;  2IY0 B;  4OZA A;  5IKC M;  2NTS A;  3GZN B;  3L17 A;  4RGO S;  4X57 B;  1F1H A;  4W9H A;  1KM7 A;  4ZYS A;  3S2A A;  2KTR A;  1E8W A;  2HDE A;  5E6P A;  2L3Z A;  2JWU A;  1L0X B;  2FCN A;  3W1S C;  5L83 A;  3APC A;  2MBE A;  1WX7 A;  3B08 A;  1C9F A;  2VH2 A;  4HRO A;  2KTF A;  2KDM A;  2HD5 B;  3RUL A;  4B95 A;  4EOY A;  2V3P A;  2K6D B;  5LXI B;  1QF6 A;  2KYW A;  1E5W A;  2J53 A;  1MJD A;  2KZR A;  3W1S A;  1CMX B;  2X8X X;  3R2T A;  1TJE A;  2D5G A;  4IW0 A;  5G2N A;  2GLS A;  1J0G A; 
#chains in the Genus database with same CATH homology
 1D5X C;  1D5Z C;  3TSS A;  2ACZ B;  4KGT A;  5G5H A;  1N61 A;  2MJD A;  1AYF A;  1ZOY B;  2LEK A;  1VRA B;  1SBB B;  1GB1 A;  2VZK D;  5T8I A;  4ZRP A;  1EU3 A;  3ETR A;  4GDL B;  3AE3 B;  1T5X D;  3BVZ A;  1WRI A;  1L4D B;  3C8Y A;  2WXG A;  3H8H A;  2DYO A;  2CU3 A;  3EUB 2;  3B2G A;  1DOY A;  1YN4 A;  1A70 A;  2Y5P A;  2WXO A;  4ZRQ A;  1MPE A;  2AQ2 B;  1FXI A;  1FIQ A;  1WWT A;  1FRR A;  3FIL B;  1ZPS A;  2WXN A;  1K52 A;  2ONQ A;  1UUP A;  5C2T B;  5C3J B;  3VQI A;  3L4P A;  4YSX B;  3AMZ A;  4IKG A;  1BML C;  4YT0 B;  1K53 A;  2L32 A;  3ABV B;  1HZ6 A;  1KF6 B;  1WGK A;  2IDY A;  2L83 A;  2EKI A;  3AEA B;  3AEG B;  1E0Z A;  2FE8 A;  1MHH E;  1C4P A;  5EE3 A;  1TY2 A;  2CJN A;  4Q2J A;  4N58 A;  1SJE D;  2QMT A;  4JE3 B;  1V8C A;  1PYW D;  1YN5 A;  1UNS A;  5BYR A;  2E3T A;  4P16 A;  5G5G A;  1JWS D;  2N0S B;  4YSZ B;  4MM3 B;  3DWM A;  2IGG A;  4A90 A;  2N9K A;  3BVM A;  1H7X A;  1JWA D;  3P1M A;  4NAW B;  4HJG E;  4DQO C;  1TS5 A;  2WXH A;  2Q5W D;  2LGI A;  4ARI A;  3ZQ4 A;  3NRZ A;  2PTL A;  1PFD A;  1BUI C;  1JAL A;  1OQR A;  2JX5 A;  4KX6 B;  3W5U B;  3IT4 B;  4LTU A;  1EU4 A;  3HVD A;  4XWW A;  4ARC A;  4YTN B;  1HZ5 A;  4OVZ A;  1ZDV A;  1K50 A;  1ROE A;  1CQV A;  5E6J A;  4US9 A;  1FCL A;  5MPO A;  2HTM E;  3Q8A A;  2QIE B;  1JCK B;  3W5V B;  3Q8E A;  5H92 C;  3J9C A;  2WXJ A;  1HA5 A;  2WNM A;  2KN4 A;  2QEJ C;  1D6E C;  1IUE A;  3P42 A;  1KRH A;  2M0A A;  1SEB D;  2NTT A;  4JWS C;  4RGM A;  1TKG A;  2MH7 A;  3IT6 B;  1CK1 A;  1JWU D;  4YTM B;  2INN E;  2EEL A;  3KQ4 A;  4D2K A;  5I4D A;  3VRB B;  1F2R I;  2TSS A;  3AE8 B;  2BW2 A;  1XO3 A;  1SF0 A;  3AE2 B;  3U52 E;  4ZHO A;  4AS1 A;  4WQM A;  1L0Y B;  4HRS A;  3BWU D;  3Q8B A;  2LJI A;  1AN8 A;  5EE1 A;  1R7S A;  3VRA B;  2JSV X;  4R3D A;  2J52 A;  3PZ8 A;  2RDH A;  5BYQ A;  1GAQ B;  1JW9 D;  1RYJ A;  3RFZ B;  1NYQ A;  1C77 A;  1VJK A;  2IPK D;  1ZP0 B;  1I4X A;  2WXM A;  3LB8 C;  2E6X A;  3BYY B;  3P63 A;  1N63 A;  4KKJ A;  1ENF A;  3MFG A;  2JZP A;  3NZ3 A;  2MEK A;  4C7Z A;  3BZD B;  2W3S A;  3RPF C;  3IAM 1;  3NVY A;  3R8B A;  1EM7 A;  1KH0 A;  5BMI A;  1QQR A;  2JYT A;  3N9Y C;  3V05 A;  3NVV A;  2WXR A;  4JWU C;  4C80 A;  3ZGZ A;  1D5M C;  3W9C B;  3FC4 A;  1XLQ A;  1E7P B;  1VZ6 A;  3Q8F A;  2N9L A;  2LHD A;  3V3X A;  4H2A A;  1B9R A;  5AUK A;  1EWC A;  2KAJ A;  3T3N A;  2RMM A;  2PLP A;  3I57 A;  2I2Y A;  5EE0 A;  1V1O A;  1VZ7 A;  4MH8 A;  5HG2 A;  1L6U A;  3P4P B;  4P6V F;  5EE9 A;  2WLB A;  1RFK A;  4A8X C;  4UDU C;  1N5W A;  5HI1 A;  3SR6 A;  3MJ5 A;  2JYE A;  1JWB D;  1QOF A;  3B2F A;  4XE0 A;  1JWM D;  4B0E A;  3EA6 A;  5H8Y E;  1WXQ A;  2W82 A;  1SJH D;  1JQ4 A;  1ET9 A;  2SAK A;  4GDK B;  2Y5C A;  4YWG G;  2L52 A;  4DXF A;  4RF0 A;  1SB3 C;  2Z8L A;  2IGH A;  4OZC A;  1J7C A;  1E6E B;  1TS3 A;  1VDV A;  4HEA 1;  1UWX A;  2XN9 C;  1FD6 A;  4GLS C;  1KLG D;  1FNU A;  3U7Z A;  4RGT A;  1J7B A;  2X38 A;  1F0Z A;  1FM0 D;  1KLU D;  5D7G A;  2W54 A;  1TZO A;  2H89 B;  3URY A;  2V4I B;  1GT8 A;  1FRD A;  3AV8 A;  3TEY A;  3E56 A;  4XDC A;  1AWD A;  4YSY B;  3AE4 B;  3ZYY X;  2INP E;  1DOI A;  3HUI A;  4J3O D;  2KWD A;  2ZW0 A;  1JML A;  1N60 A;  1NVI D;  1ACC A;  3SEB A;  4RNA A;  1QIL A;  1YMH E;  2BB5 A;  5TSS A;  2WP9 B;  2GRI A;  1QOB A;  2WXK A;  3NUH B;  5BYS A;  1V1P B;  1P7F A;  1VLB A;  1CJE A;  2JXT A;  2K0P A;  1EWY C;  1AW7 A;  1OFF A;  2BB6 A;  4XDD A;  4US8 A;  2WXI A;  3AN1 A;  3KLS X;  4MAC A;  4WH4 A;  4CQN A;  1IBX A;  2KQ4 X;  2DWQ A;  2LFI A;  1M4V A;  4DXG A;  1YQ3 B;  1FMA D;  2GB1 A;  2RPV A;  2WXQ A;  1ZXH A;  3U2S C;  2G1E A;  1TYG B;  4RCO A;  5LNK 1;  3CWI A;  3Q8C A;  1SIJ A;  4IOI E;  1ET6 A;  3BII D;  1I4Q A;  3LXF A;  4YTP B;  2W55 A;  3CF4 A;  4HKZ E;  1GTE A;  4OHJ A;  1XF5 L;  1DGJ A;  1QOA A;  2WQY B;  1I7H A;  1TY0 A;  3TEZ A;  3HVZ A;  4O1N A;  3DWG C;  2AQ1 B;  3GP7 A;  1KTK A;  1FFU A;  1TS2 A;  4WAF A;  5FR3 A;  1V1P A;  2BS2 B;  3AEF B;  1N62 A;  2AX5 A;  1SE2 A;  1L6V A;  2SEB D;  4NAM A;  1C4C A;  3GS2 A;  3AE6 B;  2OED A;  3AE7 B;  1IGD A;  1QOG A;  1L5P A;  1XXG A;  1F77 A;  1TKY A;  3GB1 A;  3ZJV A;  1VZ8 A;  3ZJU A;  1XCT L;  1SSN A;  2ICI A;  4L23 A;  2J4X A;  1ZXI A;  2KMM A;  3MP9 A;  3P4Q B;  1RWS A;  4NJC A;  2WU2 B;  1F2R C;  2PW9 A;  2JQR B;  4REZ A;  1NYR A;  1ZDX A;  3FIL A;  2LUM A;  3AH7 A;  4ZHP A;  5D3D A;  3AE1 B;  2LMC A;  5HHD G;  1QKZ A;  1N5X A;  1I4P A;  1OQQ A;  2KAC A;  1IBX B;  1V97 A;  2YEP F;  2V3N A;  2VZK B;  2BYT A;  1IGC A;  1PUT A;  3IAS 1;  1JRP A;  3NS1 A;  4OZB A;  3BK2 A;  1FEH A;  1FNV A;  4TQ1 A;  3CIR B;  2B76 B;  1PDX A;  3AEB B;  4M0W A;  4ZOH C;  1YJJ A;  1LO5 D;  4AQ7 A;  2PKO A;  2QJL A;  1FNW A;  2M56 B;  1PGX A;  2DBY A;  1STE A;  5AUI A;  4ITK A;  1QT9 A;  1GOZ A;  2RDG A;  4A6Q A;  1UWM A;  4RGN A;  1XLP A;  2G9H D;  2DYM A;  2OHF A;  2PIA A;  1JRO A;  1DOX A;  5HFY A;  2Y3A A;  1T3Q A;  1Y56 A;  2QIL A;  1L0V B;  1I4G A;  1MHX A;  5FK9 C;  1XLN A;  1YQ4 B;  4WIP A;  4XWT A;  1K51 A;  1E10 A;  3AEC B;  3SFE B;  1GTH A;  3KWV A;  1L4Z B;  4C7Y A;  2R61 A;  2MJ3 A;  1I4H A;  4IDI A;  3ZJT A;  3B9J A;  1YN3 A;  2WDQ B;  4TSS A;  3AED B;  3OWE B;  3BYT B;  4JX1 C;  5JXV A;  4HKQ A;  1FFV A;  1PGA A;  1B1Z A;  3W2D A;  1YJI A;  1MVK A;  3T3O A;  1MI0 A;  4PT5 A;  3HRD D;  4C56 C;  1FO4 A;  2BS3 B;  3AB5 A;  1C78 A;  2J42 A;  1SE4 A;  3PZ7 A;  4MT5 A;  1YNT E;  2M19 A;  4RF1 A;  3I9V 1;  4USA A;  1XCQ L;  4L2Y A;  1QLB B;  3O13 A;  3AEE B;  4EE2 A;  2ZW1 A;  3VR8 B;  3AE5 B;  1E9M A;  4RH6 A;  3UI3 A;  2WXL A;  4A55 A;  2WDV B;  2WS3 B;  2ON8 A;  3P4S B;  4RFB A;  4WWM A;  1NI3 A;  2K5P A;  3AE9 B;  1KFY B;  1HEZ E;  1TS4 A;  2BS4 B;  2K9X A;  1SE3 A;  4FXC A;  2XNA C;  2QSD A;  1CZP A;  4KKI A;  2K22 A;  1WYG A;  1HXY D;  1D4B A;  3P4R B;  1TKE A;  2H88 B;  2W3R A;  2DLB A;  2WU5 B;  3R2I A;  2WDR B;  3IXS A;  2GI9 A;  3MHZ A;  2N7J A;  4TMA B;  4NZL B;  1H7W A;  1XEE A;  2MJE A;  1HQR D;  2NMQ A;  3LYY A;  3VR9 B;  1C4A A;  2PMV A;  1PGB A;  3BVG A;  3NVZ A;  1T6B X;  2JU6 X;  4KGR A;  4YXD B;  4A9A A;  4N6E B;  3PO0 A;  3U4E G;  4N59 A;  2LHE A;  1DYQ A;  3SFD B;  2FUG 1;  2K3U A;  2WXP A;  3TUO A;  1C76 A;  3KWL A;  5D3I B;  1GB4 A;  3WCQ A;  2IJ0 A;  2BT6 A;  1C79 A;  1ZE3 D;  1Q10 A;  4OZA A;  2NTS A;  3EGR A;  1RM6 C;  4LLG M;  4RGO S;  1I4R A;  2CJO A;  4L1B A;  2BBC A;  1ESF A;  3E9S A;  4ZYS A;  2L1A A;  2WXF A;  5BMG A;  1SXT A;  1NEK B;  2HDE A;  2BTE A;  2IGD A;  3BK1 A;  2JWU A;  2I38 A;  1L0X B;  5BMH A;  2AQ3 B;  2V0G A;  4WUR A;  3AM9 A;  5GXG B;  1GPX A;  2PVO D;  1C9F A;  1BXT A;  4HRO A;  2KDM A;  1P7E A;  3NVW A;  3TEX A;  1FXA A;  1UGJ A;  3TEW A;  4TQ0 A;  4JPS A;  1ZUD 2;  3MC0 B;  2V3P A;  1J7A A;  1VR9 A;  2PVG C;  4KGS A;  4OW0 A;  3FAH A;  1QF6 A;  2J53 A;  3W1S A;  1FCC C;  2FBW B;  3R2T A;  1TJE A;  2D5G A;  1NEN B;  4LK0 M;  2YEP B;  5FKA C;  4B0M A;  1XLO A;  1WSP A;  3Q69 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...