3VR8B

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
249
structure length
249
Chain Sequence
KRIKTFEIYRFNPEEPGAKPKLQKFDVDLDKCGTMVLDALIKIKNEVDPTLTFRRSCREGICGSCAMNIAGENTLACICNIDQNTSKTTKIYPLPHMFVIKDLVPDMNLFYAQYASIQPWLQKKTKINLGEKQQYQSIKEQEKLDGLYECILCACCSASCPSYWWNADKYLGPAVLMQAYRWIIDSRDDSAAERLARMQDGFSAFKCHTIMNCTKTCPKHLNPARAIGEIKMLLTKMKTKPAPLPTPAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 57
structure length 249
sequence length 249
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13085 Fer2_3 2Fe-2S iron-sulfur cluster binding domain
B PF13534 Fer4_17 4Fe-4S dicluster domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1060.10 Mainly Alpha Orthogonal Bundle Fumarate Reductase Iron-sulfur Protein; Chain B, domain 2 Alpha-helical ferredoxin 3vr8B02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3vr8B01
3AEEB 2K9XA 1T3QA 2W3RA 1IUEA 1QOGA 1NEKB 2K22A 3AH7A 1V97A 3P1MA 3W9CB 3SFDB 1WRIA 2BS4B 1YQ3B 1FIQA 4HROA 4LTUA 3CIRB 4YTMB 2MH7A 1JQ4A 4US9A 1FXIA 3AV8A 1XO3A 4YT0B 3LB8C 2DWQA 4JWUC 2WU2B 4A9AA 2CU3A 1FMAD 4YTNB 1TYGB 2W3SA 2WQYB 3AE8B 1QOBA 1OQQA 2KAJA 2Y5CA 5C3JB 4IDIA 1VJKA 1GPXA 1TKYA 2WDVB 1WWTA 1KFYB 2N0SB 1QLBB 3L4PA 3AE5B 1GAQB 1E7PB 1FXAA 1RFKA 5EE1A 2CJOA 1NYRA 1SIJA 2W54A 3DWMA 1DOYA 5G5GA 1GT8A 1RM6C 2M19A 1FFVA 3CF4A 2DBYA 3B2GA 3VR8B 3AEAB 3AE1B 1TJEA 4ZHOA 1OQRA 1F0ZA 5AUKA 1YJJA 3AE4B 1ZUD2 1TKGA 3P63A 1FFUA 2FBWB 1CJEA 3FC4A 3AEBB 1GTEA 2QIEB 1H7WA 3NRZA 2L52A 1PUTA 1E6EB 2HTME 1RYJA 3KWLA 3VR9B 1E0ZA 4WWMA 4HRSA 4ZOHC 2B76B 1AYFA 1FRRA 2H88B 4YSZB 1ZOYB 1RWSA 1E9MA 1XLPA 1L5PA 3NVZA 1WYGA 2MJDA 3AEDB 1KRHA 3AEFB 1JALA 2PVGC 3DWGC 1QT9A 1NENB 5EE9A 2WP9B 2BT6A 1QF6A 1UWMA 1VDVA 1SB3C 1YQ4B 1DOXA 1N61A 3NS1A 2G1EA 1XLNA 1EWYC 5MPOA 3ETRA 3AMZA 1ROEA 1N60A 2H89B 5GXGB 1DOIA 3AE7B 2BS2B 4P6VF 1J7BA 3NVVA 1V8CA 3HVZA 3AEGB 3P4QB 2WU5B 3AE9B 4ZHPA 2MJ3A 2QJLA 1GTHA 1B9RA 2EKIA 2L83A 3VRBB 5H92C 2Q5WD 4N6EB 2LEKA 3NVWA 3VRAB 3AE6B 1OFFA 3B9JA 4YTPB 4US8A 5EE3A 1WXQA 2E3TA 1L0VB 4YXDB 1FRDA 3NVYA 5H8YE 1L6VA 2AX5A 1E10A 4YSYB 3AB5A 4USAA 3SR6A 1NYQA 2WS3B 1DGJA 1JWBD 4C7ZA 1H7XA 4WQMA 5EE0A 2PIAA 1TKEA 3ABVB 1FO4A 1JRPA 3BIID 3AM9A 1N5XA 4C80A 1AWDA 2JQRB 4FXCA 3WCQA 1NI3A 3AECB 1J7CA 3W5UB 5C2TB 3P4PB 3PO0A 2WDRB 4ITKA 1SF0A 1CZPA 3AE3B 5AUIA 1A70A 3AE2B 4N58A 1NVID 3P4RB 2PKOA 5G5HA 3W5VB 3HRDD 1N62A 1L6UA 1VLBA 3P4SB 1JROA 2MJEA 2PVOD 4JWSC 2JX5A 4N59A 1QOAA 3FAHA 3B2FA 3CWIA 4C7YA 1N5WA 1XLOA 3LXFA 2M56B 1WGKA 1JW9D 3AN1A 3EUB2 1ZXIA 3HUIA 1R7SA 1YJIA 2WLBA 4YSXB 1I7HA 3RPFC 1QOFA 2ACZB 3SFEB 2KMMA 1FM0D 2OHFA 1PDXA 1XLQA 2CJNA 1JWAD 1KF6B 2WDQB 1PFDA 1ZP0B 4KX6B 2K5PA 2BS3B 1J7AA 2W55A 1N63A 4JX1C 3ZYYX
chains in the Genus database with same CATH superfamily
5BO4B 3VTWA 1E8XA 3E56A 4BKSA 1MVKA 1YQ3B 2DHZA 4F1SA 1FXIA 2NMQA 3UGBB 4FADA 3OAWA 2Y3AA 2JWUA 2MW5A 1GAQB 2KACA 1RFKA 2W54A 3M62B 1WXMA 3B2GA 1D6EC 1YJJA 1UBQA 3AE4B 2M0XA 1K51A 2MP2B 2DAFA 1P1AA 1CJEA 1I42A 4G3XB 2KD0A 3X23A 3RUIB 3DWGC 4ICUA 1VDVA 1SB3C 1SIFA 1ZW7A 5GXGB 3GZNI 2BS2B 1V49A 4EEWA 2KTRB 1V8CA 2N4FA 2MBHA 2KLGA 4W9KA 3ZNHB 2J0JA 4RGOS 3ZJUA 4US8A 4YTPB 5HI1A 2JXTA 4W9DA 4II2B 4LDTB 2DYMA 4ANVA 3I5JC 2J42A 1UBIA 2K6QA 1TKEA 3L08A 4ARCA 2DZJA 3Q3OC 1AWDA 2JQRB 4FXCA 3WCQA 2VH1A 4DBGA 4WWNA 5C2TB 1SF0A 4MJSB 4P1CC 5G5HA 3ZDMC 1L6UA 3ZNGC 1JROA 3MC0B 3FAHA 4C7YA 1B1ZA 2MWSB 4KGSA 2CHZA 2GOWA 2WGSA 4WJOA 4GB9A 1TIFA 2C5LC 2A5UA 2MBQA 2KMMA 1WZ3A 4OZAA 2KOXA 2K5PA 5AEKB 1C3TA 4HCNB 3GE8C 4IOIE 3Q8AA 4GDLA 1T3QA 1IUEA 1ZDXA 1WX9A 1WF9A 5J2RA 1V6EA 2Z59B 4JWUC 4YWGG 1WGDA 4RF0A 2QHOA 1OQQA 1TS4A 5C3JB 3PLUA 2YEPB 3E9SA 1YMHE 2JYTA 4LNNA 3N20C 4M0WB 1GG3A 4TKNA 3BYTB 2WXFA 2YLMA 1PUTA 4ASWC 4FN2A 1E0ZA 4J3OD 2C7MB 1ZOYB 4KSLC 1MG4A 4II3B 1JALA 2ONQA 3DBLB 4YL8A 3D32A 1KLVA 2XN9C 1YQ4B 4K81A 1BXTA 1K52A 1WMHA 2BBCA 3AE9B 2LGXA 2OEDA 5JHBA 1GTHA 2LXAA 3EHVA 3A33B 4P1BC 1P7FA 1HEZE 4ARIA 4PS8A 2N7JA 4J6IA 1JWBD 2L32A 2KYWA 1H7XA 2RPQA 4NJCA 2V3PA 3W5UB 4I6LB 2NVUI 2WDTB 2I1JA 3VH3B 3AE2B 2N9XA 5BYRA 4NQLB 4TQ0A 1T0SC 3GS2A 2WLBA 1EU3A 1Q1OA 4FBJB 5CHFA 1ZPSA 2WXRA 2WHIA 4DXGA 1HXYD 1QOGA 2IZVB 2K22A 2O2VA 2EELA 5LNK1 3Q6BA 4OW0A 2LHDA 2BYFA 2IO0B 1FNUA 2MEKA 1FMAD 4UDUC 1ZGUB 3V60A 2N0SB 1UNSA 3APDA 3TJPA 4H2AA 4B0EA 2JU6X 2WXIA 1OQRA 2LGIA 1F52A 2M0AA 1R4NB 4JE3B 1YNTE 4K7WA 4MGYE 5D94A 4AJYB 3NVZA 1E9MA 1L5PA 3DOWA 2GI9A 3L10B 5EE9A 4BKGA 1NENB 5DPWA 1E7VA 4XYCA 1I4GA 1HZ5A 2PMVA 4ZRJA 2JT4B 5MPOA 4C00A 2FNJB 1PQSA 4NZLB 4W9IA 1JWSD 3HVZA 1V80A 2QJLA 4AUQC 4B9KA 2EKIA 3ZJVA 4W9HA 4FJYA 1FEHA 2E3TA 4YXDB 2AX5A 3BK2A 2MX2A 5BMHA 3R2TA 2LASA 3W1SC 1JRPA 4PS7A 3JVZX 2K8CA 5FR3A 2N9PC 3Q8FA 4ITKA 2CU1A 2L0TA 1T0RC 4DWFA 2FCSA 2FCNA 4ZRIA 1K53A 1VLBA 3HRDD 2PVOD 3RNBC 4A90A 1D4BA 3LXFA 3N3KB 3QIJA 4IWPA 3R2IA 1IP9A 3AU5A 1Q5WB 2QEJC 1YN4A 4EZLA 1MG8A 3QC8B 2G3QB 1YX5B 2GMIC 5D2MB 1FIQA 1L7YA 4KDLB 4GDKA 4KGTA 4DK5A 2W3SA 3AE8B 2WXPA 3A9KB 2WX0A 2FE8A 3A1QA 2KANA 1STEA 2IPKD 2M19A 1HTQA 1TZOA 1QZEA 4ANXA 3HVDA 4AJWA 2NS5A 5HHDG 2FUG1 1AYFA 3DVGX 2JYEA 2NBVB 2MLBA 4DHZE 4L23A 1C9FA 3PVLA 4BKSD 4M00A 1XXGA 5IN7A 1V81A 1C78A 1VCBA 1D5XC 3WA0A 5AZHA 3H8HA 3NVYA 3GZNB 3AXCA 3MFGA 4M02A 3VQIA 1TGZB 4LNIA 3GE3C 3GOEA 3QK0A 2KK8A 1VZ8A 2D07B 4MELA 1BMLC 4ICVA 2KO3A 3CMMB 3W1YA 4NQKE 2R61A 4EZJA 3T3NA 2SEBD 3VH4B 3ZXRA 4MACA 3ZUNA 3Q8CA 1IBXA 4B95A 4B6WA 1N5WA 4BBNC 3RI7C 2PEAA 3HUIA 1GNUA 3A4RA 4RFBA 1M4VA 3H7PA 3IAM1 3EGRA 4W9LA 4RM9A 1JWMD 2INNE 3VAWA 1WJUA 1SE3A 1WGHA 2MSED 4WWPA 4IG7B 3DBSA 1P7EA 3UIOB 3Q2AC 4HXDA 4XDCA 3W1SA 4BZAA 5G2NA 2LGSA 3ONSA 2HE7A 3WAPA 3FKYA 2WU2B 4A9AA 3PZ7A 2ZCBA 3Q8EA 4YTNB 2NTTA 2D2QA 3Q69A 4A6QA 1GJZA 5KHOA 1IGCA 4PT5A 3N30A 2C60A 2KDEB 2ZNVB 3AEAB 1F0ZA 4ANWA 1ZUD2 2J7QB 1HQRD 2FBWB 1E5WA 3NRZA 3BINA 3U7ZA 4A3PA 1WSPA 2H88B 4YSZB 4NNJB 2X38A 4XX5A 3T8MA 1V1PA 4F7ZA 1DOIA 1Q10A 4KV2A 3MTNB 3ZNZB 2RMMA 4PS3A 1I4PA 2WXNA 4HCPB 5BYSA 1F1HA 4EZKA 2LEKA 1TTNA 1A5RA 3IG3A 4WJQA 4HEA1 4ACFA 2DENB 1N5XA 4TV3A 3ZW3A 2WX1A 1ACCA 2WXHA 1NI3A 3AECB 3WALA 4K1RB 5LXIB 2DYBA 1C77A 4L2YA 3ZO5B 4FA6A 5LXHA 5JH5C 3J9CA 1JWUD 3DBHI 1TY2A 2BW2A 2JX5A 2OJRA 1QKZA 2ZVOA 1QQRA 2DAJA 1OEYJ 4OZCA 1MFWA 3H9DA 3R66C 1I7HA 3BZDB 2N9KA 2VRRB 2KFKA 3QQ8B 4BVUC 4LK0M 4OVZA 4W9EA 1SJED 3WIMA 4MM3B 1KOTA 1UF0A 3DBRI 3I9V1 3K9OB 2LD9A 2MCNB 3Q3NC 4JL9A 1RLFA 2AQ2B 2UYZB 4R3DA 1QLBB 3PT2B 4FHJA 2CJOA 1SIJA 1L0YB 2KWVB 1FFVA 1TT5B 3U2SC 4BBNF 2HJ8A 2O6VB 3SU8X 1TKGA 3JSVB 4OHJA 4KKIA 3Q14C 4LJPB 4MGKE 2RD0A 2LUMA 2DYOA 4LJOB 2V9HA 2QDFA 1GB1A 4XWWA 3ZRCA 2KHWB 4WWOA 4IUMB 1XF5L 2KWCA 2FCQA 1KLGD 4MDKE 1XEEA 2XK5A 1V5TA 1GOZA 1UGJA 2BGFA 4JIOU 1IGDA 3DPDA 5IP4D 2K25A 3ZNID 5EE3A 2UWQA 3BY4B 2BYEA 4EFOA 1NYQA 2V3NA 1WIAA 2Y5PA 2L8JA 2KDMA 3BIID 4DDGD 2RDHA 2KJ6A 4PK1A 4LCDE 3B1LX 4RGTA 1I4RA 5D3IB 5DCNA 2RR9A 5IAAC 3N32A 2WXOA 2GLSA 3P4SB 3HHMA 2UU7A 5D6JB 2M56B 3DHIC 3S2AA 4OVVA 3C8YA 4MGIE 1WMHB 3UI3A 1TS3A 2IGHA 2WDQB 2N9LA 3BVZA 3AH7A 3TIXA 1SBBB 2KC1A 4RF1A 3EA6A 4P16A 3LB8C 4D2KA 3V61A 1GPXA 2N7DA 4C4VA 3KVFB 3L4PA 2D5GA 5G5GA 1GT8A 3A9JA 4N9F4 4DXAB 2M4NA 2HTHA 3BVGA 1CK1A 5AUKA 1T0YA 1FFUA 1I35A 1GTEA 1WE6A 1E6EB 4ANUA 4RCOA 3RFZB 4E3CA 2KWUB 2MQJA 2D3BA 2IO3B 4GOCA 4NAWB 2INDC 2IJ0A 1D3ZA 3QA8A 2WP9B 4AQ7A 2IO1B 4HK2A 3UF8A 1Z2MA 3V6EB 3H7SA 3AEGB 2WU5B 2MJ3A 3NVWA 1EM7A 2I38A 5T8IA 2V4IB 2CKHB 1JRUA 1TZ1A 1KLUD 3TEXA 3Q3FA 2KJHB 2K8BA 4HPPA 3ZGZA 2LVPA 1J7CA 4HPLB 4HPMB 4I6NB 2REXA 3A4SC 1WZ0A 1H8CA 1QILA 2G9HD 1WXVA 1WM2A 4DHJD 1JCKB 2XBBC 2MJEA 4EOYA 2KTRA 4MGZE 1QOAA 2G45B 1JMLA 2V4LA 3IAS1 2WXJA 4W9FA 2ZPNA 2LXCA 3MC8A 3EC8A 2W9NA 3AU4A 5JHAA 2I2YA 4LLGM 2IYDB 2NCNA 1V1OA 4LNOA 2JY6A 1I4XA 4XDDA 4BOZB 2BS4B 4L1BA 2PTLA 5E6JA 2BVCA 1LXDA 3L0WB 1WY8A 2NBUA 3QWZB 4JQWC 1C76A 1QOBA 2KAJA 3Q3JA 1VJKA 1K8RB 5EE1A 1T5XD 4IM2A 3Q8BA 5HFYA 4K7UA 3HM3A 3N9YC 2FUHB 4P7IA 2QIEB 2BTEA 3VUWA 3NZSA 1C4AA 4GLSC 4ZRPA 2KN4A 4O1NA 3W2DA 1MHXA 4BFRA 3AEFB 4G0NB 3SD5A 2G1EA 2YEPF 3L16A 4XE0A 2N9EB 4M0WA 3PV1A 2DLBA 3NVVA 3P4QB 2KMAA 4GDKB 1SE4A 3KUZA 2D10A 3WAMA 5H92C 2RDBC 3TBLD 2GBJA 4N6EB 4WAFA 1YJ1A 5H8YE 4BKTA 3SHQA 3AB5A 1TS5A 1VR9A 3KYDD 4RMAA 3PRPB 1V5OA 2L7RA 1C1YB 4RM8A 2MBOA 4Q2JA 2KNBA 3APFA 3M3JA 3ZQ4A 3RCZA 3RNFC 1IYFA 2WXMA 1N62A 3CSTA 2FIFA 4DHJB 4OZBA 3GB1A 1XT9B 1XLOA 3HM6X 4B0MA 2LRUA 2GB1A 3N1ZC 3QARA 3DBHB 2BWFA 3PLVA 2ICIA 4RNAA 4A20A 2N7EA 3IHPC 1ZP0B 2J52A 1OTRB 2BS3B 2N1WA 2K9XA 2INPE 2PLPA 1U4AA 4RGMA 1NBFC 3MHSD 1R4MI 1WRIA 4HJGE 1UH6A 2W82A 1L4DB 5DPTA 3LYYA 2KWDA 3RN9C 2LVQA 1TYGB 4IDIA 3KWVA 2L3ZA 1ZKHA 2JPHA 2NBWB 2LFIA 3SDLC 3AE1B 1IBXB 3QHTA 4XGAB 1XCQL 3R8BA 1RFAA 1UUPA 4WIPA 3M63B 1OGWA 2ZVNA 1D5ZC 1KM7A 2HTME 2JZZA 2KDFB 3VR9B 2KC2A 3DDCB 1MI0A 3CSFA 4KVGB 2MJDA 1WGRA 3NS1A 5IOIA 3ETRA 1N60A 2H89B 2QSDA 3AE7B 1E90A 2KVRA 2IO2B 3HIZA 2BKRB 5IO9A 1OFFA 2JRHA 1T6BX 1WXQA 2HJ1A 2BB6A 2WS3B 1WX7A 5DPSA 1L4ZB 2LWPA 2PW9A 4DHZB 4FJVB 3R7RA 4IWQA 3TUOA 4XC2A 1LQBA 5CHVC 2BYVE 3PHWB 2WDRB 3TMPB 1CZPA 1WR1A 3QJZA 1VZ6A 2LUEA 3LDZE 1F9JA 3ZIMA 2ASQA 4ZYNA 1WGKA 1HA5A 2IY0B 3IVFA 5EDSA 1V1PB 4I6PA 4K7SA 4WURA 1YX6B 4W9JA 1FD6A 2OJWA 3ZLZA 3ENEA 3P1MA 3DBLI 2NR2A 4MT5A 1WFYA 4YTMB 2MH7A 3GP7A 5C1ZA 2CU3A 2MBBB 5D7GA 2WQYB 1YQBA 2ZNVC 3IBEA 1P98A 2LVOA 3N1YC 1KFYB 1WGYA 3TSSA 3OJ4B 3OLMD 5L95C 3MHZA 2L1AA 3DVNU 2AWTA 1V9JA 4TSSA 4TMAB 3UQBA 3X0WA 2V1YA 3RT3B 1H7WA 2CR5A 1EUVB 3MC9A 5BYQA 3ZTCA 2B76B 2KX3A 3ML8A 4G50A 2WXGA 4RH6A 2FCMA 3PGEA 2D11A 5FKAC 1N61A 2G4DB 4MSMB 2XNAC 4ZHPA 4GU2A 1B9RA 2L83A 3VRBB 3BWUD 3PZ8A 1J0GA 2Q5WD 3VRAB 3NY5A 1FRDA 5AZGA 4ZDVA 4NJ7A 2BB5A 4DQOC 2NPTB 3C19A 2QMTA 1KJTA 3I57A 4AS1A 4WAAA 3PO0A 2LI5A 3AE3B 1ISNA 2KQ4X 2KLCA 3R7QA 2KXJA 1UD7A 4NAMA 4JWSC 2WXQA 3FILA 1RAXA 2JXXA 1UWXA 3PHXB 4TQ1A 3ALBA 2IGDA 5AZFA 2MBEA 4M8MA 2ACZB 2PE6B 2OHFA 1GUAB 4CHKA 4ZYSA 1ZE3D 1R4NI 3BYYB 1FNVA 1YN3A 3ZYYX 5G55A 1ZDVA 3IFWB 3L13A 1ET6A 4KZCA 2R2OA 4HROA 4LTUA 3AV8A 2DWQA 2HDEA 3KUCB 1VRAB 3VTUA 1PGAA 1WJ4A 3AI5A 3DHHC 3I63C 3CF4A 1LFDA 2KVZA 4ZHOA 3NG0A 1YOVB 3FC4A 4ZRKA 4JGHB 1J8CA 3KWLA 2L0FA 1H4RA 1SE9A 2BYTA 2IY1B 3U7DA 4IKGA 3WANA 1Q0WB 4A55A 4EUTA 2BT6A 3UINB 1FXTB 3JYUA 3EECA 2WXKA 1WXAA 4HWIB 1J7BA 3RZFA 3IXSA 4FLHA 2GBMA 2LGYA 4C4VB 1E10A 3PZDA 4USAA 3L17A 1UZXB 2PE9A 3TEYA 4C7ZA 3PRZA 3ZXVA 1I4QA 3ZJTA 4GDLB 2E6XA 1LO5D 5AUIA 1A70A 3W5VB 2AQ1B 1NVID 3VHTC 2AL6A 1YD8U 4JLCA 3CWIA 3URYA 2WXLA 5TSSA 2EKEC 5BMIA 1KTKA 2JZ3B 3LJ3A 1L0XB 3AN1A 5E6OA 1Z5SB 1EF1A 2KX0A 4MH0E 3RYTA 1PFDA 1J7AA 4W9GA 4XZ4A 3AEEB 2JVCA 1K50A 1NEKB 4GMVA 4A3OA 1GC7A 3W9CB 2J4XA 3SFDB 1OQYA 2VZKD 2PPHA 2ZZPB 1EF5A 2GRIA 1V2YA 3MP9A 2ZW1A 2AQ3B 4WJPA 4MSQB 2LHEA 2M8SA 3DQVA 5DPRA 1R4MB 3H1UA 1WWTA 3AE5B 1E7PB 4LNFA 1RM6C 2R2QA 4KIKA 3VR8B 4URKA 3UIPB 3P2BA 3PREA 1DYQA 3RNGC 2WWZA 3KUDB 4MM3A 3RMKC 2L05A 4KSKC 1XLPA 4MEMA 2CS4A 5CTRC 1KRHA 1QT9A 1PGXA 1PGBA 1XCTL 2GBNA 3R3MA 1UWMA 1UELA 4W9CA 2B3AA 3PTFC 1WYWB 1L2NA 2QILA 1WXSA 4GGQA 1P0RA 2O6VA 4HKZE 3AE6B 2XEWA 2L76A 3JSVA 2Y5BB 2INCC 2KDIA 2EMSA 1FO4A 3L54A 2D3CA 2K6DB 4GXBA 1SJHD 3NOBA 2KMCA 1WGGA 4IC7B 2J0MA 3NUHB 3PPAA 4IWOA 2O2VB 2Z0DB 2WNMA 4CQNA 5HKHA 1YIWA 4EE2A 3B2FA 2MP2A 1ZXIA 5BMGA 1R7SA 1YJIA 3RPFC 2IDYA 3V6CB 2BWES 1FM0D 1LGRA 3O13A 2QC8A 1KF6B 2RGFA 3EFCA 4HKQA 2EMTA 3RULA 4BAXA 1V97A 3NZUA 1TY0A 2VZKB 4YT0B 2M1MA 2LJIA 4RGNA 3OJ3A 2WDVB 1FPYA 2VH2A 3C0RB 1DOYA 4AP4C 3P42A 4IW0A 1XQQA 3CF6E 2DBYA 1T0QC 1F77A 4CO7A 2I1KA 3VTVA 4MJSA 3U52E 4HDQA 2RSUA 2ZPYA 1P9DU 4HRSA 2TSSA 3B08A 2PVGC 1QF6A 2LZ6A 1DOXA 2BQQA 2LMCA 2ZEQA 1J19A 1LM8B 3AMZA 1ROEA 4KDIC 1OEYA 3BVMA 3TCAA 1S1QB 4HDOA 1WM3A 2RDGA 1SE2A 3VUYA 1HZ6A 3PS6A 4LNKA 1N6ZA 3V3XA 1SGHA 3VXWA 5FK9C 4X57B 3U8ZA 2JSVX 2Z0EB 2KTFA 4NAWA 2LRWA 4S17A 4DDID 2HD5B 4WQOB 4HJKA 3ZRFA 1GB4A 2BPSA 4N59A 3QAQA 4WJNA 5JZEB 2L00B 3A1QB 2KDBA 3T3OA 3RNEC 4BOSC 2C7HA 3I3TB 2J0KA 1WJNA 4K3BA 1PDXA 1XLQA 2IGGA 2CJNA 2JUOA 1MJDA 2W3RA 3EFUA 3WAOA 3QX1A 2JRIB 4EKUA 4JPSA 2MA9B 1FCCC 2AYOB 3NJTA 2QCZA 1FXAA 1WR6E 1F2RC 3ZKJC 4A8XC 2CHXA 3NS8A 3ZVVA 2NTSA 1RRBA 4NJ6A 3B0AA 1WE7A 2OOBB 3KLSX 3N1XC 4GIVA 3U30A 5I4DA 1C4CA 1WX8A 4WWMA 4ZOHC 2KT7A 2DZKA 3BK1A 3VDZA 1RWSA 5CHWA 1WJ6A 1WYGA 3AEDB 1UGMA 2K1FA 1AARA 3DBRB 2C7NB 3U4EG 5TR5A 2CHWA 1V86A 1D5MC 4OVUA 1WI0A 2BKFA 3HK0A 3VUXA 1VZ7A 2YVCA 1P3QU 5CX3A 1SSNA 4QAYA 2ZJDA 3H7PB 2M17A 3O65B 4KGRA 2K8HA 2JWZA 4YSYB 1ET9A 2PJHA 2D3GA 5IKCM 3IT4B 5EE0A 3AM9A 4C80A 1YN5A 2G4SA 3P4RB 5IA7A 2D3AA 4C56C 5E6PA 5E6NA 2JF5A 1I4HA 2SAKA 3PSEB 3DVGY 3RNAC 1C4PA 1BUIC 5GMVA 4YSXB 3SEBA 2KKCA 1JWAD 4XWTA 1VD2A 2W55A 2DX5B 2N1VA 3KH0A 1NDDA 3RZWC 4HLEA 5J18A 5HG2A 3DCGA 1JQ4A 3M95A 4US9A 5C23A 1EO6A 2K39A 3H6NA 2K0PA 1HTOA 2Y5CA 1Y8RC 2J53A 4FULA 1NYRA 3DHGC 1M94A 3T9LA 3FILB 4GN1A 3PRMB 2ZCCA 3V05A 4MH8A 4AWJA 3P63A 4TUUA 4M01A 2A4ZA 1PYWD 3APCA 2L52A 4KZ0A 3MJWA 1FRRA 4NPNA 2DZMA 2LGDA 3RNCC 3KW5B 1TS2A 3ZTDA 4REZA 1XLNA 3TL5A 1EWYC 1EWCA 4ZRQA 1CMXB 4DXFA 1WRDB 4IM3A 2AL3A 2LJ5A 3B9JA 1L0VB 1FCLA 1E7UA 1L6VA 4M8NA 4PYUA 5FR6A 3SR6A 2KFKB 5JXVA 1NI2A 1WH3A 2PIAA 4F8CB 3VVWB 3A9KA 3P4PB 1Y56A 4NY0A 5KHQA 4N58A 2AEHA 2WYQA 3UQAA 1MPEA 2KQ7A 1CQVA 2ON8A 3TEWA 2KZRA 1KH0A 1BT0A 3SFEB 4IM0A 1AN8A 2MHJA 2K3UA 2O6VD 1N63A 4JX1C 3VFKA 2JZPA 2MRPA 2C9WB 3MJ5A 3ZDTA 4WH4A 1MHHE 2IBIB 3CIRB 2V0GA 1HE8A 1XO3A 4PYZA 1TKYA 2GBKA 2GBRA 2XK5B 2V3SA 3DWMA 2FAZA 1TJEA 4G11A 4CYEA 2KN5A 3OWEB 3AEBB 1IPGA 1RYJA 3K9PB 1ENFA 4GSWA 2X8XX 3NZ3A 1G6JA 3RD2A 2FIDA 1EU4A 5LLIA 2DNFA 1E8WA 2KJRA 1S3SG 1AW7A 5L83A 4P6VF 4S0RA 3AULA 1TBEA 1XD3B 2DZIA 1SXTA 4KKJA 4LDTD 1E8ZA 3ECIA 1DGJA 4FHKA 4WQMA 4KIKB 4E74A 3ABVB 2RPVA 1X1MA 3JW0X 4FJZA 3V62A 4K3CA 2Z8LA 1C79A 3Q3MC 3NHEB 1ESFA 3QCAA 2PKOA 5J17A 4E71A 4HVBA 1JW9D 3EUB2 1E8YA 1GC6A 2KQSA 3A9JB 1QOFA 3TEZA 2ZW0A 2KFJA 1FNWA 3KYCD 1F2RI 2NPTA 3KQ4A 3IT6B 4AOFA 3DVNV 4KX6B 3OG5A 1ZXHA 3ML9A 1SEBD 2BF8B 5D3DA
chains in the Genus database with same CATH topology
2K9XA 2INPE 2PLPA 4RGMA 1V97A 3E56A 1WRIA 1P7EA 1MVKA 4HJGE 1YQ3B 1TY0A 2W82A 4XDCA 2VZKB 3W1SA 1L4DB 1FXIA 4YT0B 2NMQA 2LJIA 2WU2B 3LYYA 4A9AA 3PZ7A 2KWDA 3Q8EA 4YTNB 1TYGB 2NTTA 4IDIA 4RGNA 3Q69A 3KWVA 2Y3AA 2WDVB 2JWUA 4A6QA 1GAQB 2KACA 1RFKA 2W54A 1DOYA 1IGCA 4PT5A 3P42A 2LFIA 2DBYA 3B2GA 3AEAB 3AE1B 1IBXB 1F0ZA 1D6EC 1F77A 1YJJA 3AE4B 1ZUD2 1XCQL 1K51A 1HQRD 3R8BA 1UUPA 4WIPA 2FBWB 1CJEA 1D5ZC 3NRZA 3U7ZA 2HTME 3U52E 1WSPA 3VR9B 4HRSA 1MI0A 2H88B 4YSZB 2TSSA 2X38A 2MJDA 2PVGC 3DWGC 5GXGB 1QF6A 1VDVA 1SB3C 1DOXA 3NS1A 2LMCA 3ETRA 3AMZA 1ROEA 1N60A 2H89B 1V1PA 2QSDA 5D3DA 1DOIA 1Q10A 3AE7B 2BS2B 3BVMA 2RMMA 1V8CA 1I4PA 2WXNA 5BYSA 4RGOS 2RDGA 2LEKA 3ZJUA 4US8A 1OFFA 4YTPB 5HI1A 1SE2A 1T6BX 1WXQA 2JXTA 1HZ6A 2BB6A 2DYMA 2WS3B 3V3XA 4HEA1 1L4ZB 2PW9A 5FK9C 2J42A 1TKEA 2JSVX 4ARCA 1N5XA 3TUOA 1ACCA 1AWDA 2JQRB 2WXHA 1NI3A 3AECB 4FXCA 3WCQA 5C2TB 2WDRB 1SF0A 1C77A 1CZPA 4L2YA 1GB4A 1VZ6A 5G5HA 3J9CA 1JWUD 1L6UA 1TY2A 1JROA 2BW2A 4N59A 2JX5A 1QKZA 3FAHA 3MC0B 1QQRA 1B1ZA 4C7YA 4KGSA 1WGKA 1HA5A 4OZCA 3T3OA 1I7HA 3BZDB 1V1PB 2N9KA 2KMMA 4WURA 1PDXA 1XLQA 2IGGA 2CJNA 4OZAA 2K5PA 4LK0M 4OVZA 1FD6A 4IOIE 3Q8AA 1T3QA 2W3RA 1IUEA 1SJED 1ZDXA 3P1MA 4MM3B 3I9V1 4MT5A 4YTMB 2MH7A 3GP7A 4JWUC 4JPSA 4YWGG 1FCCC 4RF0A 2CU3A 5D7GA 2WQYB 1OQQA 1TS4A 5C3JB 2AQ2B 4R3DA 2YEPB 3E9SA 1KFYB 3TSSA 1QLBB 1YMHE 2JYTA 1FXAA 2L1AA 3MHZA 2CJOA 1SIJA 1F2RC 1L0YB 4A8XC 1FFVA 4TSSA 2NTSA 3BYTB 4TMAB 3U2SC 1TKGA 2WXFA 4OHJA 4KKIA 3KLSX 5I4DA 1H7WA 1PUTA 5BYQA 1C4CA 2LUMA 2DYOA 1E0ZA 4WWMA 4ZOHC 2B76B 4J3OD 3BK1A 1ZOYB 1RWSA 1GB1A 1WYGA 4XWWA 3AEDB 1JALA 2ONQA 2WXGA 4RH6A 1XF5L 2XN9C 1YQ4B 5FKAC 3U4EG 1N61A 1KLGD 1BXTA 1D5MC 1XEEA 1K52A 2BBCA 1VZ7A 2XNAC 4ZHPA 3AE9B 2OEDA 1GTHA 1SSNA 1B9RA 2L83A 1GOZA 3VRBB 1UGJA 3BWUD 3PZ8A 2Q5WD 1IGDA 3VRAB 5EE3A 1FRDA 1P7FA 4KGRA 1HEZE 4YSYB 1ET9A 4ARIA 1NYQA 2N7JA 2BB5A 4DQOC 3IT4B 2V3NA 1JWBD 2L32A 1H7XA 5EE0A 2Y5PA 4NJCA 2V3PA 2QMTA 2KDMA 3BIID 3AM9A 3I57A 4C80A 3W5UB 4AS1A 2RDHA 3PO0A 1YN5A 4RGTA 3AE3B 1I4RA 2KQ4X 5D3IB 3AE2B 3P4RB 2WXOA 4C56C 3P4SB 4NAMA 4JWSC 2WXQA 3FILA 2SAKA 1I4HA 5BYRA 4TQ0A 2M56B 1UWXA 4TQ1A 3GS2A 1C4PA 1BUIC 2WLBA 1EU3A 4YSXB 2IGDA 3C8YA 2ACZB 3SEBA 1ZPSA 2OHFA 3UI3A 1JWAD 1TS3A 2IGHA 2WDQB 4ZYSA 1ZE3D 4XWTA 2N9LA 3BYYB 2W55A 1FNVA 1YN3A 2WXRA 3ZYYX 4DXGA 1ZDVA 1HXYD 1QOGA 2K22A 3BVZA 3AH7A 1SBBB 1ET6A 4RF1A 2EELA 5LNK1 4HROA 4LTUA 4OW0A 5HG2A 2LHDA 1JQ4A 4US9A 3AV8A 3EA6A 1FNUA 4P16A 3LB8C 2DWQA 4D2KA 2MEKA 2K0PA 1FMAD 2HDEA 4UDUC 2Y5CA 1GPXA 1VRAB 2N0SB 1PGAA 1UNSA 3L4PA 2J53A 1NYRA 2D5GA 5G5GA 1GT8A 4H2AA 4B0EA 3CF4A 2JU6X 2WXIA 3BVGA 4ZHOA 3FILB 1OQRA 1CK1A 5AUKA 3V05A 4MH8A 2LGIA 3P63A 1FFUA 3FC4A 1GTEA 1PYWD 2L52A 1E6EB 3KWLA 2M0AA 4JE3B 1YNTE 4RCOA 2BYTA 3RFZB 1FRRA 3NVZA 1E9MA 4IKGA 1L5PA 4NAWB 2GI9A 2IJ0A 5EE9A 4A55A 1NENB 2WP9B 2BT6A 1TS2A 4AQ7A 1I4GA 1HZ5A 2PMVA 4REZA 1XLNA 1EWYC 5MPOA 1EWCA 2WXKA 4ZRQA 4DXFA 4NZLB 1J7BA 1JWSD 3HVZA 3AEGB 2WU5B 2MJ3A 2QJLA 2EKIA 3ZJVA 3IXSA 3NVWA 1EM7A 3B9JA 2I38A 1FEHA 2E3TA 1L0VB 4YXDB 5T8IA 1FCLA 1E10A 1L6VA 2AX5A 2V4IB 3BK2A 4USAA 3SR6A 1KLUD 3TEXA 3TEYA 5JXVA 4C7ZA 3R2TA 5BMHA 2PIAA 3ZGZA 1JRPA 1I4QA 3ZJTA 4GDLB 1J7CA 5FR3A 3Q8FA 3P4PB 1Y56A 2E6XA 4ITKA 1LO5D 5AUIA 1A70A 1QILA 2G9HD 2AQ1B 1NVID 4N58A 3W5VB 1JCKB 1K53A 1VLBA 2MJEA 3HRDD 2PVOD 4A90A 1QOAA 3URYA 3CWIA 1D4BA 1MPEA 2WXLA 5TSSA 1JMLA 3LXFA 5BMIA 1KTKA 1CQVA 3IAS1 2WXJA 1L0XB 3AN1A 2ON8A 3TEWA 3R2IA 1KH0A 3SFEB 2QEJC 1AN8A 1YN4A 2K3UA 1PFDA 2I2YA 4LLGM 1J7AA 1N63A 4JX1C 1V1OA 2JZPA 3AEEB 1K50A 1NEKB 1I4XA 3W9CB 2J4XA 3SFDB 4XDDA 2VZKD 3MJ5A 2BS4B 2GRIA 4L1BA 2PTLA 1FIQA 4WH4A 5E6JA 1MHHE 3CIRB 3MP9A 2V0GA 1XO3A 2ZW1A 2AQ3B 4KGTA 2LHEA 2W3SA 1C76A 3AE8B 1QOBA 2KAJA 1VJKA 2WXPA 1TKYA 1WWTA 2FE8A 3AE5B 1E7PB 1STEA 5EE1A 3DWMA 2IPKD 1T5XD 1RM6C 2M19A 1TZOA 3Q8BA 5HFYA 3VR8B 1TJEA 1DYQA 3N9YC 3HVDA 3OWEB 3AEBB 2QIEB 2BTEA 1RYJA 5HHDG 2FUG1 1C4AA 1ENFA 4GLSC 1AYFA 3NZ3A 2JYEA 1XLPA 4ZRPA 2KN4A 4O1NA 3W2DA 1MHXA 1KRHA 1EU4A 3AEFB 1QT9A 4L23A 1PGXA 1PGBA 1XCTL 1C9FA 1UWMA 2G1EA 1XXGA 2YEPF 4XE0A 1AW7A 1C78A 4M0WA 4P6VF 2DLBA 3NVVA 2QILA 3P4QB 1D5XC 4GDKB 1SE4A 5H92C 4N6EB 4WAFA 1SXTA 3AE6B 4HKZE 4KKJA 3H8HA 5H8YE 3NVYA 3AB5A 1TS5A 1VR9A 3MFGA 3VQIA 1DGJA 4WQMA 3ABVB 1FO4A 2RPVA 1SJHD 1VZ8A 3NUHB 1BMLC 2WNMA 4CQNA 2Z8LA 4Q2JA 1C79A 2R61A 1ESFA 3ZQ4A 2SEBD 3T3NA 2PKOA 2WXMA 1N62A 4MACA 4OZBA 3Q8CA 1IBXA 4EE2A 3GB1A 3B2FA 1N5WA 1XLOA 1JW9D 3EUB2 3HUIA 1ZXIA 5BMGA 4B0MA 1R7SA 2GB1A 4RFBA 1YJIA 1M4VA 3RPFC 2IDYA 3IAM1 3EGRA 1QOFA 3TEZA 2ZW0A 1FNWA 2ICIA 1F2RI 1FM0D 3O13A 1JWMD 4RNAA 3KQ4A 1KF6B 3IT6B 2INNE 1ZP0B 2J52A 4KX6B 4HKQA 1ZXHA 2BS3B 1SEBD 1SE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AEE B;  2K9X A;  1T3Q A;  2W3R A;  1IUE A;  1QOG A;  1NEK B;  2K22 A;  3AH7 A;  1V97 A;  3P1M A;  3W9C B;  3SFD B;  1WRI A;  2BS4 B;  1YQ3 B;  1FIQ A;  4HRO A;  4LTU A;  3CIR B;  4YTM B;  2MH7 A;  1JQ4 A;  4US9 A;  1FXI A;  3AV8 A;  1XO3 A;  4YT0 B;  3LB8 C;  2DWQ A;  4JWU C;  2WU2 B;  4A9A A;  2CU3 A;  1FMA D;  4YTN B;  1TYG B;  2W3S A;  2WQY B;  3AE8 B;  1QOB A;  1OQQ A;  2KAJ A;  2Y5C A;  5C3J B;  4IDI A;  1VJK A;  1GPX A;  1TKY A;  2WDV B;  1WWT A;  1KFY B;  2N0S B;  1QLB B;  3L4P A;  3AE5 B;  1GAQ B;  1E7P B;  1FXA A;  1RFK A;  5EE1 A;  2CJO A;  1NYR A;  1SIJ A;  2W54 A;  3DWM A;  1DOY A;  5G5G A;  1GT8 A;  1RM6 C;  2M19 A;  1FFV A;  3CF4 A;  2DBY A;  3B2G A;  3VR8 B;  3AEA B;  3AE1 B;  1TJE A;  4ZHO A;  1OQR A;  1F0Z A;  5AUK A;  1YJJ A;  3AE4 B;  1ZUD 2;  1TKG A;  3P63 A;  1FFU A;  2FBW B;  1CJE A;  3FC4 A;  3AEB B;  1GTE A;  2QIE B;  1H7W A;  3NRZ A;  2L52 A;  1PUT A;  1E6E B;  2HTM E;  1RYJ A;  3KWL A;  3VR9 B;  1E0Z A;  4WWM A;  4HRS A;  4ZOH C;  2B76 B;  1AYF A;  1FRR A;  2H88 B;  4YSZ B;  1ZOY B;  1RWS A;  1E9M A;  1XLP A;  1L5P A;  3NVZ A;  1WYG A;  2MJD A;  3AED B;  1KRH A;  3AEF B;  1JAL A;  2PVG C;  3DWG C;  1QT9 A;  1NEN B;  5EE9 A;  2WP9 B;  2BT6 A;  1QF6 A;  1UWM A;  1VDV A;  1SB3 C;  1YQ4 B;  1DOX A;  1N61 A;  3NS1 A;  2G1E A;  1XLN A;  1EWY C;  5MPO A;  3ETR A;  3AMZ A;  1ROE A;  1N60 A;  2H89 B;  5GXG B;  1DOI A;  3AE7 B;  2BS2 B;  4P6V F;  1J7B A;  3NVV A;  1V8C A;  3HVZ A;  3AEG B;  3P4Q B;  2WU5 B;  3AE9 B;  4ZHP A;  2MJ3 A;  2QJL A;  1GTH A;  1B9R A;  2EKI A;  2L83 A;  3VRB B;  5H92 C;  2Q5W D;  4N6E B;  2LEK A;  3NVW A;  3VRA B;  3AE6 B;  1OFF A;  3B9J A;  4YTP B;  4US8 A;  5EE3 A;  1WXQ A;  2E3T A;  1L0V B;  4YXD B;  1FRD A;  3NVY A;  5H8Y E;  1L6V A;  2AX5 A;  1E10 A;  4YSY B;  3AB5 A;  4USA A;  3SR6 A;  1NYQ A;  2WS3 B;  1DGJ A;  1JWB D;  4C7Z A;  1H7X A;  4WQM A;  5EE0 A;  2PIA A;  1TKE A;  3ABV B;  1FO4 A;  1JRP A;  3BII D;  3AM9 A;  1N5X A;  4C80 A;  1AWD A;  2JQR B;  4FXC A;  3WCQ A;  1NI3 A;  3AEC B;  1J7C A;  3W5U B;  5C2T B;  3P4P B;  3PO0 A;  2WDR B;  4ITK A;  1SF0 A;  1CZP A;  3AE3 B;  5AUI A;  1A70 A;  3AE2 B;  4N58 A;  1NVI D;  3P4R B;  2PKO A;  5G5H A;  3W5V B;  3HRD D;  1N62 A;  1L6U A;  1VLB A;  3P4S B;  1JRO A;  2MJE A;  2PVO D;  4JWS C;  2JX5 A;  4N59 A;  1QOA A;  3FAH A;  3B2F A;  3CWI A;  4C7Y A;  1N5W A;  1XLO A;  3LXF A;  2M56 B;  1WGK A;  1JW9 D;  3AN1 A;  3EUB 2;  1ZXI A;  3HUI A;  1R7S A;  1YJI A;  2WLB A;  4YSX B;  1I7H A;  3RPF C;  1QOF A;  2ACZ B;  3SFE B;  2KMM A;  1FM0 D;  2OHF A;  1PDX A;  1XLQ A;  2CJN A;  1JWA D;  1KF6 B;  2WDQ B;  1PFD A;  1ZP0 B;  4KX6 B;  2K5P A;  2BS3 B;  1J7A A;  2W55 A;  1N63 A;  4JX1 C;  3ZYY X; 
#chains in the Genus database with same CATH topology
 5BO4 B;  3VTW A;  1E8X A;  3E56 A;  4BKS A;  1MVK A;  1YQ3 B;  2DHZ A;  4F1S A;  1FXI A;  2NMQ A;  3UGB B;  4FAD A;  3OAW A;  2Y3A A;  2JWU A;  2MW5 A;  1GAQ B;  2KAC A;  1RFK A;  2W54 A;  3M62 B;  1WXM A;  3B2G A;  1D6E C;  1YJJ A;  1UBQ A;  3AE4 B;  2M0X A;  1K51 A;  2MP2 B;  2DAF A;  1P1A A;  1CJE A;  1I42 A;  4G3X B;  2KD0 A;  3X23 A;  3RUI B;  3DWG C;  4ICU A;  1VDV A;  1SB3 C;  1SIF A;  1ZW7 A;  5GXG B;  3GZN I;  2BS2 B;  1V49 A;  4EEW A;  2KTR B;  1V8C A;  2N4F A;  2MBH A;  2KLG A;  4W9K A;  3ZNH B;  2J0J A;  4RGO S;  3ZJU A;  4US8 A;  4YTP B;  5HI1 A;  2JXT A;  4W9D A;  4II2 B;  4LDT B;  2DYM A;  4ANV A;  3I5J C;  2J42 A;  1UBI A;  2K6Q A;  1TKE A;  3L08 A;  4ARC A;  2DZJ A;  3Q3O C;  1AWD A;  2JQR B;  4FXC A;  3WCQ A;  2VH1 A;  4DBG A;  4WWN A;  5C2T B;  1SF0 A;  4MJS B;  4P1C C;  5G5H A;  3ZDM C;  1L6U A;  3ZNG C;  1JRO A;  3MC0 B;  3FAH A;  4C7Y A;  1B1Z A;  2MWS B;  4KGS A;  2CHZ A;  2GOW A;  2WGS A;  4WJO A;  4GB9 A;  1TIF A;  2C5L C;  2A5U A;  2MBQ A;  2KMM A;  1WZ3 A;  4OZA A;  2KOX A;  2K5P A;  5AEK B;  1C3T A;  4HCN B;  3GE8 C;  4IOI E;  3Q8A A;  4GDL A;  1T3Q A;  1IUE A;  1ZDX A;  1WX9 A;  1WF9 A;  5J2R A;  1V6E A;  2Z59 B;  4JWU C;  4YWG G;  1WGD A;  4RF0 A;  2QHO A;  1OQQ A;  1TS4 A;  5C3J B;  3PLU A;  2YEP B;  3E9S A;  1YMH E;  2JYT A;  4LNN A;  3N20 C;  4M0W B;  1GG3 A;  4TKN A;  3BYT B;  2WXF A;  2YLM A;  1PUT A;  4ASW C;  4FN2 A;  1E0Z A;  4J3O D;  2C7M B;  1ZOY B;  4KSL C;  1MG4 A;  4II3 B;  1JAL A;  2ONQ A;  3DBL B;  4YL8 A;  3D32 A;  1KLV A;  2XN9 C;  1YQ4 B;  4K81 A;  1BXT A;  1K52 A;  1WMH A;  2BBC A;  3AE9 B;  2LGX A;  2OED A;  5JHB A;  1GTH A;  2LXA A;  3EHV A;  3A33 B;  4P1B C;  1P7F A;  1HEZ E;  4ARI A;  4PS8 A;  2N7J A;  4J6I A;  1JWB D;  2L32 A;  2KYW A;  1H7X A;  2RPQ A;  4NJC A;  2V3P A;  3W5U B;  4I6L B;  2NVU I;  2WDT B;  2I1J A;  3VH3 B;  3AE2 B;  2N9X A;  5BYR A;  4NQL B;  4TQ0 A;  1T0S C;  3GS2 A;  2WLB A;  1EU3 A;  1Q1O A;  4FBJ B;  5CHF A;  1ZPS A;  2WXR A;  2WHI A;  4DXG A;  1HXY D;  1QOG A;  2IZV B;  2K22 A;  2O2V A;  2EEL A;  5LNK 1;  3Q6B A;  4OW0 A;  2LHD A;  2BYF A;  2IO0 B;  1FNU A;  2MEK A;  1FMA D;  4UDU C;  1ZGU B;  3V60 A;  2N0S B;  1UNS A;  3APD A;  3TJP A;  4H2A A;  4B0E A;  2JU6 X;  2WXI A;  1OQR A;  2LGI A;  1F52 A;  2M0A A;  1R4N B;  4JE3 B;  1YNT E;  4K7W A;  4MGY E;  5D94 A;  4AJY B;  3NVZ A;  1E9M A;  1L5P A;  3DOW A;  2GI9 A;  3L10 B;  5EE9 A;  4BKG A;  1NEN B;  5DPW A;  1E7V A;  4XYC A;  1I4G A;  1HZ5 A;  2PMV A;  4ZRJ A;  2JT4 B;  5MPO A;  4C00 A;  2FNJ B;  1PQS A;  4NZL B;  4W9I A;  1JWS D;  3HVZ A;  1V80 A;  2QJL A;  4AUQ C;  4B9K A;  2EKI A;  3ZJV A;  4W9H A;  4FJY A;  1FEH A;  2E3T A;  4YXD B;  2AX5 A;  3BK2 A;  2MX2 A;  5BMH A;  3R2T A;  2LAS A;  3W1S C;  1JRP A;  4PS7 A;  3JVZ X;  2K8C A;  5FR3 A;  2N9P C;  3Q8F A;  4ITK A;  2CU1 A;  2L0T A;  1T0R C;  4DWF A;  2FCS A;  2FCN A;  4ZRI A;  1K53 A;  1VLB A;  3HRD D;  2PVO D;  3RNB C;  4A90 A;  1D4B A;  3LXF A;  3N3K B;  3QIJ A;  4IWP A;  3R2I A;  1IP9 A;  3AU5 A;  1Q5W B;  2QEJ C;  1YN4 A;  4EZL A;  1MG8 A;  3QC8 B;  2G3Q B;  1YX5 B;  2GMI C;  5D2M B;  1FIQ A;  1L7Y A;  4KDL B;  4GDK A;  4KGT A;  4DK5 A;  2W3S A;  3AE8 B;  2WXP A;  3A9K B;  2WX0 A;  2FE8 A;  3A1Q A;  2KAN A;  1STE A;  2IPK D;  2M19 A;  1HTQ A;  1TZO A;  1QZE A;  4ANX A;  3HVD A;  4AJW A;  2NS5 A;  5HHD G;  2FUG 1;  1AYF A;  3DVG X;  2JYE A;  2NBV B;  2MLB A;  4DHZ E;  4L23 A;  1C9F A;  3PVL A;  4BKS D;  4M00 A;  1XXG A;  5IN7 A;  1V81 A;  1C78 A;  1VCB A;  1D5X C;  3WA0 A;  5AZH A;  3H8H A;  3NVY A;  3GZN B;  3AXC A;  3MFG A;  4M02 A;  3VQI A;  1TGZ B;  4LNI A;  3GE3 C;  3GOE A;  3QK0 A;  2KK8 A;  1VZ8 A;  2D07 B;  4MEL A;  1BML C;  4ICV A;  2KO3 A;  3CMM B;  3W1Y A;  4NQK E;  2R61 A;  4EZJ A;  3T3N A;  2SEB D;  3VH4 B;  3ZXR A;  4MAC A;  3ZUN A;  3Q8C A;  1IBX A;  4B95 A;  4B6W A;  1N5W A;  4BBN C;  3RI7 C;  2PEA A;  3HUI A;  1GNU A;  3A4R A;  4RFB A;  1M4V A;  3H7P A;  3IAM 1;  3EGR A;  4W9L A;  4RM9 A;  1JWM D;  2INN E;  3VAW A;  1WJU A;  1SE3 A;  1WGH A;  2MSE D;  4WWP A;  4IG7 B;  3DBS A;  1P7E A;  3UIO B;  3Q2A C;  4HXD A;  4XDC A;  3W1S A;  4BZA A;  5G2N A;  2LGS A;  3ONS A;  2HE7 A;  3WAP A;  3FKY A;  2WU2 B;  4A9A A;  3PZ7 A;  2ZCB A;  3Q8E A;  4YTN B;  2NTT A;  2D2Q A;  3Q69 A;  4A6Q A;  1GJZ A;  5KHO A;  1IGC A;  4PT5 A;  3N30 A;  2C60 A;  2KDE B;  2ZNV B;  3AEA B;  1F0Z A;  4ANW A;  1ZUD 2;  2J7Q B;  1HQR D;  2FBW B;  1E5W A;  3NRZ A;  3BIN A;  3U7Z A;  4A3P A;  1WSP A;  2H88 B;  4YSZ B;  4NNJ B;  2X38 A;  4XX5 A;  3T8M A;  1V1P A;  4F7Z A;  1DOI A;  1Q10 A;  4KV2 A;  3MTN B;  3ZNZ B;  2RMM A;  4PS3 A;  1I4P A;  2WXN A;  4HCP B;  5BYS A;  1F1H A;  4EZK A;  2LEK A;  1TTN A;  1A5R A;  3IG3 A;  4WJQ A;  4HEA 1;  4ACF A;  2DEN B;  1N5X A;  4TV3 A;  3ZW3 A;  2WX1 A;  1ACC A;  2WXH A;  1NI3 A;  3AEC B;  3WAL A;  4K1R B;  5LXI B;  2DYB A;  1C77 A;  4L2Y A;  3ZO5 B;  4FA6 A;  5LXH A;  5JH5 C;  3J9C A;  1JWU D;  3DBH I;  1TY2 A;  2BW2 A;  2JX5 A;  2OJR A;  1QKZ A;  2ZVO A;  1QQR A;  2DAJ A;  1OEY J;  4OZC A;  1MFW A;  3H9D A;  3R66 C;  1I7H A;  3BZD B;  2N9K A;  2VRR B;  2KFK A;  3QQ8 B;  4BVU C;  4LK0 M;  4OVZ A;  4W9E A;  1SJE D;  3WIM A;  4MM3 B;  1KOT A;  1UF0 A;  3DBR I;  3I9V 1;  3K9O B;  2LD9 A;  2MCN B;  3Q3N C;  4JL9 A;  1RLF A;  2AQ2 B;  2UYZ B;  4R3D A;  1QLB B;  3PT2 B;  4FHJ A;  2CJO A;  1SIJ A;  1L0Y B;  2KWV B;  1FFV A;  1TT5 B;  3U2S C;  4BBN F;  2HJ8 A;  2O6V B;  3SU8 X;  1TKG A;  3JSV B;  4OHJ A;  4KKI A;  3Q14 C;  4LJP B;  4MGK E;  2RD0 A;  2LUM A;  2DYO A;  4LJO B;  2V9H A;  2QDF A;  1GB1 A;  4XWW A;  3ZRC A;  2KHW B;  4WWO A;  4IUM B;  1XF5 L;  2KWC A;  2FCQ A;  1KLG D;  4MDK E;  1XEE A;  2XK5 A;  1V5T A;  1GOZ A;  1UGJ A;  2BGF A;  4JIO U;  1IGD A;  3DPD A;  5IP4 D;  2K25 A;  3ZNI D;  5EE3 A;  2UWQ A;  3BY4 B;  2BYE A;  4EFO A;  1NYQ A;  2V3N A;  1WIA A;  2Y5P A;  2L8J A;  2KDM A;  3BII D;  4DDG D;  2RDH A;  2KJ6 A;  4PK1 A;  4LCD E;  3B1L X;  4RGT A;  1I4R A;  5D3I B;  5DCN A;  2RR9 A;  5IAA C;  3N32 A;  2WXO A;  2GLS A;  3P4S B;  3HHM A;  2UU7 A;  5D6J B;  2M56 B;  3DHI C;  3S2A A;  4OVV A;  3C8Y A;  4MGI E;  1WMH B;  3UI3 A;  1TS3 A;  2IGH A;  2WDQ B;  2N9L A;  3BVZ A;  3AH7 A;  3TIX A;  1SBB B;  2KC1 A;  4RF1 A;  3EA6 A;  4P16 A;  3LB8 C;  4D2K A;  3V61 A;  1GPX A;  2N7D A;  4C4V A;  3KVF B;  3L4P A;  2D5G A;  5G5G A;  1GT8 A;  3A9J A;  4N9F 4;  4DXA B;  2M4N A;  2HTH A;  3BVG A;  1CK1 A;  5AUK A;  1T0Y A;  1FFU A;  1I35 A;  1GTE A;  1WE6 A;  1E6E B;  4ANU A;  4RCO A;  3RFZ B;  4E3C A;  2KWU B;  2MQJ A;  2D3B A;  2IO3 B;  4GOC A;  4NAW B;  2IND C;  2IJ0 A;  1D3Z A;  3QA8 A;  2WP9 B;  4AQ7 A;  2IO1 B;  4HK2 A;  3UF8 A;  1Z2M A;  3V6E B;  3H7S A;  3AEG B;  2WU5 B;  2MJ3 A;  3NVW A;  1EM7 A;  2I38 A;  5T8I A;  2V4I B;  2CKH B;  1JRU A;  1TZ1 A;  1KLU D;  3TEX A;  3Q3F A;  2KJH B;  2K8B A;  4HPP A;  3ZGZ A;  2LVP A;  1J7C A;  4HPL B;  4HPM B;  4I6N B;  2REX A;  3A4S C;  1WZ0 A;  1H8C A;  1QIL A;  2G9H D;  1WXV A;  1WM2 A;  4DHJ D;  1JCK B;  2XBB C;  2MJE A;  4EOY A;  2KTR A;  4MGZ E;  1QOA A;  2G45 B;  1JML A;  2V4L A;  3IAS 1;  2WXJ A;  4W9F A;  2ZPN A;  2LXC A;  3MC8 A;  3EC8 A;  2W9N A;  3AU4 A;  5JHA A;  2I2Y A;  4LLG M;  2IYD B;  2NCN A;  1V1O A;  4LNO A;  2JY6 A;  1I4X A;  4XDD A;  4BOZ B;  2BS4 B;  4L1B A;  2PTL A;  5E6J A;  2BVC A;  1LXD A;  3L0W B;  1WY8 A;  2NBU A;  3QWZ B;  4JQW C;  1C76 A;  1QOB A;  2KAJ A;  3Q3J A;  1VJK A;  1K8R B;  5EE1 A;  1T5X D;  4IM2 A;  3Q8B A;  5HFY A;  4K7U A;  3HM3 A;  3N9Y C;  2FUH B;  4P7I A;  2QIE B;  2BTE A;  3VUW A;  3NZS A;  1C4A A;  4GLS C;  4ZRP A;  2KN4 A;  4O1N A;  3W2D A;  1MHX A;  4BFR A;  3AEF B;  4G0N B;  3SD5 A;  2G1E A;  2YEP F;  3L16 A;  4XE0 A;  2N9E B;  4M0W A;  3PV1 A;  2DLB A;  3NVV A;  3P4Q B;  2KMA A;  4GDK B;  1SE4 A;  3KUZ A;  2D10 A;  3WAM A;  5H92 C;  2RDB C;  3TBL D;  2GBJ A;  4N6E B;  4WAF A;  1YJ1 A;  5H8Y E;  4BKT A;  3SHQ A;  3AB5 A;  1TS5 A;  1VR9 A;  3KYD D;  4RMA A;  3PRP B;  1V5O A;  2L7R A;  1C1Y B;  4RM8 A;  2MBO A;  4Q2J A;  2KNB A;  3APF A;  3M3J A;  3ZQ4 A;  3RCZ A;  3RNF C;  1IYF A;  2WXM A;  1N62 A;  3CST A;  2FIF A;  4DHJ B;  4OZB A;  3GB1 A;  1XT9 B;  1XLO A;  3HM6 X;  4B0M A;  2LRU A;  2GB1 A;  3N1Z C;  3QAR A;  3DBH B;  2BWF A;  3PLV A;  2ICI A;  4RNA A;  4A20 A;  2N7E A;  3IHP C;  1ZP0 B;  2J52 A;  1OTR B;  2BS3 B;  2N1W A;  2K9X A;  2INP E;  2PLP A;  1U4A A;  4RGM A;  1NBF C;  3MHS D;  1R4M I;  1WRI A;  4HJG E;  1UH6 A;  2W82 A;  1L4D B;  5DPT A;  3LYY A;  2KWD A;  3RN9 C;  2LVQ A;  1TYG B;  4IDI A;  3KWV A;  2L3Z A;  1ZKH A;  2JPH A;  2NBW B;  2LFI A;  3SDL C;  3AE1 B;  1IBX B;  3QHT A;  4XGA B;  1XCQ L;  3R8B A;  1RFA A;  1UUP A;  4WIP A;  3M63 B;  1OGW A;  2ZVN A;  1D5Z C;  1KM7 A;  2HTM E;  2JZZ A;  2KDF B;  3VR9 B;  2KC2 A;  3DDC B;  1MI0 A;  3CSF A;  4KVG B;  2MJD A;  1WGR A;  3NS1 A;  5IOI A;  3ETR A;  1N60 A;  2H89 B;  2QSD A;  3AE7 B;  1E90 A;  2KVR A;  2IO2 B;  3HIZ A;  2BKR B;  5IO9 A;  1OFF A;  2JRH A;  1T6B X;  1WXQ A;  2HJ1 A;  2BB6 A;  2WS3 B;  1WX7 A;  5DPS A;  1L4Z B;  2LWP A;  2PW9 A;  4DHZ B;  4FJV B;  3R7R A;  4IWQ A;  3TUO A;  4XC2 A;  1LQB A;  5CHV C;  2BYV E;  3PHW B;  2WDR B;  3TMP B;  1CZP A;  1WR1 A;  3QJZ A;  1VZ6 A;  2LUE A;  3LDZ E;  1F9J A;  3ZIM A;  2ASQ A;  4ZYN A;  1WGK A;  1HA5 A;  2IY0 B;  3IVF A;  5EDS A;  1V1P B;  4I6P A;  4K7S A;  4WUR A;  1YX6 B;  4W9J A;  1FD6 A;  2OJW A;  3ZLZ A;  3ENE A;  3P1M A;  3DBL I;  2NR2 A;  4MT5 A;  1WFY A;  4YTM B;  2MH7 A;  3GP7 A;  5C1Z A;  2CU3 A;  2MBB B;  5D7G A;  2WQY B;  1YQB A;  2ZNV C;  3IBE A;  1P98 A;  2LVO A;  3N1Y C;  1KFY B;  1WGY A;  3TSS A;  3OJ4 B;  3OLM D;  5L95 C;  3MHZ A;  2L1A A;  3DVN U;  2AWT A;  1V9J A;  4TSS A;  4TMA B;  3UQB A;  3X0W A;  2V1Y A;  3RT3 B;  1H7W A;  2CR5 A;  1EUV B;  3MC9 A;  5BYQ A;  3ZTC A;  2B76 B;  2KX3 A;  3ML8 A;  4G50 A;  2WXG A;  4RH6 A;  2FCM A;  3PGE A;  2D11 A;  5FKA C;  1N61 A;  2G4D B;  4MSM B;  2XNA C;  4ZHP A;  4GU2 A;  1B9R A;  2L83 A;  3VRB B;  3BWU D;  3PZ8 A;  1J0G A;  2Q5W D;  3VRA B;  3NY5 A;  1FRD A;  5AZG A;  4ZDV A;  4NJ7 A;  2BB5 A;  4DQO C;  2NPT B;  3C19 A;  2QMT A;  1KJT A;  3I57 A;  4AS1 A;  4WAA A;  3PO0 A;  2LI5 A;  3AE3 B;  1ISN A;  2KQ4 X;  2KLC A;  3R7Q A;  2KXJ A;  1UD7 A;  4NAM A;  4JWS C;  2WXQ A;  3FIL A;  1RAX A;  2JXX A;  1UWX A;  3PHX B;  4TQ1 A;  3ALB A;  2IGD A;  5AZF A;  2MBE A;  4M8M A;  2ACZ B;  2PE6 B;  2OHF A;  1GUA B;  4CHK A;  4ZYS A;  1ZE3 D;  1R4N I;  3BYY B;  1FNV A;  1YN3 A;  3ZYY X;  5G55 A;  1ZDV A;  3IFW B;  3L13 A;  1ET6 A;  4KZC A;  2R2O A;  4HRO A;  4LTU A;  3AV8 A;  2DWQ A;  2HDE A;  3KUC B;  1VRA B;  3VTU A;  1PGA A;  1WJ4 A;  3AI5 A;  3DHH C;  3I63 C;  3CF4 A;  1LFD A;  2KVZ A;  4ZHO A;  3NG0 A;  1YOV B;  3FC4 A;  4ZRK A;  4JGH B;  1J8C A;  3KWL A;  2L0F A;  1H4R A;  1SE9 A;  2BYT A;  2IY1 B;  3U7D A;  4IKG A;  3WAN A;  1Q0W B;  4A55 A;  4EUT A;  2BT6 A;  3UIN B;  1FXT B;  3JYU A;  3EEC A;  2WXK A;  1WXA A;  4HWI B;  1J7B A;  3RZF A;  3IXS A;  4FLH A;  2GBM A;  2LGY A;  4C4V B;  1E10 A;  3PZD A;  4USA A;  3L17 A;  1UZX B;  2PE9 A;  3TEY A;  4C7Z A;  3PRZ A;  3ZXV A;  1I4Q A;  3ZJT A;  4GDL B;  2E6X A;  1LO5 D;  5AUI A;  1A70 A;  3W5V B;  2AQ1 B;  1NVI D;  3VHT C;  2AL6 A;  1YD8 U;  4JLC A;  3CWI A;  3URY A;  2WXL A;  5TSS A;  2EKE C;  5BMI A;  1KTK A;  2JZ3 B;  3LJ3 A;  1L0X B;  3AN1 A;  5E6O A;  1Z5S B;  1EF1 A;  2KX0 A;  4MH0 E;  3RYT A;  1PFD A;  1J7A A;  4W9G A;  4XZ4 A;  3AEE B;  2JVC A;  1K50 A;  1NEK B;  4GMV A;  4A3O A;  1GC7 A;  3W9C B;  2J4X A;  3SFD B;  1OQY A;  2VZK D;  2PPH A;  2ZZP B;  1EF5 A;  2GRI A;  1V2Y A;  3MP9 A;  2ZW1 A;  2AQ3 B;  4WJP A;  4MSQ B;  2LHE A;  2M8S A;  3DQV A;  5DPR A;  1R4M B;  3H1U A;  1WWT A;  3AE5 B;  1E7P B;  4LNF A;  1RM6 C;  2R2Q A;  4KIK A;  3VR8 B;  4URK A;  3UIP B;  3P2B A;  3PRE A;  1DYQ A;  3RNG C;  2WWZ A;  3KUD B;  4MM3 A;  3RMK C;  2L05 A;  4KSK C;  1XLP A;  4MEM A;  2CS4 A;  5CTR C;  1KRH A;  1QT9 A;  1PGX A;  1PGB A;  1XCT L;  2GBN A;  3R3M A;  1UWM A;  1UEL A;  4W9C A;  2B3A A;  3PTF C;  1WYW B;  1L2N A;  2QIL A;  1WXS A;  4GGQ A;  1P0R A;  2O6V A;  4HKZ E;  3AE6 B;  2XEW A;  2L76 A;  3JSV A;  2Y5B B;  2INC C;  2KDI A;  2EMS A;  1FO4 A;  3L54 A;  2D3C A;  2K6D B;  4GXB A;  1SJH D;  3NOB A;  2KMC A;  1WGG A;  4IC7 B;  2J0M A;  3NUH B;  3PPA A;  4IWO A;  2O2V B;  2Z0D B;  2WNM A;  4CQN A;  5HKH A;  1YIW A;  4EE2 A;  3B2F A;  2MP2 A;  1ZXI A;  5BMG A;  1R7S A;  1YJI A;  3RPF C;  2IDY A;  3V6C B;  2BWE S;  1FM0 D;  1LGR A;  3O13 A;  2QC8 A;  1KF6 B;  2RGF A;  3EFC A;  4HKQ A;  2EMT A;  3RUL A;  4BAX A;  1V97 A;  3NZU A;  1TY0 A;  2VZK B;  4YT0 B;  2M1M A;  2LJI A;  4RGN A;  3OJ3 A;  2WDV B;  1FPY A;  2VH2 A;  3C0R B;  1DOY A;  4AP4 C;  3P42 A;  4IW0 A;  1XQQ A;  3CF6 E;  2DBY A;  1T0Q C;  1F77 A;  4CO7 A;  2I1K A;  3VTV A;  4MJS A;  3U52 E;  4HDQ A;  2RSU A;  2ZPY A;  1P9D U;  4HRS A;  2TSS A;  3B08 A;  2PVG C;  1QF6 A;  2LZ6 A;  1DOX A;  2BQQ A;  2LMC A;  2ZEQ A;  1J19 A;  1LM8 B;  3AMZ A;  1ROE A;  4KDI C;  1OEY A;  3BVM A;  3TCA A;  1S1Q B;  4HDO A;  1WM3 A;  2RDG A;  1SE2 A;  3VUY A;  1HZ6 A;  3PS6 A;  4LNK A;  1N6Z A;  3V3X A;  1SGH A;  3VXW A;  5FK9 C;  4X57 B;  3U8Z A;  2JSV X;  2Z0E B;  2KTF A;  4NAW A;  2LRW A;  4S17 A;  4DDI D;  2HD5 B;  4WQO B;  4HJK A;  3ZRF A;  1GB4 A;  2BPS A;  4N59 A;  3QAQ A;  4WJN A;  5JZE B;  2L00 B;  3A1Q B;  2KDB A;  3T3O A;  3RNE C;  4BOS C;  2C7H A;  3I3T B;  2J0K A;  1WJN A;  4K3B A;  1PDX A;  1XLQ A;  2IGG A;  2CJN A;  2JUO A;  1MJD A;  2W3R A;  3EFU A;  3WAO A;  3QX1 A;  2JRI B;  4EKU A;  4JPS A;  2MA9 B;  1FCC C;  2AYO B;  3NJT A;  2QCZ A;  1FXA A;  1WR6 E;  1F2R C;  3ZKJ C;  4A8X C;  2CHX A;  3NS8 A;  3ZVV A;  2NTS A;  1RRB A;  4NJ6 A;  3B0A A;  1WE7 A;  2OOB B;  3KLS X;  3N1X C;  4GIV A;  3U30 A;  5I4D A;  1C4C A;  1WX8 A;  4WWM A;  4ZOH C;  2KT7 A;  2DZK A;  3BK1 A;  3VDZ A;  1RWS A;  5CHW A;  1WJ6 A;  1WYG A;  3AED B;  1UGM A;  2K1F A;  1AAR A;  3DBR B;  2C7N B;  3U4E G;  5TR5 A;  2CHW A;  1V86 A;  1D5M C;  4OVU A;  1WI0 A;  2BKF A;  3HK0 A;  3VUX A;  1VZ7 A;  2YVC A;  1P3Q U;  5CX3 A;  1SSN A;  4QAY A;  2ZJD A;  3H7P B;  2M17 A;  3O65 B;  4KGR A;  2K8H A;  2JWZ A;  4YSY B;  1ET9 A;  2PJH A;  2D3G A;  5IKC M;  3IT4 B;  5EE0 A;  3AM9 A;  4C80 A;  1YN5 A;  2G4S A;  3P4R B;  5IA7 A;  2D3A A;  4C56 C;  5E6P A;  5E6N A;  2JF5 A;  1I4H A;  2SAK A;  3PSE B;  3DVG Y;  3RNA C;  1C4P A;  1BUI C;  5GMV A;  4YSX B;  3SEB A;  2KKC A;  1JWA D;  4XWT A;  1VD2 A;  2W55 A;  2DX5 B;  2N1V A;  3KH0 A;  1NDD A;  3RZW C;  4HLE A;  5J18 A;  5HG2 A;  3DCG A;  1JQ4 A;  3M95 A;  4US9 A;  5C23 A;  1EO6 A;  2K39 A;  3H6N A;  2K0P A;  1HTO A;  2Y5C A;  1Y8R C;  2J53 A;  4FUL A;  1NYR A;  3DHG C;  1M94 A;  3T9L A;  3FIL B;  4GN1 A;  3PRM B;  2ZCC A;  3V05 A;  4MH8 A;  4AWJ A;  3P63 A;  4TUU A;  4M01 A;  2A4Z A;  1PYW D;  3APC A;  2L52 A;  4KZ0 A;  3MJW A;  1FRR A;  4NPN A;  2DZM A;  2LGD A;  3RNC C;  3KW5 B;  1TS2 A;  3ZTD A;  4REZ A;  1XLN A;  3TL5 A;  1EWY C;  1EWC A;  4ZRQ A;  1CMX B;  4DXF A;  1WRD B;  4IM3 A;  2AL3 A;  2LJ5 A;  3B9J A;  1L0V B;  1FCL A;  1E7U A;  1L6V A;  4M8N A;  4PYU A;  5FR6 A;  3SR6 A;  2KFK B;  5JXV A;  1NI2 A;  1WH3 A;  2PIA A;  4F8C B;  3VVW B;  3A9K A;  3P4P B;  1Y56 A;  4NY0 A;  5KHQ A;  4N58 A;  2AEH A;  2WYQ A;  3UQA A;  1MPE A;  2KQ7 A;  1CQV A;  2ON8 A;  3TEW A;  2KZR A;  1KH0 A;  1BT0 A;  3SFE B;  4IM0 A;  1AN8 A;  2MHJ A;  2K3U A;  2O6V D;  1N63 A;  4JX1 C;  3VFK A;  2JZP A;  2MRP A;  2C9W B;  3MJ5 A;  3ZDT A;  4WH4 A;  1MHH E;  2IBI B;  3CIR B;  2V0G A;  1HE8 A;  1XO3 A;  4PYZ A;  1TKY A;  2GBK A;  2GBR A;  2XK5 B;  2V3S A;  3DWM A;  2FAZ A;  1TJE A;  4G11 A;  4CYE A;  2KN5 A;  3OWE B;  3AEB B;  1IPG A;  1RYJ A;  3K9P B;  1ENF A;  4GSW A;  2X8X X;  3NZ3 A;  1G6J A;  3RD2 A;  2FID A;  1EU4 A;  5LLI A;  2DNF A;  1E8W A;  2KJR A;  1S3S G;  1AW7 A;  5L83 A;  4P6V F;  4S0R A;  3AUL A;  1TBE A;  1XD3 B;  2DZI A;  1SXT A;  4KKJ A;  4LDT D;  1E8Z A;  3ECI A;  1DGJ A;  4FHK A;  4WQM A;  4KIK B;  4E74 A;  3ABV B;  2RPV A;  1X1M A;  3JW0 X;  4FJZ A;  3V62 A;  4K3C A;  2Z8L A;  1C79 A;  3Q3M C;  3NHE B;  1ESF A;  3QCA A;  2PKO A;  5J17 A;  4E71 A;  4HVB A;  1JW9 D;  3EUB 2;  1E8Y A;  1GC6 A;  2KQS A;  3A9J B;  1QOF A;  3TEZ A;  2ZW0 A;  2KFJ A;  1FNW A;  3KYC D;  1F2R I;  2NPT A;  3KQ4 A;  3IT6 B;  4AOF A;  3DVN V;  4KX6 B;  3OG5 A;  1ZXH A;  3ML9 A;  1SEB D;  2BF8 B;  5D3D A; 
#chains in the Genus database with same CATH homology
 2K9X A;  2INP E;  2PLP A;  4RGM A;  1V97 A;  3E56 A;  1WRI A;  1P7E A;  1MVK A;  4HJG E;  1YQ3 B;  1TY0 A;  2W82 A;  4XDC A;  2VZK B;  3W1S A;  1L4D B;  1FXI A;  4YT0 B;  2NMQ A;  2LJI A;  2WU2 B;  3LYY A;  4A9A A;  3PZ7 A;  2KWD A;  3Q8E A;  4YTN B;  1TYG B;  2NTT A;  4IDI A;  4RGN A;  3Q69 A;  3KWV A;  2Y3A A;  2WDV B;  2JWU A;  4A6Q A;  1GAQ B;  2KAC A;  1RFK A;  2W54 A;  1DOY A;  1IGC A;  4PT5 A;  3P42 A;  2LFI A;  2DBY A;  3B2G A;  3AEA B;  3AE1 B;  1IBX B;  1F0Z A;  1D6E C;  1F77 A;  1YJJ A;  3AE4 B;  1ZUD 2;  1XCQ L;  1K51 A;  1HQR D;  3R8B A;  1UUP A;  4WIP A;  2FBW B;  1CJE A;  1D5Z C;  3NRZ A;  3U7Z A;  2HTM E;  3U52 E;  1WSP A;  3VR9 B;  4HRS A;  1MI0 A;  2H88 B;  4YSZ B;  2TSS A;  2X38 A;  2MJD A;  2PVG C;  3DWG C;  5GXG B;  1QF6 A;  1VDV A;  1SB3 C;  1DOX A;  3NS1 A;  2LMC A;  3ETR A;  3AMZ A;  1ROE A;  1N60 A;  2H89 B;  1V1P A;  2QSD A;  5D3D A;  1DOI A;  1Q10 A;  3AE7 B;  2BS2 B;  3BVM A;  2RMM A;  1V8C A;  1I4P A;  2WXN A;  5BYS A;  4RGO S;  2RDG A;  2LEK A;  3ZJU A;  4US8 A;  1OFF A;  4YTP B;  5HI1 A;  1SE2 A;  1T6B X;  1WXQ A;  2JXT A;  1HZ6 A;  2BB6 A;  2DYM A;  2WS3 B;  3V3X A;  4HEA 1;  1L4Z B;  2PW9 A;  5FK9 C;  2J42 A;  1TKE A;  2JSV X;  4ARC A;  1N5X A;  3TUO A;  1ACC A;  1AWD A;  2JQR B;  2WXH A;  1NI3 A;  3AEC B;  4FXC A;  3WCQ A;  5C2T B;  2WDR B;  1SF0 A;  1C77 A;  1CZP A;  4L2Y A;  1GB4 A;  1VZ6 A;  5G5H A;  3J9C A;  1JWU D;  1L6U A;  1TY2 A;  1JRO A;  2BW2 A;  4N59 A;  2JX5 A;  1QKZ A;  3FAH A;  3MC0 B;  1QQR A;  1B1Z A;  4C7Y A;  4KGS A;  1WGK A;  1HA5 A;  4OZC A;  3T3O A;  1I7H A;  3BZD B;  1V1P B;  2N9K A;  2KMM A;  4WUR A;  1PDX A;  1XLQ A;  2IGG A;  2CJN A;  4OZA A;  2K5P A;  4LK0 M;  4OVZ A;  1FD6 A;  4IOI E;  3Q8A A;  1T3Q A;  2W3R A;  1IUE A;  1SJE D;  1ZDX A;  3P1M A;  4MM3 B;  3I9V 1;  4MT5 A;  4YTM B;  2MH7 A;  3GP7 A;  4JWU C;  4JPS A;  4YWG G;  1FCC C;  4RF0 A;  2CU3 A;  5D7G A;  2WQY B;  1OQQ A;  1TS4 A;  5C3J B;  2AQ2 B;  4R3D A;  2YEP B;  3E9S A;  1KFY B;  3TSS A;  1QLB B;  1YMH E;  2JYT A;  1FXA A;  2L1A A;  3MHZ A;  2CJO A;  1SIJ A;  1F2R C;  1L0Y B;  4A8X C;  1FFV A;  4TSS A;  2NTS A;  3BYT B;  4TMA B;  3U2S C;  1TKG A;  2WXF A;  4OHJ A;  4KKI A;  3KLS X;  5I4D A;  1H7W A;  1PUT A;  5BYQ A;  1C4C A;  2LUM A;  2DYO A;  1E0Z A;  4WWM A;  4ZOH C;  2B76 B;  4J3O D;  3BK1 A;  1ZOY B;  1RWS A;  1GB1 A;  1WYG A;  4XWW A;  3AED B;  1JAL A;  2ONQ A;  2WXG A;  4RH6 A;  1XF5 L;  2XN9 C;  1YQ4 B;  5FKA C;  3U4E G;  1N61 A;  1KLG D;  1BXT A;  1D5M C;  1XEE A;  1K52 A;  2BBC A;  1VZ7 A;  2XNA C;  4ZHP A;  3AE9 B;  2OED A;  1GTH A;  1SSN A;  1B9R A;  2L83 A;  1GOZ A;  3VRB B;  1UGJ A;  3BWU D;  3PZ8 A;  2Q5W D;  1IGD A;  3VRA B;  5EE3 A;  1FRD A;  1P7F A;  4KGR A;  1HEZ E;  4YSY B;  1ET9 A;  4ARI A;  1NYQ A;  2N7J A;  2BB5 A;  4DQO C;  3IT4 B;  2V3N A;  1JWB D;  2L32 A;  1H7X A;  5EE0 A;  2Y5P A;  4NJC A;  2V3P A;  2QMT A;  2KDM A;  3BII D;  3AM9 A;  3I57 A;  4C80 A;  3W5U B;  4AS1 A;  2RDH A;  3PO0 A;  1YN5 A;  4RGT A;  3AE3 B;  1I4R A;  2KQ4 X;  5D3I B;  3AE2 B;  3P4R B;  2WXO A;  4C56 C;  3P4S B;  4NAM A;  4JWS C;  2WXQ A;  3FIL A;  2SAK A;  1I4H A;  5BYR A;  4TQ0 A;  2M56 B;  1UWX A;  4TQ1 A;  3GS2 A;  1C4P A;  1BUI C;  2WLB A;  1EU3 A;  4YSX B;  2IGD A;  3C8Y A;  2ACZ B;  3SEB A;  1ZPS A;  2OHF A;  3UI3 A;  1JWA D;  1TS3 A;  2IGH A;  2WDQ B;  4ZYS A;  1ZE3 D;  4XWT A;  2N9L A;  3BYY B;  2W55 A;  1FNV A;  1YN3 A;  2WXR A;  3ZYY X;  4DXG A;  1ZDV A;  1HXY D;  1QOG A;  2K22 A;  3BVZ A;  3AH7 A;  1SBB B;  1ET6 A;  4RF1 A;  2EEL A;  5LNK 1;  4HRO A;  4LTU A;  4OW0 A;  5HG2 A;  2LHD A;  1JQ4 A;  4US9 A;  3AV8 A;  3EA6 A;  1FNU A;  4P16 A;  3LB8 C;  2DWQ A;  4D2K A;  2MEK A;  2K0P A;  1FMA D;  2HDE A;  4UDU C;  2Y5C A;  1GPX A;  1VRA B;  2N0S B;  1PGA A;  1UNS A;  3L4P A;  2J53 A;  1NYR A;  2D5G A;  5G5G A;  1GT8 A;  4H2A A;  4B0E A;  3CF4 A;  2JU6 X;  2WXI A;  3BVG A;  4ZHO A;  3FIL B;  1OQR A;  1CK1 A;  5AUK A;  3V05 A;  4MH8 A;  2LGI A;  3P63 A;  1FFU A;  3FC4 A;  1GTE A;  1PYW D;  2L52 A;  1E6E B;  3KWL A;  2M0A A;  4JE3 B;  1YNT E;  4RCO A;  2BYT A;  3RFZ B;  1FRR A;  3NVZ A;  1E9M A;  4IKG A;  1L5P A;  4NAW B;  2GI9 A;  2IJ0 A;  5EE9 A;  4A55 A;  1NEN B;  2WP9 B;  2BT6 A;  1TS2 A;  4AQ7 A;  1I4G A;  1HZ5 A;  2PMV A;  4REZ A;  1XLN A;  1EWY C;  5MPO A;  1EWC A;  2WXK A;  4ZRQ A;  4DXF A;  4NZL B;  1J7B A;  1JWS D;  3HVZ A;  3AEG B;  2WU5 B;  2MJ3 A;  2QJL A;  2EKI A;  3ZJV A;  3IXS A;  3NVW A;  1EM7 A;  3B9J A;  2I38 A;  1FEH A;  2E3T A;  1L0V B;  4YXD B;  5T8I A;  1FCL A;  1E10 A;  1L6V A;  2AX5 A;  2V4I B;  3BK2 A;  4USA A;  3SR6 A;  1KLU D;  3TEX A;  3TEY A;  5JXV A;  4C7Z A;  3R2T A;  5BMH A;  2PIA A;  3ZGZ A;  1JRP A;  1I4Q A;  3ZJT A;  4GDL B;  1J7C A;  5FR3 A;  3Q8F A;  3P4P B;  1Y56 A;  2E6X A;  4ITK A;  1LO5 D;  5AUI A;  1A70 A;  1QIL A;  2G9H D;  2AQ1 B;  1NVI D;  4N58 A;  3W5V B;  1JCK B;  1K53 A;  1VLB A;  2MJE A;  3HRD D;  2PVO D;  4A90 A;  1QOA A;  3URY A;  3CWI A;  1D4B A;  1MPE A;  2WXL A;  5TSS A;  1JML A;  3LXF A;  5BMI A;  1KTK A;  1CQV A;  3IAS 1;  2WXJ A;  1L0X B;  3AN1 A;  2ON8 A;  3TEW A;  3R2I A;  1KH0 A;  3SFE B;  2QEJ C;  1AN8 A;  1YN4 A;  2K3U A;  1PFD A;  2I2Y A;  4LLG M;  1J7A A;  1N63 A;  4JX1 C;  1V1O A;  2JZP A;  3AEE B;  1K50 A;  1NEK B;  1I4X A;  3W9C B;  2J4X A;  3SFD B;  4XDD A;  2VZK D;  3MJ5 A;  2BS4 B;  2GRI A;  4L1B A;  2PTL A;  1FIQ A;  4WH4 A;  5E6J A;  1MHH E;  3CIR B;  3MP9 A;  2V0G A;  1XO3 A;  2ZW1 A;  2AQ3 B;  4KGT A;  2LHE A;  2W3S A;  1C76 A;  3AE8 B;  1QOB A;  2KAJ A;  1VJK A;  2WXP A;  1TKY A;  1WWT A;  2FE8 A;  3AE5 B;  1E7P B;  1STE A;  5EE1 A;  3DWM A;  2IPK D;  1T5X D;  1RM6 C;  2M19 A;  1TZO A;  3Q8B A;  5HFY A;  3VR8 B;  1TJE A;  1DYQ A;  3N9Y C;  3HVD A;  3OWE B;  3AEB B;  2QIE B;  2BTE A;  1RYJ A;  5HHD G;  2FUG 1;  1C4A A;  1ENF A;  4GLS C;  1AYF A;  3NZ3 A;  2JYE A;  1XLP A;  4ZRP A;  2KN4 A;  4O1N A;  3W2D A;  1MHX A;  1KRH A;  1EU4 A;  3AEF B;  1QT9 A;  4L23 A;  1PGX A;  1PGB A;  1XCT L;  1C9F A;  1UWM A;  2G1E A;  1XXG A;  2YEP F;  4XE0 A;  1AW7 A;  1C78 A;  4M0W A;  4P6V F;  2DLB A;  3NVV A;  2QIL A;  3P4Q B;  1D5X C;  4GDK B;  1SE4 A;  5H92 C;  4N6E B;  4WAF A;  1SXT A;  3AE6 B;  4HKZ E;  4KKJ A;  3H8H A;  5H8Y E;  3NVY A;  3AB5 A;  1TS5 A;  1VR9 A;  3MFG A;  3VQI A;  1DGJ A;  4WQM A;  3ABV B;  1FO4 A;  2RPV A;  1SJH D;  1VZ8 A;  3NUH B;  1BML C;  2WNM A;  4CQN A;  2Z8L A;  4Q2J A;  1C79 A;  2R61 A;  1ESF A;  3ZQ4 A;  2SEB D;  3T3N A;  2PKO A;  2WXM A;  1N62 A;  4MAC A;  4OZB A;  3Q8C A;  1IBX A;  4EE2 A;  3GB1 A;  3B2F A;  1N5W A;  1XLO A;  1JW9 D;  3EUB 2;  3HUI A;  1ZXI A;  5BMG A;  4B0M A;  1R7S A;  2GB1 A;  4RFB A;  1YJI A;  1M4V A;  3RPF C;  2IDY A;  3IAM 1;  3EGR A;  1QOF A;  3TEZ A;  2ZW0 A;  1FNW A;  2ICI A;  1F2R I;  1FM0 D;  3O13 A;  1JWM D;  4RNA A;  3KQ4 A;  1KF6 B;  3IT6 B;  2INN E;  1ZP0 B;  2J52 A;  4KX6 B;  4HKQ A;  1ZXH A;  2BS3 B;  1SEB D;  1SE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...