3VR8D

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
b'TSAAVTGAAPPQFDPIAAEKGFKPLHSHGTLFKIERYFAAAMVPLIPAAYFIHGREMDLCLALALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAYIFTACLLAGLLYFNEHDVGLTRAFEMVWEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 34
structure length 129
sequence length 129
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF05328 CybS CybS, succinate dehydrogenase cytochrome B small subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1300.10 Mainly Alpha Up-down Bundle 3 helical TM bundles of succinate and fumarate reductases Fumarate reductase/succinate dehydrogenase, transmembrane subunit 3vr8D00
1NENC 3AEAC 3AE3C 2WU2C 3P4RD 3ABVD 3P4PD 3VRAC 3AEDD 2B76D 2FBWC 2WQYC 4YTNC 4YSXC 3VRBD 3P4QD 3AE5C 4YXDD 1QLBC 3AE9D 2BS2C 2H89C 2WDQD 3VR9C 4YTPC 3P4SD 3AE2D 3SFDD 3AECC 2WP9D 5C2TC 2WS3C 3VR8C 2ACZD 3AE4C 2WU5D 1KFYC 1NEND 3AEAD 3AE3D 2WU2D 3AEGC 4KX6C 3VRAD 2H88C 3AE6C 4YT0C 3AEEC 2WDVC 2FBWD 3AE7C 4YSXD 4YTND 1NEKC 5C3JD 3AE5D 3CIRC 4YSZC 3SFEC 3AE8C 2H89D 3AEBC 3VR9D 2BS3C 3AECD 5C2TD 2WS3D 3AE1C 3VR8D 3P4QC 4YTMC 1ZOYC 1ZP0C 1YQ3C 3AE4D 1L0VC 1KFYD 1KF6C 3AEGD 2WDRC 4KX6D 2H88D 1YQ4C 4YSYC 3AE2C 3AE6D 4YT0D 2WQYD 1E7PC 3AEFC 2WDVD 3AE7D 1NEKD 3P4RC 3ABVC 3P4PC 3CIRD 4YSZD 3SFED 4YTPD 3AE8D 2BS4C 3AEBD 3AEDC 2B76C 3VRBC 3AE1D 4YXDC 3AE9C 4YTMD 1ZOYD 1ZP0D 1YQ3D 5C3JC 1L0VD 2WDQC 1KF6D 3P4SC 3SFDC 2WDRD 1YQ4D 2WP9C 3AEED 4YSYD 2ACZC 3AEFD 2WU5C
chains in the Genus database with same CATH superfamily
1NENC 3AEAC 3AE3C 2WU2C 3P4RD 3ABVD 3P4PD 3VRAC 3AEDD 2B76D 2FBWC 2WQYC 4YTNC 4YSXC 4DHIB 3VRBD 3P4QD 3AE5C 4YXDD 1QLBC 3AE9D 2BS2C 4I6LA 2H89C 2WDQD 3VR9C 4YTPC 3P4SD 3AE2D 3SFDD 3AECC 4DDIA 2ZFYA 2WP9D 5C2TC 2WS3C 3VR8C 4DDGA 2ACZD 3AE4C 2WU5D 4LDTA 1KFYC 4DHJA 1NEND 3AEAD 3AE3D 2WU2D 3AEGC 4KX6C 3VRAD 2H88C 3AE6C 4YT0C 3AEEC 2WDVC 2FBWD 3AE7C 4YSXD 4YTND 1NEKC 5C3JD 3AE5D 3CIRC 4YSZC 3SFEC 3AE8C 2H89D 3AEBC 3VR9D 2BS3C 3AECD 5C2TD 2WS3D 3AE1C 3VR8D 3P4QC 4YTMC 1ZOYC 1ZP0C 1YQ3C 3AE4D 1L0VC 1KFYD 4DHZA 1KF6C 4FJVA 3AEGD 2WDRC 4KX6D 2H88D 3VONA 1YQ4C 4YSYC 3AE2C 3AE6D 4YT0D 2WQYD 1E7PC 3AEFC 2WDVD 3AE7D 1NEKD 3P4RC 3ABVC 3P4PC 3CIRD 4YSZD 3SFED 4YTPD 1TFFA 3AE8D 2BS4C 3AEBD 3AEDC 2B76C 3VRBC 3AE1D 4YXDC 3AE9C 4YTMD 1ZOYD 1ZP0D 1YQ3D 5C3JC 1L0VD 2WDQC 1KF6D 3P4SC 3SFDC 2WDRD 1YQ4D 2WP9C 3AEED 4YSYD 2ACZC 3AEFD 2WU5C
chains in the Genus database with same CATH topology
1NENC 3AEAC 3AE3C 2WU2C 3P4RD 3ABVD 3P4PD 3VRAC 3AEDD 2B76D 2FBWC 2WQYC 4YTNC 4YSXC 3VRBD 3P4QD 3AE5C 4YXDD 1QLBC 3AE9D 2BS2C 2H89C 2WDQD 3VR9C 4YTPC 3P4SD 3AE2D 3SFDD 3AECC 2WP9D 5C2TC 2WS3C 3VR8C 2ACZD 3AE4C 2WU5D 1KFYC 1NEND 3AEAD 3AE3D 2WU2D 3AEGC 4KX6C 3VRAD 2H88C 3AE6C 4YT0C 3AEEC 2WDVC 2FBWD 3AE7C 4YSXD 4YTND 1NEKC 5C3JD 3AE5D 3CIRC 4YSZC 3SFEC 3AE8C 2H89D 3AEBC 3VR9D 2BS3C 3AECD 5C2TD 2WS3D 3AE1C 3VR8D 3P4QC 4YTMC 1ZOYC 1ZP0C 1YQ3C 3AE4D 1L0VC 1KFYD 1KF6C 3AEGD 2WDRC 4KX6D 2H88D 1YQ4C 4YSYC 3AE2C 3AE6D 4YT0D 2WQYD 1E7PC 3AEFC 2WDVD 3AE7D 1NEKD 3P4RC 3ABVC 3P4PC 3CIRD 4YSZD 3SFED 4YTPD 3AE8D 2BS4C 3AEBD 3AEDC 2B76C 3VRBC 3AE1D 4YXDC 3AE9C 4YTMD 1ZOYD 1ZP0D 1YQ3D 5C3JC 1L0VD 2WDQC 1KF6D 3P4SC 3SFDC 2WDRD 1YQ4D 2WP9C 3AEED 4YSYD 2ACZC 3AEFD 2WU5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEN C;  3AEA C;  3AE3 C;  2WU2 C;  3P4R D;  3ABV D;  3P4P D;  3VRA C;  3AED D;  2B76 D;  2FBW C;  2WQY C;  4YTN C;  4YSX C;  3VRB D;  3P4Q D;  3AE5 C;  4YXD D;  1QLB C;  3AE9 D;  2BS2 C;  2H89 C;  2WDQ D;  3VR9 C;  4YTP C;  3P4S D;  3AE2 D;  3SFD D;  3AEC C;  2WP9 D;  5C2T C;  2WS3 C;  3VR8 C;  2ACZ D;  3AE4 C;  2WU5 D;  1KFY C;  1NEN D;  3AEA D;  3AE3 D;  2WU2 D;  3AEG C;  4KX6 C;  3VRA D;  2H88 C;  3AE6 C;  4YT0 C;  3AEE C;  2WDV C;  2FBW D;  3AE7 C;  4YSX D;  4YTN D;  1NEK C;  5C3J D;  3AE5 D;  3CIR C;  4YSZ C;  3SFE C;  3AE8 C;  2H89 D;  3AEB C;  3VR9 D;  2BS3 C;  3AEC D;  5C2T D;  2WS3 D;  3AE1 C;  3VR8 D;  3P4Q C;  4YTM C;  1ZOY C;  1ZP0 C;  1YQ3 C;  3AE4 D;  1L0V C;  1KFY D;  1KF6 C;  3AEG D;  2WDR C;  4KX6 D;  2H88 D;  1YQ4 C;  4YSY C;  3AE2 C;  3AE6 D;  4YT0 D;  2WQY D;  1E7P C;  3AEF C;  2WDV D;  3AE7 D;  1NEK D;  3P4R C;  3ABV C;  3P4P C;  3CIR D;  4YSZ D;  3SFE D;  4YTP D;  3AE8 D;  2BS4 C;  3AEB D;  3AED C;  2B76 C;  3VRB C;  3AE1 D;  4YXD C;  3AE9 C;  4YTM D;  1ZOY D;  1ZP0 D;  1YQ3 D;  5C3J C;  1L0V D;  2WDQ C;  1KF6 D;  3P4S C;  3SFD C;  2WDR D;  1YQ4 D;  2WP9 C;  3AEE D;  4YSY D;  2ACZ C;  3AEF D;  2WU5 C; 
#chains in the Genus database with same CATH topology
 1NEN C;  3AEA C;  3AE3 C;  2WU2 C;  3P4R D;  3ABV D;  3P4P D;  3VRA C;  3AED D;  2B76 D;  2FBW C;  2WQY C;  4YTN C;  4YSX C;  4DHI B;  3VRB D;  3P4Q D;  3AE5 C;  4YXD D;  1QLB C;  3AE9 D;  2BS2 C;  4I6L A;  2H89 C;  2WDQ D;  3VR9 C;  4YTP C;  3P4S D;  3AE2 D;  3SFD D;  3AEC C;  4DDI A;  2ZFY A;  2WP9 D;  5C2T C;  2WS3 C;  3VR8 C;  4DDG A;  2ACZ D;  3AE4 C;  2WU5 D;  4LDT A;  1KFY C;  4DHJ A;  1NEN D;  3AEA D;  3AE3 D;  2WU2 D;  3AEG C;  4KX6 C;  3VRA D;  2H88 C;  3AE6 C;  4YT0 C;  3AEE C;  2WDV C;  2FBW D;  3AE7 C;  4YSX D;  4YTN D;  1NEK C;  5C3J D;  3AE5 D;  3CIR C;  4YSZ C;  3SFE C;  3AE8 C;  2H89 D;  3AEB C;  3VR9 D;  2BS3 C;  3AEC D;  5C2T D;  2WS3 D;  3AE1 C;  3VR8 D;  3P4Q C;  4YTM C;  1ZOY C;  1ZP0 C;  1YQ3 C;  3AE4 D;  1L0V C;  1KFY D;  4DHZ A;  1KF6 C;  4FJV A;  3AEG D;  2WDR C;  4KX6 D;  2H88 D;  3VON A;  1YQ4 C;  4YSY C;  3AE2 C;  3AE6 D;  4YT0 D;  2WQY D;  1E7P C;  3AEF C;  2WDV D;  3AE7 D;  1NEK D;  3P4R C;  3ABV C;  3P4P C;  3CIR D;  4YSZ D;  3SFE D;  4YTP D;  1TFF A;  3AE8 D;  2BS4 C;  3AEB D;  3AED C;  2B76 C;  3VRB C;  3AE1 D;  4YXD C;  3AE9 C;  4YTM D;  1ZOY D;  1ZP0 D;  1YQ3 D;  5C3J C;  1L0V D;  2WDQ C;  1KF6 D;  3P4S C;  3SFD C;  2WDR D;  1YQ4 D;  2WP9 C;  3AEE D;  4YSY D;  2ACZ C;  3AEF D;  2WU5 C; 
#chains in the Genus database with same CATH homology
 1NEN C;  3AEA C;  3AE3 C;  2WU2 C;  3P4R D;  3ABV D;  3P4P D;  3VRA C;  3AED D;  2B76 D;  2FBW C;  2WQY C;  4YTN C;  4YSX C;  3VRB D;  3P4Q D;  3AE5 C;  4YXD D;  1QLB C;  3AE9 D;  2BS2 C;  2H89 C;  2WDQ D;  3VR9 C;  4YTP C;  3P4S D;  3AE2 D;  3SFD D;  3AEC C;  2WP9 D;  5C2T C;  2WS3 C;  3VR8 C;  2ACZ D;  3AE4 C;  2WU5 D;  1KFY C;  1NEN D;  3AEA D;  3AE3 D;  2WU2 D;  3AEG C;  4KX6 C;  3VRA D;  2H88 C;  3AE6 C;  4YT0 C;  3AEE C;  2WDV C;  2FBW D;  3AE7 C;  4YSX D;  4YTN D;  1NEK C;  5C3J D;  3AE5 D;  3CIR C;  4YSZ C;  3SFE C;  3AE8 C;  2H89 D;  3AEB C;  3VR9 D;  2BS3 C;  3AEC D;  5C2T D;  2WS3 D;  3AE1 C;  3VR8 D;  3P4Q C;  4YTM C;  1ZOY C;  1ZP0 C;  1YQ3 C;  3AE4 D;  1L0V C;  1KFY D;  1KF6 C;  3AEG D;  2WDR C;  4KX6 D;  2H88 D;  1YQ4 C;  4YSY C;  3AE2 C;  3AE6 D;  4YT0 D;  2WQY D;  1E7P C;  3AEF C;  2WDV D;  3AE7 D;  1NEK D;  3P4R C;  3ABV C;  3P4P C;  3CIR D;  4YSZ D;  3SFE D;  4YTP D;  3AE8 D;  2BS4 C;  3AEB D;  3AED C;  2B76 C;  3VRB C;  3AE1 D;  4YXD C;  3AE9 C;  4YTM D;  1ZOY D;  1ZP0 D;  1YQ3 D;  5C3J C;  1L0V D;  2WDQ C;  1KF6 D;  3P4S C;  3SFD C;  2WDR D;  1YQ4 D;  2WP9 C;  3AEE D;  4YSY D;  2ACZ C;  3AEF D;  2WU5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...