3VRBA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
613
structure length
613
Chain Sequence
b'AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 196
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vrbA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vrbA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vrbA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vrbA04
3BHFA 1KNPA 2PHHA 1H81A 2YG7A 2YR4A 3AB1A 4B63A 2GV8A 3QFBA 4H4QA 4YWOA 3M13A 1CL0A 4UDQA 4J56A 2NPXA 1ZOYA 1CF3A 4JN9A 2C70A 2V61A 3NH3X 3NK0X 4H4TA 1F8RA 2YR6A 3NKSA 1PN0A 4K8DA 4AOXA 2WPCA 2WEUA 4WCTA 2BK4A 3NN6X 2C64A 3UKLA 1M64A 4U8KA 1X31B 3IC9A 5GRTA 3UTFA 1IUUA 2XVEA 1GPEA 3GMBA 1LV0A 4GDEA 2JAEA 2WPEA 1RSGA 4ZCCA 3VR9A 1ZOVA 1GSNA 4B1BA 1LQTA 1XPQA 2XYOA 3F8RA 3UOVA 2NVKX 3BI2A 2I0ZA 3LZWA 2BXRA 2B7SA 2WOWA 1L9CA 5L46A 3V76A 1RP0A 1F8WA 1OJ9A 4GDPA 3AE4A 3DJGX 3DK4A 3Q6JA 3GRTA 2RABA 2RGOA 2QA2A 4TM4A 3P4RA 4CCRA 2WP9A 1GV4A 1YQ4A 4KPRA 1B37A 3AE2A 5BVAA 1ZP0A 4YT0A 4HB9A 4EM4A 1FCDA 1CJCA 2GR2A 3AE6A 3PVCA 4GCMA 5TR3A 1K0JA 2FJDA 3AYLA 4USQA 5HHFA 1YKJA 2DKHA 2YLRA 3GDPA 4JY3A 1XANA 2AQJA 2CULA 3AE8A 3I6DA 4BK3A 5FS6A 1S3EA 4H4XA 2BACA 5FS9A 4K5RA 3NG7X 3CGCA 4LA1A 4C3XA 4OVIA 4B66A 4C3YA 3DK9A 3DJEA 3GRSA 4U2TA 1GRTA 1GTHA 1ZY8A 5U1OA 3UOXA 3CGDA 4BJYA 3B6DA 3H8LA 1N1PA 3C4AA 2EQ7A 4JNQA 1ONFA 1B4VA 1JRXA 4J36A 2R45A 3UTHA 2YLZA 1PBEA 5EB4A 4I59A 1EL5A 5GSNA 4H2QA 3UOZA 4J33A 3ITJA 3WE0A 4HA6A 2C66A 2ZZ0A 5JCKA 4DSGA 3DH9A 4YTNA 1N4WA 3P4PA 2OAMA 2LFCA 2UZZA 1K0LA 2B9YA 2BCPA 2E1MA 1IUWA 3UKKA 2B9WA 3BI5A 4M52A 1YQ3A 1H7WA 2XLPA 4Z24A 1S2QA 4CBQA 3CNPA 3GQHA 2C67A 2WDQA 4A6NA 2ACZA 1FEBA 1Y56B 1ZKQA 3IF9A 4Z26A 2BABA 3CIRA 1PBBA 2YG5A 4EIPA 3AEFA 2C3DA 4O5QA 1YY5A 2Q6UA 3PO7A 3UKPA 3C96A 2XLTA 1DXLA 1F3PA 4AT2A 1GETA 2V6OA 2GB0A 1M6IA 1RYIA 3KD9A 3T37A 3I3LA 3NN0X 1TDEA 3GDNA 5U63A 2X50A 4EMWA 4H4UA 2XVFA 2JB3A 3SM8A 2GQWA 1CHUA 3ICSA 3BI4A 1TYPA 1O94A 1PBDA 1S2YA 3V3NA 3NHOX 2O9ZA 4AP1A 4EQSA 2RGHA 3GSIA 2WBAA 2BS4A 3BNMA 2BCGG 3ALJA 3AEEA 2XFOA 1D4CA 1PBFA 3D8XA 4TLXA 4EIQA 2YG4A 2JB2A 3DGZA 5KWFA 2GMHA 3ABVA 5C3JA 1LVLA 2WOIA 1GTEA 4J2WA 3KA7A 1Y0PA 4BK1A 1DOCA 3CNTA 2YM2A 4RG4A 1KSUA 3R9UA 2XVIA 4CY6A 1NHSA 4DNAA 2BK3A 2CVJA 2QAEA 3KVEA 2C73A 1JOAA 4D04A 2BS2A 2Z5YA 5FS7A 1CC6A 3SFDA 2GAGB 1O95A 1EL8A 1NG4A 4U8MA 4U2SA 1LJ1A 2BXSA 5HY5A 1GXFA 1PHHA 4WX1A 2YVJA 3UKQA 2WU5A 3VRBA 3K30A 2GH5A 3E1TA 2WOVA 1O5WA 3UOYA 5IQ1A 5IPYA 3NNEA 1GT8A 5BUKA 3CGEA 1QJDA 4NZHA 2WS3A 4EM3A 5M10A 5JCIA 1TRBA 2XFPA 3UTEA 1VG9A 3RNMA 5EBKA 3P1WA 4E0VA 2ARDA 1E1LA 4JDRA 3NK1X 3CPHG 3URHA 4U8OA 2VRLA 3AEGA 1LQUA 3B3RA 1E6EA 2HQMA 4FK1C 1VG0A 2VQ7A 3NGCX 2GR3A 2X99A 4OPLA 3SUCA 1REOA 4MJWA 3AE3A 1B8SA 1D5TA 1NHQA 3CTYA 3LOVA 2Y6QA 1E1NA 2E4GA 1OJTA 4NEWA 4OPUA 3GD3A 4Z43A 1CBOA 1D4EA 2X8CA 4BV6A 3FIMB 3ADAB 4J31A 5CQFA 1JEHA 5CKUA 3OC4A 1IUXA 1Q9IA 4H4SA 3AE9A 3L8KA 5KVHA 2R0GA 2VQBA 1JNZA 1D7YA 1L9EA 3LJPA 5J7XA 1E1MA 4TM0A 1UKVG 1KNRA 3GYIA 4IVOB 1GESA 3ZYXA 4B67A 1DOBA 2YM1A 4H4PA 1KDGA 1JRYA 2IVEA 2TMDA 3QJ4A 1ELIA 2BC0A 1GALA 2R46A 1E1KA 2VVLG 3UCLA 1NPXA 1CJ4A 3UP4A 4N9XA 3VRDB 5BRTA 3AWIA 2ZZCA 4OPTA 4K5SA 4NTEA 3AE5A 1KSSA 2F5ZA 2EQ9A 3BHKA 4H2RA 4ZCDA 4OPDA 1TDOA 3UKAA 2XCGA 1SEZA 4YSZA 4YSHA 2WDVA 1CC2A 2AR8A 3CN8A 2YLWA 1BZLA 5HYMA 5KXJA 1GEUA 4I58A 4LIIA 4YSXA 5KOWA 1OJAA 3O0HA 4X9MA 5KVIA 4LU6A 1FL2A 3QVPA 2IVDA 2XFQA 3EF6A 1QLBA 2FJBA 1GOSA 2GEWA 1V59A 1TDNA 3NK2X 3UKFA 4XXGA 3G5QA 4UDPA 2R0PA 3II4A 4REKA 3SFEA 1DNCA 2JK6A 4K2XA 4O5UA 1H86A 3KKJA 2YLTA 2QA1A 1FECA 2WU2A 1DJNA 2ZZBA 5KOXA 4A9WA 2VVLA 4JNAA 1N4VA 2GR0A 2XLSA 3QVRA 4B64A 2Q7VA 4B68A 1YQZA 2VZ2A 3ALLA 3H8IA 3GYXA 5FMHA 1L9DA 3M12A 1PXAA 1PJ5A 1NEKA 1Z6LA 3CNJA 2WHDA 2YVGA 3M0OA 2WETA 4EQWA 4Z25A 1Q1RA 3UP5A 2BS3A 4ZN0A 1H83A 3GQKA 1TDKA 3RP7A 2WQYA 2V3AA 1BF3A 4OPIA 2C75A 1KFYA 4A65A 1F8SA 4K7ZA 2R0CA 4H4YA 2APGA 1JNRA 1B5QA 2C76A 5ER0A 2CDUA 2WESA 3AD7B 1IUVA 4FX9A 5LV9A 2YG6A 4A6NB 2WDRA 3LZXA 1MO9A 4A79A 1PS9A 2GF3A 2Y6RA 1JU2A 2EQ6A 3LB8A 4AT0A 1NG3A 4OPCA 3H4KA 1GERA 2ZBWA 1GNDA 3AD9B 3CPJG 5KRQA 4U2LA 1JRZA 1XHCA 2JBVA 2XVJA 3ALMA 3GMCA 1PJ7A 4GR1A 1VDCA 2AAQA 4USRA 3FMWA 2R4JA 1HYUA 4C74A 1H7XA 1GRAA 2Q0KA 3AXBA 3DK8A 3IHGA 3JSKA 3KU9A 5FS8A 4CRTA 4DSHA 4AP3A 1H84A 1DOEA 3D1CA 4CNJA 5DBJA 4X9NA 3REDA 1AOGA 1KF6A 2TPRA 4YKGA 1MOKA 5EB5A 1IUSA 4APNA 1FEAA 3F8PA 3VR8A 2PYXA 1GRFA 1BGNA 1GRGA 4H2NA 1COYA 2GQFA 3RP6A 4BK2A 3IHMA 4UDRA 1OJCA 1ZMCA 3K7TA 4FDCB 2XFNA 1OJDA 1P2HA 3NT6A 2Q0LA 5M0ZA 4YSYA 2BC1A 1H6VA 2C3CA 3S5WA 4TM3A 1VQWA 4KX6A 4H4VA 4CY8A 4NTCA 4H50A 2A87A 2H89A 2W0HA 3K7QX 2B9XA 1CJ3A 1P2EA 3KLJA 2VOUA 4EMJA 3P9UA 4J57A 3BNUA 2BA9A 1GRBA 3NLCA 4EMIA 4FK1A 4DGKA 3ISHA 3PS9A 3OZ2A 3VQRA 2VRMA 4PABA 2FJAA 2DKIA 1PXBA 4P9SA 2YLXA 4TLZA 4ADWA 3DA1A 5EOWA 4EQXA 2GAHB 3UKHA 1PBCA 1NENA 3LADA 2YG3A 2BYBA 3V3OA 4A7AA 2V3BA 2V60A 1TYTA 1N4UA 2BK5A 4RG3A 3AYIA 3EPTA 3NYEA 1IUTA 1LPFA 4Z2TA 2A89A 1XDIA 3IWAA 4XWZA 3LXDA 4U8IA 4BJZA 2E5VA 3GWDA 3NTAA 4BURA 1PXCA 4PAAA 4JQ9A 1GREA 1CC4A 1NDAA 2X8HA 1F6MA 4H4RA 3DJDA 4IA6A 3QFAA 1NHPA 2XLRA 4Y4MA 3FG2P 4OPGA 3GWFA 5IQ4A 1VRQB 2R9ZA 2FJEA 3DMEA 2YLSA 2YAUA 5HXIA 5JCNA 2IIDA 1ZK7A 1W4XA 2X8GA 3NIXA 3NYCA 4K22A 4Y4LA 3NRNA 1PJ6A 1Q1WA 3SGLA 1EBDA 2YWLA 4B65A 3CNDA 3G5RA 2OA1A 1QO8A 3CGBA 2C7GA 3RP8A 4EQRA 4H2PA 2YVFA 4B69A 5C2TA 4GUVA 2X3NA 2RGJA 4H4WA 1EL9A 4A5LA 4C77A 1FOHA 1Y56A 3FBSA 3QSEA 4XWRA 4OCGA 3RHAA 4A99A 3DGHA 4U8LA 3AEAA 4AOSA 1CJ2A 3CPIG 2GRTA 2C65A 1ZMDA 1LTXR 2XLUA 3CNSA 5BULA 5J60A 4GRTA 5JCLA 2OLOA 4RSLA 3ICTA 2A8XA 1D7LA 3AE7A 1H82A 1NHRA 3EAOA 3SQPA 1TDFA 1BGJA 4YTMA 2GR1A 4C5OA 2C72A 4GF7A 1K0IA 4H7UA 3AECA 3L1RA 3UTGA 1E7PA 4CCQA 2B7RA 5JCMA 1K4QA 1S3BA 2B76A 3GD4A 1BKWA 5U25A 1BWCA 1NAAA 4Z2RA 4CNKA 4NEVA 2V5ZA 4Y4NA 4IV9A 1E39A 3G5SA 4YTPA 3ICRA 4YXDA 4UP3A 2YR5A 4Z44A 3COXA 3C4NA 2FBWA 1GRHA 4J34A 3NTDA 2XVHA 2XDOA 3S61A 4ECHA 1DJQA 3GYJA 2YQUA 4IA5A 2VVMA 3HZLA 2J3NA 3QSSA 3AD8B 3KPFA 2Z5XA 2OLNA 4IVMB 3Q9TA 3VRAA 2WPFA 4H4ZA 4ICYA 4U8JA 1DODA 3EANA 3AE1A 4U8PA 2JKCA 3F8DA 4Z2UA 4U8NA 3P4QA 2H88A 2GVCA 1MXTA 3AYJA 1D4DA 1PDHA 2EQ8A 4YKFA 2WP6A 4TM1A 3ATRA 1ZX9A 3AEBA 2OALA 4X4JA 3NYFA 2XFUA 3QSMA 2WP5A 1EL7A 3P4SA 2CFYA 4JY2A 2JB1A 3K7MX 1IJHA 3ATQA 3FPZA 3DJJA 3AEDA 2GMJA 1ZDLA 2R4EA 4NTDA 3ZDNA 2QCUA 1L0VA 4D03A
chains in the Genus database with same CATH superfamily
2PHHA 4JEUB 5A1LA 1H81A 3C4WA 2YG7A 1RUD4 3AB1A 1MIYA 4YWOA 1CL0A 5AQIB 2X68A 2XY8B 1PIV4 2MYSA 2ZMAA 4TX5A 3NKSA 3RLFF 4WCTA 2HN2A 1NCQD 5HCMA 2XZEA 3LBXA 5L3DB 1IUUA 1N32T 1KNZA 2WPEA 2KZ7B 1RSGA 2UXDT 1LQTA 1GQEA 2PW9A 5L3CB 3UOVA 2BXRA 3LG7A 1L9CA 4Z8XA 2PFVA 1RP0A 1F8WA 4GDPA 2KLQA 3ZCIA 3Q6JA 3N9PA 4HWCA 4QXHB 2MBGA 1YQ4A 4CXWA 3AE2A 3RIFA 1Z7S4 3IA3A 1M7KA 4YT0A 3HR0A 4JV5T 1K0JA 3AYLA 1LVFA 2Q9QA 4UVBB 4EEDA 3AXJA 3ZJ1A 2AQJA 2YDQA 1UCUA 2CULA 3AE8A 2CEAA 4CZZB 2XQ3A 4H4XA 3EABA 2DI4A 4C3XA 5HXRA 1BR2A 3DK9A 3U3IA 1GRTA 2M6IA 5LBQB 4YJ3E 4CXYA 1ONFA 1B4VA 3UTHA 2R45A 1RUC4 2LSIA 1SE7A 3OBVE 4UF0A 4I59A 3ITJA 4HA6A 2ZZ0A 3SYIA 1V9DA 4GK0E 3KV5A 3UKKA 5AQVB 3I0QA 4LFBT 4CBQA 3V5SA 3CNPA 3GQHA 4HWFA 2N1GA 2C67A 2ACZA 1FEBA 4COFA 2XPKA 3CIRA 2BABA 2YG5A 3N9QA 4DUZT 2Q6UA 2R6GF 3UKPA 3C96A 1DXLA 3PUXF 1RYIA 3K1SA 4EMWA 2JB3A 1CHUA 1S2YA 3V3NA 2O9ZA 3GSIA 4QX8B 4P1NA 3ALJA 2YDSA 3FZLB 4EIQA 2X66A 1WCRA 3UTKA 3ZLIA 1LVLA 2Q9QD 1Y0PA 3J7Yq 3R9UA 3KV4A 4CY6A 5J2TE 5F3JA 1HG5A 4DNAA 3KVEA 1JOAA 1HNXT 1R8IA 5FS7A 1NG4A 3N2GE 2BXSA 3ETVA 5HY5A 4DV6T 1K5MD 4ISSA 1IJ5A 2GH5A 1O5WA 4NZHA 5JCIA 2V26A 5F8PA 3R6NA 2XFPA 3RNMA 4H63V 2EHOC 5EBKA 5FXWA 1LRZA 3CPHG 3URHA 4U8OA 2VRLA 1E6EA 3AVSA 2HQMA 5FNVE 2VQ7A 3SUCA 1XDOA 4MJWA 1OOPD 3NWIA 1D5TA 3LOVA 2X0LB 2VVNA 1XHXA 4GKKT 2E4GA 5JH7E 4NEWA 4OPUA 3FBLA 1CBOA 4LMJA 1D4EA 4AQYT 4BV6A 1HR0T 3FIMB 4J31A 1H7CA 1JEHA 4MFRA 5AQJB 1AR64 5KVHA 2A72A 3AE9A 3AAAB 3Q5DA 2CE7A 3LJPA 1E1MA 3LBXB 4NNJA 2MTQA 3T1YT 1KNRA 1UKVG 3GYIA 1GESA 3K3QC 4H9SE 1HNWT 4B67A 1DOBA 2YM1A 2A3DA 2C5KT 4EYUA 2BC0A 4DR4T 3EUHA 1NPXA 1PO14 1M62A 3VRDB 5LOVE 4NTEA 3A7MA 4V1Av 2EQ9A 3BHKA 3RC3A 1TDOA 3UKAA 1CC2A 2AR8A 1BZLA 1GEUA 2YEVC 3M65A 4YSXA 5KOWA 1OJAA 3AA0B 3OVUA 1FL2A 4AQFC 2W62A 2XFQA 2Q9QB 1D1CA 2GEWA 1ASJ4 3AXJB 3NK2X 2RS14 2V6XA 4ILBA 2ZM6T 2JK6A 4K2XA 3O1IA 1H86A 2YLTA 5HXHA 5L3BB 2WU2A 5HWXA 3MKDA 4A9WA 4JNAA 1N4VA 4OX9T 2DNXA 4B64A 4CI3B 2YKSA 1YQZA 2VQET 1L9DA 2UU9T 5FMNA 4UF0B 4EQWA 1HCIA 4TV9E 3UP5A 1IZNB 2BS3A 2IC6A 1TDKA 4IDPA 2WQYA 5FVKA 2V3AA 4ZZBA 2UUAT 4OPIA 2JMKA 2FUPA 3JAEA 4K7ZA 2CDUA 2CM0A 3AD7B 5JDNA 4WYVA 4FX9A 3B13A 2NR4A 4HFCA 2CLYB 2V7MA 1PS9A 4A79A 2Y6RA 1OEDC 3ZYMA 4AT0A 1NG3A 4PJLA 2YN6A 3HKEE 3HKBE 5FKYA 3CPJG 1JRZA 1XHCA 2JBVA 4UR9A 4GR1A 5L3GB 3HYVA 2R4JA 3Q5XA 2Q0KA 3AXBA 3UUBA 5BMVE 3DK8A 2H3RA 4DSHA 4LF5T 4O2BE 3TLVA 3REDA 4YKGA 1IUSA 1S94A 5CA0E 4IL9A 3U78A 3ZN1B 1HRV4 1GRFA 3RP6A 1J5WA 1UGOA 2KNDA 1OJCA 3B57A 1XMOT 2WZIA 4L5GA 2JQHA 4CY8A 1O3XA 4H50A 2W0HA 1CJ3A 2VOUA 3P9UA 3WAJA 5DABA 3UFGA 3PUZF 4DR7T 2WBLA 4GKJT 3VQRA 3RRWA 2VRMA 4P9SA 1PXBA 4TLZA 2E8IA 1ZKEA 4EQXA 5KMQA 2LKHA 2DWKA 2YINA 5FXVA 3V3OA 1TYTA 4LFCT 3FBZA 1LPFA 2A89A 2RR14 1XDIA 3T31A 4U8IA 4BJZA 2E5VA 4TNVA 1PXCA 2C4CA 3EDUA 1CC4A 1GREA 2R074 3HKDE 4Y4MA 3T2YA 2Q9QC 5JCNA 3MA9A 4OFZA 3SZCA 2Y8DA 4ANJA 3CNDA 4EQRA 3M3ZB 4X1KE 2C7GA 4WBNE 4B69A 5C8YE 2WAUA 2VASA 1AR94 3RYHE 2CPTA 4AXPA 5AQUB 4GK5E 2V7KA 3HA4A 1Y56A 4P0BA 3CQCB 4OCGA 3DGHA 4AOSA 3RI5A 2GRTA 2C65A 5BULA 2BVLA 2IW5B 3MK7C 4B3RT 3SQPA 2A8XA 2XAHB 1AJ3A 3PUGA 2E9XA 2GR1A 4GF7A 3FXDB 3P8CD 4TWHA 4H7UA 4X66T 2CLYC 2W00A 3L1RA 4YHJA 5JCMA 1CUNA 2XASB 4FJOA 4CNKA 4TN7B 5HCJA 4CQIA 5L2LA 4IV9A 1E39A 4YTPA 3ICRA 2X9WA 4UP3A 2YR5A 3UULA 3COXA 4KUMB 4ZXLA 5EK2A 2DWGA 4HWDA 2NW9A 4IL4A 1GRHA 4J34A 3ESLA 1FMVA 5FL0A 4IHJE 3LDQB 4QXBB 4HFBA 4ECHA 1XI1A 2VVMA 1IBMT 4JI7T 2BBHA 3N2KE 3PUAA 3ZC0A 2OLNA 5AQGB 3Q9TA 3VRAA 4U8JA 2LSYA 2A2FX 1RUE4 5HEUA 4U8PA 4Z2UA 4U8NA 4O2AE 3P4QA 4QH1A 1MXTA 2MOZA 4LF4T 3CMMA 2WP6A 1VCSA 3F57A 3FZFB 2WSSV 3MJXA 3E0ZA 3UUXB 3LK42 3K7MX 4ZZCA 3ATQA 4PNIA 2VKOA 5LGTB 3FPZA 1SA0E 5J1GA 3GN5A 3TLUA 2RA1A 4D03A 1HG2A 4X1IE 2XQ9A 4B63A 2GV8A 4Q4V4 3M13A 1CF3A 2C70A 1YXRA 3GA8A 4AOXA 2V7IA 1QUUA 3UQ7A 4HTEA 2C5JA 2K3WA 1MIVA 5ABHA 1M64A 1Z8UA 5GRTA 3UTFA 4GDEA 4I50E 1LV0A 3EAMA 2KMFA 2LE8A 2E5LT 4ZCCA 3VR9A 4B1BA 1GSNA 1XPQA 2XYOA 3F8RA 2NTXA 2I0ZA 3ZSSA 2B7SA 2RGOA 3P4RA 2V6YA 2WP9A 5BVAA 4KPRA 2JRKA 3ONXA 1FCDA 3AE6A 4NUVA 1T8BA 2DKHA 4GB34 2XAJB 3Q5EA 2PBIA 5FS9A 4K5RA 1I6ZA 1N33T 3BQKA 4OVIA 3RIUA 2UXCT 1W0AA 2WMOA 3SWHA 5LMNT 4BJYA 3H8LA 1N36T 2VL0A 4MLKA 1N1PA 3KPKA 2XQ4A 2CRBA 3RPUA 5JDHA 1JRXA 2YLZA 3FZKB 3ZC1A 3SZWA 1EL5A 5GSNA 1HFAA 4H2QA 4BJNA 5JCKA 4DBRA 4YTNA 2LFCA 5LG4A 1IUWA 2B9WA 3BI5A 1YQ3A 3OKQA 2XLPA 1RUF4 3L09A 1YKEB 1BR0A 4A6NA 4F8HA 1Y56B 1PBBA 4O5QA 1MNEA 2LSGA 3RHWA 4PJJA 4G63A 4AT2A 1M6IA 3RH3A 5E0OA 3T37A 2ZM8A 4IREA 3NKZA 2E9XB 5U63A 4H4UA 3JAFA 4EB6E 2KWIB 1ZV4X 3BI4A 1TYPA 3NHOX 1PBFA 2KT9A 2YG4A 2LM9A 2GMHA 5C3JA 2M6BA 3KA7A 4ZI7E 1DOCA 4RG4A 1KSUA 4AKGA 2CWYA 2VKHA 4H9QC 1XWMA 4KP3C 4QWNB 3MXZA 4U2SA 5AQPB 4WX1A 3ZMTB 3K30A 5CJ5A 3E1TA 3QC9A 2W61A 5IQ1A 4YJ2E 2OV9A 3CGEA 3HKCE 1QJDA 2V5CA 5M10A 1VG9A 4H9RC 3ANWA 3P1WA 4E0VA 1E1LA 1LQUA 3B3RA 3GN5B 3T14A 1EV14 1VG0A 3NGCX 2GR3A 4OPLA 1REOA 1HXS4 2CBJA 2JQ9A 4ASKA 1E1NA 2X8CA 3PURA 5CQFA 1Q9IA 2GK9A 5L3FB 2R0GA 2LEHA 1JNZA 3G06A 4TM0A 5LJMA 2CXLA 4IVOB 3T1HT 3RRCA 1KDGA 1ELIA 2QGSA 3ZT7A 1IJ6A 2VVLG 5LMUT 3UP4A 4KMCA 5JRCA 3AWIA 1R094 4JUYA 4K5SA 2F5ZA 2XQAA 1XZYA 2HPLA 4JI6T 4H2RA 4ZCDA 4OPDA 4BJMA 2V6YB 1D0ZA 5KXJA 4I58A 4LIIA 1SUMB 4X9MA 2K9AA 2UXXB 4G9KA 2X51A 4B3TT 4XXGA 1NAFA 3II4A 1DNCA 3LSVA 4O5UA 3N9MA 1SHZC 1FECA 5LHGB 2IHR1 2ZZBA 2JMHA 4IIJE 3QVRA 4B68A 3ALLA 3H8IA 2NW7A 5H6QB 5FMHA 5JVDE 3CNJA 4X62T 3M0OA 4AI6A 5AQTB 1Q1RA 5L47A 1G73A 4DV3T 4P0AA 3O1JA 5CA1E 3GQKA 5KMRA 4U2YA 1E1HB 1KFYA 2NTYA 4PJMA 2R0CA 4H4YA 5AQOB 1WR0A 3CK6A 4DMWA 4DV5T 2C76A 5ER0A 1WYBA 4JI5T 2CA5A 1IUVA 2YG6A 4A6NB 3LZXA 1MO9A 1UX5A 3TLTA 5KMPA 5FY0A 1JU2A 2WB5A 4EYYR 1UURA 2YDRA 2BKPA 1GERA 1POV0 2ZBWA 1GNDA 5KRQA 3RYIE 1W9RA 1EAH4 3RIAA 4XBFB 3CQGB 5HEHA 1FJGT 3FMWA 5KMSA 1RUI4 2LJLA 3I9WA 4CRTA 3IHGA 1WRDA 2R044 1DOEA 4CNJA 4X9NA 2PLV4 2BBJA 1FEAA 3F8PA 3AVRA 3VR8A 2PYXA 4I0UA 4H2NA 1ZMCA 1OJDA 4NXNT 1P2HA 2Q0LA 2BC1A 1H6VA 4DV2T 2C3CA 3S5WA 1LKXA 1VQWA 4H4VA 4NTCA 2A87A 4MBQA 3KLJA 1P2EA 1EZ3A 4EMJA 2R064 3BNUA 1GRBA 2PTFA 4EMIA 4FK1A 1RUG4 3ISHA 3PS9A 4DV7T 5LHHB 2DKIA 2B1EA 2CXDA 5EOWA 2RP4A 2GAHB 3UKHA 4GYRA 1PBCA 2HWC4 4KI0F 2BYBA 4A7AA 3ANWB 1N4UA 2ZLYA 3FZMB 1MMGA 4E7ZA 1IUTA 1WYCA 3IWAA 2XQ8A 1QSDA 3CQXC 4ZHQE 4JYAT 5AQQB 4PAAA 4JQ9A 3W15B 1NDAA 2X8HA 2E2AA 1F6MA 3LFMA 3QFAA 2XLRA 5L4HA 1IBLT 4OPGA 3UUNA 2NW8A 4UIGA 1VRQB 2R9ZA 2D0UA 2W0GA 5HXIA 2IIDA 2V7LA 2RMU4 2BDEA 4MHCA 3NYCA 3NIXA 4K22A 4Y4LA 2YWLA 4B65A 3G5RA 3RP8A 4HN9A 3LJCA 5C2TA 3TLSA 4GUVA 2X3NA 4H63H 3D0TA 4QXCB 2L3LA 2UXNB 2VL8A 3QNUA 4GYSA 5JRCB 1FOHA 4DR1T 4U8LA 3AEAA 2A9UA 1CJ2A 3ONJA 3CPIG 2D5UA 3OYZA 1ZMDA 3CNSA 3RYCE 4H9PC 4GRTA 5JCLA 2JIWA 3T8OA 4RSLA 5IHYA 3S4UA 3RC8A 1D7LA 3AE7A 1H82A 4O4IE 3BQLA 1TDFA 2C72A 1W09A 1WR6A 4HFEA 4HKAA 3PU3A 2AE9A 1S3BA 3B5MA 4Z2RA 5LGUB 2V5ZA 3VKGA 1LVKA 4IE5A 2FBWA 3UU6A 4KHZF 2M67A 2LHNA 4F6RC 3JADA 5CFBA 4HWIB 2XDOA 2KXPB 4TWDA 3OPCA 4C90A 1DJQA 3S61A 3GYJA 5J0ZA 2J3NA 2Y6XA 4IVMB 2WPFA 2LOPA 2DHRA 2JKCA 2H88A 2Z6EA 3V5UA 3VKHA 2OALA 2XFUA 3QB5K 1EL7A 2J4GA 4Q25A 2PYJA 1HRI4 4Z90A 3AEDA 3HI2A 3FHNA 3ZDNA 3O9XA 3BHFA 1KNPA 4AISA 3SZFA 1H8TD 2XAGB 3PE0A 4H4QA 4GAPA 4DV4T 3R84B 2NPXA 1ZOYA 1FEWA 1KK7A 3T2KA 2N9DA 3NK0X 3CWZB 4H4TA 3PJAJ 1F8RA 2YR6A 4K8DA 2WPCA 2DLRA 2WEUA 1BR4A 3NN6X 2WWVA 4DNDA 4O4LE 2C64A 3UKLA 4NUUA 4U8KA 2VK9A 1X31B 4DR3T 3GMBA 2JAEA 4IE0A 2ODVA 1VBB4 4IDQA 3BI2A 4ILAA 1RVF4 5JQGE 3RX6A 5L46A 2CWOA 2D2SA 3KVAA 3AE4A 4JI2T 4GOUA 5FXXA 4IT4A 3DK4A 4ADZA 1NWMX 4PAGA 3UUMA 4TM4A 3JCFA 3E22E 1GV4A 4U7YA 1ZP0A 4EM4A 2P9BA 1CJCA 2GR2A 4AQGA 3PVCA 5TR3A 4JI3T 3KBUA 1BR1A 4USQA 5HHFA 2YK0A 5AQKB 1YKJA 2YLRA 3GDPA 4JY3A 2CHOA 3I6DA 4BK3A 5FS6A 2BACA 3CGCA 2W2UA 4B66A 4C3YA 1GTHA 5U1OA 4CI2B 1ZY8A 3UOXA 1W0BA 3CGDA 3QUJA 5ETWA 4NIQA 5LGNB 3B6DA 2EQ7A 4JNQA 4I55E 1T7SA 1Y01A 1PBEA 3C50A 5EB4A 4LMKA 4Q4Y4 4IGUA 3UOZA 4J33A 2AXDS 2C66A 3DH9A 1N4WA 1D0YA 2UZZA 2NOXA 2BCPA 3C98B 5TAOA 4LFAT 2IAKA 4TUYE 3SOLA 2WDQA 2YU2A 3IF9A 3ZMSB 4Z26A 4EIPA 4CXXA 4UVCB 1VBA4 1B7TA 2WZHA 2CCQA 3CPZA 2XLTA 5F5WA 2V6OA 2X0HA 2GB0A 3CVRA 3KD9A 4ZS2A 1IBKT 3I3LA 3NN0X 2X50A 1PO24 4HFIA 2GQWA 3ICSA 3QK6A 4EXTA 4K0UA 3N2OA 4BAYB 1O94A 1PBDA 4AP1A 2RGHA 4GIWA 2BS4A 3BNMA 2BCGG 3AEEA 2XFOA 4I43B 4U72A 1D4CA 4MALA 2JB2A 4U3CA 3DGZA 5KWFA 2WMNA 2PG8A 3CNTA 2YM2A 2OA5A 2HHHT 1NHSA 2BK3A 2CVJA 1OXZA 4IE7A 4D04A 4Q4W4 1WFDA 4ZEYA 2BS2A 2Z5YA 5AQSB 3AAIA 1CC6A 3SFDA 3SS1A 1O95A 1EL8A 1LJ1A 1PHHA 2RS34 2WU5A 3VRBA 3PJAA 3UOYA 5IPYA 4PFOA 3NNEA 5FXZA 4ERRA 4EM3A 1TRBA 3UTEA 4PDWD 2E9XD 5EZYE 1D1AA 4U2ZA 3ZEFB 2ARDA 4JDRA 3NK1X 2QRXA 3GWHA 3AEGA 3CX8B 4FK1C 3IBPA 2KINB 3ZJ2A 2EHOA 3AE3A 1B8SA 3X1DA 3CTYA 2XQ5A 2Y6QA 2ODUA 4Z43A 5IWAT 4G74A 5CKUA 4X1YE 3OC4A 3VHLA 3HYWA 4H4SA 2IUBA 2VQBA 4EGWA 3NVOA 1T72A 2LLYA 3PDYA 2VVSA 4ZI2D 3ZYXA 3ZKRA 1JRYA 4PFPA 1E1KA 5HEGA 3NRYA 1CJ4A 5JTGA 4AKRB 2ZZCA 4OPTA 1KSSA 2BG9A 1UK5A 1U5PA 5CB4E 1YW0A 4YSZA 4YSHA 1KEYA 4JI0T 4TZ4C 2LT3A 2OLTA 3O0HA 1MQTD 1AL24 3QVPA 4II2A 3EF6A 1QLBA 1GOSA 1V59A 1TDNA 3K3OA 4QX7B 3UKFA 4M1PA 3G5QA 4UDPA 2R0PA 4REKA 4HE8A 4H9OC 2RPAA 3KKJA 2I59A 2QA7A 3EDVA 2D0TA 2V1DB 2GR0A 1YKHB 2J1DG 3LK2B 2VZ2A 4L9IA 4YY3T 3I1AA 3M12A 1PXAA 1MNDA 4GAVA 3ZMVB 4ZN0A 1H83A 3J9X1 3ZMUB 3O4XE 4P09A 2C5IT 3ZT6A 3KFWX 2C75A 3ZN0B 4A65A 1F8SA 2N2NA 1JNRA 1B5QA 4ZI3D 2WESA 2ACXA 5JDFA 2WDRA 3BK9A 3T0KA 3EVYA 4UXNB 5IUXA 4OK0A 1HS7A 3H4KA 2V7JA 4FI5A 2BKNA 4QKNA 5LXTE 4B3MT 3AD9B 2JQQA 4O4JE 3GMCA 3SXIA 1OEDA 1PJ7A 3QOFA 1VDCA 5L4EA 4C74A 1H7XA 3JSKA 5FS8A 3RF1A 1H84A 3D1CA 3NZQA 2BRAA 1AOGA 1KF6A 5FL1A 1VOMA 5EB5A 2LHRA 3PUQA 3K3NA 3CX6B 4YHHT 1GRGA 2GQFA 3PUWF 5LNKA 3IHMA 4UDRA 3K7TA 4FDCB 5M0ZA 1MMAA 4YSYA 3ZYLA 3NBXX 3OYXA 5LG3A 4KX6A 3KVBA 1IAPA 2H89A 3AB3B 3SRZA 2XSBA 1HF8A 4J57A 2BA9A 1T98A 2UXBT 3HYXA 4B3ST 1BEV4 3N5LA 4DGKA 1MIWA 1D1BA 3I9YA 1Z0PA 4ADWA 3FI7A 3I0OA 3DA1A 4WZXA 2HWB4 2LSJA 4L0RA 3FXEB 3LADA 2V3BA 4G73A 2V60A 4A97A 2BK5A 4U31A 3AYIA 3UU8A 3EPTA 3NYEA 2UUCT 4Z2TA 4XWZA 4AKLA 2EHOB 5AQMB 4H9NC 3NTAA 4BURA 2V8SV 2XQ6A 4H4RA 4IE4A 2K48A 5DQWA 5LJNA 3KV9A 1NHPA 2LSKA 5M4YA 3GWFA 5IQ4A 2G0UA 3DMEA 2YAUA 4WBOA 4DBQA 1PJ6A 1Q1WA 2W66A 3CGBA 1QO8A 2RS54 3N9LA 5L3EB 4H2PA 1HX8A 3RYFE 2H7OA 2IIUA 3C4ZA 3F31A 1EL9A 3A5XA 1XHZA 5AQHB 3ZPOA 4XAXB 2BG9B 1OWAA 4UELA 4DMVA 3RKOA 2E9XC 5J60A 2OLOA 2YU1A 1NHRA 3EAOA 5LYJE 2XQYA 1BGJA 4YTMA 3SZ0A 3UT5E 1K0IA 3AECA 2D9DA 4LMLA 3ZSTA 2F4VT 4NXMT 4DV1T 4CCQA 2HPJA 1HNZT 1K4QA 3GD4A 4G6GA 1NAAA 2XTLA 1HX1B 4ILCA 2VB6A 3RQWA 4Y4NA 4I4TE 4Z44A 2PY5A 1J5ET 1Y64B 1FMWA 4ZI2C 2XVHA 3T2ZA 2WM9A 2IMLA 4IA5A 3HZLA 5KX5E 2X9XA 3QSSA 3ETUA 2Z5XA 2HN1A 5DQVA 4H4ZA 1VCTA 1DODA 3EANA 4OYJA 4DR2T 4YFSA 2GVCA 1X79A 1VRBA 3PTRB 1D4DA 2JJ9A 4HWHA 2RM24 4TM1A 4Z91A 3AEBA 4X4JA 4KBMB 2KWHA 3QSMA 4ZOLE 3P4SA 4PK5A 2CFYA 4JY2A 2JB1A 2YOEA 3JC6D 5KNLA 3L3PA 1IJHA 1OEDB 1ZDLA 4NTDA 2LKGA 3EI0A 4PK4A 1ZHCA 2QCUA 4CN6A 2VKJA 4ISTA 3LK3B 3J8F4 2YR4A 2PYLA 2XAFB 4LF8T 3QFBA 4HFVA 4UDQA 4J56A 4TWFA 4AIUA 4JN9A 2V61A 3NH3X 1VRH4 2DL1A 4CN1A 2UUBT 5HEJA 1PN0A 3P7IA 1VBD4 2KSRA 2BK4A 4NPPA 1VBC4 3OJAA 4PK6A 5HYAA 5LB7B 3IC9A 2XVEA 1GPEA 4Q4X4 3N9NA 2XQ7A 2PJQA 3EHZA 1ZOVA 4JBWF 4ZI3C 3Q5WA 4HGAA 2K5BB 2NVKX 3LZWA 1G8XA 2WOWA 5JDLA 2BG9E 3DJBA 3V76A 1OJ9A 3DJGX 3GRTA 2RABA 2QA2A 2JPFA 4JLEA 4CCRA 1B37A 1UUSA 2XUEA 4HB9A 4O8SA 3IEEA 4GCMA 3UFEA 2FJDA 2VQFT 2Y48B 4DR5T 5HAXA 3Q2MA 1XANA 3RIUC 2BG9C 1S3EA 3NG7X 2IC9A 2NP9A 3PUSA 4LA1A 2W4XA 3DJEA 3GRSA 4U2TA 2VWAA 3A8YC 2LRLA 4QH4A 1XNQT 4LF9T 4DUYT 3C4AA 5HWYA 1X9BA 4J36A 4IDZA 3WE0A 4DSGA 3P4PA 2OAMA 5JDQA 3ZT5A 1K0LA 2B9YA 2E1MA 3GMIA 3WI3A 5KDMC 4PJNA 4M52A 2XAQB 3PUYF 1H7WA 4LF6T 4Z24A 1S2QA 1WLXA 4OYKA 5HEOA 2VURA 3PUVF 3HL6A 1ZKQA 2DCFA 3AEFA 2C3DA 1YY5A 3PO7A 2XJ7A 1OEDE 1F3PA 5JR9A 1GETA 2XM1A 2I6HA 1TDEA 3GDNA 2CXFA 4HEAA 2X9HA 2XVFA 3SM8A 2ZM0A 3AAEB 2W67A 4EQSA 1US7B 2WBAA 4XZCA 5ADXL 4U74A 1U4QA 3CX7B 4DV0T 3IHRA 3D8XA 4TLXA 3FZHB 3ABVA 2WOIA 1GTEA 2L8KA 4J2WA 4JI1T 4BK1A 2XVIA 2QAEA 2X67A 2C73A 4X5TA 3VU7H 2GAGB 4U8MA 1GXFA 2YVJA 3UKQA 3QB5A 4CN4A 5GONE 3E08A 4UEMA 2WOVA 3H3AA 1GT8A 5BUKA 2WS3A 5HXEA 3AA1B 1RUJ4 5IYZE 3PU8A 5LP6E 4CI1B 5J2UE 5HXCA 3K8PC 2X99A 1NHQA 2XSAA 2JQKA 4JI8T 2BKOA 4HFDA 1OJTA 3GD3A 4TNWA 5FY7A 3DP7A 5LCYA 4X65T 4PW8A 3ADAB 1IUXA 3O1HA 4G6HA 4WW0A 3L8KA 1YD8G 2XHEB 1D7YA 1L9EA 5J7XA 2CMRA 1PVC4 3UU3A 2X5ID 1NA1D 4H4PA 2TMDA 2IVEA 3QJ4A 4DVDA 4KHPT 1COV4 1GALA 2R46A 3UCLA 3KV6A 4U7IA 5ABFA 3ZYKA 5LHIB 4N9XA 5BRTA 4G2AA 1VBE4 3F2EA 3AE5A 4EZHA 2XCGA 1SEZA 3JC6C 4EOZB 2WDVA 5HYMA 3CN8A 2YLWA 3P50A 2W63A 5KVIA 4LU6A 2IVDA 2LM2A 3NZPA 2FJBA 3C4XA 3FB2A 3SFEA 2QA1A 2WY2A 4EAHA 1DJNA 5KOXA 3AA6B 2VVLA 3PV0F 2XLSA 2Q7VA 5BR8T 4EIWA 1S35A 3GYXA 1PJ5A 1NEKA 1Z6LA 2WHDA 2YVGA 2R7FA 2WETA 4Z25A 4II3A 4O4HE 1ZEEA 3KDSE 2ZM2A 1E2AA 3RP7A 1BF3A 3H3MA 1J1JA 4DR6T 2J62A 2APGA 5LV9A 3CMLA 2MPKA 2GF3A 2EQ6A 3LB8A 2L9QA 4OPCA 4QHOA 3KINB 5AQRB 4K0KT 5JR9B 4U2LA 4ILUA 5FY1A 3ALMA 2XVJA 3N9OA 2AAQA 5AQLB 4USRA 3SY4A 1RHI4 2ES0A 1HYUA 1GRAA 2XM2A 3KU9A 2MAWA 4AP3A 5DBJA 5ABGA 2TPRA 2LRKA 3MACA 1MOKA 4APNA 2X9YA 3DTOA 1BGNA 4QH5A 1D0XA 1COYA 4BK2A 4EEBA 2XFNA 3NT6A 1D4M4 4TM3A 3MZKB 4EZ4A 3K7QX 2B9XA 4DIDB 3WAKA 2CBIA 3NRXA 3NLCA 2SPCA 1MMDA 2NWBA 4IDNA 3C64A 1AR84 1R084 3OZ2A 4PABA 2FJAA 4HFHA 1AR74 2YLXA 2H7VC 1HTJF 1NENA 2YG3A 2LOSA 3ONLC 4UV9B 2BZBA 4JEHB 4RG3A 5JDGA 2QYWA 2BRYA 3JD74 3LXDA 4X64T 3GWDA 4DO0A 3TLWA 4NWZA 4YLHA 3JBG4 5AQFB 3RKGA 3DJDA 4IA6A 1N34T 3FG2P 3H37A 1UX4A 2FJEA 2YLSA 3OTOT 1ZK7A 1W4XA 2X8GA 4B6XA 3NRNA 3SGLA 1EBDA 5FP3A 5FYMA 2IDOB 2OA1A 2J47A 2YVFA 4J2CA 2VKDA 3L8RA 2HH7A 3UQ4A 1RUH4 2RGJA 4AQFA 4H4WA 5CGMA 1XNRT 3SX6A 4A5LA 4C77A 2C0SA 5ABFB 4AKIA 3RQUA 3FBSA 3QSEA 3P4WA 4XWRA 3RHAA 4A99A 4OHFA 3BQIA 4E7SA 5DJQC 1XDPA 4UVAB 4U33A 1FIOA 5HXSA 1LTXR 2XLUA 2WCAA 4A56A 3C51A 3UU4A 1DU2A 3ICTA 4BA9A 3IF8B 2EHOD 4C5OA 5AFUL 1RMU4 4C91A 1MMNA 5JDMA 3UTGA 1E7PA 2B7RA 2B76A 2WWUA 1BKWA 5U25A 2PZSA 3CKDA 1BWCA 5FVLA 4NEVA 5JR9C 3G5SA 2I0MA 4IDOA 4ZS3A 5LBMA 4YXDA 4AKHA 3AA7B 3C4NA 2EX3A 5LA6E 5EK3A 1XMQT 4TV8E 2X0YA 3NTDA 4X20E 2YQUA 3ZCJA 3AD8B 3KPFA 3ZMZB 2BVMA 3L39A 4LF7T 4ICYA 3RGLA 3AE1A 2K24A 3F8DA 4IE6A 3AYJA 1PDHA 4EV6A 3TKLB 2EQ8A 4YKFA 4N78D 5JREA 3KBTA 5EK4A 4A5XA 5KMGP 4JI4T 1ZX9A 3ATRA 3UU5A 3NYFA 4RHV4 2WP5A 2QVAA 2V5DA 5H6RB 4A98A 3DJJA 2GMJA 5ABEA 5AQNB 2R4EA 2CHNA 3Q9DA 1L0VA 4WNKA 1I94T 4UV8B
chains in the Genus database with same CATH topology
3BHFA 1KNPA 2PHHA 1H81A 3SZFA 2YG7A 2YR4A 3AB1A 4B63A 2GV8A 3QFBA 4H4QA 4YWOA 3M13A 1CL0A 4GAPA 4UDQA 4J56A 2NPXA 1ZOYA 1CF3A 4JN9A 2C70A 2V61A 3NH3X 3T2KA 3NK0X 4H4TA 1F8RA 2YR6A 3NKSA 1PN0A 4K8DA 4AOXA 2WPCA 2WEUA 4WCTA 2BK4A 3NN6X 2C64A 3UKLA 1M64A 4U8KA 1X31B 3IC9A 5GRTA 3UTFA 1IUUA 2XVEA 1GPEA 3GMBA 1LV0A 4GDEA 2JAEA 2WPEA 1RSGA 4ZCCA 3VR9A 1ZOVA 1GSNA 4B1BA 1LQTA 1XPQA 2XYOA 3F8RA 3UOVA 2NVKX 3BI2A 2I0ZA 3LZWA 2BXRA 2B7SA 2WOWA 1L9CA 5L46A 3V76A 1RP0A 1F8WA 1OJ9A 4GDPA 3AE4A 3DJGX 3DK4A 3Q6JA 3GRTA 2RABA 2RGOA 2QA2A 4TM4A 3P4RA 4CCRA 2WP9A 1GV4A 1YQ4A 4KPRA 1B37A 3AE2A 5BVAA 1ZP0A 4YT0A 4HB9A 4EM4A 1FCDA 1CJCA 2GR2A 3AE6A 3PVCA 4GCMA 5TR3A 1K0JA 2FJDA 3AYLA 4USQA 5HHFA 1YKJA 2DKHA 2YLRA 3GDPA 4JY3A 1XANA 2AQJA 2CULA 3AE8A 3I6DA 4BK3A 5FS6A 1S3EA 4H4XA 2BACA 5FS9A 4K5RA 3NG7X 3CGCA 4LA1A 4C3XA 4OVIA 4B66A 4C3YA 3DK9A 3DJEA 3GRSA 4U2TA 1GRTA 1GTHA 1ZY8A 5U1OA 3UOXA 3CGDA 4BJYA 3B6DA 3H8LA 1N1PA 3KPKA 3C4AA 2EQ7A 4JNQA 1ONFA 1B4VA 1JRXA 4J36A 2R45A 3UTHA 2YLZA 1PBEA 5EB4A 4I59A 3SZWA 1EL5A 5GSNA 4H2QA 3UOZA 4J33A 3ITJA 3WE0A 4HA6A 2C66A 2ZZ0A 5JCKA 3SYIA 4DSGA 3DH9A 4YTNA 1N4WA 3P4PA 2OAMA 2LFCA 2UZZA 1K0LA 2B9YA 2BCPA 2E1MA 1IUWA 3UKKA 2B9WA 3BI5A 4M52A 1YQ3A 1H7WA 2XLPA 4Z24A 1S2QA 4CBQA 3CNPA 3GQHA 2C67A 2WDQA 4A6NA 2ACZA 1FEBA 1Y56B 1ZKQA 3IF9A 4Z26A 2BABA 3CIRA 1PBBA 2YG5A 4EIPA 3AEFA 2C3DA 4O5QA 1YY5A 2Q6UA 3PO7A 3UKPA 3C96A 2XLTA 1DXLA 1F3PA 4AT2A 1GETA 2V6OA 2GB0A 1M6IA 1RYIA 3KD9A 3T37A 3I3LA 3NN0X 1TDEA 3GDNA 5U63A 2X50A 4EMWA 4H4UA 2XVFA 2JB3A 3SM8A 2GQWA 1CHUA 3ICSA 3BI4A 1TYPA 1O94A 1PBDA 1S2YA 3V3NA 3NHOX 2O9ZA 4AP1A 4EQSA 2RGHA 3GSIA 2WBAA 2BS4A 3BNMA 2BCGG 3ALJA 3AEEA 2XFOA 1D4CA 1PBFA 3D8XA 4TLXA 4EIQA 2YG4A 2JB2A 3DGZA 5KWFA 2GMHA 3ABVA 5C3JA 1LVLA 2WOIA 1GTEA 4J2WA 3KA7A 1Y0PA 4BK1A 1DOCA 3CNTA 2YM2A 4RG4A 1KSUA 3R9UA 2XVIA 4CY6A 1NHSA 4DNAA 2BK3A 2CVJA 2QAEA 3KVEA 2C73A 1JOAA 4D04A 2BS2A 2Z5YA 5FS7A 1CC6A 3SFDA 2GAGB 1O95A 1EL8A 1NG4A 4U8MA 4U2SA 1LJ1A 2BXSA 5HY5A 1GXFA 1PHHA 4WX1A 2YVJA 3UKQA 2WU5A 3VRBA 3K30A 2GH5A 3E1TA 2WOVA 1O5WA 3UOYA 5IQ1A 5IPYA 3NNEA 1GT8A 5BUKA 3CGEA 1QJDA 4NZHA 2WS3A 4EM3A 5M10A 5JCIA 1TRBA 2XFPA 3UTEA 1VG9A 3RNMA 5EBKA 3P1WA 4E0VA 2ARDA 1E1LA 4JDRA 3NK1X 3CPHG 3URHA 4U8OA 2VRLA 3AEGA 1LQUA 3B3RA 3T14A 1E6EA 2HQMA 4FK1C 1VG0A 2VQ7A 3NGCX 2GR3A 2X99A 4OPLA 3SUCA 1REOA 4MJWA 3AE3A 1B8SA 1D5TA 1NHQA 3CTYA 3LOVA 2Y6QA 1E1NA 2E4GA 1OJTA 4NEWA 4OPUA 3GD3A 4G74A 4Z43A 1CBOA 1D4EA 2X8CA 4BV6A 3FIMB 3ADAB 4J31A 5CQFA 1JEHA 5CKUA 3OC4A 1IUXA 4G6HA 1Q9IA 3HYWA 3AE9A 3L8KA 4H4SA 5KVHA 2R0GA 2VQBA 1JNZA 1D7YA 1L9EA 3LJPA 5J7XA 1E1MA 4TM0A 4NNJA 1UKVG 1KNRA 3GYIA 4IVOB 1GESA 3ZYXA 4B67A 1DOBA 2YM1A 4H4PA 1KDGA 1JRYA 2IVEA 2TMDA 3QJ4A 1ELIA 2BC0A 1GALA 2R46A 1E1KA 2VVLG 3UCLA 1NPXA 1CJ4A 3UP4A 4N9XA 3VRDB 5BRTA 3AWIA 2ZZCA 4OPTA 4K5SA 4NTEA 3AE5A 1KSSA 2F5ZA 2EQ9A 3BHKA 4H2RA 4ZCDA 4OPDA 1TDOA 3UKAA 2XCGA 1SEZA 4YSZA 4YSHA 2WDVA 1CC2A 2AR8A 3CN8A 2YLWA 1BZLA 5HYMA 5KXJA 1GEUA 4I58A 4LIIA 4YSXA 5KOWA 1OJAA 3O0HA 4X9MA 5KVIA 4LU6A 4G9KA 1FL2A 3QVPA 2IVDA 2XFQA 3EF6A 4II2A 1QLBA 2FJBA 1GOSA 2GEWA 1V59A 1TDNA 3NK2X 3UKFA 4XXGA 3G5QA 4UDPA 2R0PA 3II4A 4REKA 3SFEA 1DNCA 2JK6A 4K2XA 4O5UA 1H86A 3KKJA 2YLTA 2QA1A 1FECA 2WU2A 1DJNA 2ZZBA 5KOXA 4A9WA 2VVLA 4JNAA 1N4VA 2GR0A 2XLSA 3QVRA 4B64A 2Q7VA 4B68A 1YQZA 2VZ2A 3ALLA 3H8IA 3GYXA 5FMHA 1L9DA 3M12A 1PXAA 1PJ5A 1NEKA 1Z6LA 3CNJA 2WHDA 2YVGA 3M0OA 2WETA 4GAVA 4EQWA 4Z25A 1Q1RA 4II3A 3UP5A 2BS3A 4ZN0A 1H83A 3GQKA 5KMRA 1TDKA 3RP7A 2WQYA 2V3AA 1BF3A 4OPIA 2C75A 1KFYA 4A65A 1F8SA 4K7ZA 2R0CA 4H4YA 2APGA 1JNRA 1B5QA 2C76A 5ER0A 2CDUA 2WESA 3AD7B 1IUVA 4FX9A 5LV9A 2YG6A 4A6NB 2WDRA 3LZXA 1MO9A 5KMPA 3T0KA 1PS9A 4A79A 2GF3A 2Y6RA 1JU2A 2EQ6A 3LB8A 4AT0A 1NG3A 4OPCA 3H4KA 1GERA 2ZBWA 1GNDA 3AD9B 3CPJG 5KRQA 4U2LA 1JRZA 1XHCA 2JBVA 2XVJA 3ALMA 3GMCA 1PJ7A 4GR1A 1VDCA 2AAQA 4USRA 3SXIA 3FMWA 3SY4A 5KMSA 3HYVA 2R4JA 1HYUA 4C74A 1H7XA 1GRAA 2Q0KA 3AXBA 3DK8A 3IHGA 3JSKA 3KU9A 5FS8A 4CRTA 4DSHA 4AP3A 1H84A 1DOEA 3D1CA 4CNJA 2BRAA 5DBJA 4X9NA 3REDA 1AOGA 1KF6A 2TPRA 4YKGA 1MOKA 5EB5A 1IUSA 4APNA 1FEAA 3F8PA 3VR8A 2PYXA 1GRFA 1BGNA 1GRGA 4H2NA 1COYA 2GQFA 3RP6A 4BK2A 3IHMA 4UDRA 1OJCA 1ZMCA 3K7TA 4FDCB 2XFNA 1OJDA 1P2HA 3NT6A 2Q0LA 5M0ZA 4YSYA 2BC1A 1H6VA 2C3CA 3S5WA 4TM3A 1VQWA 4KX6A 4H4VA 4CY8A 4NTCA 4H50A 2A87A 2H89A 2W0HA 3K7QX 2B9XA 1CJ3A 1P2EA 3KLJA 2VOUA 4EMJA 3P9UA 4J57A 3BNUA 2BA9A 1GRBA 3NLCA 3HYXA 4EMIA 4FK1A 4DGKA 3ISHA 3PS9A 3OZ2A 3VQRA 2VRMA 4PABA 2FJAA 2DKIA 1PXBA 4P9SA 2YLXA 4TLZA 4ADWA 3DA1A 5EOWA 4EQXA 5KMQA 2GAHB 3UKHA 1PBCA 1NENA 3LADA 2YG3A 2BYBA 3V3OA 4A7AA 2V3BA 4G73A 2V60A 1TYTA 1N4UA 2BK5A 4RG3A 3AYIA 3EPTA 3NYEA 1IUTA 1LPFA 4Z2TA 2A89A 2BRYA 1XDIA 3T31A 3IWAA 4XWZA 3LXDA 4U8IA 4BJZA 2E5VA 3GWDA 3NTAA 4BURA 1PXCA 4PAAA 2C4CA 4JQ9A 1GREA 1CC4A 1NDAA 2X8HA 4NWZA 1F6MA 4H4RA 3DJDA 4IA6A 3QFAA 1NHPA 2XLRA 4Y4MA 3FG2P 4OPGA 3T2YA 3GWFA 5IQ4A 1VRQB 2R9ZA 2FJEA 3DMEA 2YLSA 2YAUA 5HXIA 5JCNA 2IIDA 1ZK7A 1W4XA 2X8GA 3NIXA 3NYCA 4K22A 4Y4LA 3SZCA 3NRNA 1PJ6A 1Q1WA 3SGLA 1EBDA 2YWLA 4B65A 3CNDA 3G5RA 2OA1A 1QO8A 3CGBA 2C7GA 3RP8A 4EQRA 4H2PA 2YVFA 4B69A 5C2TA 4GUVA 2X3NA 2RGJA 4H4WA 1EL9A 3SX6A 4A5LA 4C77A 1FOHA 1Y56A 3FBSA 3QSEA 4XWRA 4OCGA 3RHAA 4A99A 3DGHA 4U8LA 3AEAA 4AOSA 1CJ2A 3CPIG 2GRTA 2C65A 1ZMDA 1LTXR 2XLUA 3CNSA 5BULA 5J60A 4GRTA 5JCLA 2OLOA 4RSLA 3ICTA 2A8XA 1D7LA 3AE7A 1H82A 1NHRA 3EAOA 3SQPA 1TDFA 1BGJA 4YTMA 2GR1A 4C5OA 2C72A 3SZ0A 4GF7A 1K0IA 4H7UA 3AECA 3L1RA 3UTGA 1E7PA 4CCQA 2B7RA 5JCMA 1K4QA 1S3BA 2B76A 3GD4A 1BKWA 4G6GA 5U25A 1BWCA 1NAAA 4Z2RA 4CNKA 4NEVA 2V5ZA 4Y4NA 4IV9A 1E39A 3G5SA 4YTPA 3ICRA 4YXDA 4UP3A 2YR5A 4Z44A 3COXA 3C4NA 2FBWA 1GRHA 4J34A 3NTDA 2XVHA 2XDOA 3T2ZA 3S61A 4ECHA 1DJQA 3GYJA 2YQUA 4IA5A 2VVMA 3HZLA 2J3NA 3QSSA 3AD8B 3KPFA 2Z5XA 2OLNA 4IVMB 3Q9TA 3VRAA 2WPFA 4H4ZA 4ICYA 4U8JA 1DODA 3EANA 3AE1A 4U8PA 2JKCA 3F8DA 4Z2UA 4U8NA 3P4QA 2H88A 2GVCA 1MXTA 3CMMA 3AYJA 1D4DA 1PDHA 2EQ8A 4YKFA 2WP6A 4TM1A 3ATRA 1ZX9A 3AEBA 2OALA 4X4JA 3NYFA 2XFUA 3QSMA 2WP5A 1EL7A 3P4SA 2CFYA 4JY2A 5KNLA 2JB1A 3K7MX 1IJHA 3ATQA 3FPZA 3DJJA 3AEDA 2GMJA 1ZDLA 2R4EA 4NTDA 3ZDNA 2QCUA 1L0VA 4D03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHF A;  1KNP A;  2PHH A;  1H81 A;  2YG7 A;  2YR4 A;  3AB1 A;  4B63 A;  2GV8 A;  3QFB A;  4H4Q A;  4YWO A;  3M13 A;  1CL0 A;  4UDQ A;  4J56 A;  2NPX A;  1ZOY A;  1CF3 A;  4JN9 A;  2C70 A;  2V61 A;  3NH3 X;  3NK0 X;  4H4T A;  1F8R A;  2YR6 A;  3NKS A;  1PN0 A;  4K8D A;  4AOX A;  2WPC A;  2WEU A;  4WCT A;  2BK4 A;  3NN6 X;  2C64 A;  3UKL A;  1M64 A;  4U8K A;  1X31 B;  3IC9 A;  5GRT A;  3UTF A;  1IUU A;  2XVE A;  1GPE A;  3GMB A;  1LV0 A;  4GDE A;  2JAE A;  2WPE A;  1RSG A;  4ZCC A;  3VR9 A;  1ZOV A;  1GSN A;  4B1B A;  1LQT A;  1XPQ A;  2XYO A;  3F8R A;  3UOV A;  2NVK X;  3BI2 A;  2I0Z A;  3LZW A;  2BXR A;  2B7S A;  2WOW A;  1L9C A;  5L46 A;  3V76 A;  1RP0 A;  1F8W A;  1OJ9 A;  4GDP A;  3AE4 A;  3DJG X;  3DK4 A;  3Q6J A;  3GRT A;  2RAB A;  2RGO A;  2QA2 A;  4TM4 A;  3P4R A;  4CCR A;  2WP9 A;  1GV4 A;  1YQ4 A;  4KPR A;  1B37 A;  3AE2 A;  5BVA A;  1ZP0 A;  4YT0 A;  4HB9 A;  4EM4 A;  1FCD A;  1CJC A;  2GR2 A;  3AE6 A;  3PVC A;  4GCM A;  5TR3 A;  1K0J A;  2FJD A;  3AYL A;  4USQ A;  5HHF A;  1YKJ A;  2DKH A;  2YLR A;  3GDP A;  4JY3 A;  1XAN A;  2AQJ A;  2CUL A;  3AE8 A;  3I6D A;  4BK3 A;  5FS6 A;  1S3E A;  4H4X A;  2BAC A;  5FS9 A;  4K5R A;  3NG7 X;  3CGC A;  4LA1 A;  4C3X A;  4OVI A;  4B66 A;  4C3Y A;  3DK9 A;  3DJE A;  3GRS A;  4U2T A;  1GRT A;  1GTH A;  1ZY8 A;  5U1O A;  3UOX A;  3CGD A;  4BJY A;  3B6D A;  3H8L A;  1N1P A;  3C4A A;  2EQ7 A;  4JNQ A;  1ONF A;  1B4V A;  1JRX A;  4J36 A;  2R45 A;  3UTH A;  2YLZ A;  1PBE A;  5EB4 A;  4I59 A;  1EL5 A;  5GSN A;  4H2Q A;  3UOZ A;  4J33 A;  3ITJ A;  3WE0 A;  4HA6 A;  2C66 A;  2ZZ0 A;  5JCK A;  4DSG A;  3DH9 A;  4YTN A;  1N4W A;  3P4P A;  2OAM A;  2LFC A;  2UZZ A;  1K0L A;  2B9Y A;  2BCP A;  2E1M A;  1IUW A;  3UKK A;  2B9W A;  3BI5 A;  4M52 A;  1YQ3 A;  1H7W A;  2XLP A;  4Z24 A;  1S2Q A;  4CBQ A;  3CNP A;  3GQH A;  2C67 A;  2WDQ A;  4A6N A;  2ACZ A;  1FEB A;  1Y56 B;  1ZKQ A;  3IF9 A;  4Z26 A;  2BAB A;  3CIR A;  1PBB A;  2YG5 A;  4EIP A;  3AEF A;  2C3D A;  4O5Q A;  1YY5 A;  2Q6U A;  3PO7 A;  3UKP A;  3C96 A;  2XLT A;  1DXL A;  1F3P A;  4AT2 A;  1GET A;  2V6O A;  2GB0 A;  1M6I A;  1RYI A;  3KD9 A;  3T37 A;  3I3L A;  3NN0 X;  1TDE A;  3GDN A;  5U63 A;  2X50 A;  4EMW A;  4H4U A;  2XVF A;  2JB3 A;  3SM8 A;  2GQW A;  1CHU A;  3ICS A;  3BI4 A;  1TYP A;  1O94 A;  1PBD A;  1S2Y A;  3V3N A;  3NHO X;  2O9Z A;  4AP1 A;  4EQS A;  2RGH A;  3GSI A;  2WBA A;  2BS4 A;  3BNM A;  2BCG G;  3ALJ A;  3AEE A;  2XFO A;  1D4C A;  1PBF A;  3D8X A;  4TLX A;  4EIQ A;  2YG4 A;  2JB2 A;  3DGZ A;  5KWF A;  2GMH A;  3ABV A;  5C3J A;  1LVL A;  2WOI A;  1GTE A;  4J2W A;  3KA7 A;  1Y0P A;  4BK1 A;  1DOC A;  3CNT A;  2YM2 A;  4RG4 A;  1KSU A;  3R9U A;  2XVI A;  4CY6 A;  1NHS A;  4DNA A;  2BK3 A;  2CVJ A;  2QAE A;  3KVE A;  2C73 A;  1JOA A;  4D04 A;  2BS2 A;  2Z5Y A;  5FS7 A;  1CC6 A;  3SFD A;  2GAG B;  1O95 A;  1EL8 A;  1NG4 A;  4U8M A;  4U2S A;  1LJ1 A;  2BXS A;  5HY5 A;  1GXF A;  1PHH A;  4WX1 A;  2YVJ A;  3UKQ A;  2WU5 A;  3VRB A;  3K30 A;  2GH5 A;  3E1T A;  2WOV A;  1O5W A;  3UOY A;  5IQ1 A;  5IPY A;  3NNE A;  1GT8 A;  5BUK A;  3CGE A;  1QJD A;  4NZH A;  2WS3 A;  4EM3 A;  5M10 A;  5JCI A;  1TRB A;  2XFP A;  3UTE A;  1VG9 A;  3RNM A;  5EBK A;  3P1W A;  4E0V A;  2ARD A;  1E1L A;  4JDR A;  3NK1 X;  3CPH G;  3URH A;  4U8O A;  2VRL A;  3AEG A;  1LQU A;  3B3R A;  1E6E A;  2HQM A;  4FK1 C;  1VG0 A;  2VQ7 A;  3NGC X;  2GR3 A;  2X99 A;  4OPL A;  3SUC A;  1REO A;  4MJW A;  3AE3 A;  1B8S A;  1D5T A;  1NHQ A;  3CTY A;  3LOV A;  2Y6Q A;  1E1N A;  2E4G A;  1OJT A;  4NEW A;  4OPU A;  3GD3 A;  4Z43 A;  1CBO A;  1D4E A;  2X8C A;  4BV6 A;  3FIM B;  3ADA B;  4J31 A;  5CQF A;  1JEH A;  5CKU A;  3OC4 A;  1IUX A;  1Q9I A;  4H4S A;  3AE9 A;  3L8K A;  5KVH A;  2R0G A;  2VQB A;  1JNZ A;  1D7Y A;  1L9E A;  3LJP A;  5J7X A;  1E1M A;  4TM0 A;  1UKV G;  1KNR A;  3GYI A;  4IVO B;  1GES A;  3ZYX A;  4B67 A;  1DOB A;  2YM1 A;  4H4P A;  1KDG A;  1JRY A;  2IVE A;  2TMD A;  3QJ4 A;  1ELI A;  2BC0 A;  1GAL A;  2R46 A;  1E1K A;  2VVL G;  3UCL A;  1NPX A;  1CJ4 A;  3UP4 A;  4N9X A;  3VRD B;  5BRT A;  3AWI A;  2ZZC A;  4OPT A;  4K5S A;  4NTE A;  3AE5 A;  1KSS A;  2F5Z A;  2EQ9 A;  3BHK A;  4H2R A;  4ZCD A;  4OPD A;  1TDO A;  3UKA A;  2XCG A;  1SEZ A;  4YSZ A;  4YSH A;  2WDV A;  1CC2 A;  2AR8 A;  3CN8 A;  2YLW A;  1BZL A;  5HYM A;  5KXJ A;  1GEU A;  4I58 A;  4LII A;  4YSX A;  5KOW A;  1OJA A;  3O0H A;  4X9M A;  5KVI A;  4LU6 A;  1FL2 A;  3QVP A;  2IVD A;  2XFQ A;  3EF6 A;  1QLB A;  2FJB A;  1GOS A;  2GEW A;  1V59 A;  1TDN A;  3NK2 X;  3UKF A;  4XXG A;  3G5Q A;  4UDP A;  2R0P A;  3II4 A;  4REK A;  3SFE A;  1DNC A;  2JK6 A;  4K2X A;  4O5U A;  1H86 A;  3KKJ A;  2YLT A;  2QA1 A;  1FEC A;  2WU2 A;  1DJN A;  2ZZB A;  5KOX A;  4A9W A;  2VVL A;  4JNA A;  1N4V A;  2GR0 A;  2XLS A;  3QVR A;  4B64 A;  2Q7V A;  4B68 A;  1YQZ A;  2VZ2 A;  3ALL A;  3H8I A;  3GYX A;  5FMH A;  1L9D A;  3M12 A;  1PXA A;  1PJ5 A;  1NEK A;  1Z6L A;  3CNJ A;  2WHD A;  2YVG A;  3M0O A;  2WET A;  4EQW A;  4Z25 A;  1Q1R A;  3UP5 A;  2BS3 A;  4ZN0 A;  1H83 A;  3GQK A;  1TDK A;  3RP7 A;  2WQY A;  2V3A A;  1BF3 A;  4OPI A;  2C75 A;  1KFY A;  4A65 A;  1F8S A;  4K7Z A;  2R0C A;  4H4Y A;  2APG A;  1JNR A;  1B5Q A;  2C76 A;  5ER0 A;  2CDU A;  2WES A;  3AD7 B;  1IUV A;  4FX9 A;  5LV9 A;  2YG6 A;  4A6N B;  2WDR A;  3LZX A;  1MO9 A;  4A79 A;  1PS9 A;  2GF3 A;  2Y6R A;  1JU2 A;  2EQ6 A;  3LB8 A;  4AT0 A;  1NG3 A;  4OPC A;  3H4K A;  1GER A;  2ZBW A;  1GND A;  3AD9 B;  3CPJ G;  5KRQ A;  4U2L A;  1JRZ A;  1XHC A;  2JBV A;  2XVJ A;  3ALM A;  3GMC A;  1PJ7 A;  4GR1 A;  1VDC A;  2AAQ A;  4USR A;  3FMW A;  2R4J A;  1HYU A;  4C74 A;  1H7X A;  1GRA A;  2Q0K A;  3AXB A;  3DK8 A;  3IHG A;  3JSK A;  3KU9 A;  5FS8 A;  4CRT A;  4DSH A;  4AP3 A;  1H84 A;  1DOE A;  3D1C A;  4CNJ A;  5DBJ A;  4X9N A;  3RED A;  1AOG A;  1KF6 A;  2TPR A;  4YKG A;  1MOK A;  5EB5 A;  1IUS A;  4APN A;  1FEA A;  3F8P A;  3VR8 A;  2PYX A;  1GRF A;  1BGN A;  1GRG A;  4H2N A;  1COY A;  2GQF A;  3RP6 A;  4BK2 A;  3IHM A;  4UDR A;  1OJC A;  1ZMC A;  3K7T A;  4FDC B;  2XFN A;  1OJD A;  1P2H A;  3NT6 A;  2Q0L A;  5M0Z A;  4YSY A;  2BC1 A;  1H6V A;  2C3C A;  3S5W A;  4TM3 A;  1VQW A;  4KX6 A;  4H4V A;  4CY8 A;  4NTC A;  4H50 A;  2A87 A;  2H89 A;  2W0H A;  3K7Q X;  2B9X A;  1CJ3 A;  1P2E A;  3KLJ A;  2VOU A;  4EMJ A;  3P9U A;  4J57 A;  3BNU A;  2BA9 A;  1GRB A;  3NLC A;  4EMI A;  4FK1 A;  4DGK A;  3ISH A;  3PS9 A;  3OZ2 A;  3VQR A;  2VRM A;  4PAB A;  2FJA A;  2DKI A;  1PXB A;  4P9S A;  2YLX A;  4TLZ A;  4ADW A;  3DA1 A;  5EOW A;  4EQX A;  2GAH B;  3UKH A;  1PBC A;  1NEN A;  3LAD A;  2YG3 A;  2BYB A;  3V3O A;  4A7A A;  2V3B A;  2V60 A;  1TYT A;  1N4U A;  2BK5 A;  4RG3 A;  3AYI A;  3EPT A;  3NYE A;  1IUT A;  1LPF A;  4Z2T A;  2A89 A;  1XDI A;  3IWA A;  4XWZ A;  3LXD A;  4U8I A;  4BJZ A;  2E5V A;  3GWD A;  3NTA A;  4BUR A;  1PXC A;  4PAA A;  4JQ9 A;  1GRE A;  1CC4 A;  1NDA A;  2X8H A;  1F6M A;  4H4R A;  3DJD A;  4IA6 A;  3QFA A;  1NHP A;  2XLR A;  4Y4M A;  3FG2 P;  4OPG A;  3GWF A;  5IQ4 A;  1VRQ B;  2R9Z A;  2FJE A;  3DME A;  2YLS A;  2YAU A;  5HXI A;  5JCN A;  2IID A;  1ZK7 A;  1W4X A;  2X8G A;  3NIX A;  3NYC A;  4K22 A;  4Y4L A;  3NRN A;  1PJ6 A;  1Q1W A;  3SGL A;  1EBD A;  2YWL A;  4B65 A;  3CND A;  3G5R A;  2OA1 A;  1QO8 A;  3CGB A;  2C7G A;  3RP8 A;  4EQR A;  4H2P A;  2YVF A;  4B69 A;  5C2T A;  4GUV A;  2X3N A;  2RGJ A;  4H4W A;  1EL9 A;  4A5L A;  4C77 A;  1FOH A;  1Y56 A;  3FBS A;  3QSE A;  4XWR A;  4OCG A;  3RHA A;  4A99 A;  3DGH A;  4U8L A;  3AEA A;  4AOS A;  1CJ2 A;  3CPI G;  2GRT A;  2C65 A;  1ZMD A;  1LTX R;  2XLU A;  3CNS A;  5BUL A;  5J60 A;  4GRT A;  5JCL A;  2OLO A;  4RSL A;  3ICT A;  2A8X A;  1D7L A;  3AE7 A;  1H82 A;  1NHR A;  3EAO A;  3SQP A;  1TDF A;  1BGJ A;  4YTM A;  2GR1 A;  4C5O A;  2C72 A;  4GF7 A;  1K0I A;  4H7U A;  3AEC A;  3L1R A;  3UTG A;  1E7P A;  4CCQ A;  2B7R A;  5JCM A;  1K4Q A;  1S3B A;  2B76 A;  3GD4 A;  1BKW A;  5U25 A;  1BWC A;  1NAA A;  4Z2R A;  4CNK A;  4NEV A;  2V5Z A;  4Y4N A;  4IV9 A;  1E39 A;  3G5S A;  4YTP A;  3ICR A;  4YXD A;  4UP3 A;  2YR5 A;  4Z44 A;  3COX A;  3C4N A;  2FBW A;  1GRH A;  4J34 A;  3NTD A;  2XVH A;  2XDO A;  3S61 A;  4ECH A;  1DJQ A;  3GYJ A;  2YQU A;  4IA5 A;  2VVM A;  3HZL A;  2J3N A;  3QSS A;  3AD8 B;  3KPF A;  2Z5X A;  2OLN A;  4IVM B;  3Q9T A;  3VRA A;  2WPF A;  4H4Z A;  4ICY A;  4U8J A;  1DOD A;  3EAN A;  3AE1 A;  4U8P A;  2JKC A;  3F8D A;  4Z2U A;  4U8N A;  3P4Q A;  2H88 A;  2GVC A;  1MXT A;  3AYJ A;  1D4D A;  1PDH A;  2EQ8 A;  4YKF A;  2WP6 A;  4TM1 A;  3ATR A;  1ZX9 A;  3AEB A;  2OAL A;  4X4J A;  3NYF A;  2XFU A;  3QSM A;  2WP5 A;  1EL7 A;  3P4S A;  2CFY A;  4JY2 A;  2JB1 A;  3K7M X;  1IJH A;  3ATQ A;  3FPZ A;  3DJJ A;  3AED A;  2GMJ A;  1ZDL A;  2R4E A;  4NTD A;  3ZDN A;  2QCU A;  1L0V A;  4D03 A; 
#chains in the Genus database with same CATH topology
 2PHH A;  4JEU B;  5A1L A;  1H81 A;  3C4W A;  2YG7 A;  1RUD 4;  3AB1 A;  1MIY A;  4YWO A;  1CL0 A;  5AQI B;  2X68 A;  2XY8 B;  1PIV 4;  2MYS A;  2ZMA A;  4TX5 A;  3NKS A;  3RLF F;  4WCT A;  2HN2 A;  1NCQ D;  5HCM A;  2XZE A;  3LBX A;  5L3D B;  1IUU A;  1N32 T;  1KNZ A;  2WPE A;  2KZ7 B;  1RSG A;  2UXD T;  1LQT A;  1GQE A;  2PW9 A;  5L3C B;  3UOV A;  2BXR A;  3LG7 A;  1L9C A;  4Z8X A;  2PFV A;  1RP0 A;  1F8W A;  4GDP A;  2KLQ A;  3ZCI A;  3Q6J A;  3N9P A;  4HWC A;  4QXH B;  2MBG A;  1YQ4 A;  4CXW A;  3AE2 A;  3RIF A;  1Z7S 4;  3IA3 A;  1M7K A;  4YT0 A;  3HR0 A;  4JV5 T;  1K0J A;  3AYL A;  1LVF A;  2Q9Q A;  4UVB B;  4EED A;  3AXJ A;  3ZJ1 A;  2AQJ A;  2YDQ A;  1UCU A;  2CUL A;  3AE8 A;  2CEA A;  4CZZ B;  2XQ3 A;  4H4X A;  3EAB A;  2DI4 A;  4C3X A;  5HXR A;  1BR2 A;  3DK9 A;  3U3I A;  1GRT A;  2M6I A;  5LBQ B;  4YJ3 E;  4CXY A;  1ONF A;  1B4V A;  3UTH A;  2R45 A;  1RUC 4;  2LSI A;  1SE7 A;  3OBV E;  4UF0 A;  4I59 A;  3ITJ A;  4HA6 A;  2ZZ0 A;  3SYI A;  1V9D A;  4GK0 E;  3KV5 A;  3UKK A;  5AQV B;  3I0Q A;  4LFB T;  4CBQ A;  3V5S A;  3CNP A;  3GQH A;  4HWF A;  2N1G A;  2C67 A;  2ACZ A;  1FEB A;  4COF A;  2XPK A;  3CIR A;  2BAB A;  2YG5 A;  3N9Q A;  4DUZ T;  2Q6U A;  2R6G F;  3UKP A;  3C96 A;  1DXL A;  3PUX F;  1RYI A;  3K1S A;  4EMW A;  2JB3 A;  1CHU A;  1S2Y A;  3V3N A;  2O9Z A;  3GSI A;  4QX8 B;  4P1N A;  3ALJ A;  2YDS A;  3FZL B;  4EIQ A;  2X66 A;  1WCR A;  3UTK A;  3ZLI A;  1LVL A;  2Q9Q D;  1Y0P A;  3J7Y q;  3R9U A;  3KV4 A;  4CY6 A;  5J2T E;  5F3J A;  1HG5 A;  4DNA A;  3KVE A;  1JOA A;  1HNX T;  1R8I A;  5FS7 A;  1NG4 A;  3N2G E;  2BXS A;  3ETV A;  5HY5 A;  4DV6 T;  1K5M D;  4ISS A;  1IJ5 A;  2GH5 A;  1O5W A;  4NZH A;  5JCI A;  2V26 A;  5F8P A;  3R6N A;  2XFP A;  3RNM A;  4H63 V;  2EHO C;  5EBK A;  5FXW A;  1LRZ A;  3CPH G;  3URH A;  4U8O A;  2VRL A;  1E6E A;  3AVS A;  2HQM A;  5FNV E;  2VQ7 A;  3SUC A;  1XDO A;  4MJW A;  1OOP D;  3NWI A;  1D5T A;  3LOV A;  2X0L B;  2VVN A;  1XHX A;  4GKK T;  2E4G A;  5JH7 E;  4NEW A;  4OPU A;  3FBL A;  1CBO A;  4LMJ A;  1D4E A;  4AQY T;  4BV6 A;  1HR0 T;  3FIM B;  4J31 A;  1H7C A;  1JEH A;  4MFR A;  5AQJ B;  1AR6 4;  5KVH A;  2A72 A;  3AE9 A;  3AAA B;  3Q5D A;  2CE7 A;  3LJP A;  1E1M A;  3LBX B;  4NNJ A;  2MTQ A;  3T1Y T;  1KNR A;  1UKV G;  3GYI A;  1GES A;  3K3Q C;  4H9S E;  1HNW T;  4B67 A;  1DOB A;  2YM1 A;  2A3D A;  2C5K T;  4EYU A;  2BC0 A;  4DR4 T;  3EUH A;  1NPX A;  1PO1 4;  1M62 A;  3VRD B;  5LOV E;  4NTE A;  3A7M A;  4V1A v;  2EQ9 A;  3BHK A;  3RC3 A;  1TDO A;  3UKA A;  1CC2 A;  2AR8 A;  1BZL A;  1GEU A;  2YEV C;  3M65 A;  4YSX A;  5KOW A;  1OJA A;  3AA0 B;  3OVU A;  1FL2 A;  4AQF C;  2W62 A;  2XFQ A;  2Q9Q B;  1D1C A;  2GEW A;  1ASJ 4;  3AXJ B;  3NK2 X;  2RS1 4;  2V6X A;  4ILB A;  2ZM6 T;  2JK6 A;  4K2X A;  3O1I A;  1H86 A;  2YLT A;  5HXH A;  5L3B B;  2WU2 A;  5HWX A;  3MKD A;  4A9W A;  4JNA A;  1N4V A;  4OX9 T;  2DNX A;  4B64 A;  4CI3 B;  2YKS A;  1YQZ A;  2VQE T;  1L9D A;  2UU9 T;  5FMN A;  4UF0 B;  4EQW A;  1HCI A;  4TV9 E;  3UP5 A;  1IZN B;  2BS3 A;  2IC6 A;  1TDK A;  4IDP A;  2WQY A;  5FVK A;  2V3A A;  4ZZB A;  2UUA T;  4OPI A;  2JMK A;  2FUP A;  3JAE A;  4K7Z A;  2CDU A;  2CM0 A;  3AD7 B;  5JDN A;  4WYV A;  4FX9 A;  3B13 A;  2NR4 A;  4HFC A;  2CLY B;  2V7M A;  1PS9 A;  4A79 A;  2Y6R A;  1OED C;  3ZYM A;  4AT0 A;  1NG3 A;  4PJL A;  2YN6 A;  3HKE E;  3HKB E;  5FKY A;  3CPJ G;  1JRZ A;  1XHC A;  2JBV A;  4UR9 A;  4GR1 A;  5L3G B;  3HYV A;  2R4J A;  3Q5X A;  2Q0K A;  3AXB A;  3UUB A;  5BMV E;  3DK8 A;  2H3R A;  4DSH A;  4LF5 T;  4O2B E;  3TLV A;  3RED A;  4YKG A;  1IUS A;  1S94 A;  5CA0 E;  4IL9 A;  3U78 A;  3ZN1 B;  1HRV 4;  1GRF A;  3RP6 A;  1J5W A;  1UGO A;  2KND A;  1OJC A;  3B57 A;  1XMO T;  2WZI A;  4L5G A;  2JQH A;  4CY8 A;  1O3X A;  4H50 A;  2W0H A;  1CJ3 A;  2VOU A;  3P9U A;  3WAJ A;  5DAB A;  3UFG A;  3PUZ F;  4DR7 T;  2WBL A;  4GKJ T;  3VQR A;  3RRW A;  2VRM A;  4P9S A;  1PXB A;  4TLZ A;  2E8I A;  1ZKE A;  4EQX A;  5KMQ A;  2LKH A;  2DWK A;  2YIN A;  5FXV A;  3V3O A;  1TYT A;  4LFC T;  3FBZ A;  1LPF A;  2A89 A;  2RR1 4;  1XDI A;  3T31 A;  4U8I A;  4BJZ A;  2E5V A;  4TNV A;  1PXC A;  2C4C A;  3EDU A;  1CC4 A;  1GRE A;  2R07 4;  3HKD E;  4Y4M A;  3T2Y A;  2Q9Q C;  5JCN A;  3MA9 A;  4OFZ A;  3SZC A;  2Y8D A;  4ANJ A;  3CND A;  4EQR A;  3M3Z B;  4X1K E;  2C7G A;  4WBN E;  4B69 A;  5C8Y E;  2WAU A;  2VAS A;  1AR9 4;  3RYH E;  2CPT A;  4AXP A;  5AQU B;  4GK5 E;  2V7K A;  3HA4 A;  1Y56 A;  4P0B A;  3CQC B;  4OCG A;  3DGH A;  4AOS A;  3RI5 A;  2GRT A;  2C65 A;  5BUL A;  2BVL A;  2IW5 B;  3MK7 C;  4B3R T;  3SQP A;  2A8X A;  2XAH B;  1AJ3 A;  3PUG A;  2E9X A;  2GR1 A;  4GF7 A;  3FXD B;  3P8C D;  4TWH A;  4H7U A;  4X66 T;  2CLY C;  2W00 A;  3L1R A;  4YHJ A;  5JCM A;  1CUN A;  2XAS B;  4FJO A;  4CNK A;  4TN7 B;  5HCJ A;  4CQI A;  5L2L A;  4IV9 A;  1E39 A;  4YTP A;  3ICR A;  2X9W A;  4UP3 A;  2YR5 A;  3UUL A;  3COX A;  4KUM B;  4ZXL A;  5EK2 A;  2DWG A;  4HWD A;  2NW9 A;  4IL4 A;  1GRH A;  4J34 A;  3ESL A;  1FMV A;  5FL0 A;  4IHJ E;  3LDQ B;  4QXB B;  4HFB A;  4ECH A;  1XI1 A;  2VVM A;  1IBM T;  4JI7 T;  2BBH A;  3N2K E;  3PUA A;  3ZC0 A;  2OLN A;  5AQG B;  3Q9T A;  3VRA A;  4U8J A;  2LSY A;  2A2F X;  1RUE 4;  5HEU A;  4U8P A;  4Z2U A;  4U8N A;  4O2A E;  3P4Q A;  4QH1 A;  1MXT A;  2MOZ A;  4LF4 T;  3CMM A;  2WP6 A;  1VCS A;  3F57 A;  3FZF B;  2WSS V;  3MJX A;  3E0Z A;  3UUX B;  3LK4 2;  3K7M X;  4ZZC A;  3ATQ A;  4PNI A;  2VKO A;  5LGT B;  3FPZ A;  1SA0 E;  5J1G A;  3GN5 A;  3TLU A;  2RA1 A;  4D03 A;  1HG2 A;  4X1I E;  2XQ9 A;  4B63 A;  2GV8 A;  4Q4V 4;  3M13 A;  1CF3 A;  2C70 A;  1YXR A;  3GA8 A;  4AOX A;  2V7I A;  1QUU A;  3UQ7 A;  4HTE A;  2C5J A;  2K3W A;  1MIV A;  5ABH A;  1M64 A;  1Z8U A;  5GRT A;  3UTF A;  4GDE A;  4I50 E;  1LV0 A;  3EAM A;  2KMF A;  2LE8 A;  2E5L T;  4ZCC A;  3VR9 A;  4B1B A;  1GSN A;  1XPQ A;  2XYO A;  3F8R A;  2NTX A;  2I0Z A;  3ZSS A;  2B7S A;  2RGO A;  3P4R A;  2V6Y A;  2WP9 A;  5BVA A;  4KPR A;  2JRK A;  3ONX A;  1FCD A;  3AE6 A;  4NUV A;  1T8B A;  2DKH A;  4GB3 4;  2XAJ B;  3Q5E A;  2PBI A;  5FS9 A;  4K5R A;  1I6Z A;  1N33 T;  3BQK A;  4OVI A;  3RIU A;  2UXC T;  1W0A A;  2WMO A;  3SWH A;  5LMN T;  4BJY A;  3H8L A;  1N36 T;  2VL0 A;  4MLK A;  1N1P A;  3KPK A;  2XQ4 A;  2CRB A;  3RPU A;  5JDH A;  1JRX A;  2YLZ A;  3FZK B;  3ZC1 A;  3SZW A;  1EL5 A;  5GSN A;  1HFA A;  4H2Q A;  4BJN A;  5JCK A;  4DBR A;  4YTN A;  2LFC A;  5LG4 A;  1IUW A;  2B9W A;  3BI5 A;  1YQ3 A;  3OKQ A;  2XLP A;  1RUF 4;  3L09 A;  1YKE B;  1BR0 A;  4A6N A;  4F8H A;  1Y56 B;  1PBB A;  4O5Q A;  1MNE A;  2LSG A;  3RHW A;  4PJJ A;  4G63 A;  4AT2 A;  1M6I A;  3RH3 A;  5E0O A;  3T37 A;  2ZM8 A;  4IRE A;  3NKZ A;  2E9X B;  5U63 A;  4H4U A;  3JAF A;  4EB6 E;  2KWI B;  1ZV4 X;  3BI4 A;  1TYP A;  3NHO X;  1PBF A;  2KT9 A;  2YG4 A;  2LM9 A;  2GMH A;  5C3J A;  2M6B A;  3KA7 A;  4ZI7 E;  1DOC A;  4RG4 A;  1KSU A;  4AKG A;  2CWY A;  2VKH A;  4H9Q C;  1XWM A;  4KP3 C;  4QWN B;  3MXZ A;  4U2S A;  5AQP B;  4WX1 A;  3ZMT B;  3K30 A;  5CJ5 A;  3E1T A;  3QC9 A;  2W61 A;  5IQ1 A;  4YJ2 E;  2OV9 A;  3CGE A;  3HKC E;  1QJD A;  2V5C A;  5M10 A;  1VG9 A;  4H9R C;  3ANW A;  3P1W A;  4E0V A;  1E1L A;  1LQU A;  3B3R A;  3GN5 B;  3T14 A;  1EV1 4;  1VG0 A;  3NGC X;  2GR3 A;  4OPL A;  1REO A;  1HXS 4;  2CBJ A;  2JQ9 A;  4ASK A;  1E1N A;  2X8C A;  3PUR A;  5CQF A;  1Q9I A;  2GK9 A;  5L3F B;  2R0G A;  2LEH A;  1JNZ A;  3G06 A;  4TM0 A;  5LJM A;  2CXL A;  4IVO B;  3T1H T;  3RRC A;  1KDG A;  1ELI A;  2QGS A;  3ZT7 A;  1IJ6 A;  2VVL G;  5LMU T;  3UP4 A;  4KMC A;  5JRC A;  3AWI A;  1R09 4;  4JUY A;  4K5S A;  2F5Z A;  2XQA A;  1XZY A;  2HPL A;  4JI6 T;  4H2R A;  4ZCD A;  4OPD A;  4BJM A;  2V6Y B;  1D0Z A;  5KXJ A;  4I58 A;  4LII A;  1SUM B;  4X9M A;  2K9A A;  2UXX B;  4G9K A;  2X51 A;  4B3T T;  4XXG A;  1NAF A;  3II4 A;  1DNC A;  3LSV A;  4O5U A;  3N9M A;  1SHZ C;  1FEC A;  5LHG B;  2IHR 1;  2ZZB A;  2JMH A;  4IIJ E;  3QVR A;  4B68 A;  3ALL A;  3H8I A;  2NW7 A;  5H6Q B;  5FMH A;  5JVD E;  3CNJ A;  4X62 T;  3M0O A;  4AI6 A;  5AQT B;  1Q1R A;  5L47 A;  1G73 A;  4DV3 T;  4P0A A;  3O1J A;  5CA1 E;  3GQK A;  5KMR A;  4U2Y A;  1E1H B;  1KFY A;  2NTY A;  4PJM A;  2R0C A;  4H4Y A;  5AQO B;  1WR0 A;  3CK6 A;  4DMW A;  4DV5 T;  2C76 A;  5ER0 A;  1WYB A;  4JI5 T;  2CA5 A;  1IUV A;  2YG6 A;  4A6N B;  3LZX A;  1MO9 A;  1UX5 A;  3TLT A;  5KMP A;  5FY0 A;  1JU2 A;  2WB5 A;  4EYY R;  1UUR A;  2YDR A;  2BKP A;  1GER A;  1POV 0;  2ZBW A;  1GND A;  5KRQ A;  3RYI E;  1W9R A;  1EAH 4;  3RIA A;  4XBF B;  3CQG B;  5HEH A;  1FJG T;  3FMW A;  5KMS A;  1RUI 4;  2LJL A;  3I9W A;  4CRT A;  3IHG A;  1WRD A;  2R04 4;  1DOE A;  4CNJ A;  4X9N A;  2PLV 4;  2BBJ A;  1FEA A;  3F8P A;  3AVR A;  3VR8 A;  2PYX A;  4I0U A;  4H2N A;  1ZMC A;  1OJD A;  4NXN T;  1P2H A;  2Q0L A;  2BC1 A;  1H6V A;  4DV2 T;  2C3C A;  3S5W A;  1LKX A;  1VQW A;  4H4V A;  4NTC A;  2A87 A;  4MBQ A;  3KLJ A;  1P2E A;  1EZ3 A;  4EMJ A;  2R06 4;  3BNU A;  1GRB A;  2PTF A;  4EMI A;  4FK1 A;  1RUG 4;  3ISH A;  3PS9 A;  4DV7 T;  5LHH B;  2DKI A;  2B1E A;  2CXD A;  5EOW A;  2RP4 A;  2GAH B;  3UKH A;  4GYR A;  1PBC A;  2HWC 4;  4KI0 F;  2BYB A;  4A7A A;  3ANW B;  1N4U A;  2ZLY A;  3FZM B;  1MMG A;  4E7Z A;  1IUT A;  1WYC A;  3IWA A;  2XQ8 A;  1QSD A;  3CQX C;  4ZHQ E;  4JYA T;  5AQQ B;  4PAA A;  4JQ9 A;  3W15 B;  1NDA A;  2X8H A;  2E2A A;  1F6M A;  3LFM A;  3QFA A;  2XLR A;  5L4H A;  1IBL T;  4OPG A;  3UUN A;  2NW8 A;  4UIG A;  1VRQ B;  2R9Z A;  2D0U A;  2W0G A;  5HXI A;  2IID A;  2V7L A;  2RMU 4;  2BDE A;  4MHC A;  3NYC A;  3NIX A;  4K22 A;  4Y4L A;  2YWL A;  4B65 A;  3G5R A;  3RP8 A;  4HN9 A;  3LJC A;  5C2T A;  3TLS A;  4GUV A;  2X3N A;  4H63 H;  3D0T A;  4QXC B;  2L3L A;  2UXN B;  2VL8 A;  3QNU A;  4GYS A;  5JRC B;  1FOH A;  4DR1 T;  4U8L A;  3AEA A;  2A9U A;  1CJ2 A;  3ONJ A;  3CPI G;  2D5U A;  3OYZ A;  1ZMD A;  3CNS A;  3RYC E;  4H9P C;  4GRT A;  5JCL A;  2JIW A;  3T8O A;  4RSL A;  5IHY A;  3S4U A;  3RC8 A;  1D7L A;  3AE7 A;  1H82 A;  4O4I E;  3BQL A;  1TDF A;  2C72 A;  1W09 A;  1WR6 A;  4HFE A;  4HKA A;  3PU3 A;  2AE9 A;  1S3B A;  3B5M A;  4Z2R A;  5LGU B;  2V5Z A;  3VKG A;  1LVK A;  4IE5 A;  2FBW A;  3UU6 A;  4KHZ F;  2M67 A;  2LHN A;  4F6R C;  3JAD A;  5CFB A;  4HWI B;  2XDO A;  2KXP B;  4TWD A;  3OPC A;  4C90 A;  1DJQ A;  3S61 A;  3GYJ A;  5J0Z A;  2J3N A;  2Y6X A;  4IVM B;  2WPF A;  2LOP A;  2DHR A;  2JKC A;  2H88 A;  2Z6E A;  3V5U A;  3VKH A;  2OAL A;  2XFU A;  3QB5 K;  1EL7 A;  2J4G A;  4Q25 A;  2PYJ A;  1HRI 4;  4Z90 A;  3AED A;  3HI2 A;  3FHN A;  3ZDN A;  3O9X A;  3BHF A;  1KNP A;  4AIS A;  3SZF A;  1H8T D;  2XAG B;  3PE0 A;  4H4Q A;  4GAP A;  4DV4 T;  3R84 B;  2NPX A;  1ZOY A;  1FEW A;  1KK7 A;  3T2K A;  2N9D A;  3NK0 X;  3CWZ B;  4H4T A;  3PJA J;  1F8R A;  2YR6 A;  4K8D A;  2WPC A;  2DLR A;  2WEU A;  1BR4 A;  3NN6 X;  2WWV A;  4DND A;  4O4L E;  2C64 A;  3UKL A;  4NUU A;  4U8K A;  2VK9 A;  1X31 B;  4DR3 T;  3GMB A;  2JAE A;  4IE0 A;  2ODV A;  1VBB 4;  4IDQ A;  3BI2 A;  4ILA A;  1RVF 4;  5JQG E;  3RX6 A;  5L46 A;  2CWO A;  2D2S A;  3KVA A;  3AE4 A;  4JI2 T;  4GOU A;  5FXX A;  4IT4 A;  3DK4 A;  4ADZ A;  1NWM X;  4PAG A;  3UUM A;  4TM4 A;  3JCF A;  3E22 E;  1GV4 A;  4U7Y A;  1ZP0 A;  4EM4 A;  2P9B A;  1CJC A;  2GR2 A;  4AQG A;  3PVC A;  5TR3 A;  4JI3 T;  3KBU A;  1BR1 A;  4USQ A;  5HHF A;  2YK0 A;  5AQK B;  1YKJ A;  2YLR A;  3GDP A;  4JY3 A;  2CHO A;  3I6D A;  4BK3 A;  5FS6 A;  2BAC A;  3CGC A;  2W2U A;  4B66 A;  4C3Y A;  1GTH A;  5U1O A;  4CI2 B;  1ZY8 A;  3UOX A;  1W0B A;  3CGD A;  3QUJ A;  5ETW A;  4NIQ A;  5LGN B;  3B6D A;  2EQ7 A;  4JNQ A;  4I55 E;  1T7S A;  1Y01 A;  1PBE A;  3C50 A;  5EB4 A;  4LMK A;  4Q4Y 4;  4IGU A;  3UOZ A;  4J33 A;  2AXD S;  2C66 A;  3DH9 A;  1N4W A;  1D0Y A;  2UZZ A;  2NOX A;  2BCP A;  3C98 B;  5TAO A;  4LFA T;  2IAK A;  4TUY E;  3SOL A;  2WDQ A;  2YU2 A;  3IF9 A;  3ZMS B;  4Z26 A;  4EIP A;  4CXX A;  4UVC B;  1VBA 4;  1B7T A;  2WZH A;  2CCQ A;  3CPZ A;  2XLT A;  5F5W A;  2V6O A;  2X0H A;  2GB0 A;  3CVR A;  3KD9 A;  4ZS2 A;  1IBK T;  3I3L A;  3NN0 X;  2X50 A;  1PO2 4;  4HFI A;  2GQW A;  3ICS A;  3QK6 A;  4EXT A;  4K0U A;  3N2O A;  4BAY B;  1O94 A;  1PBD A;  4AP1 A;  2RGH A;  4GIW A;  2BS4 A;  3BNM A;  2BCG G;  3AEE A;  2XFO A;  4I43 B;  4U72 A;  1D4C A;  4MAL A;  2JB2 A;  4U3C A;  3DGZ A;  5KWF A;  2WMN A;  2PG8 A;  3CNT A;  2YM2 A;  2OA5 A;  2HHH T;  1NHS A;  2BK3 A;  2CVJ A;  1OXZ A;  4IE7 A;  4D04 A;  4Q4W 4;  1WFD A;  4ZEY A;  2BS2 A;  2Z5Y A;  5AQS B;  3AAI A;  1CC6 A;  3SFD A;  3SS1 A;  1O95 A;  1EL8 A;  1LJ1 A;  1PHH A;  2RS3 4;  2WU5 A;  3VRB A;  3PJA A;  3UOY A;  5IPY A;  4PFO A;  3NNE A;  5FXZ A;  4ERR A;  4EM3 A;  1TRB A;  3UTE A;  4PDW D;  2E9X D;  5EZY E;  1D1A A;  4U2Z A;  3ZEF B;  2ARD A;  4JDR A;  3NK1 X;  2QRX A;  3GWH A;  3AEG A;  3CX8 B;  4FK1 C;  3IBP A;  2KIN B;  3ZJ2 A;  2EHO A;  3AE3 A;  1B8S A;  3X1D A;  3CTY A;  2XQ5 A;  2Y6Q A;  2ODU A;  4Z43 A;  5IWA T;  4G74 A;  5CKU A;  4X1Y E;  3OC4 A;  3VHL A;  3HYW A;  4H4S A;  2IUB A;  2VQB A;  4EGW A;  3NVO A;  1T72 A;  2LLY A;  3PDY A;  2VVS A;  4ZI2 D;  3ZYX A;  3ZKR A;  1JRY A;  4PFP A;  1E1K A;  5HEG A;  3NRY A;  1CJ4 A;  5JTG A;  4AKR B;  2ZZC A;  4OPT A;  1KSS A;  2BG9 A;  1UK5 A;  1U5P A;  5CB4 E;  1YW0 A;  4YSZ A;  4YSH A;  1KEY A;  4JI0 T;  4TZ4 C;  2LT3 A;  2OLT A;  3O0H A;  1MQT D;  1AL2 4;  3QVP A;  4II2 A;  3EF6 A;  1QLB A;  1GOS A;  1V59 A;  1TDN A;  3K3O A;  4QX7 B;  3UKF A;  4M1P A;  3G5Q A;  4UDP A;  2R0P A;  4REK A;  4HE8 A;  4H9O C;  2RPA A;  3KKJ A;  2I59 A;  2QA7 A;  3EDV A;  2D0T A;  2V1D B;  2GR0 A;  1YKH B;  2J1D G;  3LK2 B;  2VZ2 A;  4L9I A;  4YY3 T;  3I1A A;  3M12 A;  1PXA A;  1MND A;  4GAV A;  3ZMV B;  4ZN0 A;  1H83 A;  3J9X 1;  3ZMU B;  3O4X E;  4P09 A;  2C5I T;  3ZT6 A;  3KFW X;  2C75 A;  3ZN0 B;  4A65 A;  1F8S A;  2N2N A;  1JNR A;  1B5Q A;  4ZI3 D;  2WES A;  2ACX A;  5JDF A;  2WDR A;  3BK9 A;  3T0K A;  3EVY A;  4UXN B;  5IUX A;  4OK0 A;  1HS7 A;  3H4K A;  2V7J A;  4FI5 A;  2BKN A;  4QKN A;  5LXT E;  4B3M T;  3AD9 B;  2JQQ A;  4O4J E;  3GMC A;  3SXI A;  1OED A;  1PJ7 A;  3QOF A;  1VDC A;  5L4E A;  4C74 A;  1H7X A;  3JSK A;  5FS8 A;  3RF1 A;  1H84 A;  3D1C A;  3NZQ A;  2BRA A;  1AOG A;  1KF6 A;  5FL1 A;  1VOM A;  5EB5 A;  2LHR A;  3PUQ A;  3K3N A;  3CX6 B;  4YHH T;  1GRG A;  2GQF A;  3PUW F;  5LNK A;  3IHM A;  4UDR A;  3K7T A;  4FDC B;  5M0Z A;  1MMA A;  4YSY A;  3ZYL A;  3NBX X;  3OYX A;  5LG3 A;  4KX6 A;  3KVB A;  1IAP A;  2H89 A;  3AB3 B;  3SRZ A;  2XSB A;  1HF8 A;  4J57 A;  2BA9 A;  1T98 A;  2UXB T;  3HYX A;  4B3S T;  1BEV 4;  3N5L A;  4DGK A;  1MIW A;  1D1B A;  3I9Y A;  1Z0P A;  4ADW A;  3FI7 A;  3I0O A;  3DA1 A;  4WZX A;  2HWB 4;  2LSJ A;  4L0R A;  3FXE B;  3LAD A;  2V3B A;  4G73 A;  2V60 A;  4A97 A;  2BK5 A;  4U31 A;  3AYI A;  3UU8 A;  3EPT A;  3NYE A;  2UUC T;  4Z2T A;  4XWZ A;  4AKL A;  2EHO B;  5AQM B;  4H9N C;  3NTA A;  4BUR A;  2V8S V;  2XQ6 A;  4H4R A;  4IE4 A;  2K48 A;  5DQW A;  5LJN A;  3KV9 A;  1NHP A;  2LSK A;  5M4Y A;  3GWF A;  5IQ4 A;  2G0U A;  3DME A;  2YAU A;  4WBO A;  4DBQ A;  1PJ6 A;  1Q1W A;  2W66 A;  3CGB A;  1QO8 A;  2RS5 4;  3N9L A;  5L3E B;  4H2P A;  1HX8 A;  3RYF E;  2H7O A;  2IIU A;  3C4Z A;  3F31 A;  1EL9 A;  3A5X A;  1XHZ A;  5AQH B;  3ZPO A;  4XAX B;  2BG9 B;  1OWA A;  4UEL A;  4DMV A;  3RKO A;  2E9X C;  5J60 A;  2OLO A;  2YU1 A;  1NHR A;  3EAO A;  5LYJ E;  2XQY A;  1BGJ A;  4YTM A;  3SZ0 A;  3UT5 E;  1K0I A;  3AEC A;  2D9D A;  4LML A;  3ZST A;  2F4V T;  4NXM T;  4DV1 T;  4CCQ A;  2HPJ A;  1HNZ T;  1K4Q A;  3GD4 A;  4G6G A;  1NAA A;  2XTL A;  1HX1 B;  4ILC A;  2VB6 A;  3RQW A;  4Y4N A;  4I4T E;  4Z44 A;  2PY5 A;  1J5E T;  1Y64 B;  1FMW A;  4ZI2 C;  2XVH A;  3T2Z A;  2WM9 A;  2IML A;  4IA5 A;  3HZL A;  5KX5 E;  2X9X A;  3QSS A;  3ETU A;  2Z5X A;  2HN1 A;  5DQV A;  4H4Z A;  1VCT A;  1DOD A;  3EAN A;  4OYJ A;  4DR2 T;  4YFS A;  2GVC A;  1X79 A;  1VRB A;  3PTR B;  1D4D A;  2JJ9 A;  4HWH A;  2RM2 4;  4TM1 A;  4Z91 A;  3AEB A;  4X4J A;  4KBM B;  2KWH A;  3QSM A;  4ZOL E;  3P4S A;  4PK5 A;  2CFY A;  4JY2 A;  2JB1 A;  2YOE A;  3JC6 D;  5KNL A;  3L3P A;  1IJH A;  1OED B;  1ZDL A;  4NTD A;  2LKG A;  3EI0 A;  4PK4 A;  1ZHC A;  2QCU A;  4CN6 A;  2VKJ A;  4IST A;  3LK3 B;  3J8F 4;  2YR4 A;  2PYL A;  2XAF B;  4LF8 T;  3QFB A;  4HFV A;  4UDQ A;  4J56 A;  4TWF A;  4AIU A;  4JN9 A;  2V61 A;  3NH3 X;  1VRH 4;  2DL1 A;  4CN1 A;  2UUB T;  5HEJ A;  1PN0 A;  3P7I A;  1VBD 4;  2KSR A;  2BK4 A;  4NPP A;  1VBC 4;  3OJA A;  4PK6 A;  5HYA A;  5LB7 B;  3IC9 A;  2XVE A;  1GPE A;  4Q4X 4;  3N9N A;  2XQ7 A;  2PJQ A;  3EHZ A;  1ZOV A;  4JBW F;  4ZI3 C;  3Q5W A;  4HGA A;  2K5B B;  2NVK X;  3LZW A;  1G8X A;  2WOW A;  5JDL A;  2BG9 E;  3DJB A;  3V76 A;  1OJ9 A;  3DJG X;  3GRT A;  2RAB A;  2QA2 A;  2JPF A;  4JLE A;  4CCR A;  1B37 A;  1UUS A;  2XUE A;  4HB9 A;  4O8S A;  3IEE A;  4GCM A;  3UFE A;  2FJD A;  2VQF T;  2Y48 B;  4DR5 T;  5HAX A;  3Q2M A;  1XAN A;  3RIU C;  2BG9 C;  1S3E A;  3NG7 X;  2IC9 A;  2NP9 A;  3PUS A;  4LA1 A;  2W4X A;  3DJE A;  3GRS A;  4U2T A;  2VWA A;  3A8Y C;  2LRL A;  4QH4 A;  1XNQ T;  4LF9 T;  4DUY T;  3C4A A;  5HWY A;  1X9B A;  4J36 A;  4IDZ A;  3WE0 A;  4DSG A;  3P4P A;  2OAM A;  5JDQ A;  3ZT5 A;  1K0L A;  2B9Y A;  2E1M A;  3GMI A;  3WI3 A;  5KDM C;  4PJN A;  4M52 A;  2XAQ B;  3PUY F;  1H7W A;  4LF6 T;  4Z24 A;  1S2Q A;  1WLX A;  4OYK A;  5HEO A;  2VUR A;  3PUV F;  3HL6 A;  1ZKQ A;  2DCF A;  3AEF A;  2C3D A;  1YY5 A;  3PO7 A;  2XJ7 A;  1OED E;  1F3P A;  5JR9 A;  1GET A;  2XM1 A;  2I6H A;  1TDE A;  3GDN A;  2CXF A;  4HEA A;  2X9H A;  2XVF A;  3SM8 A;  2ZM0 A;  3AAE B;  2W67 A;  4EQS A;  1US7 B;  2WBA A;  4XZC A;  5ADX L;  4U74 A;  1U4Q A;  3CX7 B;  4DV0 T;  3IHR A;  3D8X A;  4TLX A;  3FZH B;  3ABV A;  2WOI A;  1GTE A;  2L8K A;  4J2W A;  4JI1 T;  4BK1 A;  2XVI A;  2QAE A;  2X67 A;  2C73 A;  4X5T A;  3VU7 H;  2GAG B;  4U8M A;  1GXF A;  2YVJ A;  3UKQ A;  3QB5 A;  4CN4 A;  5GON E;  3E08 A;  4UEM A;  2WOV A;  3H3A A;  1GT8 A;  5BUK A;  2WS3 A;  5HXE A;  3AA1 B;  1RUJ 4;  5IYZ E;  3PU8 A;  5LP6 E;  4CI1 B;  5J2U E;  5HXC A;  3K8P C;  2X99 A;  1NHQ A;  2XSA A;  2JQK A;  4JI8 T;  2BKO A;  4HFD A;  1OJT A;  3GD3 A;  4TNW A;  5FY7 A;  3DP7 A;  5LCY A;  4X65 T;  4PW8 A;  3ADA B;  1IUX A;  3O1H A;  4G6H A;  4WW0 A;  3L8K A;  1YD8 G;  2XHE B;  1D7Y A;  1L9E A;  5J7X A;  2CMR A;  1PVC 4;  3UU3 A;  2X5I D;  1NA1 D;  4H4P A;  2TMD A;  2IVE A;  3QJ4 A;  4DVD A;  4KHP T;  1COV 4;  1GAL A;  2R46 A;  3UCL A;  3KV6 A;  4U7I A;  5ABF A;  3ZYK A;  5LHI B;  4N9X A;  5BRT A;  4G2A A;  1VBE 4;  3F2E A;  3AE5 A;  4EZH A;  2XCG A;  1SEZ A;  3JC6 C;  4EOZ B;  2WDV A;  5HYM A;  3CN8 A;  2YLW A;  3P50 A;  2W63 A;  5KVI A;  4LU6 A;  2IVD A;  2LM2 A;  3NZP A;  2FJB A;  3C4X A;  3FB2 A;  3SFE A;  2QA1 A;  2WY2 A;  4EAH A;  1DJN A;  5KOX A;  3AA6 B;  2VVL A;  3PV0 F;  2XLS A;  2Q7V A;  5BR8 T;  4EIW A;  1S35 A;  3GYX A;  1PJ5 A;  1NEK A;  1Z6L A;  2WHD A;  2YVG A;  2R7F A;  2WET A;  4Z25 A;  4II3 A;  4O4H E;  1ZEE A;  3KDS E;  2ZM2 A;  1E2A A;  3RP7 A;  1BF3 A;  3H3M A;  1J1J A;  4DR6 T;  2J62 A;  2APG A;  5LV9 A;  3CML A;  2MPK A;  2GF3 A;  2EQ6 A;  3LB8 A;  2L9Q A;  4OPC A;  4QHO A;  3KIN B;  5AQR B;  4K0K T;  5JR9 B;  4U2L A;  4ILU A;  5FY1 A;  3ALM A;  2XVJ A;  3N9O A;  2AAQ A;  5AQL B;  4USR A;  3SY4 A;  1RHI 4;  2ES0 A;  1HYU A;  1GRA A;  2XM2 A;  3KU9 A;  2MAW A;  4AP3 A;  5DBJ A;  5ABG A;  2TPR A;  2LRK A;  3MAC A;  1MOK A;  4APN A;  2X9Y A;  3DTO A;  1BGN A;  4QH5 A;  1D0X A;  1COY A;  4BK2 A;  4EEB A;  2XFN A;  3NT6 A;  1D4M 4;  4TM3 A;  3MZK B;  4EZ4 A;  3K7Q X;  2B9X A;  4DID B;  3WAK A;  2CBI A;  3NRX A;  3NLC A;  2SPC A;  1MMD A;  2NWB A;  4IDN A;  3C64 A;  1AR8 4;  1R08 4;  3OZ2 A;  4PAB A;  2FJA A;  4HFH A;  1AR7 4;  2YLX A;  2H7V C;  1HTJ F;  1NEN A;  2YG3 A;  2LOS A;  3ONL C;  4UV9 B;  2BZB A;  4JEH B;  4RG3 A;  5JDG A;  2QYW A;  2BRY A;  3JD7 4;  3LXD A;  4X64 T;  3GWD A;  4DO0 A;  3TLW A;  4NWZ A;  4YLH A;  3JBG 4;  5AQF B;  3RKG A;  3DJD A;  4IA6 A;  1N34 T;  3FG2 P;  3H37 A;  1UX4 A;  2FJE A;  2YLS A;  3OTO T;  1ZK7 A;  1W4X A;  2X8G A;  4B6X A;  3NRN A;  3SGL A;  1EBD A;  5FP3 A;  5FYM A;  2IDO B;  2OA1 A;  2J47 A;  2YVF A;  4J2C A;  2VKD A;  3L8R A;  2HH7 A;  3UQ4 A;  1RUH 4;  2RGJ A;  4AQF A;  4H4W A;  5CGM A;  1XNR T;  3SX6 A;  4A5L A;  4C77 A;  2C0S A;  5ABF B;  4AKI A;  3RQU A;  3FBS A;  3QSE A;  3P4W A;  4XWR A;  3RHA A;  4A99 A;  4OHF A;  3BQI A;  4E7S A;  5DJQ C;  1XDP A;  4UVA B;  4U33 A;  1FIO A;  5HXS A;  1LTX R;  2XLU A;  2WCA A;  4A56 A;  3C51 A;  3UU4 A;  1DU2 A;  3ICT A;  4BA9 A;  3IF8 B;  2EHO D;  4C5O A;  5AFU L;  1RMU 4;  4C91 A;  1MMN A;  5JDM A;  3UTG A;  1E7P A;  2B7R A;  2B76 A;  2WWU A;  1BKW A;  5U25 A;  2PZS A;  3CKD A;  1BWC A;  5FVL A;  4NEV A;  5JR9 C;  3G5S A;  2I0M A;  4IDO A;  4ZS3 A;  5LBM A;  4YXD A;  4AKH A;  3AA7 B;  3C4N A;  2EX3 A;  5LA6 E;  5EK3 A;  1XMQ T;  4TV8 E;  2X0Y A;  3NTD A;  4X20 E;  2YQU A;  3ZCJ A;  3AD8 B;  3KPF A;  3ZMZ B;  2BVM A;  3L39 A;  4LF7 T;  4ICY A;  3RGL A;  3AE1 A;  2K24 A;  3F8D A;  4IE6 A;  3AYJ A;  1PDH A;  4EV6 A;  3TKL B;  2EQ8 A;  4YKF A;  4N78 D;  5JRE A;  3KBT A;  5EK4 A;  4A5X A;  5KMG P;  4JI4 T;  1ZX9 A;  3ATR A;  3UU5 A;  3NYF A;  4RHV 4;  2WP5 A;  2QVA A;  2V5D A;  5H6R B;  4A98 A;  3DJJ A;  2GMJ A;  5ABE A;  5AQN B;  2R4E A;  2CHN A;  3Q9D A;  1L0V A;  4WNK A;  1I94 T;  4UV8 B; 
#chains in the Genus database with same CATH homology
 3BHF A;  1KNP A;  2PHH A;  1H81 A;  3SZF A;  2YG7 A;  2YR4 A;  3AB1 A;  4B63 A;  2GV8 A;  3QFB A;  4H4Q A;  4YWO A;  3M13 A;  1CL0 A;  4GAP A;  4UDQ A;  4J56 A;  2NPX A;  1ZOY A;  1CF3 A;  4JN9 A;  2C70 A;  2V61 A;  3NH3 X;  3T2K A;  3NK0 X;  4H4T A;  1F8R A;  2YR6 A;  3NKS A;  1PN0 A;  4K8D A;  4AOX A;  2WPC A;  2WEU A;  4WCT A;  2BK4 A;  3NN6 X;  2C64 A;  3UKL A;  1M64 A;  4U8K A;  1X31 B;  3IC9 A;  5GRT A;  3UTF A;  1IUU A;  2XVE A;  1GPE A;  3GMB A;  1LV0 A;  4GDE A;  2JAE A;  2WPE A;  1RSG A;  4ZCC A;  3VR9 A;  1ZOV A;  1GSN A;  4B1B A;  1LQT A;  1XPQ A;  2XYO A;  3F8R A;  3UOV A;  2NVK X;  3BI2 A;  2I0Z A;  3LZW A;  2BXR A;  2B7S A;  2WOW A;  1L9C A;  5L46 A;  3V76 A;  1RP0 A;  1F8W A;  1OJ9 A;  4GDP A;  3AE4 A;  3DJG X;  3DK4 A;  3Q6J A;  3GRT A;  2RAB A;  2RGO A;  2QA2 A;  4TM4 A;  3P4R A;  4CCR A;  2WP9 A;  1GV4 A;  1YQ4 A;  4KPR A;  1B37 A;  3AE2 A;  5BVA A;  1ZP0 A;  4YT0 A;  4HB9 A;  4EM4 A;  1FCD A;  1CJC A;  2GR2 A;  3AE6 A;  3PVC A;  4GCM A;  5TR3 A;  1K0J A;  2FJD A;  3AYL A;  4USQ A;  5HHF A;  1YKJ A;  2DKH A;  2YLR A;  3GDP A;  4JY3 A;  1XAN A;  2AQJ A;  2CUL A;  3AE8 A;  3I6D A;  4BK3 A;  5FS6 A;  1S3E A;  4H4X A;  2BAC A;  5FS9 A;  4K5R A;  3NG7 X;  3CGC A;  4LA1 A;  4C3X A;  4OVI A;  4B66 A;  4C3Y A;  3DK9 A;  3DJE A;  3GRS A;  4U2T A;  1GRT A;  1GTH A;  1ZY8 A;  5U1O A;  3UOX A;  3CGD A;  4BJY A;  3B6D A;  3H8L A;  1N1P A;  3KPK A;  3C4A A;  2EQ7 A;  4JNQ A;  1ONF A;  1B4V A;  1JRX A;  4J36 A;  2R45 A;  3UTH A;  2YLZ A;  1PBE A;  5EB4 A;  4I59 A;  3SZW A;  1EL5 A;  5GSN A;  4H2Q A;  3UOZ A;  4J33 A;  3ITJ A;  3WE0 A;  4HA6 A;  2C66 A;  2ZZ0 A;  5JCK A;  3SYI A;  4DSG A;  3DH9 A;  4YTN A;  1N4W A;  3P4P A;  2OAM A;  2LFC A;  2UZZ A;  1K0L A;  2B9Y A;  2BCP A;  2E1M A;  1IUW A;  3UKK A;  2B9W A;  3BI5 A;  4M52 A;  1YQ3 A;  1H7W A;  2XLP A;  4Z24 A;  1S2Q A;  4CBQ A;  3CNP A;  3GQH A;  2C67 A;  2WDQ A;  4A6N A;  2ACZ A;  1FEB A;  1Y56 B;  1ZKQ A;  3IF9 A;  4Z26 A;  2BAB A;  3CIR A;  1PBB A;  2YG5 A;  4EIP A;  3AEF A;  2C3D A;  4O5Q A;  1YY5 A;  2Q6U A;  3PO7 A;  3UKP A;  3C96 A;  2XLT A;  1DXL A;  1F3P A;  4AT2 A;  1GET A;  2V6O A;  2GB0 A;  1M6I A;  1RYI A;  3KD9 A;  3T37 A;  3I3L A;  3NN0 X;  1TDE A;  3GDN A;  5U63 A;  2X50 A;  4EMW A;  4H4U A;  2XVF A;  2JB3 A;  3SM8 A;  2GQW A;  1CHU A;  3ICS A;  3BI4 A;  1TYP A;  1O94 A;  1PBD A;  1S2Y A;  3V3N A;  3NHO X;  2O9Z A;  4AP1 A;  4EQS A;  2RGH A;  3GSI A;  2WBA A;  2BS4 A;  3BNM A;  2BCG G;  3ALJ A;  3AEE A;  2XFO A;  1D4C A;  1PBF A;  3D8X A;  4TLX A;  4EIQ A;  2YG4 A;  2JB2 A;  3DGZ A;  5KWF A;  2GMH A;  3ABV A;  5C3J A;  1LVL A;  2WOI A;  1GTE A;  4J2W A;  3KA7 A;  1Y0P A;  4BK1 A;  1DOC A;  3CNT A;  2YM2 A;  4RG4 A;  1KSU A;  3R9U A;  2XVI A;  4CY6 A;  1NHS A;  4DNA A;  2BK3 A;  2CVJ A;  2QAE A;  3KVE A;  2C73 A;  1JOA A;  4D04 A;  2BS2 A;  2Z5Y A;  5FS7 A;  1CC6 A;  3SFD A;  2GAG B;  1O95 A;  1EL8 A;  1NG4 A;  4U8M A;  4U2S A;  1LJ1 A;  2BXS A;  5HY5 A;  1GXF A;  1PHH A;  4WX1 A;  2YVJ A;  3UKQ A;  2WU5 A;  3VRB A;  3K30 A;  2GH5 A;  3E1T A;  2WOV A;  1O5W A;  3UOY A;  5IQ1 A;  5IPY A;  3NNE A;  1GT8 A;  5BUK A;  3CGE A;  1QJD A;  4NZH A;  2WS3 A;  4EM3 A;  5M10 A;  5JCI A;  1TRB A;  2XFP A;  3UTE A;  1VG9 A;  3RNM A;  5EBK A;  3P1W A;  4E0V A;  2ARD A;  1E1L A;  4JDR A;  3NK1 X;  3CPH G;  3URH A;  4U8O A;  2VRL A;  3AEG A;  1LQU A;  3B3R A;  3T14 A;  1E6E A;  2HQM A;  4FK1 C;  1VG0 A;  2VQ7 A;  3NGC X;  2GR3 A;  2X99 A;  4OPL A;  3SUC A;  1REO A;  4MJW A;  3AE3 A;  1B8S A;  1D5T A;  1NHQ A;  3CTY A;  3LOV A;  2Y6Q A;  1E1N A;  2E4G A;  1OJT A;  4NEW A;  4OPU A;  3GD3 A;  4G74 A;  4Z43 A;  1CBO A;  1D4E A;  2X8C A;  4BV6 A;  3FIM B;  3ADA B;  4J31 A;  5CQF A;  1JEH A;  5CKU A;  3OC4 A;  1IUX A;  4G6H A;  1Q9I A;  3HYW A;  3AE9 A;  3L8K A;  4H4S A;  5KVH A;  2R0G A;  2VQB A;  1JNZ A;  1D7Y A;  1L9E A;  3LJP A;  5J7X A;  1E1M A;  4TM0 A;  4NNJ A;  1UKV G;  1KNR A;  3GYI A;  4IVO B;  1GES A;  3ZYX A;  4B67 A;  1DOB A;  2YM1 A;  4H4P A;  1KDG A;  1JRY A;  2IVE A;  2TMD A;  3QJ4 A;  1ELI A;  2BC0 A;  1GAL A;  2R46 A;  1E1K A;  2VVL G;  3UCL A;  1NPX A;  1CJ4 A;  3UP4 A;  4N9X A;  3VRD B;  5BRT A;  3AWI A;  2ZZC A;  4OPT A;  4K5S A;  4NTE A;  3AE5 A;  1KSS A;  2F5Z A;  2EQ9 A;  3BHK A;  4H2R A;  4ZCD A;  4OPD A;  1TDO A;  3UKA A;  2XCG A;  1SEZ A;  4YSZ A;  4YSH A;  2WDV A;  1CC2 A;  2AR8 A;  3CN8 A;  2YLW A;  1BZL A;  5HYM A;  5KXJ A;  1GEU A;  4I58 A;  4LII A;  4YSX A;  5KOW A;  1OJA A;  3O0H A;  4X9M A;  5KVI A;  4LU6 A;  4G9K A;  1FL2 A;  3QVP A;  2IVD A;  2XFQ A;  3EF6 A;  4II2 A;  1QLB A;  2FJB A;  1GOS A;  2GEW A;  1V59 A;  1TDN A;  3NK2 X;  3UKF A;  4XXG A;  3G5Q A;  4UDP A;  2R0P A;  3II4 A;  4REK A;  3SFE A;  1DNC A;  2JK6 A;  4K2X A;  4O5U A;  1H86 A;  3KKJ A;  2YLT A;  2QA1 A;  1FEC A;  2WU2 A;  1DJN A;  2ZZB A;  5KOX A;  4A9W A;  2VVL A;  4JNA A;  1N4V A;  2GR0 A;  2XLS A;  3QVR A;  4B64 A;  2Q7V A;  4B68 A;  1YQZ A;  2VZ2 A;  3ALL A;  3H8I A;  3GYX A;  5FMH A;  1L9D A;  3M12 A;  1PXA A;  1PJ5 A;  1NEK A;  1Z6L A;  3CNJ A;  2WHD A;  2YVG A;  3M0O A;  2WET A;  4GAV A;  4EQW A;  4Z25 A;  1Q1R A;  4II3 A;  3UP5 A;  2BS3 A;  4ZN0 A;  1H83 A;  3GQK A;  5KMR A;  1TDK A;  3RP7 A;  2WQY A;  2V3A A;  1BF3 A;  4OPI A;  2C75 A;  1KFY A;  4A65 A;  1F8S A;  4K7Z A;  2R0C A;  4H4Y A;  2APG A;  1JNR A;  1B5Q A;  2C76 A;  5ER0 A;  2CDU A;  2WES A;  3AD7 B;  1IUV A;  4FX9 A;  5LV9 A;  2YG6 A;  4A6N B;  2WDR A;  3LZX A;  1MO9 A;  5KMP A;  3T0K A;  1PS9 A;  4A79 A;  2GF3 A;  2Y6R A;  1JU2 A;  2EQ6 A;  3LB8 A;  4AT0 A;  1NG3 A;  4OPC A;  3H4K A;  1GER A;  2ZBW A;  1GND A;  3AD9 B;  3CPJ G;  5KRQ A;  4U2L A;  1JRZ A;  1XHC A;  2JBV A;  2XVJ A;  3ALM A;  3GMC A;  1PJ7 A;  4GR1 A;  1VDC A;  2AAQ A;  4USR A;  3SXI A;  3FMW A;  3SY4 A;  5KMS A;  3HYV A;  2R4J A;  1HYU A;  4C74 A;  1H7X A;  1GRA A;  2Q0K A;  3AXB A;  3DK8 A;  3IHG A;  3JSK A;  3KU9 A;  5FS8 A;  4CRT A;  4DSH A;  4AP3 A;  1H84 A;  1DOE A;  3D1C A;  4CNJ A;  2BRA A;  5DBJ A;  4X9N A;  3RED A;  1AOG A;  1KF6 A;  2TPR A;  4YKG A;  1MOK A;  5EB5 A;  1IUS A;  4APN A;  1FEA A;  3F8P A;  3VR8 A;  2PYX A;  1GRF A;  1BGN A;  1GRG A;  4H2N A;  1COY A;  2GQF A;  3RP6 A;  4BK2 A;  3IHM A;  4UDR A;  1OJC A;  1ZMC A;  3K7T A;  4FDC B;  2XFN A;  1OJD A;  1P2H A;  3NT6 A;  2Q0L A;  5M0Z A;  4YSY A;  2BC1 A;  1H6V A;  2C3C A;  3S5W A;  4TM3 A;  1VQW A;  4KX6 A;  4H4V A;  4CY8 A;  4NTC A;  4H50 A;  2A87 A;  2H89 A;  2W0H A;  3K7Q X;  2B9X A;  1CJ3 A;  1P2E A;  3KLJ A;  2VOU A;  4EMJ A;  3P9U A;  4J57 A;  3BNU A;  2BA9 A;  1GRB A;  3NLC A;  3HYX A;  4EMI A;  4FK1 A;  4DGK A;  3ISH A;  3PS9 A;  3OZ2 A;  3VQR A;  2VRM A;  4PAB A;  2FJA A;  2DKI A;  1PXB A;  4P9S A;  2YLX A;  4TLZ A;  4ADW A;  3DA1 A;  5EOW A;  4EQX A;  5KMQ A;  2GAH B;  3UKH A;  1PBC A;  1NEN A;  3LAD A;  2YG3 A;  2BYB A;  3V3O A;  4A7A A;  2V3B A;  4G73 A;  2V60 A;  1TYT A;  1N4U A;  2BK5 A;  4RG3 A;  3AYI A;  3EPT A;  3NYE A;  1IUT A;  1LPF A;  4Z2T A;  2A89 A;  2BRY A;  1XDI A;  3T31 A;  3IWA A;  4XWZ A;  3LXD A;  4U8I A;  4BJZ A;  2E5V A;  3GWD A;  3NTA A;  4BUR A;  1PXC A;  4PAA A;  2C4C A;  4JQ9 A;  1GRE A;  1CC4 A;  1NDA A;  2X8H A;  4NWZ A;  1F6M A;  4H4R A;  3DJD A;  4IA6 A;  3QFA A;  1NHP A;  2XLR A;  4Y4M A;  3FG2 P;  4OPG A;  3T2Y A;  3GWF A;  5IQ4 A;  1VRQ B;  2R9Z A;  2FJE A;  3DME A;  2YLS A;  2YAU A;  5HXI A;  5JCN A;  2IID A;  1ZK7 A;  1W4X A;  2X8G A;  3NIX A;  3NYC A;  4K22 A;  4Y4L A;  3SZC A;  3NRN A;  1PJ6 A;  1Q1W A;  3SGL A;  1EBD A;  2YWL A;  4B65 A;  3CND A;  3G5R A;  2OA1 A;  1QO8 A;  3CGB A;  2C7G A;  3RP8 A;  4EQR A;  4H2P A;  2YVF A;  4B69 A;  5C2T A;  4GUV A;  2X3N A;  2RGJ A;  4H4W A;  1EL9 A;  3SX6 A;  4A5L A;  4C77 A;  1FOH A;  1Y56 A;  3FBS A;  3QSE A;  4XWR A;  4OCG A;  3RHA A;  4A99 A;  3DGH A;  4U8L A;  3AEA A;  4AOS A;  1CJ2 A;  3CPI G;  2GRT A;  2C65 A;  1ZMD A;  1LTX R;  2XLU A;  3CNS A;  5BUL A;  5J60 A;  4GRT A;  5JCL A;  2OLO A;  4RSL A;  3ICT A;  2A8X A;  1D7L A;  3AE7 A;  1H82 A;  1NHR A;  3EAO A;  3SQP A;  1TDF A;  1BGJ A;  4YTM A;  2GR1 A;  4C5O A;  2C72 A;  3SZ0 A;  4GF7 A;  1K0I A;  4H7U A;  3AEC A;  3L1R A;  3UTG A;  1E7P A;  4CCQ A;  2B7R A;  5JCM A;  1K4Q A;  1S3B A;  2B76 A;  3GD4 A;  1BKW A;  4G6G A;  5U25 A;  1BWC A;  1NAA A;  4Z2R A;  4CNK A;  4NEV A;  2V5Z A;  4Y4N A;  4IV9 A;  1E39 A;  3G5S A;  4YTP A;  3ICR A;  4YXD A;  4UP3 A;  2YR5 A;  4Z44 A;  3COX A;  3C4N A;  2FBW A;  1GRH A;  4J34 A;  3NTD A;  2XVH A;  2XDO A;  3T2Z A;  3S61 A;  4ECH A;  1DJQ A;  3GYJ A;  2YQU A;  4IA5 A;  2VVM A;  3HZL A;  2J3N A;  3QSS A;  3AD8 B;  3KPF A;  2Z5X A;  2OLN A;  4IVM B;  3Q9T A;  3VRA A;  2WPF A;  4H4Z A;  4ICY A;  4U8J A;  1DOD A;  3EAN A;  3AE1 A;  4U8P A;  2JKC A;  3F8D A;  4Z2U A;  4U8N A;  3P4Q A;  2H88 A;  2GVC A;  1MXT A;  3CMM A;  3AYJ A;  1D4D A;  1PDH A;  2EQ8 A;  4YKF A;  2WP6 A;  4TM1 A;  3ATR A;  1ZX9 A;  3AEB A;  2OAL A;  4X4J A;  3NYF A;  2XFU A;  3QSM A;  2WP5 A;  1EL7 A;  3P4S A;  2CFY A;  4JY2 A;  5KNL A;  2JB1 A;  3K7M X;  1IJH A;  3ATQ A;  3FPZ A;  3DJJ A;  3AED A;  2GMJ A;  1ZDL A;  2R4E A;  4NTD A;  3ZDN A;  2QCU A;  1L0V A;  4D03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...