3VRBA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Flavoprotein subunit of complex II
total genus 196
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vrbA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vrbA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vrbA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vrbA04
1KNPA 3AEFA 1JRZA 1K0LA 1NHRA 4EQRA 5HY5A 3RNMA 4YTNA 2FJBA 1VRQB 4H4ZA 4B63A 1CF3A 2GR1A 2GMJA 1P2EA 3RP6A 4AT0A 1N1PA 2OLNA 4TM3A 2VVLA 4OCGA 4YSHA 1ZKQA 1DJQA 1OJ9A 3FBSA 4GF7A 3AE7A 3JSKA 4H4RA 5EOWA 3ZDNA 3LZWA 1CJ4A 1B8SA 2C66A 1CBOA 3ADAB 4JY2A 1JRXA 1Y0PA 2V5ZA 1DODA 1ELIA 1O94A 1ZOVA 2A87A 2YM1A 2F5ZA 4YSYA 3CPHG 3ICRA 4GRTA 2WDRA 1D4CA 4B66A 3V3NA 3PO7A 1E1MA 4EMIA 1GOSA 4BJYA 4APNA 2JK6A 5JCIA 3AE3A 2Z5YA 3H4KA 3DA1A 1ZMCA 4OPTA 2AAQA 3CIRA 1EBDA 2J3NA 2XFUA 3DH9A 2WQYA 4UDQA 3G5QA 3IC9A 4ECHA 1D7YA 4FK1C 4AOSA 1IUTA 3CGCA 3GDPA 4U8MA 4EIPA 3CNPA 4J31A 4A99A 2OLOA 3NIXA 4CCRA 4Z2TA 1IUVA 4CY8A 3EANA 1CL0A 4E0VA 1PBEA 4K5SA 2JAEA 2XLUA 2WETA 4NTCA 3UP4A 4H4PA 4Z44A 1EL7A 3T37A 2YG6A 4A6NA 5GSNA 4HA6A 4AP1A 1MXTA 2QA1A 2HQMA 3UOYA 1BGNA 1JNRA 4JN9A 4ZCDA 2VQBA 1JNZA 4B64A 3L8KA 3DMEA 2IIDA 2VVLG 4NEVA 4H4QA 1Y56B 1B5QA 4J56A 1TDNA 3RP8A 4WX1A 1XDIA 3E1TA 4EM3A 1NEKA 2YLWA 4U8JA 4ZN0A 3KA7A 2XVIA 2WPEA 3NRNA 1DJNA 5KOWA 3UKKA 3GYXA 1S3BA 1BF3A 4OPCA 2WDVA 1PDHA 3NT6A 4U8KA 5KVIA 2WPCA 3AXBA 3LJPA 4M52A 4YKGA 2BS3A 1ZP0A 2YG4A 3UCLA 4B67A 1FCDA 1GPEA 3UKHA 1K4QA 4JNQA 4EQXA 3GD4A 3NYCA 1SEZA 4REKA 2FJAA 2BCPA 4FK1A 3NYEA 3C96A 3H8LA 2APGA 2YVFA 3ATQA 1Q1WA 2NVKX 2W0HA 1ZDLA 2WS3A 4NEWA 1PBFA 3IWAA 4U8OA 2GR0A 2ZBWA 3H8IA 2B7RA 4H2QA 1BKWA 3UKPA 5KOXA 3UP5A 3SM8A 4USRA 3KU9A 2X3NA 3BNUA 1GRHA 2PHHA 2VVMA 3GDNA 4K5RA 1KFYA 4DSHA 4J36A 4UDPA 1PBDA 1B37A 1DNCA 1QJDA 4J34A 2XLRA 5U25A 1DOBA 1HYUA 1O5WA 2EQ7A 2YR4A 4A79A 2VRLA 4GUVA 4P9SA 1GERA 3QJ4A 1MO9A 4C74A 1XPQA 3PVCA 2EQ6A 1PJ7A 3CTYA 4XWRA 3DK9A 2QA2A 5FS7A 3CGBA 1NG4A 2X50A 3GYIA 2YLTA 2XFQA 1XANA 3NNEA 2BC0A 2XYOA 4PAAA 3LXDA 2C67A 3LZXA 3NG7X 3WE0A 4K2XA 4Z25A 4K7ZA 2R0CA 2WU2A 4XWZA 5FMHA 2AR8A 2DKIA 2Q0LA 3NK1X 4RG4A 4DSGA 4H4XA 4NZHA 4C5OA 3I3LA 4UDRA 4A5LA 3NN6X 1CC2A 1RP0A 1NPXA 3CNDA 3GD3A 1LVLA 3F8PA 3NTAA 3AE9A 2WU5A 1NENA 1E39A 1TYTA 1TYPA 4JY3A 3URHA 1GRBA 3CNJA 3KPFA 4B68A 1EL9A 3OC4A 2WBAA 1E1LA 3P4PA 2BXRA 2GMHA 3DJGX 2XFNA 4XXGA 3D1CA 3AEAA 1S2QA 2GH5A 1VG9A 4H4WA 2Y6QA 2CULA 1KSSA 1FL2A 4H4VA 4UP3A 4ADWA 1D4DA 5L46A 2H89A 1E1NA 4USQA 4H4UA 2BA9A 3C4AA 5HHFA 4GR1A 3SGLA 2XVEA 3DK4A 4YTMA 1H81A 4B1BA 3KLJA 1GXFA 3REDA 1TDOA 4IV9A 2CDUA 2BCGG 2DKHA 2O9ZA 3C4NA 2Q6UA 2BK5A 4OVIA 3GSIA 1GTEA 2B9WA 2C72A 3GRTA 1PJ6A 4U8NA 1BZLA 3UKAA 5JCMA 1GRGA 3CGDA 1E1KA 1IUUA 3CNSA 4NTDA 1ZX9A 2GR3A 2QCUA 3ALMA 3AE1A 4J33A 1KNRA 3P9UA 3EPTA 4TLXA 4Z2RA 1IUWA 1LV0A 2C7GA 1UKVG 3AEBA 1GT8A 3L1RA 2QAEA 2V6OA 2R46A 2XVFA 4U8LA 1IUXA 1N4WA 1D5TA 1EL8A 2C3DA 1PXCA 5IQ4A 3LB8A 5HXIA 3OZ2A 5EB5A 3VQRA 1NAAA 4CBQA 4RG3A 2YLSA 3QFBA 4IA6A 4C3YA 1QLBA 1GEUA 3QVPA 3IF9A 3KD9A 2YLZA 1LPFA 4YSXA 3F8RA 2FBWA 3D8XA 3RP7A 1GREA 1H7WA 1PBCA 4H2PA 4AP3A 2ZZ0A 2JB2A 1TDKA 1F3PA 4CNKA 2JB3A 4GDEA 3P1WA 3VRBA 4JDRA 1NG3A 5U1OA 3S5WA 2YAUA 1M6IA 2YG7A 2YM2A 4U8PA 3RHAA 2YG3A 2C3CA 1CJCA 1H86A 1PBBA 3B6DA 3AEEA 2BK3A 3AE5A 2CFYA 2V3BA 2VRMA 2WDQA 2BXSA 2RGJA 5IPYA 1GSNA 5BUKA 5TR3A 4D03A 3UKFA 2WEUA 1PXAA 2OALA 5FS8A 3UKQA 4Y4LA 4YWOA 2YQUA 2TPRA 2GRTA 5CQFA 3AEGA 2PYXA 1Y56A 4KX6A 5BVAA 1PXBA 4JNAA 3K30A 3VR8A 4Z43A 4B65A 1V59A 3AYJA 2GEWA 3F8DA 2R4EA 3R9UA 4DGKA 2BK4A 1YQ3A 1BGJA 1KF6A 4CRTA 3SUCA 3NKSA 4MJWA 1BWCA 2FJEA 1L9DA 3PS9A 5C2TA 2XFPA 4H4YA 4GDPA 5JCLA 5GRTA 2GQFA 3BI2A 4Y4MA 2XVHA 3GMBA 3AB1A 1GRFA 1KDGA 1LTXR 2EQ9A 4TM0A 1VDCA 2GVCA 2A89A 5M0ZA 4K22A 1VQWA 2R9ZA 1GRAA 5CKUA 2JB1A 2YR5A 2XLSA 3LADA 3VRAA 1PJ5A 3ALLA 3M0OA 1B4VA 4U2TA 4I59A 4YSZA 1CC4A 2BS2A 4H2NA 3ALJA 3NTDA 3UTFA 2C65A 1LJ1A 3QSMA 4X9MA 3AWIA 2JBVA 3AYIA 4ZCCA 4N9XA 3GQKA 2E4GA 4J2WA 3DJDA 4DNAA 5JCKA 1PS9A 1F6MA 2WHDA 1ZK7A 3VR9A 2XDOA 3AD9B 3K7QX 3KKJA 1TDFA 2VQ7A 1F8WA 2Z5XA 1RYIA 3QFAA 4EIQA 4YXDA 1CHUA 2H88A 4FDCB 4TM4A 2E1MA 1OJAA 5KRQA 2XFOA 3BNMA 1H7XA 3UTEA 5ER0A 2V60A 1XHCA 1ZOYA 2EQ8A 2BS4A 2V61A 3AD8B 3ICTA 3K7MX 4X9NA 3QVRA 2WPFA 2R45A 2IVDA 3HZLA 2B7SA 1F8SA 2VOUA 3UOXA 3I6DA 4Y4NA 2I0ZA 2XLTA 3EF6A 4IVMB 2OAMA 1MOKA 3IHMA 5EB4A 2ZZCA 5KVHA 1L9CA 4D04A 4O5UA 2GQWA 2FJDA 4AOXA 1ZY8A 4YKFA 3V3OA 1GV4A 4IVOB 2WOWA 4LU6A 4B69A 2YVJA 1DOEA 2YR6A 4OPGA 3VRDB 4RSLA 1YQ4A 1IUSA 1CJ2A 1NHQA 4K8DA 5M10A 1NHSA 2GV8A 4EQWA 4GCMA 2XLPA 1YY5A 2WESA 2GB0A 1GRTA 2Q0KA 3UTGA 3ATRA 4ICYA 1Q9IA 4BJZA 4EM4A 3O0HA 4FX9A 1DOCA 3CGEA 1REOA 4IA5A 1N4VA 1PHHA 1DXLA 4LA1A 1E7PA 2JKCA 3KVEA 4LIIA 3QSSA 4EMWA 2GR2A 2RABA 5KWFA 5JCNA 3P4QA 3SFDA 1OJCA 3UKLA 1PN0A 1TRBA 1FEAA 2R4JA 3GWDA 5EBKA 4OPIA 1ZMDA 5J60A 3ITJA 1JRYA 3AECA 4A6NB 3IHGA 3V76A 4PABA 1L0VA 2WP6A 1OJDA 4YT0A 3DK8A 3NLCA 5U63A 4X4JA 1S2YA 4BK3A 3GQHA 2C64A 1NHPA 1L9EA 1GALA 3AE2A 1FOHA 1K0IA 4OPLA 2Y6RA 3BI4A 1GNDA 3NGCX 3FG2P 3NHOX 3S61A 3UOZA 4C77A 2YWLA 3NK2X 3BHKA 1GETA 4C3XA 2C76A 2B9YA 3NYFA 1H84A 1ONFA 2LFCA 4CY6A 3AYLA 1D7LA 1YQZA 5FS9A 3M12A 3GWFA 2GAGB 4U2LA 4EMJA 3Q9TA 4H50A 1P2HA 3DGZA 3CN8A 2B76A 2WP5A 2C73A 5IQ1A 1JU2A 1M64A 3AD7B 4NTEA 4OPDA 4U2SA 1IJHA 3P4SA 2ACZA 1H82A 3BI5A 4CNJA 1VG0A 1K0JA 4H7UA 3GMCA 4A9WA 2ZZBA 4BK1A 3ZYXA 3G5SA 2RGHA 4J57A 4AT2A 4U8IA 3AE8A 1CC6A 2C70A 3QSEA 4BK2A 2E5VA 1LQUA 2WP9A 2X8CA 3ICSA 4CCQA 1D4EA 5BRTA 1FEBA 3NN0X 1Q1RA 3SQPA 3Q6JA 1S3EA 2ARDA 2XCGA 5LV9A 4A7AA 3II4A 3NK0X 2UZZA 2C75A 2RGOA 1X31B 2GAHB 2YLXA 4BV6A 1EL5A 2WOIA 3ABVA 3EAOA 5DBJA 1JOAA 3ISHA 2R0GA 2B9XA 4EQSA 1W4XA 1CJ3A 1GTHA 3DGHA 4TLZA 2AQJA 3K7TA 1RSGA 3LOVA 5J7XA 4WCTA 4I58A 1COYA 1E6EA 3NH3X 2YLRA 4O5QA 3GRSA 3GYJA 2GF3A 1F8RA 4Z2UA 4H4TA 3UTHA 1O95A 4YTPA 3FIMB 2R0PA 4Z24A 3M13A 1QO8A 1AOGA 2YVGA 2V3AA 4JQ9A 1NDAA 5BULA 4HB9A 5FS6A 5HYMA 4A65A 3COXA 3G5RA 3P4RA 1JEHA 2A8XA 4KPRA 4H2RA 3AEDA 3CPIG 4OPUA 3CPJG 1GESA 4BURA 3FPZA 2X8HA 4TM1A 1FECA 5KXJA 4H4SA 3B3RA 3AE6A 1H83A 2BYBA 3BHFA 1Z6LA 5C3JA 2CVJA 1H6VA 1YKJA 2YG5A 3CNTA 3UOVA 1OJTA 2TMDA 2X99A 1KSUA 4Z26A 1TDEA 3DJJA 2Q7VA 2WOVA 2XVJA 2OA1A 3AE4A 1N4UA 2X8GA 2NPXA 3DJEA 2BACA 2IVEA 2VZ2A 2BABA 3SFEA 3FMWA 2BC1A 1LQTA
chains in the Genus database with same CATH superfamily
3NBXX 2RS54 5HY5A 4WBOA 4YTNA 1MNEA 4DR1T 4X62T 4TM3A 3NZPA 1DJQA 1OJ9A 4O4HE 5FL1A 3AE7A 5EOWA 3CX7B 5L3DB 3LZWA 2C66A 3AB3B 4BJNA 3OVUA 2A87A 4JLEA 2UXCT 4GRTA 4O2BE 4KBMB 2LSYA 3PO7A 4BJYA 4YFSA 5LGTB 3PUSA 4PW8A 2XQYA 3ETVA 2H7OA 4U7YA 4YHJA 2AAQA 2K5BB 4HE8A 2XASB 2A3DA 2J3NA 2XFUA 3LSVA 1D7YA 3QNUA 4AQYT 3Q5WA 1IUTA 4DR3T 2MYSA 2YKSA 3GDPA 3CNPA 4A99A 3NIXA 4Z2TA 1I94T 4E0VA 1PBEA 4X1YE 3UP4A 5L4HA 4NTCA 2WMNA 4Z44A 1RUJ4 2YN6A 2YG6A 2XAJB 1MXTA 2HQMA 4AKRB 4B3RT 4ILUA 4I0UA 4B64A 4AKIA 5IUXA 3TLSA 2VVLG 3B5MA 3RP8A 4HEAA 3WI3A 3ANWB 2VL0A 4PK4A 3FZFB 5L3CB 5AQMB 2YLWA 1UCUA 1DJNA 4U8KA 4HWIB 3ZPOA 3T2KA 5FYMA 2WPCA 3AXBA 2UUCT 4YKGA 2XSAA 2DNXA 4P09A 3NYEA 1OEDA 3N9NA 3FI7A 4N78D 2XQ7A 3IWAA 1FEWA 4DV4T 2GR0A 2ZBWA 3MZKB 1BKWA 5DQWA 2XUEA 3K3QC 4USRA 3KU9A 2VVMA 4L9IA 2PHHA 4UDPA 1PBDA 4DBQA 4ZI2C 2XLRA 5U25A 3FB2A 4X5TA 3CK6A 4P9SA 3L3PA 1PJ7A 3CTYA 4QKNA 1NCQD 1B7TA 1XANA 1XWMA 3LXDA 3LZXA 4EZ4A 1RUH4 2HWC4 4K7ZA 1J1JA 4EZHA 3Q9DA 2J1DG 4ZI3D 4H4XA 2XHEB 1CC2A 1NPXA 4I4TE 3AE9A 2WU5A 4DMVA 1TYTA 4TNVA 3OC4A 1SA0E 4JI0T 3P4PA 2OLTA 2GMHA 3DJGX 4JI3T 2GH5A 4X66T 1AR64 4UP3A 3K3NA 5L46A 4CXXA 1HRV4 5AQLB 5ABHA 4ZZCA 4KHPT 4YTMA 4GAVA 1GXFA 2CDUA 2DKHA 2Q6UA 2WBLA 4DV1T 1YXRA 2B9WA 2VWAA 4IE7A 2C72A 3GRTA 5KMGP 2BG9C 4JV5T 1PJ6A 4ILAA 3ZMTB 3PUVF 2OV9A 3CNSA 4UELA 5LGUB 1ZX9A 2IHR1 3UUXB 1O3XA 2JIWA 1IUWA 1LV0A 3OBVE 3EAMA 3NZQA 1GT8A 1OXZA 1UUSA 2CMRA 2BKNA 4U8LA 4DV6T 4I50E 2ZLYA 1PXCA 4HFCA 3ZT7A 2VVSA 2EHOA 4RG3A 2YLSA 4I55E 3IF9A 4IE6A 3KD9A 4COFA 2V8SV 4UEMA 1IBKT 2FBWA 2X0HA 3RP7A 3SYIA 1GREA 1H7WA 4PNIA 5JDLA 2CLYC 4Q4Y4 2JB2A 4FI5A 4CNKA 4H9RC 1NG3A 3MA9A 5FXZA 3JAFA 4LFAT 2L8KA 2XQ3A 2YG3A 2C3CA 4L5GA 1H86A 3B6DA 3OPCA 2DWKA 4F6RC 4WW0A 3AEEA 2BK3A 5H6QB 1VBE4 2VRMA 5FP3A 3RYHE 2XQ8A 5TR3A 5BUKA 2OALA 2AE9A 2WMOA 3QUJA 4UVCB 1YW0A 3AYJA 2BBJA 3UU3A 5FXWA 2BK4A 1YQ3A 1HFAA 4DR5T 2RR14 1KF6A 2XSBA 4H63H 4PJJA 2ZM0A 4P0BA 2XQ6A 3N2GE 1BWCA 4XAXB 5JCLA 2XFPA 2X9HA 5GRTA 1HTJF 4YHHT 2LSKA 3VU7H 2RA1A 3AB1A 3Q5XA 2V7MA 1GRFA 1KDGA 2EQ9A 1MIYA 2UXXB 4QXBB 4K22A 2YEVC 1VQWA 2YR5A 5HCJA 4MALA 4X1KE 2A72A 3M0OA 1YKEB 3H3AA 1MNDA 4YSZA 2D5UA 2I0MA 3VHLA 1M62A 4TX5A 1LJ1A 4ZS2A 2YDRA 4GAPA 4HN9A 1ZK7A 1HG5A 5HXSA 3LFMA 3RRCA 3K7QX 3KKJA 2VQ7A 1D1AA 1F8WA 2Z5XA 5FMNA 3QFAA 1T7SA 3ZN1B 4EEBA 5H6RB 4LFCT 3X1DA 2E1MA 1OJAA 3BNMA 1M7KA 3UTEA 1VCTA 5L4EA 2V60A 2V61A 3ICTA 3HR0A 3K7MX 2KWIB 2R45A 4X20E 2VOUA 3UOXA 2AXDS 3QOFA 2I0ZA 3IHMA 5KVHA 1UX4A 5AQOB 1L9CA 2FJDA 3NVOA 1ZY8A 2CE7A 2KLQA 5LBMA 1DOEA 2YVJA 2BKPA 2BVLA 3W15B 1NHQA 4K8DA 5LMUT 2GV8A 4EQWA 4GCMA 4OK0A 3RHWA 4ICYA 1Q9IA 2J47A 1DOCA 3ETUA 1VRBA 1YD8G 3TLVA 3RIFA 3SFDA 1PN0A 1BR4A 1QSDA 5EZYE 2V5CA 1X9BA 4PABA 3NRXA 2DI4A 4LF4T 4X4JA 3GQHA 1NHPA 3E0ZA 1FOHA 1K0IA 1Y01A 1GNDA 3NHOX 2K24A 3BHKA 3O1JA 3TLTA 2B9YA 3PUYF 4PJNA 1ONFA 5JH7E 2C0SA 3Q2MA 3GWFA 3RIUA 2A9UA 3Q9TA 4H50A 1P2HA 3N2KE 4V1Av 1JU2A 1M64A 2WCAA 3AD7B 2VQET 1RUF4 3RF1A 3BI5A 1H82A 3ZMUB 5KMPA 3JADA 4HWHA 5J0ZA 2C5KT 5JDMA 4E7SA 2RS14 1WR6A 3RLFF 5JQGE 2JRKA 1LQUA 4G6GA 2IW5B 2WP9A 1POV0 4CCQA 3UU4A 3AVSA 3K1SA 3KBTA 2UXBT 1XMOT 4HGAA 2VQFT 1S3EA 2ARDA 5LV9A 3JBG4 3NK0X 2R044 1X31B 2PJQA 4ILCA 2GAHB 4BV6A 2W0GA 4DBRA 1EL5A 5LOVE 2QA7A 4G6HA 3ISHA 2VVNA 3I9WA 1CJ3A 3K7TA 3LOVA 2DCFA 3PV0F 4DVDA 3AVRA 3ZCJA 5JR9B 3PU8A 1BEV4 1J5WA 5JRCA 5E0OA 4AKLA 5LHHB 4YTPA 3FIMB 2R0PA 3FZHB 4LFBT 4A65A 1JEHA 3CPIG 2V6XA 2XAGB 1GESA 3KVAA 1FECA 3NRYA 2F4VT 2LM9A 1N34T 3AE6A 3SWHA 4UF0A 3CNTA 1H6VA 3UOVA 1OJTA 5AQRB 2X99A 5FY1A 5L3FB 5IWAT 2XAFB 3T0KA 1N4UA 2W67A 2WWUA 2BABA 2XQ9A 3S4UA 1JRZA 3ONXA 1W0BA 1ZV4X 5AQQB 1U5PA 3RNMA 4U72A 1HRI4 2CBJA 3RP6A 3V5SA 1N1PA 3TLUA 2B1EA 4K0KT 1ZKQA 4ZS3A 3ZDNA 5AFUL 1CJ4A 1JRXA 2V5ZA 4CXWA 1O94A 4TWFA 2F5ZA 4YSYA 3ICRA 3ZYKA 5AQTB 5AQSB 4B66A 5IHYA 4EMIA 1GOSA 4APNA 3SZWA 2IDOB 4H9OC 2Z5YA 3GN5A 2Y6XA 2HN1A 4Z8XA 2CHOA 2A2FX 3IC9A 3T2ZA 4ECHA 2SPCA 4PDWD 4EIPA 4BA9A 4ZI3C 4HFEA 4KMCA 2K3WA 4CY8A 5FVKA 1CL0A 1MQTD 4K5SA 2XLUA 1N32T 1G73A 2KXPB 4AP1A 3UOYA 1BGNA 3SZCA 1JNRA 4ZCDA 2VQBA 1VBC4 4NUVA 3L8KA 1EAH4 2IIDA 4NEVA 4WX1A 4HWFA 4HFHA 2QGSA 4OHFA 1XDIA 3E1TA 4IT4A 2V7JA 4U8JA 4ZN0A 2XVIA 2WPEA 3NRNA 3GYXA 3UKKA 1FJGT 2WDVA 3UFGA 1PDHA 3LJPA 3U3IA 4PJLA 1W9RA 1ZP0A 4LF7T 1FCDA 1GPEA 4REKA 2W00A 4FK1A 1XHZA 1LKXA 2CRBA 5LCYA 3H8LA 4AISA 1VBD4 3BK9A 2W0HA 1PBFA 3CX8B 4U8OA 3H8IA 1W0AA 3HKEE 1VOMA 3UP5A 2D0TA 4K5RA 3K3OA 4J36A 1DNCA 3RRWA 1DOBA 2EQ7A 2YR4A 3KV9A 4GUVA 4GOUA 1MO9A 2D9DA 3DK9A 4XWRA 2ZM8A 4LF9T 2YLTA 2XFQA 1E2AA 4EB6E 2X0LB 2C67A 1MIWA 4Z25A 4K2XA 3UU6A 2XQAA 4XWZA 5L3BB 4U2YA 2DKIA 4RG4A 4C5OA 2XM1A 4UDRA 3NN6X 4A5LA 5JDHA 1RP0A 3CMMA 1LVLA 2HHHT 5LNKA 1MMGA 1XDOA 3URHA 1E39A 2V5DA 4DNDA 1TYPA 4QXHB 1EL9A 2XFNA 3D1CA 3AEAA 2CULA 1KSSA 4H4VA 4A5XA 2Z6EA 4ADWA 2X66A 3C4AA 3SGLA 3DK4A 2CPTA 1H81A 3JC6D 4B1BA 4A97A 2M67A 2NR4A 1TDOA 3M3ZB 3BQLA 2O9ZA 2JJ9A 4OVIA 4UF0B 3GSIA 1GTEA 3F2EA 1BR1A 4JI1T 4U8NA 2X9WA 2WZIA 3N2OA 1AR94 4EV6A 3CGDA 1E1KA 1IUUA 4JBWF 4NTDA 4NIQA 3ZSTA 4KUMB 4J33A 5AQPB 3P9UA 3EPTA 2C7GA 1MIVA 3J8F4 2QAEA 1NAFA 1ZKEA 1D5TA 2VKJA 2C3DA 5IQ4A 5HXIA 4U3CA 1RUC4 3ZJ1A 3VQRA 1NAAA 3QFBA 4C3YA 3QVPA 3LDQB 2HPJA 4C90A 4AP3A 4H9NC 3UU5A 1US7B 2DHRA 2XPKA 4ZI2D 2Q9QC 3LBXB 4JDRA 1LRZA 3S5WA 2V6YB 2YG7A 2NW7A 1DU2A 2YM2A 3ZC0A 5C8YE 4U31A 4O2AE 2V6YA 2CFYA 2VB6A 2WDQA 5IPYA 1WLXA 2JQ9A 3UKFA 2P9BA 2WEUA 5LXTE 5FS8A 3UKQA 4JI7T 2TPRA 2GRTA 5CQFA 4DV3T 3RH3A 5JVDE 4JNAA 5KDMC 3T2YA 4Z43A 1RUD4 4UVAB 3R9UA 5JDNA 4JI6T 4CRTA 5HWYA 3SUCA 3UQ7A 4MJWA 2LSJA 5HXRA 1IBMT 2LOPA 5C2TA 4H4YA 2XVHA 3OYXA 2WB5A 3KBUA 4TM0A 5CKUA 3LADA 3ALLA 5AQVB 1B4VA 4NXNT 4I59A 3RPUA 3UTFA 2C65A 4X9MA 2E5LT 2JBVA 2CBIA 4N9XA 1OWAA 3UU8A 3V5UA 3DJDA 3UQ4A 4J2WA 2XDOA 3B13A 3AD9B 1TDFA 3KFWX 4UV9B 5LHGB 1HCIA 2WSSV 1RYIA 4TV8E 1CHUA 4EYUA 2H88A 4FDCB 4TM4A 2ODUA 2XFOA 1ZOYA 2BS4A 5LMNT 4X9NA 1WYBA 1FIOA 2BDEA 3ZEFB 4U2ZA 1WYCA 5L3GB 1MOKA 5KMQA 5EB4A 3PJAA 4D04A 5EK3A 4IE5A 2GQWA 4AOXA 2X67A 4YKFA 3PDYA 4IVOB 4B69A 4OPGA 2YR6A 1IUSA 3UUBA 4HFBA 3RQUA 5JDGA 4IGUA 1Y64B 2Y48B 1YY5A 2WESA 2GB0A 1GRTA 3UTGA 3ATRA 4ISTA 4IA5A 1PHHA 4LA1A 2W4XA 5LP6E 3F31A 3C64A 3MJXA 3RYFE 1UURA 5CA0E 5LJMA 1TRBA 1FEAA 3GWDA 5J1GA 1X79A 3WAKA 5LA6E 5J60A 3PE0A 4QHOA 5AQKB 1JRYA 4CZZB 2DL1A 2WP6A 4YT0A 1WCRA 1S2YA 4BK3A 2C64A 4ZZBA 1GALA 4IREA 5HAXA 4IDQA 3NGCX 3N9LA 4UXNB 1OEDC 3FBZA 3NK2X 1XNRT 2DWGA 5FY7A 3AYLA 2GAGB 3HKDE 3ZYMA 4EMJA 3AAIA 3R6NA 4U2SA 2JQHA 2OA5A 2NP9A 4CNJA 3H3MA 3IA3A 1VG0A 1K0JA 4H7UA 4IDNA 4QH5A 4J2CA 3ZYXA 2HH7A 3EABA 4J57A 4U8IA 2C70A 3QSEA 4CI1B 3ICSA 4PJMA 1D4EA 2LSIA 3ZMZB 3HYWA 2JQKA 4A56A 3RIAA 2RGOA 4Q4V4 1OEDE 2JMKA 3AAAB 3ABVA 5DBJA 2R0GA 2B9XA 3HL6A 3L39A 4G63A 1GTHA 3DGHA 4TLZA 2AQJA 1RSGA 4I58A 3GRSA 3KPKA 2GF3A 1F8RA 4Z2UA 1O95A 3I9YA 1QO8A 1S35A 1NDAA 3G5RA 4Z91A 2N9DA 2WY2A 4KPRA 3ANWA 4DV5T 4BURA 2VK9A 2LLYA 5BR8T 2YINA 2E9XB 1H83A 2BYBA 2IC9A 1Z6LA 4X1IE 3O1HA 2IIUA 4LF6T 1TDEA 4H9QC 2NPXA 3DJEA 1MMDA 3CWZB 4G2AA 3SZFA 2RMU4 3AXJA 3SFEA 1G8XA 1E1HB 3AEFA 2ZM6T 1OOPD 4B63A 2V1DB 4G9KA 2UUBT 3SXIA 5ABFA 2N1GA 1P2EA 2GMJA 4AT0A 5AQFB 4OCGA 1EZ3A 5FL0A 5CB4E 3SS1A 4JI8T 1B8SA 1CBOA 2RP4A 1ZOVA 2YM1A 1RVF4 2ODVA 4UIGA 1D4CA 5KX5E 5AQIB 2LKHA 4A98A 1E1MA 2LKGA 5JCIA 3AE3A 5CFBA 3H4KA 3DA1A 1T72A 4AXPA 4GK0E 5AQUB 5EK2A 3CIRA 1EBDA 4II3A 2WQYA 4UDQA 4RHV4 3LK42 4FK1C 3UUNA 1VBA4 4M1PA 3CGCA 4U8MA 4IDPA 2K48A 1IUVA 2I59A 2W63A 4IDZA 2X9XA 2JAEA 3C4WA 2WETA 2UXNB 3PURA 4H4PA 1EL7A 4A6NA 5GSNA 2QA1A 3T1YT 1IBLT 3A7MA 4H9PC 1XDPA 2CXFA 4H4QA 4J56A 1TDNA 1XI1A 4YJ3E 2XQ5A 2VKOA 3M65A 3KA7A 3ZC1A 5KOWA 1HX1B 5HCMA 4EOZB 1BF3A 3NT6A 5J2UE 5CJ5A 4M52A 3UUMA 2BS3A 3N9PA 3BQIA 3UCLA 4B67A 3UKHA 1K4QA 4JNQA 3GD4A 1LVFA 1V9DA 3NYCA 1SEZA 2FJAA 4ZXLA 5CA1E 3C96A 3EI0A 3ATQA 1Q1WA 2NVKX 4NEWA 5HHFA 4Z90A 3SOLA 2NW8A 3ZKRA 3SM8A 2PY5A 4ASKA 5JR9C 4Q25A 3ZN0B 1PO14 4J34A 1O5WA 4A79A 1N33T 3KV4A 4C74A 2NWBA 5L47A 1XPQA 2EQ6A 1NA1D 4QH4A 2GK9A 5FS7A 3CGBA 2X50A 3GYIA 2NTXA 1BR2A 2IC6A 2V7LA 3CKDA 3NNEA 2XYOA 3EVYA 2BBHA 3NG7X 4XZCA 2R0CA 2WU2A 1RUE4 2R6GF 2Q0LA 3NK1X 2LSGA 4QXCB 4DSGA 3I3LA 2BG9B 4NXMT 3ONJA 3CNDA 3NTAA 1IJ5A 4JYAT 5HEOA 1NENA 3CQGB 3C4ZA 4H9SE 5LG4A 3AA0B 1GRBA 3CNJA 3D0TA 3WAJA 2YOEA 2BXRA 3CQXC 4ADZA 1S2QA 4H4WA 2Y6QA 5KMSA 2I6HA 2H89A 2ZM2A 2LE8A 2XVEA 2E9XD 3KLJA 2BCGG 4DR7T 3C4NA 2CCQA 3AA7B 3PUXF 2BK5A 1BR0A 3QK6A 2HN2A 3N9OA 3K8PC 1BZLA 5L2LA 3UKAA 1GRGA 5JCMA 1R8IA 2K9AA 2D0UA 2GR3A 2QCUA 3CPZA 3OJAA 3ALMA 3AE1A 5LG3A 1KNRA 4CN6A 3U78A 3AEBA 4Q4X4 2VKDA 1IUXA 1N4WA 5F3JA 3LB8A 3ONLC 3OTOT 5EB5A 1IAPA 2MTQA 1WR0A 5F5WA 2YLZA 1LPFA 1D0ZA 2R074 3RQWA 4IDOA 3LJCA 1AR84 2LT3A 5HXCA 4F8HA 2LEHA 1PBCA 2LHNA 5AQHB 3T8OA 2ZZ0A 3SRZA 2YDQA 3P1WA 4MHCA 1R084 2LHRA 3HA4A 1M6IA 5GONE 4U8PA 1FMWA 2X5ID 3RHAA 1CJCA 2CWYA 1RUI4 2D2SA 5AQJB 1PBBA 2H3RA 3AE5A 4X65T 1NWMX 2RGJA 1SUMB 2MAWA 3ESLA 3L8RA 2MOZA 4WBNE 2YQUA 3DJBA 3N9MA 3T1HT 3AEGA 3KVBA 1Y56A 4O8SA 2PYXA 5BVAA 4IL9A 4GIWA 3VR8A 4MBQA 2GEWA 4DGKA 4YY3T 1BGJA 4DR2T 4C91A 3NKSA 1ASJ4 3ZJ2A 2EX3A 3PUQA 2LM2A 2FJEA 3RKGA 5KNLA 4GDPA 3BI2A 4Y4MA 4EXTA 2EHOD 3L09A 5M0ZA 4KHZF 2JQQA 3FXDB 2R9ZA 2JB1A 2XLSA 4CI2B 3VRAA 5AQNB 4CI3B 3VKGA 4DV0T 1CC4A 2E9XA 2BS2A 3DTOA 3ALJA 2RM24 3AWIA 3GQKA 2E4GA 1KK7A 2WHDA 3VR9A 4TWDA 4GKJT 1HG2A 4QX7B 4EIQA 4YXDA 1H7CA 4TNWA 5J2TE 3MK7C 5KRQA 4GYSA 5DJQC 1H7XA 1HR0T 3RKOA 5HEUA 3QVRA 2B7SA 4HFVA 1F8SA 4G73A 3OYZA 3I6DA 2XLTA 3JD74 3EF6A 4IVMB 4TWHA 3NKZA 4WYVA 2ZZCA 4NWZA 4O5UA 1GV4A 3C50A 3PJAJ 4LU6A 4PFOA 4FJOA 4YLHA 4RSLA 5LYJE 1IJ6A 1LVKA 4AI6A 1CJ2A 5A1LA 3FZLB 5FXVA 4PK5A 5HWXA 5M10A 4CN4A 1NHSA 2Q0KA 3AA6B 4OX9T 2IUBA 2KZ7B 2VKHA 4JUYA 4BJZA 4AKHA 2UU9T 4FX9A 2V7KA 2ACXA 1REOA 1DXLA 2MBGA 5HEJA 3QSSA 4LIIA 4EMWA 2GR2A 1VRH4 1OJCA 2LOSA 4B6XA 4OPIA 5F8PA 1ZMDA 3ITJA 3IF8B 5JTGA 4A6NB 1R094 1IZNB 4LMJA 4U74A 1KEYA 3PUAA 2PG8A 4DR6T 3CMLA 4YJ2E 4HFDA 1L9EA 2BRAA 2Y6RA 3BI4A 3ZT5A 3S61A 4Q4W4 2H7VC 4C77A 4HKAA 2KWHA 2C76A 2QVAA 4H63V 1H84A 2LFCA 1YQZA 5FS9A 3M12A 2X0YA 1W09A 3GA8A 4U2LA 2EHOC 4IIJE 2B76A 3CN8A 3QB5A 3UT5E 3KV5A 4OPDA 3PUZF 3P4SA 2ACZA 4CQIA 2UXDT 2ZZBA 2W61A 4TZ4C 4BK1A 4UVBB 3QB5K 3QC9A 3ZCIA 3LK2B 3FZKB 3SZ0A 4JI2T 1ZHCA 4AKGA 2Q9QA 2J62A 4BK2A 2E5VA 4G74A 2PZSA 2CXLA 5BRTA 3NN0X 1Q1RA 1CUNA 3Q6JA 3SQPA 3II4A 2Q9QB 2XJ7A 4OYJA 2UZZA 3J7Yq 4EYYR 4ERRA 4P0AA 2W2UA 2NOXA 3JCFA 3RI5A 3GN5B 5J7XA 3HKBE 4WCTA 1E6EA 2ES0A 2YLRA 4O5QA 2CM0A 3GYJA 4P1NA 3M13A 4AQFA 2YVGA 4JQ9A 3FZMB 1D4M4 4HB9A 5FS6A 3COXA 2XAHB 5HXHA 3AEDA 1HS7A 3CPJG 3RC8A 4X64T 2X8HA 3IEEA 4I43B 4JEUB 5C3JA 3HYXA 2E2AA 2TMDA 2LRLA 1KSUA 4IHJE 3DJJA 2Q7VA 2XVJA 2NW9A 2OA1A 3AE4A 2JMHA 2PTFA 1D0YA 2BACA 3FMWA 4B3TT 1KNPA 1NHRA 3N9QA 1K0LA 4EQRA 5LJNA 2FJBA 2UUAT 3AXJB 1VRQB 4O4LE 4H4ZA 1CF3A 3LK3B 2PW9A 2GR1A 4JEHB 2OLNA 5ABEA 2VVLA 4YSHA 4U33A 3FBSA 4GF7A 1EV14 4O4JE 3JSKA 4H4RA 4JY2A 3ADAB 1Y0PA 4NPPA 1DODA 1ELIA 3CPHG 1WRDA 2WDRA 3V3NA 3CX6B 3RX6A 3SX6A 2W62A 2JK6A 3J9X1 4PAGA 3G06A 5L3EB 1ZMCA 4XBFB 4JI5T 4OPTA 1UGOA 4II2A 3TLWA 3HKCE 3DH9A 3P7IA 4PK6A 3G5QA 4AOSA 2KSRA 4QX8B 2IAKA 1XHXA 2Q9QD 4J31A 4CCRA 2OLOA 3RC3A 3EANA 4CN1A 2IMLA 3ZYLA 3T37A 5JR9A 4HA6A 3P4WA 4DUYT 4MFRA 4JN9A 1JNZA 4K0UA 3DMEA 2CLYB 5JDQA 1Y56B 1B5QA 4DR4T 1FMVA 4EM3A 1NEKA 1QUUA 4E7ZA 4HTEA 1S3BA 4OPCA 5HEHA 5KVIA 3E22E 1U4QA 5FXXA 2YG4A 4EQXA 3ZLIA 2BCPA 2PBIA 5ABFB 2RS34 1UX5A 2APGA 2YVFA 1ZDLA 2WS3A 2B7RA 4H2QA 3UKPA 5KOXA 4DV7T 5HXEA 2N2NA 3RIUC 2X3NA 3BNUA 1GRHA 3GDNA 4DSHA 1KFYA 2KT9A 3I0QA 1B37A 1QJDA 1HYUA 5JREA 2VRLA 1GERA 3QJ4A 3N5LA 3PVCA 3JC6C 3LBXA 2QA2A 4QWNB 2L3LA 1NG4A 3F57A 2CEAA 3E08A 1HNXT 3A8YC 2BC0A 4PAAA 4LF5T 3WE0A 2PLV4 5LBQB 5FMHA 2AR8A 4BJMA 1RHI4 4NZHA 2RPAA 1I6ZA 3GD3A 3CVRA 3F8PA 4JY3A 5TAOA 4B68A 3KPFA 1VCSA 3MXZA 2M6BA 2WBAA 1E1LA 2X9YA 4XXGA 2NTYA 1VG9A 1SE7A 1GQEA 2XQ4A 3FBLA 4NUUA 5CGMA 1FL2A 1D4DA 1E1NA 3TKLB 4NNJA 2XZEA 4USQA 4H4UA 2V26A 2PYJA 2BA9A 4GR1A 1AJ3A 3O1IA 1XMQT 4OYKA 5EK4A 5JDFA 3REDA 4IV9A 3CQCB 5LB7B 4JI4T 3IHRA 5DABA 2X51A 5ADXL 2BG9E 5JRCB 1HNZT 5AQGB 2BZBA 4TLXA 1VBB4 2WZHA 4Z2RA 2XTLA 3PTRB 2QYWA 1UKVG 3L1RA 2V6OA 2R46A 2XVFA 1EL8A 2EHOB 1UK5A 2Y8DA 2VURA 3OZ2A 3FXEB 4CBQA 2HWB4 4IA6A 1QLBA 1GEUA 4YSXA 3F8RA 3D8XA 1Z8UA 4KP3C 3KDSE 1RMU4 4H2PA 2R064 2CWOA 3EDVA 4EEDA 4ZOLE 1F3PA 1TDKA 2JB3A 3P8CD 4GDEA 3VRBA 4WZXA 5U1OA 2YAUA 2BG9A 4LF8T 2BRYA 3I1AA 3A5XA 3O4XE 4HWDA 4AQGA 5HYAA 4IL4A 3T31A 4MLKA 3BQKA 4IE4A 2V3BA 3MACA 2BXSA 1GSNA 2E9XC 3H37A 4D03A 2YU1A 4ISSA 5KMRA 1PXAA 4Y4LA 4YWOA 2M6IA 4KX6A 1PXBA 4U7IA 3I0OA 2C5IT 3K30A 4B65A 1V59A 3F8DA 2R4EA 4TUYE 3Q5DA 5FY0A 4GYRA 1L9DA 2VL8A 3PS9A 4AIUA 4GB34 2GQFA 3GMBA 2KINB 4EGWA 1LTXR 3PUGA 1VDCA 2GVCA 2A89A 1RUG4 1PIV4 4B3ST 1GRAA 1YKHB 1PJ5A 2L9QA 3RYIE 2WWVA 1KNZA 4U2TA 1PO24 4H2NA 3OKQA 3NTDA 2LRKA 3QSMA 2XY8B 3AYIA 4ZCCA 2HPLA 2E8IA 4DNAA 5JCKA 1MMAA 1PS9A 1F6MA 2YK0A 5FKYA 4EIWA 3T14A 3HI2A 2FUPA 1AL24 2DLRA 3AAEB 4IE0A 4GKKT 1J5ET 5ER0A 1XHCA 2EQ8A 3EUHA 3AD8B 3P50A 4ZEYA 2XAQB 2WPFA 2IVDA 3HZLA 4UV8B 1SHZC 4Y4NA 4OFZA 2OAMA 3RYCE 1D1BA 3GWHA 2C4CA 3V3OA 3ZMVB 3C51A 2WOWA 3VRDB 1S94A 1YQ4A 1MMNA 4DIDB 3KV6A 4GK5E 2YDSA 4BAYB 4L0RA 3PU3A 2V7IA 2XLPA 2QRXA 3NWIA 5HEGA 2KNDA 4KI0F 4EM4A 3O0HA 3JAEA 4UR9A 3CGEA 3UTKA 1N4VA 1E7PA 2JKCA 3KVEA 2RABA 5KWFA 2CA5A 5LHIB 3P4QA 3UKLA 5JCNA 2J4GA 2R4JA 5EBKA 2XM2A 2CHNA 3MKDA 3LG7A 3AECA 3IHGA 3V76A 1L0VA 3DP7A 1HNWT 1OJDA 4B3MT 3DK8A 3NLCA 5U63A 2R7FA 1HX8A 5ETWA 5FNVE 1T98A 3AE2A 4DMWA 4LMKA 4OPLA 3FG2P 3UOZA 2YWLA 1GETA 1OEDB 4C3XA 2WAUA 3NYFA 1XZYA 3UULA 4CY6A 1D7LA 2W66A 1HF8A 2BKOA 4O4IE 2C5JA 3EHZA 3DGZA 3KINB 2C73A 2WP5A 1Z7S4 5IQ1A 2G0UA 4NTEA 3Q5EA 1IJHA 5BMVE 4AQFC 4WNKA 4TN7B 4EAHA 2KMFA 3GMCA 4A9WA 3R84B 3GMIA 3G5SA 2RGHA 4AT2A 3O9XA 2PYLA 3AE8A 1CC6A 3RGLA 3C98B 3B57A 2PFVA 3IBPA 4DV2T 1HXS4 2X8CA 2BVMA 5FVLA 1FEBA 3HYVA 3UFEA 1WFDA 5IYZE 2XCGA 4A7AA 1T8BA 2C75A 2YLXA 2ZMAA 4PFPA 4DO0A 2WOIA 3EAOA 1AR74 4ZI7E 4ILBA 1D1CA 3ZMSB 1JOAA 3SY4A 4EQSA 1W4XA 2VASA 5LGNB 2MPKA 3PUWF 1ZEEA 1H8TD 1COYA 2X68A 3ZSSA 3NH3X 2CXDA 1N36T 4H4TA 3UTHA 1Z0PA 4Z24A 2LJLA 1AOGA 4DUZT 2YU2A 2V3AA 5BULA 5HYMA 4ZHQE 1COV4 4CXYA 4ANJA 3EDUA 3P4RA 2JPFA 3FHNA 2A8XA 4H2RA 4OPUA 1K5MD 3FPZA 5DQVA 5ABGA 4TM1A 5KXJA 2WM9A 3VKHA 4H4SA 3B3RA 1XNQT 3BHFA 4HFIA 2CVJA 1YKJA 2YG5A 3AA1B 3C4XA 4HWCA 5M4YA 4Z26A 2WOVA 2X8GA 4QH1A 3ZT6A 4LMLA 1D0XA 4TV9E 1PVC4 2IVEA 2VZ2A 2BC1A 1LQTA
chains in the Genus database with same CATH topology
1KNPA 3AEFA 1JRZA 1K0LA 1NHRA 4EQRA 5HY5A 3RNMA 4YTNA 2FJBA 1VRQB 4H4ZA 4B63A 4G9KA 1CF3A 2GR1A 3SXIA 2GMJA 1P2EA 3RP6A 4AT0A 1N1PA 2OLNA 4TM3A 2VVLA 4OCGA 4YSHA 1ZKQA 1DJQA 1OJ9A 3FBSA 4GF7A 3AE7A 3JSKA 4H4RA 5EOWA 3ZDNA 3LZWA 1CJ4A 1B8SA 2C66A 1CBOA 3ADAB 4JY2A 1JRXA 1Y0PA 2V5ZA 1DODA 1ELIA 1O94A 1ZOVA 2A87A 2YM1A 2F5ZA 4YSYA 3CPHG 3ICRA 4GRTA 2WDRA 1D4CA 4B66A 3V3NA 3SX6A 3PO7A 1E1MA 4EMIA 1GOSA 4BJYA 4APNA 3SZWA 2JK6A 5JCIA 3AE3A 2Z5YA 3H4KA 3DA1A 1ZMCA 4OPTA 4II2A 2AAQA 3CIRA 1EBDA 4II3A 2J3NA 2XFUA 3DH9A 2WQYA 4UDQA 3G5QA 3IC9A 3T2ZA 4ECHA 1D7YA 4FK1C 4AOSA 1IUTA 3CGCA 3GDPA 4U8MA 4EIPA 3CNPA 4J31A 4A99A 2OLOA 3NIXA 4CCRA 4Z2TA 1IUVA 4CY8A 3EANA 1CL0A 4E0VA 1PBEA 4K5SA 2JAEA 2XLUA 2WETA 4NTCA 3UP4A 4H4PA 4Z44A 1EL7A 3T37A 2YG6A 4A6NA 5GSNA 4HA6A 4AP1A 1MXTA 2QA1A 2HQMA 3UOYA 1BGNA 3SZCA 1JNRA 4JN9A 4ZCDA 2VQBA 1JNZA 4B64A 3L8KA 3DMEA 2IIDA 2VVLG 4NEVA 4H4QA 1Y56B 1B5QA 4J56A 1TDNA 3RP8A 4WX1A 1XDIA 3E1TA 4EM3A 1NEKA 2YLWA 4U8JA 4ZN0A 3KA7A 2XVIA 2WPEA 3NRNA 1DJNA 5KOWA 3GYXA 3UKKA 1S3BA 1BF3A 4OPCA 2WDVA 1PDHA 3NT6A 4U8KA 5KVIA 3T2KA 2WPCA 3AXBA 3LJPA 4M52A 4YKGA 2BS3A 1ZP0A 2YG4A 3UCLA 4B67A 1FCDA 1GPEA 3UKHA 1K4QA 4JNQA 4EQXA 3GD4A 3NYCA 1SEZA 4REKA 2FJAA 2BCPA 4FK1A 3NYEA 3C96A 3H8LA 2APGA 2YVFA 3ATQA 1Q1WA 2NVKX 2W0HA 1ZDLA 2WS3A 4NEWA 1PBFA 3IWAA 4U8OA 2GR0A 2ZBWA 3H8IA 2B7RA 4H2QA 1BKWA 3UKPA 5KOXA 3UP5A 3SM8A 4USRA 3KU9A 2X3NA 3BNUA 1GRHA 2PHHA 2VVMA 3GDNA 4K5RA 1KFYA 4DSHA 4J36A 4UDPA 1PBDA 1B37A 1DNCA 1QJDA 4J34A 2XLRA 5U25A 1DOBA 1HYUA 1O5WA 2EQ7A 2YR4A 4A79A 2VRLA 4GUVA 4P9SA 1GERA 3QJ4A 1MO9A 4C74A 1XPQA 3PVCA 2EQ6A 1PJ7A 3CTYA 4XWRA 3DK9A 2QA2A 5FS7A 3CGBA 1NG4A 2X50A 3GYIA 2YLTA 2XFQA 1XANA 3NNEA 2BC0A 2XYOA 4PAAA 3LXDA 2C67A 3LZXA 3NG7X 3WE0A 4K2XA 4Z25A 4K7ZA 2R0CA 2WU2A 4XWZA 5FMHA 2AR8A 2DKIA 2Q0LA 3NK1X 4RG4A 4DSGA 4H4XA 4NZHA 4C5OA 3I3LA 4UDRA 4A5LA 3NN6X 1CC2A 1RP0A 1NPXA 3CNDA 3CMMA 3GD3A 1LVLA 3F8PA 3NTAA 3AE9A 2WU5A 1NENA 1E39A 1TYTA 1TYPA 4JY3A 3URHA 1GRBA 3CNJA 3KPFA 4B68A 1EL9A 3OC4A 2WBAA 1E1LA 3P4PA 2BXRA 2GMHA 3DJGX 2XFNA 4XXGA 3D1CA 3AEAA 1S2QA 2GH5A 1VG9A 4H4WA 2Y6QA 2CULA 1KSSA 1FL2A 4H4VA 4UP3A 5KMSA 4ADWA 1D4DA 5L46A 2H89A 1E1NA 4NNJA 4USQA 4H4UA 2BA9A 3C4AA 5HHFA 4GR1A 3SGLA 2XVEA 3DK4A 4YTMA 1H81A 4B1BA 4GAVA 3KLJA 1GXFA 3REDA 1TDOA 4IV9A 2CDUA 2BCGG 2DKHA 2O9ZA 3C4NA 2Q6UA 2BK5A 4OVIA 3GSIA 1GTEA 2B9WA 2C72A 3GRTA 1PJ6A 4U8NA 1BZLA 3UKAA 5JCMA 1GRGA 3CGDA 1E1KA 1IUUA 3CNSA 4NTDA 1ZX9A 2GR3A 2QCUA 3ALMA 3AE1A 4J33A 1KNRA 3P9UA 3EPTA 4TLXA 4Z2RA 1IUWA 1LV0A 2C7GA 1UKVG 3AEBA 1GT8A 3L1RA 2QAEA 2V6OA 2R46A 2XVFA 4U8LA 1IUXA 1N4WA 1D5TA 1EL8A 2C3DA 1PXCA 5IQ4A 3LB8A 5HXIA 3OZ2A 5EB5A 3VQRA 1NAAA 4CBQA 4RG3A 2YLSA 3QFBA 4IA6A 4C3YA 1QLBA 1GEUA 3QVPA 3IF9A 3KD9A 2YLZA 1LPFA 4YSXA 3F8RA 2FBWA 3D8XA 3RP7A 3SYIA 1GREA 1H7WA 1PBCA 4H2PA 4AP3A 2ZZ0A 2JB2A 1TDKA 1F3PA 4CNKA 2JB3A 4GDEA 3P1WA 3VRBA 4JDRA 1NG3A 5U1OA 3S5WA 2YAUA 2BRYA 1M6IA 2YG7A 2YM2A 4U8PA 3RHAA 2YG3A 2C3CA 1CJCA 3T31A 1H86A 1PBBA 3B6DA 3AEEA 2BK3A 3AE5A 2CFYA 2V3BA 2VRMA 2WDQA 2BXSA 2RGJA 5IPYA 1GSNA 5BUKA 5TR3A 4D03A 5KMRA 3UKFA 2WEUA 1PXAA 2OALA 5FS8A 3UKQA 4Y4LA 4YWOA 2YQUA 2TPRA 2GRTA 5CQFA 3AEGA 2PYXA 1Y56A 4KX6A 5BVAA 1PXBA 4JNAA 3K30A 3VR8A 3T2YA 4Z43A 4B65A 1V59A 3AYJA 2GEWA 3F8DA 2R4EA 3R9UA 4DGKA 2BK4A 1YQ3A 1BGJA 1KF6A 4CRTA 3SUCA 3NKSA 4MJWA 1BWCA 5KNLA 2FJEA 1L9DA 3PS9A 5C2TA 2XFPA 4H4YA 4GDPA 5JCLA 5GRTA 2GQFA 3BI2A 4Y4MA 2XVHA 3GMBA 3AB1A 1GRFA 1KDGA 1LTXR 2EQ9A 4TM0A 1VDCA 2GVCA 2A89A 5M0ZA 4K22A 1VQWA 2R9ZA 1GRAA 5CKUA 2JB1A 2YR5A 2XLSA 3LADA 3VRAA 1PJ5A 3ALLA 3M0OA 1B4VA 4U2TA 4I59A 4YSZA 1CC4A 2BS2A 4H2NA 3ALJA 3NTDA 3UTFA 2C65A 1LJ1A 3QSMA 4X9MA 3AWIA 2JBVA 3AYIA 4ZCCA 4N9XA 3GQKA 2E4GA 4GAPA 4J2WA 3DJDA 4DNAA 5JCKA 1PS9A 1F6MA 2WHDA 1ZK7A 3VR9A 2XDOA 3AD9B 3K7QX 3KKJA 1TDFA 3T14A 2VQ7A 1F8WA 2Z5XA 1RYIA 3QFAA 4EIQA 4YXDA 1CHUA 2H88A 4FDCB 4TM4A 2E1MA 1OJAA 5KRQA 2XFOA 3BNMA 1H7XA 3UTEA 5ER0A 2V60A 1XHCA 1ZOYA 2BS4A 2EQ8A 2V61A 3AD8B 3ICTA 3K7MX 4X9NA 3QVRA 2WPFA 2R45A 2IVDA 3HZLA 2B7SA 1F8SA 4G73A 2VOUA 3UOXA 3I6DA 4Y4NA 2I0ZA 2XLTA 3EF6A 4IVMB 2OAMA 1MOKA 3IHMA 5EB4A 2ZZCA 5KMQA 5KVHA 1L9CA 4D04A 4NWZA 2GQWA 2FJDA 2C4CA 1ZY8A 4O5UA 4YKFA 3V3OA 4AOXA 1GV4A 4IVOB 2WOWA 4LU6A 4B69A 2YVJA 1DOEA 2YR6A 4OPGA 3VRDB 4RSLA 1YQ4A 1IUSA 1CJ2A 1NHQA 4K8DA 5M10A 1NHSA 2GV8A 4EQWA 4GCMA 2XLPA 1YY5A 2WESA 2GB0A 1GRTA 2Q0KA 3UTGA 3ATRA 4ICYA 1Q9IA 4BJZA 4EM4A 3O0HA 4FX9A 1DOCA 3CGEA 1REOA 4IA5A 1N4VA 1PHHA 1DXLA 4LA1A 1E7PA 2JKCA 3KVEA 4LIIA 3QSSA 4EMWA 2GR2A 2RABA 5KWFA 5JCNA 3P4QA 3SFDA 1OJCA 3UKLA 1PN0A 1TRBA 1FEAA 2R4JA 3GWDA 5EBKA 4OPIA 1ZMDA 5J60A 3ITJA 1JRYA 3AECA 4A6NB 3IHGA 3V76A 4PABA 1L0VA 2WP6A 1OJDA 4YT0A 3DK8A 3NLCA 5U63A 4X4JA 1S2YA 4BK3A 3GQHA 2C64A 1NHPA 2BRAA 1L9EA 1GALA 3AE2A 1FOHA 1K0IA 4OPLA 2Y6RA 3BI4A 1GNDA 3NGCX 3FG2P 3NHOX 3S61A 3UOZA 4C77A 2YWLA 3NK2X 3BHKA 1GETA 4C3XA 2C76A 2B9YA 3NYFA 1H84A 1ONFA 2LFCA 4CY6A 3AYLA 1D7LA 1YQZA 5FS9A 3M12A 3GWFA 2GAGB 4U2LA 4EMJA 3Q9TA 4H50A 1P2HA 3DGZA 3CN8A 2B76A 2WP5A 2C73A 5IQ1A 1JU2A 1M64A 3AD7B 4NTEA 4OPDA 4U2SA 1IJHA 3P4SA 2ACZA 1H82A 3BI5A 4CNJA 1VG0A 1K0JA 5KMPA 4H7UA 3GMCA 4A9WA 2ZZBA 4BK1A 3ZYXA 3G5SA 2RGHA 3SZ0A 4J57A 4AT2A 4U8IA 3AE8A 1CC6A 2C70A 3QSEA 4BK2A 2E5VA 1LQUA 4G6GA 4G74A 2WP9A 2X8CA 3ICSA 4CCQA 1D4EA 5BRTA 1FEBA 3NN0X 1Q1RA 3SQPA 3HYVA 3Q6JA 3HYWA 1S3EA 2ARDA 2XCGA 5LV9A 4A7AA 3II4A 3NK0X 2UZZA 2C75A 2RGOA 1X31B 2GAHB 2YLXA 4BV6A 1EL5A 2WOIA 3ABVA 3EAOA 5DBJA 4G6HA 1JOAA 3ISHA 2R0GA 2B9XA 3SY4A 1W4XA 4EQSA 1CJ3A 1GTHA 3DGHA 4TLZA 2AQJA 3K7TA 1RSGA 3LOVA 5J7XA 4WCTA 4I58A 1COYA 1E6EA 3NH3X 2YLRA 4O5QA 3GRSA 3KPKA 3GYJA 2GF3A 1F8RA 4Z2UA 4H4TA 3UTHA 1O95A 4YTPA 3FIMB 2R0PA 4Z24A 3M13A 1QO8A 1AOGA 2YVGA 2V3AA 4JQ9A 1NDAA 5BULA 4HB9A 5FS6A 5HYMA 4A65A 3COXA 3G5RA 3P4RA 1JEHA 2A8XA 4KPRA 4H2RA 3AEDA 3CPIG 4OPUA 3CPJG 1GESA 4BURA 3FPZA 2X8HA 4TM1A 1FECA 5KXJA 4H4SA 3B3RA 3AE6A 1H83A 2BYBA 3BHFA 1Z6LA 5C3JA 2CVJA 1H6VA 1YKJA 2YG5A 3CNTA 3UOVA 3HYXA 1OJTA 2TMDA 2X99A 1KSUA 4Z26A 1TDEA 3DJJA 2Q7VA 3T0KA 2WOVA 2XVJA 2OA1A 3AE4A 1N4UA 2X8GA 2NPXA 3DJEA 3SZFA 2BACA 2IVEA 2VZ2A 2BABA 3SFEA 3FMWA 2BC1A 1LQTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNP A;  3AEF A;  1JRZ A;  1K0L A;  1NHR A;  4EQR A;  5HY5 A;  3RNM A;  4YTN A;  2FJB A;  1VRQ B;  4H4Z A;  4B63 A;  1CF3 A;  2GR1 A;  2GMJ A;  1P2E A;  3RP6 A;  4AT0 A;  1N1P A;  2OLN A;  4TM3 A;  2VVL A;  4OCG A;  4YSH A;  1ZKQ A;  1DJQ A;  1OJ9 A;  3FBS A;  4GF7 A;  3AE7 A;  3JSK A;  4H4R A;  5EOW A;  3ZDN A;  3LZW A;  1CJ4 A;  1B8S A;  2C66 A;  1CBO A;  3ADA B;  4JY2 A;  1JRX A;  1Y0P A;  2V5Z A;  1DOD A;  1ELI A;  1O94 A;  1ZOV A;  2A87 A;  2YM1 A;  2F5Z A;  4YSY A;  3CPH G;  3ICR A;  4GRT A;  2WDR A;  1D4C A;  4B66 A;  3V3N A;  3PO7 A;  1E1M A;  4EMI A;  1GOS A;  4BJY A;  4APN A;  2JK6 A;  5JCI A;  3AE3 A;  2Z5Y A;  3H4K A;  3DA1 A;  1ZMC A;  4OPT A;  2AAQ A;  3CIR A;  1EBD A;  2J3N A;  2XFU A;  3DH9 A;  2WQY A;  4UDQ A;  3G5Q A;  3IC9 A;  4ECH A;  1D7Y A;  4FK1 C;  4AOS A;  1IUT A;  3CGC A;  3GDP A;  4U8M A;  4EIP A;  3CNP A;  4J31 A;  4A99 A;  2OLO A;  3NIX A;  4CCR A;  4Z2T A;  1IUV A;  4CY8 A;  3EAN A;  1CL0 A;  4E0V A;  1PBE A;  4K5S A;  2JAE A;  2XLU A;  2WET A;  4NTC A;  3UP4 A;  4H4P A;  4Z44 A;  1EL7 A;  3T37 A;  2YG6 A;  4A6N A;  5GSN A;  4HA6 A;  4AP1 A;  1MXT A;  2QA1 A;  2HQM A;  3UOY A;  1BGN A;  1JNR A;  4JN9 A;  4ZCD A;  2VQB A;  1JNZ A;  4B64 A;  3L8K A;  3DME A;  2IID A;  2VVL G;  4NEV A;  4H4Q A;  1Y56 B;  1B5Q A;  4J56 A;  1TDN A;  3RP8 A;  4WX1 A;  1XDI A;  3E1T A;  4EM3 A;  1NEK A;  2YLW A;  4U8J A;  4ZN0 A;  3KA7 A;  2XVI A;  2WPE A;  3NRN A;  1DJN A;  5KOW A;  3UKK A;  3GYX A;  1S3B A;  1BF3 A;  4OPC A;  2WDV A;  1PDH A;  3NT6 A;  4U8K A;  5KVI A;  2WPC A;  3AXB A;  3LJP A;  4M52 A;  4YKG A;  2BS3 A;  1ZP0 A;  2YG4 A;  3UCL A;  4B67 A;  1FCD A;  1GPE A;  3UKH A;  1K4Q A;  4JNQ A;  4EQX A;  3GD4 A;  3NYC A;  1SEZ A;  4REK A;  2FJA A;  2BCP A;  4FK1 A;  3NYE A;  3C96 A;  3H8L A;  2APG A;  2YVF A;  3ATQ A;  1Q1W A;  2NVK X;  2W0H A;  1ZDL A;  2WS3 A;  4NEW A;  1PBF A;  3IWA A;  4U8O A;  2GR0 A;  2ZBW A;  3H8I A;  2B7R A;  4H2Q A;  1BKW A;  3UKP A;  5KOX A;  3UP5 A;  3SM8 A;  4USR A;  3KU9 A;  2X3N A;  3BNU A;  1GRH A;  2PHH A;  2VVM A;  3GDN A;  4K5R A;  1KFY A;  4DSH A;  4J36 A;  4UDP A;  1PBD A;  1B37 A;  1DNC A;  1QJD A;  4J34 A;  2XLR A;  5U25 A;  1DOB A;  1HYU A;  1O5W A;  2EQ7 A;  2YR4 A;  4A79 A;  2VRL A;  4GUV A;  4P9S A;  1GER A;  3QJ4 A;  1MO9 A;  4C74 A;  1XPQ A;  3PVC A;  2EQ6 A;  1PJ7 A;  3CTY A;  4XWR A;  3DK9 A;  2QA2 A;  5FS7 A;  3CGB A;  1NG4 A;  2X50 A;  3GYI A;  2YLT A;  2XFQ A;  1XAN A;  3NNE A;  2BC0 A;  2XYO A;  4PAA A;  3LXD A;  2C67 A;  3LZX A;  3NG7 X;  3WE0 A;  4K2X A;  4Z25 A;  4K7Z A;  2R0C A;  2WU2 A;  4XWZ A;  5FMH A;  2AR8 A;  2DKI A;  2Q0L A;  3NK1 X;  4RG4 A;  4DSG A;  4H4X A;  4NZH A;  4C5O A;  3I3L A;  4UDR A;  4A5L A;  3NN6 X;  1CC2 A;  1RP0 A;  1NPX A;  3CND A;  3GD3 A;  1LVL A;  3F8P A;  3NTA A;  3AE9 A;  2WU5 A;  1NEN A;  1E39 A;  1TYT A;  1TYP A;  4JY3 A;  3URH A;  1GRB A;  3CNJ A;  3KPF A;  4B68 A;  1EL9 A;  3OC4 A;  2WBA A;  1E1L A;  3P4P A;  2BXR A;  2GMH A;  3DJG X;  2XFN A;  4XXG A;  3D1C A;  3AEA A;  1S2Q A;  2GH5 A;  1VG9 A;  4H4W A;  2Y6Q A;  2CUL A;  1KSS A;  1FL2 A;  4H4V A;  4UP3 A;  4ADW A;  1D4D A;  5L46 A;  2H89 A;  1E1N A;  4USQ A;  4H4U A;  2BA9 A;  3C4A A;  5HHF A;  4GR1 A;  3SGL A;  2XVE A;  3DK4 A;  4YTM A;  1H81 A;  4B1B A;  3KLJ A;  1GXF A;  3RED A;  1TDO A;  4IV9 A;  2CDU A;  2BCG G;  2DKH A;  2O9Z A;  3C4N A;  2Q6U A;  2BK5 A;  4OVI A;  3GSI A;  1GTE A;  2B9W A;  2C72 A;  3GRT A;  1PJ6 A;  4U8N A;  1BZL A;  3UKA A;  5JCM A;  1GRG A;  3CGD A;  1E1K A;  1IUU A;  3CNS A;  4NTD A;  1ZX9 A;  2GR3 A;  2QCU A;  3ALM A;  3AE1 A;  4J33 A;  1KNR A;  3P9U A;  3EPT A;  4TLX A;  4Z2R A;  1IUW A;  1LV0 A;  2C7G A;  1UKV G;  3AEB A;  1GT8 A;  3L1R A;  2QAE A;  2V6O A;  2R46 A;  2XVF A;  4U8L A;  1IUX A;  1N4W A;  1D5T A;  1EL8 A;  2C3D A;  1PXC A;  5IQ4 A;  3LB8 A;  5HXI A;  3OZ2 A;  5EB5 A;  3VQR A;  1NAA A;  4CBQ A;  4RG3 A;  2YLS A;  3QFB A;  4IA6 A;  4C3Y A;  1QLB A;  1GEU A;  3QVP A;  3IF9 A;  3KD9 A;  2YLZ A;  1LPF A;  4YSX A;  3F8R A;  2FBW A;  3D8X A;  3RP7 A;  1GRE A;  1H7W A;  1PBC A;  4H2P A;  4AP3 A;  2ZZ0 A;  2JB2 A;  1TDK A;  1F3P A;  4CNK A;  2JB3 A;  4GDE A;  3P1W A;  3VRB A;  4JDR A;  1NG3 A;  5U1O A;  3S5W A;  2YAU A;  1M6I A;  2YG7 A;  2YM2 A;  4U8P A;  3RHA A;  2YG3 A;  2C3C A;  1CJC A;  1H86 A;  1PBB A;  3B6D A;  3AEE A;  2BK3 A;  3AE5 A;  2CFY A;  2V3B A;  2VRM A;  2WDQ A;  2BXS A;  2RGJ A;  5IPY A;  1GSN A;  5BUK A;  5TR3 A;  4D03 A;  3UKF A;  2WEU A;  1PXA A;  2OAL A;  5FS8 A;  3UKQ A;  4Y4L A;  4YWO A;  2YQU A;  2TPR A;  2GRT A;  5CQF A;  3AEG A;  2PYX A;  1Y56 A;  4KX6 A;  5BVA A;  1PXB A;  4JNA A;  3K30 A;  3VR8 A;  4Z43 A;  4B65 A;  1V59 A;  3AYJ A;  2GEW A;  3F8D A;  2R4E A;  3R9U A;  4DGK A;  2BK4 A;  1YQ3 A;  1BGJ A;  1KF6 A;  4CRT A;  3SUC A;  3NKS A;  4MJW A;  1BWC A;  2FJE A;  1L9D A;  3PS9 A;  5C2T A;  2XFP A;  4H4Y A;  4GDP A;  5JCL A;  5GRT A;  2GQF A;  3BI2 A;  4Y4M A;  2XVH A;  3GMB A;  3AB1 A;  1GRF A;  1KDG A;  1LTX R;  2EQ9 A;  4TM0 A;  1VDC A;  2GVC A;  2A89 A;  5M0Z A;  4K22 A;  1VQW A;  2R9Z A;  1GRA A;  5CKU A;  2JB1 A;  2YR5 A;  2XLS A;  3LAD A;  3VRA A;  1PJ5 A;  3ALL A;  3M0O A;  1B4V A;  4U2T A;  4I59 A;  4YSZ A;  1CC4 A;  2BS2 A;  4H2N A;  3ALJ A;  3NTD A;  3UTF A;  2C65 A;  1LJ1 A;  3QSM A;  4X9M A;  3AWI A;  2JBV A;  3AYI A;  4ZCC A;  4N9X A;  3GQK A;  2E4G A;  4J2W A;  3DJD A;  4DNA A;  5JCK A;  1PS9 A;  1F6M A;  2WHD A;  1ZK7 A;  3VR9 A;  2XDO A;  3AD9 B;  3K7Q X;  3KKJ A;  1TDF A;  2VQ7 A;  1F8W A;  2Z5X A;  1RYI A;  3QFA A;  4EIQ A;  4YXD A;  1CHU A;  2H88 A;  4FDC B;  4TM4 A;  2E1M A;  1OJA A;  5KRQ A;  2XFO A;  3BNM A;  1H7X A;  3UTE A;  5ER0 A;  2V60 A;  1XHC A;  1ZOY A;  2EQ8 A;  2BS4 A;  2V61 A;  3AD8 B;  3ICT A;  3K7M X;  4X9N A;  3QVR A;  2WPF A;  2R45 A;  2IVD A;  3HZL A;  2B7S A;  1F8S A;  2VOU A;  3UOX A;  3I6D A;  4Y4N A;  2I0Z A;  2XLT A;  3EF6 A;  4IVM B;  2OAM A;  1MOK A;  3IHM A;  5EB4 A;  2ZZC A;  5KVH A;  1L9C A;  4D04 A;  4O5U A;  2GQW A;  2FJD A;  4AOX A;  1ZY8 A;  4YKF A;  3V3O A;  1GV4 A;  4IVO B;  2WOW A;  4LU6 A;  4B69 A;  2YVJ A;  1DOE A;  2YR6 A;  4OPG A;  3VRD B;  4RSL A;  1YQ4 A;  1IUS A;  1CJ2 A;  1NHQ A;  4K8D A;  5M10 A;  1NHS A;  2GV8 A;  4EQW A;  4GCM A;  2XLP A;  1YY5 A;  2WES A;  2GB0 A;  1GRT A;  2Q0K A;  3UTG A;  3ATR A;  4ICY A;  1Q9I A;  4BJZ A;  4EM4 A;  3O0H A;  4FX9 A;  1DOC A;  3CGE A;  1REO A;  4IA5 A;  1N4V A;  1PHH A;  1DXL A;  4LA1 A;  1E7P A;  2JKC A;  3KVE A;  4LII A;  3QSS A;  4EMW A;  2GR2 A;  2RAB A;  5KWF A;  5JCN A;  3P4Q A;  3SFD A;  1OJC A;  3UKL A;  1PN0 A;  1TRB A;  1FEA A;  2R4J A;  3GWD A;  5EBK A;  4OPI A;  1ZMD A;  5J60 A;  3ITJ A;  1JRY A;  3AEC A;  4A6N B;  3IHG A;  3V76 A;  4PAB A;  1L0V A;  2WP6 A;  1OJD A;  4YT0 A;  3DK8 A;  3NLC A;  5U63 A;  4X4J A;  1S2Y A;  4BK3 A;  3GQH A;  2C64 A;  1NHP A;  1L9E A;  1GAL A;  3AE2 A;  1FOH A;  1K0I A;  4OPL A;  2Y6R A;  3BI4 A;  1GND A;  3NGC X;  3FG2 P;  3NHO X;  3S61 A;  3UOZ A;  4C77 A;  2YWL A;  3NK2 X;  3BHK A;  1GET A;  4C3X A;  2C76 A;  2B9Y A;  3NYF A;  1H84 A;  1ONF A;  2LFC A;  4CY6 A;  3AYL A;  1D7L A;  1YQZ A;  5FS9 A;  3M12 A;  3GWF A;  2GAG B;  4U2L A;  4EMJ A;  3Q9T A;  4H50 A;  1P2H A;  3DGZ A;  3CN8 A;  2B76 A;  2WP5 A;  2C73 A;  5IQ1 A;  1JU2 A;  1M64 A;  3AD7 B;  4NTE A;  4OPD A;  4U2S A;  1IJH A;  3P4S A;  2ACZ A;  1H82 A;  3BI5 A;  4CNJ A;  1VG0 A;  1K0J A;  4H7U A;  3GMC A;  4A9W A;  2ZZB A;  4BK1 A;  3ZYX A;  3G5S A;  2RGH A;  4J57 A;  4AT2 A;  4U8I A;  3AE8 A;  1CC6 A;  2C70 A;  3QSE A;  4BK2 A;  2E5V A;  1LQU A;  2WP9 A;  2X8C A;  3ICS A;  4CCQ A;  1D4E A;  5BRT A;  1FEB A;  3NN0 X;  1Q1R A;  3SQP A;  3Q6J A;  1S3E A;  2ARD A;  2XCG A;  5LV9 A;  4A7A A;  3II4 A;  3NK0 X;  2UZZ A;  2C75 A;  2RGO A;  1X31 B;  2GAH B;  2YLX A;  4BV6 A;  1EL5 A;  2WOI A;  3ABV A;  3EAO A;  5DBJ A;  1JOA A;  3ISH A;  2R0G A;  2B9X A;  4EQS A;  1W4X A;  1CJ3 A;  1GTH A;  3DGH A;  4TLZ A;  2AQJ A;  3K7T A;  1RSG A;  3LOV A;  5J7X A;  4WCT A;  4I58 A;  1COY A;  1E6E A;  3NH3 X;  2YLR A;  4O5Q A;  3GRS A;  3GYJ A;  2GF3 A;  1F8R A;  4Z2U A;  4H4T A;  3UTH A;  1O95 A;  4YTP A;  3FIM B;  2R0P A;  4Z24 A;  3M13 A;  1QO8 A;  1AOG A;  2YVG A;  2V3A A;  4JQ9 A;  1NDA A;  5BUL A;  4HB9 A;  5FS6 A;  5HYM A;  4A65 A;  3COX A;  3G5R A;  3P4R A;  1JEH A;  2A8X A;  4KPR A;  4H2R A;  3AED A;  3CPI G;  4OPU A;  3CPJ G;  1GES A;  4BUR A;  3FPZ A;  2X8H A;  4TM1 A;  1FEC A;  5KXJ A;  4H4S A;  3B3R A;  3AE6 A;  1H83 A;  2BYB A;  3BHF A;  1Z6L A;  5C3J A;  2CVJ A;  1H6V A;  1YKJ A;  2YG5 A;  3CNT A;  3UOV A;  1OJT A;  2TMD A;  2X99 A;  1KSU A;  4Z26 A;  1TDE A;  3DJJ A;  2Q7V A;  2WOV A;  2XVJ A;  2OA1 A;  3AE4 A;  1N4U A;  2X8G A;  2NPX A;  3DJE A;  2BAC A;  2IVE A;  2VZ2 A;  2BAB A;  3SFE A;  3FMW A;  2BC1 A;  1LQT A; 
#chains in the Genus database with same CATH topology
 3NBX X;  2RS5 4;  5HY5 A;  4WBO A;  4YTN A;  1MNE A;  4DR1 T;  4X62 T;  4TM3 A;  3NZP A;  1DJQ A;  1OJ9 A;  4O4H E;  5FL1 A;  3AE7 A;  5EOW A;  3CX7 B;  5L3D B;  3LZW A;  2C66 A;  3AB3 B;  4BJN A;  3OVU A;  2A87 A;  4JLE A;  2UXC T;  4GRT A;  4O2B E;  4KBM B;  2LSY A;  3PO7 A;  4BJY A;  4YFS A;  5LGT B;  3PUS A;  4PW8 A;  2XQY A;  3ETV A;  2H7O A;  4U7Y A;  4YHJ A;  2AAQ A;  2K5B B;  4HE8 A;  2XAS B;  2A3D A;  2J3N A;  2XFU A;  3LSV A;  1D7Y A;  3QNU A;  4AQY T;  3Q5W A;  1IUT A;  4DR3 T;  2MYS A;  2YKS A;  3GDP A;  3CNP A;  4A99 A;  3NIX A;  4Z2T A;  1I94 T;  4E0V A;  1PBE A;  4X1Y E;  3UP4 A;  5L4H A;  4NTC A;  2WMN A;  4Z44 A;  1RUJ 4;  2YN6 A;  2YG6 A;  2XAJ B;  1MXT A;  2HQM A;  4AKR B;  4B3R T;  4ILU A;  4I0U A;  4B64 A;  4AKI A;  5IUX A;  3TLS A;  2VVL G;  3B5M A;  3RP8 A;  4HEA A;  3WI3 A;  3ANW B;  2VL0 A;  4PK4 A;  3FZF B;  5L3C B;  5AQM B;  2YLW A;  1UCU A;  1DJN A;  4U8K A;  4HWI B;  3ZPO A;  3T2K A;  5FYM A;  2WPC A;  3AXB A;  2UUC T;  4YKG A;  2XSA A;  2DNX A;  4P09 A;  3NYE A;  1OED A;  3N9N A;  3FI7 A;  4N78 D;  2XQ7 A;  3IWA A;  1FEW A;  4DV4 T;  2GR0 A;  2ZBW A;  3MZK B;  1BKW A;  5DQW A;  2XUE A;  3K3Q C;  4USR A;  3KU9 A;  2VVM A;  4L9I A;  2PHH A;  4UDP A;  1PBD A;  4DBQ A;  4ZI2 C;  2XLR A;  5U25 A;  3FB2 A;  4X5T A;  3CK6 A;  4P9S A;  3L3P A;  1PJ7 A;  3CTY A;  4QKN A;  1NCQ D;  1B7T A;  1XAN A;  1XWM A;  3LXD A;  3LZX A;  4EZ4 A;  1RUH 4;  2HWC 4;  4K7Z A;  1J1J A;  4EZH A;  3Q9D A;  2J1D G;  4ZI3 D;  4H4X A;  2XHE B;  1CC2 A;  1NPX A;  4I4T E;  3AE9 A;  2WU5 A;  4DMV A;  1TYT A;  4TNV A;  3OC4 A;  1SA0 E;  4JI0 T;  3P4P A;  2OLT A;  2GMH A;  3DJG X;  4JI3 T;  2GH5 A;  4X66 T;  1AR6 4;  4UP3 A;  3K3N A;  5L46 A;  4CXX A;  1HRV 4;  5AQL B;  5ABH A;  4ZZC A;  4KHP T;  4YTM A;  4GAV A;  1GXF A;  2CDU A;  2DKH A;  2Q6U A;  2WBL A;  4DV1 T;  1YXR A;  2B9W A;  2VWA A;  4IE7 A;  2C72 A;  3GRT A;  5KMG P;  2BG9 C;  4JV5 T;  1PJ6 A;  4ILA A;  3ZMT B;  3PUV F;  2OV9 A;  3CNS A;  4UEL A;  5LGU B;  1ZX9 A;  2IHR 1;  3UUX B;  1O3X A;  2JIW A;  1IUW A;  1LV0 A;  3OBV E;  3EAM A;  3NZQ A;  1GT8 A;  1OXZ A;  1UUS A;  2CMR A;  2BKN A;  4U8L A;  4DV6 T;  4I50 E;  2ZLY A;  1PXC A;  4HFC A;  3ZT7 A;  2VVS A;  2EHO A;  4RG3 A;  2YLS A;  4I55 E;  3IF9 A;  4IE6 A;  3KD9 A;  4COF A;  2V8S V;  4UEM A;  1IBK T;  2FBW A;  2X0H A;  3RP7 A;  3SYI A;  1GRE A;  1H7W A;  4PNI A;  5JDL A;  2CLY C;  4Q4Y 4;  2JB2 A;  4FI5 A;  4CNK A;  4H9R C;  1NG3 A;  3MA9 A;  5FXZ A;  3JAF A;  4LFA T;  2L8K A;  2XQ3 A;  2YG3 A;  2C3C A;  4L5G A;  1H86 A;  3B6D A;  3OPC A;  2DWK A;  4F6R C;  4WW0 A;  3AEE A;  2BK3 A;  5H6Q B;  1VBE 4;  2VRM A;  5FP3 A;  3RYH E;  2XQ8 A;  5TR3 A;  5BUK A;  2OAL A;  2AE9 A;  2WMO A;  3QUJ A;  4UVC B;  1YW0 A;  3AYJ A;  2BBJ A;  3UU3 A;  5FXW A;  2BK4 A;  1YQ3 A;  1HFA A;  4DR5 T;  2RR1 4;  1KF6 A;  2XSB A;  4H63 H;  4PJJ A;  2ZM0 A;  4P0B A;  2XQ6 A;  3N2G E;  1BWC A;  4XAX B;  5JCL A;  2XFP A;  2X9H A;  5GRT A;  1HTJ F;  4YHH T;  2LSK A;  3VU7 H;  2RA1 A;  3AB1 A;  3Q5X A;  2V7M A;  1GRF A;  1KDG A;  2EQ9 A;  1MIY A;  2UXX B;  4QXB B;  4K22 A;  2YEV C;  1VQW A;  2YR5 A;  5HCJ A;  4MAL A;  4X1K E;  2A72 A;  3M0O A;  1YKE B;  3H3A A;  1MND A;  4YSZ A;  2D5U A;  2I0M A;  3VHL A;  1M62 A;  4TX5 A;  1LJ1 A;  4ZS2 A;  2YDR A;  4GAP A;  4HN9 A;  1ZK7 A;  1HG5 A;  5HXS A;  3LFM A;  3RRC A;  3K7Q X;  3KKJ A;  2VQ7 A;  1D1A A;  1F8W A;  2Z5X A;  5FMN A;  3QFA A;  1T7S A;  3ZN1 B;  4EEB A;  5H6R B;  4LFC T;  3X1D A;  2E1M A;  1OJA A;  3BNM A;  1M7K A;  3UTE A;  1VCT A;  5L4E A;  2V60 A;  2V61 A;  3ICT A;  3HR0 A;  3K7M X;  2KWI B;  2R45 A;  4X20 E;  2VOU A;  3UOX A;  2AXD S;  3QOF A;  2I0Z A;  3IHM A;  5KVH A;  1UX4 A;  5AQO B;  1L9C A;  2FJD A;  3NVO A;  1ZY8 A;  2CE7 A;  2KLQ A;  5LBM A;  1DOE A;  2YVJ A;  2BKP A;  2BVL A;  3W15 B;  1NHQ A;  4K8D A;  5LMU T;  2GV8 A;  4EQW A;  4GCM A;  4OK0 A;  3RHW A;  4ICY A;  1Q9I A;  2J47 A;  1DOC A;  3ETU A;  1VRB A;  1YD8 G;  3TLV A;  3RIF A;  3SFD A;  1PN0 A;  1BR4 A;  1QSD A;  5EZY E;  2V5C A;  1X9B A;  4PAB A;  3NRX A;  2DI4 A;  4LF4 T;  4X4J A;  3GQH A;  1NHP A;  3E0Z A;  1FOH A;  1K0I A;  1Y01 A;  1GND A;  3NHO X;  2K24 A;  3BHK A;  3O1J A;  3TLT A;  2B9Y A;  3PUY F;  4PJN A;  1ONF A;  5JH7 E;  2C0S A;  3Q2M A;  3GWF A;  3RIU A;  2A9U A;  3Q9T A;  4H50 A;  1P2H A;  3N2K E;  4V1A v;  1JU2 A;  1M64 A;  2WCA A;  3AD7 B;  2VQE T;  1RUF 4;  3RF1 A;  3BI5 A;  1H82 A;  3ZMU B;  5KMP A;  3JAD A;  4HWH A;  5J0Z A;  2C5K T;  5JDM A;  4E7S A;  2RS1 4;  1WR6 A;  3RLF F;  5JQG E;  2JRK A;  1LQU A;  4G6G A;  2IW5 B;  2WP9 A;  1POV 0;  4CCQ A;  3UU4 A;  3AVS A;  3K1S A;  3KBT A;  2UXB T;  1XMO T;  4HGA A;  2VQF T;  1S3E A;  2ARD A;  5LV9 A;  3JBG 4;  3NK0 X;  2R04 4;  1X31 B;  2PJQ A;  4ILC A;  2GAH B;  4BV6 A;  2W0G A;  4DBR A;  1EL5 A;  5LOV E;  2QA7 A;  4G6H A;  3ISH A;  2VVN A;  3I9W A;  1CJ3 A;  3K7T A;  3LOV A;  2DCF A;  3PV0 F;  4DVD A;  3AVR A;  3ZCJ A;  5JR9 B;  3PU8 A;  1BEV 4;  1J5W A;  5JRC A;  5E0O A;  4AKL A;  5LHH B;  4YTP A;  3FIM B;  2R0P A;  3FZH B;  4LFB T;  4A65 A;  1JEH A;  3CPI G;  2V6X A;  2XAG B;  1GES A;  3KVA A;  1FEC A;  3NRY A;  2F4V T;  2LM9 A;  1N34 T;  3AE6 A;  3SWH A;  4UF0 A;  3CNT A;  1H6V A;  3UOV A;  1OJT A;  5AQR B;  2X99 A;  5FY1 A;  5L3F B;  5IWA T;  2XAF B;  3T0K A;  1N4U A;  2W67 A;  2WWU A;  2BAB A;  2XQ9 A;  3S4U A;  1JRZ A;  3ONX A;  1W0B A;  1ZV4 X;  5AQQ B;  1U5P A;  3RNM A;  4U72 A;  1HRI 4;  2CBJ A;  3RP6 A;  3V5S A;  1N1P A;  3TLU A;  2B1E A;  4K0K T;  1ZKQ A;  4ZS3 A;  3ZDN A;  5AFU L;  1CJ4 A;  1JRX A;  2V5Z A;  4CXW A;  1O94 A;  4TWF A;  2F5Z A;  4YSY A;  3ICR A;  3ZYK A;  5AQT B;  5AQS B;  4B66 A;  5IHY A;  4EMI A;  1GOS A;  4APN A;  3SZW A;  2IDO B;  4H9O C;  2Z5Y A;  3GN5 A;  2Y6X A;  2HN1 A;  4Z8X A;  2CHO A;  2A2F X;  3IC9 A;  3T2Z A;  4ECH A;  2SPC A;  4PDW D;  4EIP A;  4BA9 A;  4ZI3 C;  4HFE A;  4KMC A;  2K3W A;  4CY8 A;  5FVK A;  1CL0 A;  1MQT D;  4K5S A;  2XLU A;  1N32 T;  1G73 A;  2KXP B;  4AP1 A;  3UOY A;  1BGN A;  3SZC A;  1JNR A;  4ZCD A;  2VQB A;  1VBC 4;  4NUV A;  3L8K A;  1EAH 4;  2IID A;  4NEV A;  4WX1 A;  4HWF A;  4HFH A;  2QGS A;  4OHF A;  1XDI A;  3E1T A;  4IT4 A;  2V7J A;  4U8J A;  4ZN0 A;  2XVI A;  2WPE A;  3NRN A;  3GYX A;  3UKK A;  1FJG T;  2WDV A;  3UFG A;  1PDH A;  3LJP A;  3U3I A;  4PJL A;  1W9R A;  1ZP0 A;  4LF7 T;  1FCD A;  1GPE A;  4REK A;  2W00 A;  4FK1 A;  1XHZ A;  1LKX A;  2CRB A;  5LCY A;  3H8L A;  4AIS A;  1VBD 4;  3BK9 A;  2W0H A;  1PBF A;  3CX8 B;  4U8O A;  3H8I A;  1W0A A;  3HKE E;  1VOM A;  3UP5 A;  2D0T A;  4K5R A;  3K3O A;  4J36 A;  1DNC A;  3RRW A;  1DOB A;  2EQ7 A;  2YR4 A;  3KV9 A;  4GUV A;  4GOU A;  1MO9 A;  2D9D A;  3DK9 A;  4XWR A;  2ZM8 A;  4LF9 T;  2YLT A;  2XFQ A;  1E2A A;  4EB6 E;  2X0L B;  2C67 A;  1MIW A;  4Z25 A;  4K2X A;  3UU6 A;  2XQA A;  4XWZ A;  5L3B B;  4U2Y A;  2DKI A;  4RG4 A;  4C5O A;  2XM1 A;  4UDR A;  3NN6 X;  4A5L A;  5JDH A;  1RP0 A;  3CMM A;  1LVL A;  2HHH T;  5LNK A;  1MMG A;  1XDO A;  3URH A;  1E39 A;  2V5D A;  4DND A;  1TYP A;  4QXH B;  1EL9 A;  2XFN A;  3D1C A;  3AEA A;  2CUL A;  1KSS A;  4H4V A;  4A5X A;  2Z6E A;  4ADW A;  2X66 A;  3C4A A;  3SGL A;  3DK4 A;  2CPT A;  1H81 A;  3JC6 D;  4B1B A;  4A97 A;  2M67 A;  2NR4 A;  1TDO A;  3M3Z B;  3BQL A;  2O9Z A;  2JJ9 A;  4OVI A;  4UF0 B;  3GSI A;  1GTE A;  3F2E A;  1BR1 A;  4JI1 T;  4U8N A;  2X9W A;  2WZI A;  3N2O A;  1AR9 4;  4EV6 A;  3CGD A;  1E1K A;  1IUU A;  4JBW F;  4NTD A;  4NIQ A;  3ZST A;  4KUM B;  4J33 A;  5AQP B;  3P9U A;  3EPT A;  2C7G A;  1MIV A;  3J8F 4;  2QAE A;  1NAF A;  1ZKE A;  1D5T A;  2VKJ A;  2C3D A;  5IQ4 A;  5HXI A;  4U3C A;  1RUC 4;  3ZJ1 A;  3VQR A;  1NAA A;  3QFB A;  4C3Y A;  3QVP A;  3LDQ B;  2HPJ A;  4C90 A;  4AP3 A;  4H9N C;  3UU5 A;  1US7 B;  2DHR A;  2XPK A;  4ZI2 D;  2Q9Q C;  3LBX B;  4JDR A;  1LRZ A;  3S5W A;  2V6Y B;  2YG7 A;  2NW7 A;  1DU2 A;  2YM2 A;  3ZC0 A;  5C8Y E;  4U31 A;  4O2A E;  2V6Y A;  2CFY A;  2VB6 A;  2WDQ A;  5IPY A;  1WLX A;  2JQ9 A;  3UKF A;  2P9B A;  2WEU A;  5LXT E;  5FS8 A;  3UKQ A;  4JI7 T;  2TPR A;  2GRT A;  5CQF A;  4DV3 T;  3RH3 A;  5JVD E;  4JNA A;  5KDM C;  3T2Y A;  4Z43 A;  1RUD 4;  4UVA B;  3R9U A;  5JDN A;  4JI6 T;  4CRT A;  5HWY A;  3SUC A;  3UQ7 A;  4MJW A;  2LSJ A;  5HXR A;  1IBM T;  2LOP A;  5C2T A;  4H4Y A;  2XVH A;  3OYX A;  2WB5 A;  3KBU A;  4TM0 A;  5CKU A;  3LAD A;  3ALL A;  5AQV B;  1B4V A;  4NXN T;  4I59 A;  3RPU A;  3UTF A;  2C65 A;  4X9M A;  2E5L T;  2JBV A;  2CBI A;  4N9X A;  1OWA A;  3UU8 A;  3V5U A;  3DJD A;  3UQ4 A;  4J2W A;  2XDO A;  3B13 A;  3AD9 B;  1TDF A;  3KFW X;  4UV9 B;  5LHG B;  1HCI A;  2WSS V;  1RYI A;  4TV8 E;  1CHU A;  4EYU A;  2H88 A;  4FDC B;  4TM4 A;  2ODU A;  2XFO A;  1ZOY A;  2BS4 A;  5LMN T;  4X9N A;  1WYB A;  1FIO A;  2BDE A;  3ZEF B;  4U2Z A;  1WYC A;  5L3G B;  1MOK A;  5KMQ A;  5EB4 A;  3PJA A;  4D04 A;  5EK3 A;  4IE5 A;  2GQW A;  4AOX A;  2X67 A;  4YKF A;  3PDY A;  4IVO B;  4B69 A;  4OPG A;  2YR6 A;  1IUS A;  3UUB A;  4HFB A;  3RQU A;  5JDG A;  4IGU A;  1Y64 B;  2Y48 B;  1YY5 A;  2WES A;  2GB0 A;  1GRT A;  3UTG A;  3ATR A;  4IST A;  4IA5 A;  1PHH A;  4LA1 A;  2W4X A;  5LP6 E;  3F31 A;  3C64 A;  3MJX A;  3RYF E;  1UUR A;  5CA0 E;  5LJM A;  1TRB A;  1FEA A;  3GWD A;  5J1G A;  1X79 A;  3WAK A;  5LA6 E;  5J60 A;  3PE0 A;  4QHO A;  5AQK B;  1JRY A;  4CZZ B;  2DL1 A;  2WP6 A;  4YT0 A;  1WCR A;  1S2Y A;  4BK3 A;  2C64 A;  4ZZB A;  1GAL A;  4IRE A;  5HAX A;  4IDQ A;  3NGC X;  3N9L A;  4UXN B;  1OED C;  3FBZ A;  3NK2 X;  1XNR T;  2DWG A;  5FY7 A;  3AYL A;  2GAG B;  3HKD E;  3ZYM A;  4EMJ A;  3AAI A;  3R6N A;  4U2S A;  2JQH A;  2OA5 A;  2NP9 A;  4CNJ A;  3H3M A;  3IA3 A;  1VG0 A;  1K0J A;  4H7U A;  4IDN A;  4QH5 A;  4J2C A;  3ZYX A;  2HH7 A;  3EAB A;  4J57 A;  4U8I A;  2C70 A;  3QSE A;  4CI1 B;  3ICS A;  4PJM A;  1D4E A;  2LSI A;  3ZMZ B;  3HYW A;  2JQK A;  4A56 A;  3RIA A;  2RGO A;  4Q4V 4;  1OED E;  2JMK A;  3AAA B;  3ABV A;  5DBJ A;  2R0G A;  2B9X A;  3HL6 A;  3L39 A;  4G63 A;  1GTH A;  3DGH A;  4TLZ A;  2AQJ A;  1RSG A;  4I58 A;  3GRS A;  3KPK A;  2GF3 A;  1F8R A;  4Z2U A;  1O95 A;  3I9Y A;  1QO8 A;  1S35 A;  1NDA A;  3G5R A;  4Z91 A;  2N9D A;  2WY2 A;  4KPR A;  3ANW A;  4DV5 T;  4BUR A;  2VK9 A;  2LLY A;  5BR8 T;  2YIN A;  2E9X B;  1H83 A;  2BYB A;  2IC9 A;  1Z6L A;  4X1I E;  3O1H A;  2IIU A;  4LF6 T;  1TDE A;  4H9Q C;  2NPX A;  3DJE A;  1MMD A;  3CWZ B;  4G2A A;  3SZF A;  2RMU 4;  3AXJ A;  3SFE A;  1G8X A;  1E1H B;  3AEF A;  2ZM6 T;  1OOP D;  4B63 A;  2V1D B;  4G9K A;  2UUB T;  3SXI A;  5ABF A;  2N1G A;  1P2E A;  2GMJ A;  4AT0 A;  5AQF B;  4OCG A;  1EZ3 A;  5FL0 A;  5CB4 E;  3SS1 A;  4JI8 T;  1B8S A;  1CBO A;  2RP4 A;  1ZOV A;  2YM1 A;  1RVF 4;  2ODV A;  4UIG A;  1D4C A;  5KX5 E;  5AQI B;  2LKH A;  4A98 A;  1E1M A;  2LKG A;  5JCI A;  3AE3 A;  5CFB A;  3H4K A;  3DA1 A;  1T72 A;  4AXP A;  4GK0 E;  5AQU B;  5EK2 A;  3CIR A;  1EBD A;  4II3 A;  2WQY A;  4UDQ A;  4RHV 4;  3LK4 2;  4FK1 C;  3UUN A;  1VBA 4;  4M1P A;  3CGC A;  4U8M A;  4IDP A;  2K48 A;  1IUV A;  2I59 A;  2W63 A;  4IDZ A;  2X9X A;  2JAE A;  3C4W A;  2WET A;  2UXN B;  3PUR A;  4H4P A;  1EL7 A;  4A6N A;  5GSN A;  2QA1 A;  3T1Y T;  1IBL T;  3A7M A;  4H9P C;  1XDP A;  2CXF A;  4H4Q A;  4J56 A;  1TDN A;  1XI1 A;  4YJ3 E;  2XQ5 A;  2VKO A;  3M65 A;  3KA7 A;  3ZC1 A;  5KOW A;  1HX1 B;  5HCM A;  4EOZ B;  1BF3 A;  3NT6 A;  5J2U E;  5CJ5 A;  4M52 A;  3UUM A;  2BS3 A;  3N9P A;  3BQI A;  3UCL A;  4B67 A;  3UKH A;  1K4Q A;  4JNQ A;  3GD4 A;  1LVF A;  1V9D A;  3NYC A;  1SEZ A;  2FJA A;  4ZXL A;  5CA1 E;  3C96 A;  3EI0 A;  3ATQ A;  1Q1W A;  2NVK X;  4NEW A;  5HHF A;  4Z90 A;  3SOL A;  2NW8 A;  3ZKR A;  3SM8 A;  2PY5 A;  4ASK A;  5JR9 C;  4Q25 A;  3ZN0 B;  1PO1 4;  4J34 A;  1O5W A;  4A79 A;  1N33 T;  3KV4 A;  4C74 A;  2NWB A;  5L47 A;  1XPQ A;  2EQ6 A;  1NA1 D;  4QH4 A;  2GK9 A;  5FS7 A;  3CGB A;  2X50 A;  3GYI A;  2NTX A;  1BR2 A;  2IC6 A;  2V7L A;  3CKD A;  3NNE A;  2XYO A;  3EVY A;  2BBH A;  3NG7 X;  4XZC A;  2R0C A;  2WU2 A;  1RUE 4;  2R6G F;  2Q0L A;  3NK1 X;  2LSG A;  4QXC B;  4DSG A;  3I3L A;  2BG9 B;  4NXM T;  3ONJ A;  3CND A;  3NTA A;  1IJ5 A;  4JYA T;  5HEO A;  1NEN A;  3CQG B;  3C4Z A;  4H9S E;  5LG4 A;  3AA0 B;  1GRB A;  3CNJ A;  3D0T A;  3WAJ A;  2YOE A;  2BXR A;  3CQX C;  4ADZ A;  1S2Q A;  4H4W A;  2Y6Q A;  5KMS A;  2I6H A;  2H89 A;  2ZM2 A;  2LE8 A;  2XVE A;  2E9X D;  3KLJ A;  2BCG G;  4DR7 T;  3C4N A;  2CCQ A;  3AA7 B;  3PUX F;  2BK5 A;  1BR0 A;  3QK6 A;  2HN2 A;  3N9O A;  3K8P C;  1BZL A;  5L2L A;  3UKA A;  1GRG A;  5JCM A;  1R8I A;  2K9A A;  2D0U A;  2GR3 A;  2QCU A;  3CPZ A;  3OJA A;  3ALM A;  3AE1 A;  5LG3 A;  1KNR A;  4CN6 A;  3U78 A;  3AEB A;  4Q4X 4;  2VKD A;  1IUX A;  1N4W A;  5F3J A;  3LB8 A;  3ONL C;  3OTO T;  5EB5 A;  1IAP A;  2MTQ A;  1WR0 A;  5F5W A;  2YLZ A;  1LPF A;  1D0Z A;  2R07 4;  3RQW A;  4IDO A;  3LJC A;  1AR8 4;  2LT3 A;  5HXC A;  4F8H A;  2LEH A;  1PBC A;  2LHN A;  5AQH B;  3T8O A;  2ZZ0 A;  3SRZ A;  2YDQ A;  3P1W A;  4MHC A;  1R08 4;  2LHR A;  3HA4 A;  1M6I A;  5GON E;  4U8P A;  1FMW A;  2X5I D;  3RHA A;  1CJC A;  2CWY A;  1RUI 4;  2D2S A;  5AQJ B;  1PBB A;  2H3R A;  3AE5 A;  4X65 T;  1NWM X;  2RGJ A;  1SUM B;  2MAW A;  3ESL A;  3L8R A;  2MOZ A;  4WBN E;  2YQU A;  3DJB A;  3N9M A;  3T1H T;  3AEG A;  3KVB A;  1Y56 A;  4O8S A;  2PYX A;  5BVA A;  4IL9 A;  4GIW A;  3VR8 A;  4MBQ A;  2GEW A;  4DGK A;  4YY3 T;  1BGJ A;  4DR2 T;  4C91 A;  3NKS A;  1ASJ 4;  3ZJ2 A;  2EX3 A;  3PUQ A;  2LM2 A;  2FJE A;  3RKG A;  5KNL A;  4GDP A;  3BI2 A;  4Y4M A;  4EXT A;  2EHO D;  3L09 A;  5M0Z A;  4KHZ F;  2JQQ A;  3FXD B;  2R9Z A;  2JB1 A;  2XLS A;  4CI2 B;  3VRA A;  5AQN B;  4CI3 B;  3VKG A;  4DV0 T;  1CC4 A;  2E9X A;  2BS2 A;  3DTO A;  3ALJ A;  2RM2 4;  3AWI A;  3GQK A;  2E4G A;  1KK7 A;  2WHD A;  3VR9 A;  4TWD A;  4GKJ T;  1HG2 A;  4QX7 B;  4EIQ A;  4YXD A;  1H7C A;  4TNW A;  5J2T E;  3MK7 C;  5KRQ A;  4GYS A;  5DJQ C;  1H7X A;  1HR0 T;  3RKO A;  5HEU A;  3QVR A;  2B7S A;  4HFV A;  1F8S A;  4G73 A;  3OYZ A;  3I6D A;  2XLT A;  3JD7 4;  3EF6 A;  4IVM B;  4TWH A;  3NKZ A;  4WYV A;  2ZZC A;  4NWZ A;  4O5U A;  1GV4 A;  3C50 A;  3PJA J;  4LU6 A;  4PFO A;  4FJO A;  4YLH A;  4RSL A;  5LYJ E;  1IJ6 A;  1LVK A;  4AI6 A;  1CJ2 A;  5A1L A;  3FZL B;  5FXV A;  4PK5 A;  5HWX A;  5M10 A;  4CN4 A;  1NHS A;  2Q0K A;  3AA6 B;  4OX9 T;  2IUB A;  2KZ7 B;  2VKH A;  4JUY A;  4BJZ A;  4AKH A;  2UU9 T;  4FX9 A;  2V7K A;  2ACX A;  1REO A;  1DXL A;  2MBG A;  5HEJ A;  3QSS A;  4LII A;  4EMW A;  2GR2 A;  1VRH 4;  1OJC A;  2LOS A;  4B6X A;  4OPI A;  5F8P A;  1ZMD A;  3ITJ A;  3IF8 B;  5JTG A;  4A6N B;  1R09 4;  1IZN B;  4LMJ A;  4U74 A;  1KEY A;  3PUA A;  2PG8 A;  4DR6 T;  3CML A;  4YJ2 E;  4HFD A;  1L9E A;  2BRA A;  2Y6R A;  3BI4 A;  3ZT5 A;  3S61 A;  4Q4W 4;  2H7V C;  4C77 A;  4HKA A;  2KWH A;  2C76 A;  2QVA A;  4H63 V;  1H84 A;  2LFC A;  1YQZ A;  5FS9 A;  3M12 A;  2X0Y A;  1W09 A;  3GA8 A;  4U2L A;  2EHO C;  4IIJ E;  2B76 A;  3CN8 A;  3QB5 A;  3UT5 E;  3KV5 A;  4OPD A;  3PUZ F;  3P4S A;  2ACZ A;  4CQI A;  2UXD T;  2ZZB A;  2W61 A;  4TZ4 C;  4BK1 A;  4UVB B;  3QB5 K;  3QC9 A;  3ZCI A;  3LK2 B;  3FZK B;  3SZ0 A;  4JI2 T;  1ZHC A;  4AKG A;  2Q9Q A;  2J62 A;  4BK2 A;  2E5V A;  4G74 A;  2PZS A;  2CXL A;  5BRT A;  3NN0 X;  1Q1R A;  1CUN A;  3Q6J A;  3SQP A;  3II4 A;  2Q9Q B;  2XJ7 A;  4OYJ A;  2UZZ A;  3J7Y q;  4EYY R;  4ERR A;  4P0A A;  2W2U A;  2NOX A;  3JCF A;  3RI5 A;  3GN5 B;  5J7X A;  3HKB E;  4WCT A;  1E6E A;  2ES0 A;  2YLR A;  4O5Q A;  2CM0 A;  3GYJ A;  4P1N A;  3M13 A;  4AQF A;  2YVG A;  4JQ9 A;  3FZM B;  1D4M 4;  4HB9 A;  5FS6 A;  3COX A;  2XAH B;  5HXH A;  3AED A;  1HS7 A;  3CPJ G;  3RC8 A;  4X64 T;  2X8H A;  3IEE A;  4I43 B;  4JEU B;  5C3J A;  3HYX A;  2E2A A;  2TMD A;  2LRL A;  1KSU A;  4IHJ E;  3DJJ A;  2Q7V A;  2XVJ A;  2NW9 A;  2OA1 A;  3AE4 A;  2JMH A;  2PTF A;  1D0Y A;  2BAC A;  3FMW A;  4B3T T;  1KNP A;  1NHR A;  3N9Q A;  1K0L A;  4EQR A;  5LJN A;  2FJB A;  2UUA T;  3AXJ B;  1VRQ B;  4O4L E;  4H4Z A;  1CF3 A;  3LK3 B;  2PW9 A;  2GR1 A;  4JEH B;  2OLN A;  5ABE A;  2VVL A;  4YSH A;  4U33 A;  3FBS A;  4GF7 A;  1EV1 4;  4O4J E;  3JSK A;  4H4R A;  4JY2 A;  3ADA B;  1Y0P A;  4NPP A;  1DOD A;  1ELI A;  3CPH G;  1WRD A;  2WDR A;  3V3N A;  3CX6 B;  3RX6 A;  3SX6 A;  2W62 A;  2JK6 A;  3J9X 1;  4PAG A;  3G06 A;  5L3E B;  1ZMC A;  4XBF B;  4JI5 T;  4OPT A;  1UGO A;  4II2 A;  3TLW A;  3HKC E;  3DH9 A;  3P7I A;  4PK6 A;  3G5Q A;  4AOS A;  2KSR A;  4QX8 B;  2IAK A;  1XHX A;  2Q9Q D;  4J31 A;  4CCR A;  2OLO A;  3RC3 A;  3EAN A;  4CN1 A;  2IML A;  3ZYL A;  3T37 A;  5JR9 A;  4HA6 A;  3P4W A;  4DUY T;  4MFR A;  4JN9 A;  1JNZ A;  4K0U A;  3DME A;  2CLY B;  5JDQ A;  1Y56 B;  1B5Q A;  4DR4 T;  1FMV A;  4EM3 A;  1NEK A;  1QUU A;  4E7Z A;  4HTE A;  1S3B A;  4OPC A;  5HEH A;  5KVI A;  3E22 E;  1U4Q A;  5FXX A;  2YG4 A;  4EQX A;  3ZLI A;  2BCP A;  2PBI A;  5ABF B;  2RS3 4;  1UX5 A;  2APG A;  2YVF A;  1ZDL A;  2WS3 A;  2B7R A;  4H2Q A;  3UKP A;  5KOX A;  4DV7 T;  5HXE A;  2N2N A;  3RIU C;  2X3N A;  3BNU A;  1GRH A;  3GDN A;  4DSH A;  1KFY A;  2KT9 A;  3I0Q A;  1B37 A;  1QJD A;  1HYU A;  5JRE A;  2VRL A;  1GER A;  3QJ4 A;  3N5L A;  3PVC A;  3JC6 C;  3LBX A;  2QA2 A;  4QWN B;  2L3L A;  1NG4 A;  3F57 A;  2CEA A;  3E08 A;  1HNX T;  3A8Y C;  2BC0 A;  4PAA A;  4LF5 T;  3WE0 A;  2PLV 4;  5LBQ B;  5FMH A;  2AR8 A;  4BJM A;  1RHI 4;  4NZH A;  2RPA A;  1I6Z A;  3GD3 A;  3CVR A;  3F8P A;  4JY3 A;  5TAO A;  4B68 A;  3KPF A;  1VCS A;  3MXZ A;  2M6B A;  2WBA A;  1E1L A;  2X9Y A;  4XXG A;  2NTY A;  1VG9 A;  1SE7 A;  1GQE A;  2XQ4 A;  3FBL A;  4NUU A;  5CGM A;  1FL2 A;  1D4D A;  1E1N A;  3TKL B;  4NNJ A;  2XZE A;  4USQ A;  4H4U A;  2V26 A;  2PYJ A;  2BA9 A;  4GR1 A;  1AJ3 A;  3O1I A;  1XMQ T;  4OYK A;  5EK4 A;  5JDF A;  3RED A;  4IV9 A;  3CQC B;  5LB7 B;  4JI4 T;  3IHR A;  5DAB A;  2X51 A;  5ADX L;  2BG9 E;  5JRC B;  1HNZ T;  5AQG B;  2BZB A;  4TLX A;  1VBB 4;  2WZH A;  4Z2R A;  2XTL A;  3PTR B;  2QYW A;  1UKV G;  3L1R A;  2V6O A;  2R46 A;  2XVF A;  1EL8 A;  2EHO B;  1UK5 A;  2Y8D A;  2VUR A;  3OZ2 A;  3FXE B;  4CBQ A;  2HWB 4;  4IA6 A;  1QLB A;  1GEU A;  4YSX A;  3F8R A;  3D8X A;  1Z8U A;  4KP3 C;  3KDS E;  1RMU 4;  4H2P A;  2R06 4;  2CWO A;  3EDV A;  4EED A;  4ZOL E;  1F3P A;  1TDK A;  2JB3 A;  3P8C D;  4GDE A;  3VRB A;  4WZX A;  5U1O A;  2YAU A;  2BG9 A;  4LF8 T;  2BRY A;  3I1A A;  3A5X A;  3O4X E;  4HWD A;  4AQG A;  5HYA A;  4IL4 A;  3T31 A;  4MLK A;  3BQK A;  4IE4 A;  2V3B A;  3MAC A;  2BXS A;  1GSN A;  2E9X C;  3H37 A;  4D03 A;  2YU1 A;  4ISS A;  5KMR A;  1PXA A;  4Y4L A;  4YWO A;  2M6I A;  4KX6 A;  1PXB A;  4U7I A;  3I0O A;  2C5I T;  3K30 A;  4B65 A;  1V59 A;  3F8D A;  2R4E A;  4TUY E;  3Q5D A;  5FY0 A;  4GYR A;  1L9D A;  2VL8 A;  3PS9 A;  4AIU A;  4GB3 4;  2GQF A;  3GMB A;  2KIN B;  4EGW A;  1LTX R;  3PUG A;  1VDC A;  2GVC A;  2A89 A;  1RUG 4;  1PIV 4;  4B3S T;  1GRA A;  1YKH B;  1PJ5 A;  2L9Q A;  3RYI E;  2WWV A;  1KNZ A;  4U2T A;  1PO2 4;  4H2N A;  3OKQ A;  3NTD A;  2LRK A;  3QSM A;  2XY8 B;  3AYI A;  4ZCC A;  2HPL A;  2E8I A;  4DNA A;  5JCK A;  1MMA A;  1PS9 A;  1F6M A;  2YK0 A;  5FKY A;  4EIW A;  3T14 A;  3HI2 A;  2FUP A;  1AL2 4;  2DLR A;  3AAE B;  4IE0 A;  4GKK T;  1J5E T;  5ER0 A;  1XHC A;  2EQ8 A;  3EUH A;  3AD8 B;  3P50 A;  4ZEY A;  2XAQ B;  2WPF A;  2IVD A;  3HZL A;  4UV8 B;  1SHZ C;  4Y4N A;  4OFZ A;  2OAM A;  3RYC E;  1D1B A;  3GWH A;  2C4C A;  3V3O A;  3ZMV B;  3C51 A;  2WOW A;  3VRD B;  1S94 A;  1YQ4 A;  1MMN A;  4DID B;  3KV6 A;  4GK5 E;  2YDS A;  4BAY B;  4L0R A;  3PU3 A;  2V7I A;  2XLP A;  2QRX A;  3NWI A;  5HEG A;  2KND A;  4KI0 F;  4EM4 A;  3O0H A;  3JAE A;  4UR9 A;  3CGE A;  3UTK A;  1N4V A;  1E7P A;  2JKC A;  3KVE A;  2RAB A;  5KWF A;  2CA5 A;  5LHI B;  3P4Q A;  3UKL A;  5JCN A;  2J4G A;  2R4J A;  5EBK A;  2XM2 A;  2CHN A;  3MKD A;  3LG7 A;  3AEC A;  3IHG A;  3V76 A;  1L0V A;  3DP7 A;  1HNW T;  1OJD A;  4B3M T;  3DK8 A;  3NLC A;  5U63 A;  2R7F A;  1HX8 A;  5ETW A;  5FNV E;  1T98 A;  3AE2 A;  4DMW A;  4LMK A;  4OPL A;  3FG2 P;  3UOZ A;  2YWL A;  1GET A;  1OED B;  4C3X A;  2WAU A;  3NYF A;  1XZY A;  3UUL A;  4CY6 A;  1D7L A;  2W66 A;  1HF8 A;  2BKO A;  4O4I E;  2C5J A;  3EHZ A;  3DGZ A;  3KIN B;  2C73 A;  2WP5 A;  1Z7S 4;  5IQ1 A;  2G0U A;  4NTE A;  3Q5E A;  1IJH A;  5BMV E;  4AQF C;  4WNK A;  4TN7 B;  4EAH A;  2KMF A;  3GMC A;  4A9W A;  3R84 B;  3GMI A;  3G5S A;  2RGH A;  4AT2 A;  3O9X A;  2PYL A;  3AE8 A;  1CC6 A;  3RGL A;  3C98 B;  3B57 A;  2PFV A;  3IBP A;  4DV2 T;  1HXS 4;  2X8C A;  2BVM A;  5FVL A;  1FEB A;  3HYV A;  3UFE A;  1WFD A;  5IYZ E;  2XCG A;  4A7A A;  1T8B A;  2C75 A;  2YLX A;  2ZMA A;  4PFP A;  4DO0 A;  2WOI A;  3EAO A;  1AR7 4;  4ZI7 E;  4ILB A;  1D1C A;  3ZMS B;  1JOA A;  3SY4 A;  4EQS A;  1W4X A;  2VAS A;  5LGN B;  2MPK A;  3PUW F;  1ZEE A;  1H8T D;  1COY A;  2X68 A;  3ZSS A;  3NH3 X;  2CXD A;  1N36 T;  4H4T A;  3UTH A;  1Z0P A;  4Z24 A;  2LJL A;  1AOG A;  4DUZ T;  2YU2 A;  2V3A A;  5BUL A;  5HYM A;  4ZHQ E;  1COV 4;  4CXY A;  4ANJ A;  3EDU A;  3P4R A;  2JPF A;  3FHN A;  2A8X A;  4H2R A;  4OPU A;  1K5M D;  3FPZ A;  5DQV A;  5ABG A;  4TM1 A;  5KXJ A;  2WM9 A;  3VKH A;  4H4S A;  3B3R A;  1XNQ T;  3BHF A;  4HFI A;  2CVJ A;  1YKJ A;  2YG5 A;  3AA1 B;  3C4X A;  4HWC A;  5M4Y A;  4Z26 A;  2WOV A;  2X8G A;  4QH1 A;  3ZT6 A;  4LML A;  1D0X A;  4TV9 E;  1PVC 4;  2IVE A;  2VZ2 A;  2BC1 A;  1LQT A; 
#chains in the Genus database with same CATH homology
 1KNP A;  3AEF A;  1JRZ A;  1K0L A;  1NHR A;  4EQR A;  5HY5 A;  3RNM A;  4YTN A;  2FJB A;  1VRQ B;  4H4Z A;  4B63 A;  4G9K A;  1CF3 A;  2GR1 A;  3SXI A;  2GMJ A;  1P2E A;  3RP6 A;  4AT0 A;  1N1P A;  2OLN A;  4TM3 A;  2VVL A;  4OCG A;  4YSH A;  1ZKQ A;  1DJQ A;  1OJ9 A;  3FBS A;  4GF7 A;  3AE7 A;  3JSK A;  4H4R A;  5EOW A;  3ZDN A;  3LZW A;  1CJ4 A;  1B8S A;  2C66 A;  1CBO A;  3ADA B;  4JY2 A;  1JRX A;  1Y0P A;  2V5Z A;  1DOD A;  1ELI A;  1O94 A;  1ZOV A;  2A87 A;  2YM1 A;  2F5Z A;  4YSY A;  3CPH G;  3ICR A;  4GRT A;  2WDR A;  1D4C A;  4B66 A;  3V3N A;  3SX6 A;  3PO7 A;  1E1M A;  4EMI A;  1GOS A;  4BJY A;  4APN A;  3SZW A;  2JK6 A;  5JCI A;  3AE3 A;  2Z5Y A;  3H4K A;  3DA1 A;  1ZMC A;  4OPT A;  4II2 A;  2AAQ A;  3CIR A;  1EBD A;  4II3 A;  2J3N A;  2XFU A;  3DH9 A;  2WQY A;  4UDQ A;  3G5Q A;  3IC9 A;  3T2Z A;  4ECH A;  1D7Y A;  4FK1 C;  4AOS A;  1IUT A;  3CGC A;  3GDP A;  4U8M A;  4EIP A;  3CNP A;  4J31 A;  4A99 A;  2OLO A;  3NIX A;  4CCR A;  4Z2T A;  1IUV A;  4CY8 A;  3EAN A;  1CL0 A;  4E0V A;  1PBE A;  4K5S A;  2JAE A;  2XLU A;  2WET A;  4NTC A;  3UP4 A;  4H4P A;  4Z44 A;  1EL7 A;  3T37 A;  2YG6 A;  4A6N A;  5GSN A;  4HA6 A;  4AP1 A;  1MXT A;  2QA1 A;  2HQM A;  3UOY A;  1BGN A;  3SZC A;  1JNR A;  4JN9 A;  4ZCD A;  2VQB A;  1JNZ A;  4B64 A;  3L8K A;  3DME A;  2IID A;  2VVL G;  4NEV A;  4H4Q A;  1Y56 B;  1B5Q A;  4J56 A;  1TDN A;  3RP8 A;  4WX1 A;  1XDI A;  3E1T A;  4EM3 A;  1NEK A;  2YLW A;  4U8J A;  4ZN0 A;  3KA7 A;  2XVI A;  2WPE A;  3NRN A;  1DJN A;  5KOW A;  3GYX A;  3UKK A;  1S3B A;  1BF3 A;  4OPC A;  2WDV A;  1PDH A;  3NT6 A;  4U8K A;  5KVI A;  3T2K A;  2WPC A;  3AXB A;  3LJP A;  4M52 A;  4YKG A;  2BS3 A;  1ZP0 A;  2YG4 A;  3UCL A;  4B67 A;  1FCD A;  1GPE A;  3UKH A;  1K4Q A;  4JNQ A;  4EQX A;  3GD4 A;  3NYC A;  1SEZ A;  4REK A;  2FJA A;  2BCP A;  4FK1 A;  3NYE A;  3C96 A;  3H8L A;  2APG A;  2YVF A;  3ATQ A;  1Q1W A;  2NVK X;  2W0H A;  1ZDL A;  2WS3 A;  4NEW A;  1PBF A;  3IWA A;  4U8O A;  2GR0 A;  2ZBW A;  3H8I A;  2B7R A;  4H2Q A;  1BKW A;  3UKP A;  5KOX A;  3UP5 A;  3SM8 A;  4USR A;  3KU9 A;  2X3N A;  3BNU A;  1GRH A;  2PHH A;  2VVM A;  3GDN A;  4K5R A;  1KFY A;  4DSH A;  4J36 A;  4UDP A;  1PBD A;  1B37 A;  1DNC A;  1QJD A;  4J34 A;  2XLR A;  5U25 A;  1DOB A;  1HYU A;  1O5W A;  2EQ7 A;  2YR4 A;  4A79 A;  2VRL A;  4GUV A;  4P9S A;  1GER A;  3QJ4 A;  1MO9 A;  4C74 A;  1XPQ A;  3PVC A;  2EQ6 A;  1PJ7 A;  3CTY A;  4XWR A;  3DK9 A;  2QA2 A;  5FS7 A;  3CGB A;  1NG4 A;  2X50 A;  3GYI A;  2YLT A;  2XFQ A;  1XAN A;  3NNE A;  2BC0 A;  2XYO A;  4PAA A;  3LXD A;  2C67 A;  3LZX A;  3NG7 X;  3WE0 A;  4K2X A;  4Z25 A;  4K7Z A;  2R0C A;  2WU2 A;  4XWZ A;  5FMH A;  2AR8 A;  2DKI A;  2Q0L A;  3NK1 X;  4RG4 A;  4DSG A;  4H4X A;  4NZH A;  4C5O A;  3I3L A;  4UDR A;  4A5L A;  3NN6 X;  1CC2 A;  1RP0 A;  1NPX A;  3CND A;  3CMM A;  3GD3 A;  1LVL A;  3F8P A;  3NTA A;  3AE9 A;  2WU5 A;  1NEN A;  1E39 A;  1TYT A;  1TYP A;  4JY3 A;  3URH A;  1GRB A;  3CNJ A;  3KPF A;  4B68 A;  1EL9 A;  3OC4 A;  2WBA A;  1E1L A;  3P4P A;  2BXR A;  2GMH A;  3DJG X;  2XFN A;  4XXG A;  3D1C A;  3AEA A;  1S2Q A;  2GH5 A;  1VG9 A;  4H4W A;  2Y6Q A;  2CUL A;  1KSS A;  1FL2 A;  4H4V A;  4UP3 A;  5KMS A;  4ADW A;  1D4D A;  5L46 A;  2H89 A;  1E1N A;  4NNJ A;  4USQ A;  4H4U A;  2BA9 A;  3C4A A;  5HHF A;  4GR1 A;  3SGL A;  2XVE A;  3DK4 A;  4YTM A;  1H81 A;  4B1B A;  4GAV A;  3KLJ A;  1GXF A;  3RED A;  1TDO A;  4IV9 A;  2CDU A;  2BCG G;  2DKH A;  2O9Z A;  3C4N A;  2Q6U A;  2BK5 A;  4OVI A;  3GSI A;  1GTE A;  2B9W A;  2C72 A;  3GRT A;  1PJ6 A;  4U8N A;  1BZL A;  3UKA A;  5JCM A;  1GRG A;  3CGD A;  1E1K A;  1IUU A;  3CNS A;  4NTD A;  1ZX9 A;  2GR3 A;  2QCU A;  3ALM A;  3AE1 A;  4J33 A;  1KNR A;  3P9U A;  3EPT A;  4TLX A;  4Z2R A;  1IUW A;  1LV0 A;  2C7G A;  1UKV G;  3AEB A;  1GT8 A;  3L1R A;  2QAE A;  2V6O A;  2R46 A;  2XVF A;  4U8L A;  1IUX A;  1N4W A;  1D5T A;  1EL8 A;  2C3D A;  1PXC A;  5IQ4 A;  3LB8 A;  5HXI A;  3OZ2 A;  5EB5 A;  3VQR A;  1NAA A;  4CBQ A;  4RG3 A;  2YLS A;  3QFB A;  4IA6 A;  4C3Y A;  1QLB A;  1GEU A;  3QVP A;  3IF9 A;  3KD9 A;  2YLZ A;  1LPF A;  4YSX A;  3F8R A;  2FBW A;  3D8X A;  3RP7 A;  3SYI A;  1GRE A;  1H7W A;  1PBC A;  4H2P A;  4AP3 A;  2ZZ0 A;  2JB2 A;  1TDK A;  1F3P A;  4CNK A;  2JB3 A;  4GDE A;  3P1W A;  3VRB A;  4JDR A;  1NG3 A;  5U1O A;  3S5W A;  2YAU A;  2BRY A;  1M6I A;  2YG7 A;  2YM2 A;  4U8P A;  3RHA A;  2YG3 A;  2C3C A;  1CJC A;  3T31 A;  1H86 A;  1PBB A;  3B6D A;  3AEE A;  2BK3 A;  3AE5 A;  2CFY A;  2V3B A;  2VRM A;  2WDQ A;  2BXS A;  2RGJ A;  5IPY A;  1GSN A;  5BUK A;  5TR3 A;  4D03 A;  5KMR A;  3UKF A;  2WEU A;  1PXA A;  2OAL A;  5FS8 A;  3UKQ A;  4Y4L A;  4YWO A;  2YQU A;  2TPR A;  2GRT A;  5CQF A;  3AEG A;  2PYX A;  1Y56 A;  4KX6 A;  5BVA A;  1PXB A;  4JNA A;  3K30 A;  3VR8 A;  3T2Y A;  4Z43 A;  4B65 A;  1V59 A;  3AYJ A;  2GEW A;  3F8D A;  2R4E A;  3R9U A;  4DGK A;  2BK4 A;  1YQ3 A;  1BGJ A;  1KF6 A;  4CRT A;  3SUC A;  3NKS A;  4MJW A;  1BWC A;  5KNL A;  2FJE A;  1L9D A;  3PS9 A;  5C2T A;  2XFP A;  4H4Y A;  4GDP A;  5JCL A;  5GRT A;  2GQF A;  3BI2 A;  4Y4M A;  2XVH A;  3GMB A;  3AB1 A;  1GRF A;  1KDG A;  1LTX R;  2EQ9 A;  4TM0 A;  1VDC A;  2GVC A;  2A89 A;  5M0Z A;  4K22 A;  1VQW A;  2R9Z A;  1GRA A;  5CKU A;  2JB1 A;  2YR5 A;  2XLS A;  3LAD A;  3VRA A;  1PJ5 A;  3ALL A;  3M0O A;  1B4V A;  4U2T A;  4I59 A;  4YSZ A;  1CC4 A;  2BS2 A;  4H2N A;  3ALJ A;  3NTD A;  3UTF A;  2C65 A;  1LJ1 A;  3QSM A;  4X9M A;  3AWI A;  2JBV A;  3AYI A;  4ZCC A;  4N9X A;  3GQK A;  2E4G A;  4GAP A;  4J2W A;  3DJD A;  4DNA A;  5JCK A;  1PS9 A;  1F6M A;  2WHD A;  1ZK7 A;  3VR9 A;  2XDO A;  3AD9 B;  3K7Q X;  3KKJ A;  1TDF A;  3T14 A;  2VQ7 A;  1F8W A;  2Z5X A;  1RYI A;  3QFA A;  4EIQ A;  4YXD A;  1CHU A;  2H88 A;  4FDC B;  4TM4 A;  2E1M A;  1OJA A;  5KRQ A;  2XFO A;  3BNM A;  1H7X A;  3UTE A;  5ER0 A;  2V60 A;  1XHC A;  1ZOY A;  2BS4 A;  2EQ8 A;  2V61 A;  3AD8 B;  3ICT A;  3K7M X;  4X9N A;  3QVR A;  2WPF A;  2R45 A;  2IVD A;  3HZL A;  2B7S A;  1F8S A;  4G73 A;  2VOU A;  3UOX A;  3I6D A;  4Y4N A;  2I0Z A;  2XLT A;  3EF6 A;  4IVM B;  2OAM A;  1MOK A;  3IHM A;  5EB4 A;  2ZZC A;  5KMQ A;  5KVH A;  1L9C A;  4D04 A;  4NWZ A;  2GQW A;  2FJD A;  2C4C A;  1ZY8 A;  4O5U A;  4YKF A;  3V3O A;  4AOX A;  1GV4 A;  4IVO B;  2WOW A;  4LU6 A;  4B69 A;  2YVJ A;  1DOE A;  2YR6 A;  4OPG A;  3VRD B;  4RSL A;  1YQ4 A;  1IUS A;  1CJ2 A;  1NHQ A;  4K8D A;  5M10 A;  1NHS A;  2GV8 A;  4EQW A;  4GCM A;  2XLP A;  1YY5 A;  2WES A;  2GB0 A;  1GRT A;  2Q0K A;  3UTG A;  3ATR A;  4ICY A;  1Q9I A;  4BJZ A;  4EM4 A;  3O0H A;  4FX9 A;  1DOC A;  3CGE A;  1REO A;  4IA5 A;  1N4V A;  1PHH A;  1DXL A;  4LA1 A;  1E7P A;  2JKC A;  3KVE A;  4LII A;  3QSS A;  4EMW A;  2GR2 A;  2RAB A;  5KWF A;  5JCN A;  3P4Q A;  3SFD A;  1OJC A;  3UKL A;  1PN0 A;  1TRB A;  1FEA A;  2R4J A;  3GWD A;  5EBK A;  4OPI A;  1ZMD A;  5J60 A;  3ITJ A;  1JRY A;  3AEC A;  4A6N B;  3IHG A;  3V76 A;  4PAB A;  1L0V A;  2WP6 A;  1OJD A;  4YT0 A;  3DK8 A;  3NLC A;  5U63 A;  4X4J A;  1S2Y A;  4BK3 A;  3GQH A;  2C64 A;  1NHP A;  2BRA A;  1L9E A;  1GAL A;  3AE2 A;  1FOH A;  1K0I A;  4OPL A;  2Y6R A;  3BI4 A;  1GND A;  3NGC X;  3FG2 P;  3NHO X;  3S61 A;  3UOZ A;  4C77 A;  2YWL A;  3NK2 X;  3BHK A;  1GET A;  4C3X A;  2C76 A;  2B9Y A;  3NYF A;  1H84 A;  1ONF A;  2LFC A;  4CY6 A;  3AYL A;  1D7L A;  1YQZ A;  5FS9 A;  3M12 A;  3GWF A;  2GAG B;  4U2L A;  4EMJ A;  3Q9T A;  4H50 A;  1P2H A;  3DGZ A;  3CN8 A;  2B76 A;  2WP5 A;  2C73 A;  5IQ1 A;  1JU2 A;  1M64 A;  3AD7 B;  4NTE A;  4OPD A;  4U2S A;  1IJH A;  3P4S A;  2ACZ A;  1H82 A;  3BI5 A;  4CNJ A;  1VG0 A;  1K0J A;  5KMP A;  4H7U A;  3GMC A;  4A9W A;  2ZZB A;  4BK1 A;  3ZYX A;  3G5S A;  2RGH A;  3SZ0 A;  4J57 A;  4AT2 A;  4U8I A;  3AE8 A;  1CC6 A;  2C70 A;  3QSE A;  4BK2 A;  2E5V A;  1LQU A;  4G6G A;  4G74 A;  2WP9 A;  2X8C A;  3ICS A;  4CCQ A;  1D4E A;  5BRT A;  1FEB A;  3NN0 X;  1Q1R A;  3SQP A;  3HYV A;  3Q6J A;  3HYW A;  1S3E A;  2ARD A;  2XCG A;  5LV9 A;  4A7A A;  3II4 A;  3NK0 X;  2UZZ A;  2C75 A;  2RGO A;  1X31 B;  2GAH B;  2YLX A;  4BV6 A;  1EL5 A;  2WOI A;  3ABV A;  3EAO A;  5DBJ A;  4G6H A;  1JOA A;  3ISH A;  2R0G A;  2B9X A;  3SY4 A;  1W4X A;  4EQS A;  1CJ3 A;  1GTH A;  3DGH A;  4TLZ A;  2AQJ A;  3K7T A;  1RSG A;  3LOV A;  5J7X A;  4WCT A;  4I58 A;  1COY A;  1E6E A;  3NH3 X;  2YLR A;  4O5Q A;  3GRS A;  3KPK A;  3GYJ A;  2GF3 A;  1F8R A;  4Z2U A;  4H4T A;  3UTH A;  1O95 A;  4YTP A;  3FIM B;  2R0P A;  4Z24 A;  3M13 A;  1QO8 A;  1AOG A;  2YVG A;  2V3A A;  4JQ9 A;  1NDA A;  5BUL A;  4HB9 A;  5FS6 A;  5HYM A;  4A65 A;  3COX A;  3G5R A;  3P4R A;  1JEH A;  2A8X A;  4KPR A;  4H2R A;  3AED A;  3CPI G;  4OPU A;  3CPJ G;  1GES A;  4BUR A;  3FPZ A;  2X8H A;  4TM1 A;  1FEC A;  5KXJ A;  4H4S A;  3B3R A;  3AE6 A;  1H83 A;  2BYB A;  3BHF A;  1Z6L A;  5C3J A;  2CVJ A;  1H6V A;  1YKJ A;  2YG5 A;  3CNT A;  3UOV A;  3HYX A;  1OJT A;  2TMD A;  2X99 A;  1KSU A;  4Z26 A;  1TDE A;  3DJJ A;  2Q7V A;  3T0K A;  2WOV A;  2XVJ A;  2OA1 A;  3AE4 A;  1N4U A;  2X8G A;  2NPX A;  3DJE A;  3SZF A;  2BAC A;  2IVE A;  2VZ2 A;  2BAB A;  3SFE A;  3FMW A;  2BC1 A;  1LQT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...