3VRBA

Mitochondrial rhodoquinol-fumarate reductase from the parasitic nematode ascaris suum with the specific inhibitor flutolanil and substrate fumarate
Total Genus 196
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
196
sequence length
613
structure length
613
Chain Sequence
AQYKVIDHAYDVVIIGAGGAGLRAAMGLGEAGFKTAVVTKMFPTRSHTTAAQGGINAALGSMNPDDWKWHFYDTAKGSDWLGDQNAMHYLTRNAVEAVTELENFGMPFSRTPEGKIYQRSFGGQSNNYGKGGVAKRTCCVADRTGHSMLHTLYGNSLRCHCTFFIEYFALDLLMDKGRCVGVIALCLEDGTIHRFRSKRTIVATGGYGRAYFSCTTAHMNTGDGTALATRAGIALEDLEFIQFHPTGIYGVGCLITEGSRGEGGFLVNSEGERFMERYAPKAKDLASRDVVSRAETIEIMEGRGVGPEKDHIYLQLHHLPAEQLHQRLPGISETAKIFAGVDVTKEPIPVIPTVHYNMGGIPTNYKAQVIKYTKEGGDKIVPGLYACGECACHSVHGANRLGANSLLDAVVFGRACSINIKEELKPDEKIPELPEGAGEESIANLDAVRYANGDVPTAELRLTMQKTMQKHAGVFRRGDILAEGVKKMMDLSKELKRLKTTDRSLIWNSDLTESLELQNLMLNATQTIVAAENRKESRGAHARDDFPKREDEYDYSKPIEGQTKRPFEKHWRKHTLTKQDPRTGHITLDYRPVIDKTLDPAEVDWIPPIIRSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Flavoprotein subunit of complex II
publication title Crystal structure of mitochondrial quinol-fumarate reductase from the parasitic nematode Ascaris suum
pubmed doi rcsb
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 196
structure length 613
sequence length 613
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00890 FAD_binding_2 FAD binding domain
A PF02910 Succ_DH_flav_C Fumarate reductase flavoprotein C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.100 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Fumarate reductase/succinate dehydrogenase flavoprotein-like, C-terminal domain 3vrbA03
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 3vrbA01
3.90.700.10 Alpha Beta Alpha-Beta Complex Flavocytochrome C3; Chain A, domain 1 Succinate dehydrogenase/fumarate reductase flavoprotein, catalytic domain 3vrbA02
4.10.80.40 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 succinate dehydrogenase protein domain 3vrbA04
4TM0A 3QVRA 1KNPA 1PS9A 3NTDA 3I6DA 3EAOA 3NK2X 4IVOB 4LA1A 3T37A 3UOXA 1KSUA 1GEUA 3UOYA 2B76A 4JN9A 1D4EA 1L0VA 4BJYA 3P4QA 1GTEA 2QCUA 3NHOX 3UKLA 4X9NA 1NENA 4JNQA 2VVMA 4NTDA 5JCNA 1DJNA 1DXLA 4NEVA 1PBEA 5ER0A 3CNDA 3CGDA 3KPFA 4TLZA 1MOKA 3H8LA 2WPEA 4C5OA 3P1WA 5FMHA 1S2QA 3RP7A 3BHFA 1E1KA 3VRDB 3AE2A 3AE5A 2JKCA 2X50A 5LV9A 1NHRA 3D1CA 4JDRA 1ZMDA 1PDHA 3DJJA 5HHFA 1D4CA 2V6OA 2VRMA 2OALA 1XPQA 4RG3A 3F8RA 4TM1A 1PJ5A 3CIRA 3KLJA 3UP4A 3B6DA 4H4ZA 3GRSA 2EQ7A 2YLZA 3S61A 2GQWA 2WOWA 1JNRA 2B9YA 3I3LA 1E6EA 2XCGA 3VR8A 3H4KA 3GMBA 2E5VA 1B8SA 1UKVG 3CNPA 1NHPA 3UTFA 2WU2A 1YQZA 3AE6A 5KOWA 3M12A 2OAMA 3REDA 4CCQA 4TM3A 4X4JA 1VDCA 1RSGA 1TDFA 4REKA 4K5SA 4IA5A 2XLPA 2W0HA 4I59A 5J7XA 3GYIA 2YVFA 3AEEA 3JSKA 2XVFA 3K7TA 2BK3A 2Q7VA 4LU6A 5EB4A 2FJAA 4H50A 4APNA 2UZZA 3P4SA 3KD9A 4U8MA 4YSZA 2Q0KA 1Y0PA 1N1PA 2Q6UA 3ALLA 4EQXA 1GNDA 3M0OA 1Q1RA 3SFEA 2XFUA 3UKPA 1GREA 1K0JA 2Q0LA 3GMCA 4K5RA 3K30A 5HY5A 1MXTA 4A65A 3M13A 2GR1A 1HYUA 2YAUA 1CC6A 5FS7A 4FK1C 3ZDNA 1D5TA 2WP5A 1SEZA 1MO9A 4YKFA 1GRTA 4I58A 2RABA 4X9MA 1GPEA 2ACZA 1H6VA 2GRTA 2VOUA 3BNUA 3IC9A 3DGHA 3SFDA 2X3NA 1PBDA 1PXAA 2EQ6A 1DNCA 4J57A 4JNAA 4YSHA 4IVMB 3UKFA 2EQ8A 1XANA 4USRA 4YTNA 1OJCA 4H4TA 4O5QA 3UKQA 4Y4LA 1LQUA 4YSYA 3GWFA 3RP8A 3FG2P 4YTPA 3LZWA 1ZMCA 5HXIA 2YWLA 3SQPA 5KWFA 4XXGA 2WOIA 3AEBA 2GR2A 4JQ9A 3NYFA 4Z43A 3LADA 2HQMA 4PAAA 2XVJA 1Z6LA 3Q9TA 1GXFA 4RG4A 2BS2A 5U1OA 2YM2A 3B3RA 4CBQA 3PVCA 5BRTA 3LXDA 3F8DA 3DJDA 5KXJA 2Y6RA 4PABA 3ABVA 3RNMA 1S2YA 1YY5A 1H81A 2BA9A 2WPFA 2XVEA 1FEBA 1OJDA 3P4RA 3DA1A 4H4UA 3UKAA 2VQBA 4NTCA 3V76A 4CY6A 2XVIA 1BZLA 1F8SA 1DJQA 2ZBWA 2V5ZA 1CC2A 2C73A 4OCGA 4OPUA 2IVDA 4DSHA 1JRYA 2C7GA 2V60A 2TMDA 1COYA 3AXBA 1ZY8A 4Y4NA 4H4VA 3QSMA 2AAQA 4OPGA 5KVIA 3IHGA 4OPLA 1YKJA 2WOVA 1ZDLA 2QAEA 3BI4A 3AEFA 3QFAA 4WCTA 3URHA 2BACA 2R45A 3NN0X 4OVIA 4YSXA 1M6IA 1GTHA 3L8KA 4AOSA 3KVEA 5BULA 3GQHA 2YG7A 2ARDA 4J33A 3KA7A 3KU9A 3AE7A 1FOHA 1B5QA 3GDPA 2R0GA 2XFNA 2YG6A 1PXBA 4GRTA 1LTXR 4YT0A 3DJEA 1CBOA 2O9ZA 5BVAA 2FBWA 2OLOA 2F5ZA 2V3BA 4A6NB 3PS9A 3AB1A 1GRBA 2BK4A 1K0IA 1D4DA 2OA1A 2YLTA 1ZX9A 2YLSA 3HZLA 3SM8A 2XLRA 1AOGA 1GETA 1BGJA 2C66A 2ZZ0A 2GR3A 4Z44A 1NPXA 1PBFA 1DOCA 4B63A 1CF3A 3AE3A 1VG0A 3QSEA 5U25A 2WHDA 1F6MA 2RGJA 2V61A 2WDVA 2YVGA 4U8IA 3H8IA 4NZHA 2A89A 1LJ1A 2WP9A 1JOAA 2WDQA 3UCLA 1CJ3A 3DMEA 3QSSA 1TDNA 1W4XA 2XLSA 3AEGA 2VVLA 3G5QA 1BGNA 5BUKA 1CL0A 2BABA 4K22A 2BCGG 5CKUA 5CQFA 4C77A 2WU5A 5JCMA 2DKHA 4U8NA 3AD9B 3NYCA 4EMWA 4BK1A 3LOVA 2Y6QA 3CNSA 4H4RA 1N4WA 3FIMB 4K7ZA 3P4PA 3ATQA 5C2TA 3IHMA 4ADWA 3IWAA 4EQSA 4DSGA 3UTGA 1V59A 2GR0A 2XVHA 1CJ2A 2R46A 3NH3X 3NK1X 2FJDA 1GRHA 2BK5A 4GR1A 3GQKA 5DBJA 5L46A 1GESA 3BI5A 1K4QA 1TYTA 2WESA 3NN6X 2GAHB 4B1BA 1S3BA 3EPTA 4YKGA 3Q6JA 5GSNA 2NVKX 3ICTA 3VR9A 2BCPA 2CVJA 2B9WA 2X8GA 3OC4A 5HYMA 5JCIA 2R9ZA 4E0VA 3C96A 1H83A 2X8CA 1IUVA 3CNJA 3GDNA 1N4VA 3BNMA 4FX9A 2EQ9A 4U8LA 1RYIA 2BYBA 5C3JA 2CDUA 1RP0A 3G5RA 5U63A 3ICRA 2JB2A 1H82A 1Y56B 4J34A 1OJ9A 1Q1WA 2XFQA 1O95A 1P2EA 2C75A 4LIIA 4OPTA 4B64A 2GEWA 4UP3A 1PBBA 1PHHA 4JY3A 1D7LA 4A99A 1E1LA 3ITJA 5FS8A 1NEKA 1PJ6A 2RGOA 1OJAA 2C64A 2XLTA 2WEUA 4EQWA 4N9XA 4BJZA 2E1MA 2OLNA 4FDCB 4NEWA 2VVLG 3UP5A 4A6NA 2R4JA 1N4UA 3FPZA 3NNEA 2JAEA 4AP1A 3CGBA 2GAGB 1D7YA 5EOWA 4K2XA 4KX6A 1QO8A 3II4A 2GB0A 2GVCA 3EANA 1EBDA 4ZN0A 1ZP0A 1CC4A 3SGLA 3DK8A 1DOEA 1LV0A 1TDOA 4Z2RA 3C4AA 1BF3A 3GSIA 3CNTA 1KF6A 1E39A 1BKWA 3AWIA 1L9CA 3NT6A 4RSLA 2JK6A 3NGCX 2GF3A 3D8XA 4IA6A 1PJ7A 3IF9A 3ADAB 1XHCA 2QA2A 2GH5A 4TLXA 2YLWA 4CY8A 4B67A 1IUWA 3NG7X 2A8XA 4CNJA 4O5UA 5IPYA 2YVJA 4CNKA 4A79A 3UTHA 2B7SA 1H84A 2YLRA 4GDEA 1CJCA 3GD4A 4GF7A 2E4GA 1OJTA 2YM1A 3LZXA 1IUSA 1LVLA 4HA6A 4J31A 3CN8A 1S3EA 1REOA 5FS9A 4A5LA 1QLBA 2GMHA 4M52A 4USQA 3VRAA 4XWRA 1TDEA 3QVPA 1TRBA 2R0PA 2IIDA 4DNAA 2C67A 2QA1A 3UOZA 1GOSA 4GUVA 3WE0A 2WPCA 3GRTA 3AYIA 2J3NA 4UDPA 1FEAA 4J2WA 3E1TA 4D03A 3DK9A 2JBVA 3GYXA 2YR5A 1Y56A 1GERA 2NPXA 3GWDA 3NLCA 1F3PA 2C76A 1ONFA 2JB3A 3C4NA 3OZ2A 5J60A 4U8KA 2JB1A 1CHUA 1FECA 1BWCA 3ALMA 2WS3A 5JCKA 1O94A 3CPJG 3LB8A 3ATRA 1CJ4A 2BS4A 1H7WA 4Y4MA 4B66A 3ICSA 2PYXA 2BS3A 4BV6A 1E7PA 2Z5YA 3K7QX 1JRZA 4A7AA 1ZK7A 3BHKA 1L9EA 4C74A 2C3CA 1O5WA 3CPHG 3AE4A 4JY2A 4C3YA 5M0ZA 1K0LA 1IJHA 4P9SA 4J56A 3SUCA 3AEAA 4ZCDA 1DODA 2WDRA 1KSSA 3QJ4A 4GCMA 2AQJA 4EIQA 4YWOA 5GRTA 4BK3A 4OPDA 3VQRA 2YG5A 3DK4A 4H2QA 4EMJA 4WX1A 4B68A 2RGHA 2BXSA 2YG3A 1L9DA 3CPIG 4XWZA 4Z26A 1B37A 5M10A 4U2TA 3BI2A 1H86A 1VQWA 1GRGA 2C3DA 2DKIA 3UOVA 4EQRA 2R4EA 2YR4A 3COXA 3LJPA 2VZ2A 1NDAA 4Z2TA 3NK0X 4OPIA 2BC0A 2XFOA 1PN0A 4OPCA 4H2RA 1NG4A 3FMWA 3NRNA 2CFYA 4U2LA 4B69A 4C3XA 1JU2A 3ALJA 2C72A 4GDPA 2YQUA 2GQFA 4H2PA 4YXDA 3NKSA 4DGKA 3AE9A 3DGZA 1E1MA 3NIXA 1KFYA 3AE8A 1Q9IA 1ZKQA 3DH9A 3ZYXA 4H7UA 1F8RA 4J36A 1GV4A 1QJDA 4EM4A 4ECHA 2H88A 2YR6A 2IVEA 1GT8A 1KDGA 2CULA 1JEHA 3L1RA 2BC1A 1DOBA 1EL9A 4H4XA 3S5WA 2FJBA 4U8PA 3O0HA 4U8OA 4AP3A 2WBAA 4K8DA 5KOXA 3FBSA 4U2SA 4BK2A 1IUUA 1JNZA 3NTAA 2XDOA 3RHAA 2V3AA 2H89A 4EIPA 4ICYA 4Z25A 3ISHA 5EB5A 4HB9A 3AECA 3UTEA 5IQ4A 1M64A 4UDRA 1GRFA 2A87A 3G5SA 4Z2UA 1XDIA 3AYJA 3AE1A 2VQ7A 2XFPA 4D04A 3CGEA 2GMJA 3UKKA 5JCLA 2R0CA 2B9XA 2YLXA 4IV9A 3QFBA 2B7RA 4H4YA 1TDKA 3AD7B 4CRTA 1ZOVA 2YG4A 3V3OA 1NHSA 2GV8A 4A9WA 1IUXA 2I0ZA 4FK1A 3R9UA 2ZZBA 1YQ3A 2PHHA 1PBCA 1NHQA 2X99A 4NTEA 4EMIA 1P2HA 1B4VA 1X31B 3P9UA 3AEDA 1EL5A 1IUTA 4H4SA 1KNRA 1VG9A 3F8PA 1LPFA 5TR3A 2XLUA 1GRAA 4UDQA 3UKHA 2WETA 2Z5XA 1JRXA 1NAAA 1LQTA 2X8HA 3AD8B 3KKJA 5KRQA 5KVHA 2ZZCA 4H4PA 4U8JA 4AOXA 2AR8A 1EL7A 3CTYA 4H4QA 4H4WA 2LFCA 1ZOYA 1NG3A 4B65A 1F8WA 1FL2A 1TYPA 3PO7A 3K7MX 2BXRA 3VRBA 2WQYA 3GD3A 2TPRA 3V3NA 1ELIA 1FCDA 1H7XA 3CGCA 4BURA 2FJEA 4Z24A 5IQ1A 4TM4A 1GSNA 1GALA 2XYOA 4H2NA 4CCRA 4AT2A 1PXCA 3GYJA 1E1NA 3NYEA 4AT0A 1VRQB 5EBKA 4EM3A 3RP6A 1EL8A 2WP6A 3EF6A 3AYLA 4KPRA 5FS6A 2C70A 1YQ4A 4YTMA 2APGA 4MJWA 2C65A 3DJGX 2VRLA 4ZCCA
chains in the Genus database with same CATH superfamily
4TM0A 3QVRA 3SY4A 1HTJF 4EB6E 3NTDA 3EAOA 3NK2X 4IVOB 4H9OC 3UOXA 5IWAT 2BRAA 2V7IA 1PO24 4BJYA 3P4QA 3SWHA 2LSKA 1GTEA 4DMVA 5JCNA 5ABEA 2WAUA 4LMKA 3CNDA 3UT5E 2WPEA 3K1SA 3P1WA 4C5OA 2UXDT 1S2QA 3ZCJA 2VWAA 4AISA 5LV9A 4X5TA 1LVFA 3PUQA 1PDHA 4A56A 5BMVE 4B3MT 4ISTA 4RG3A 1VCTA 1SA0E 5EK2A 3F8RA 4IREA 3Q5XA 3KLJA 4GYSA 4H4ZA 5AQIB 3OKQA 5FL0A 3I3LA 5LG4A 3H4KA 2NOXA 2E5VA 2XASB 1UK5A 2V1DB 5FMNA 2WWVA 4CCQA 4TM3A 4JI3T 4KMCA 1TDFA 1D1CA 4JI5T 5J7XA 1US7B 2XVFA 3K7TA 3KBUA 4DVDA 4LU6A 5EB4A 3ONLC 5GONE 4H50A 3JAFA 2I6HA 3ALLA 5LB7B 3SFEA 3T2YA 3UKPA 3HR0A 2Q0LA 4K5RA 4U2YA 5HY5A 2X9YA 1HYUA 3VU7H 5L2LA 1SUMB 4U2ZA 2V26A 2RABA 5HYAA 1Z7S4 3BNUA 2ACZA 3P4WA 1H6VA 4LF7T 4G6GA 3DGHA 1DNCA 4IVMB 2Q9QC 3UKFA 4USRA 1R084 1OEDB 2A9UA 5LYJE 1T98A 4HWHA 2DLRA 3SQPA 5KWFA 4EGWA 1MQTD 5AQUB 3HL6A 3AEBA 1N33T 2WOIA 2V6XA 4JQ9A 3NYFA 4Z43A 2CLYC 3ZMSB 1IJ6A 4MHCA 2XVJA 1QUUA 3Q9TA 4PFOA 3LSVA 5JDLA 3ZSTA 1R094 2YM2A 2PBIA 4NWZA 4CBQA 2V7MA 4OYJA 5LGNB 5AQQB 3ABVA 5DABA 2LEHA 1S2YA 4U33A 4CZZB 1OJDA 3DA1A 2VQBA 4NTCA 4XAXB 2XVIA 4G2AA 4PJJA 2A72A 3IHRA 2V5ZA 4LFCT 4TNVA 2TMDA 1UUSA 1COYA 4H63V 3QSMA 3IHGA 2X9WA 4WCTA 3URHA 3WAKA 2BACA 4AXPA 4OVIA 2KINB 1HF8A 3KVEA 3SS1A 2YG7A 1XWMA 2ARDA 4J33A 5BR8T 1MIYA 2CHOA 3KU9A 4Q25A 1XNQT 3RYIE 4JV5T 4UELA 3GDPA 2KZ7B 2YG6A 1LTXR 1IZNB 2RR14 3DJEA 3KV6A 1CBOA 4JEHB 4GIWA 2OLOA 3RKGA 4DV1T 4AKGA 4P0AA 3PS9A 3QK6A 3AB1A 3JCFA 4I50E 5DJQC 2OA1A 1ZX9A 3GA8A 2YLSA 3A8YC 5HWYA 3UU8A 4UVAB 2QGSA 2M6BA 2C66A 4DV3T 2GR3A 1NPXA 1AR94 3UTKA 5U25A 3CMMA 1HR0T 2V61A 2WDVA 3H8IA 3GN5B 1HFAA 4JI7T 4O2AE 2XLSA 3G5QA 5BUKA 1BGNA 4K22A 5CQFA 4QX8B 1RVF4 3Q9DA 4EMWA 3RIFA 3N9PA 2KNDA 3CX6B 2Y6QA 3SYIA 3CNSA 2XSAA 3FIMB 3P4PA 3ATQA 3WI3A 5C2TA 5LJNA 3IHMA 3IWAA 4DSGA 4Q4W4 1V59A 2MYSA 1CJ2A 2R46A 5J2UE 3NH3X 2FJDA 4EYYR 4DUYT 3KFWX 5L46A 3M3ZB 4J2CA 1ZEEA 2GAHB 3F2EA 3EPTA 2NVKX 3ICTA 3VR9A 1WYCA 2CVJA 3NKZA 2H7OA 3UU6A 3GDNA 3N9OA 2CDUA 2BYBA 5C3JA 3S4UA 5U63A 3ICRA 3KVAA 2V5DA 2C75A 3HKBE 4ZS2A 5L4EA 2GEWA 5HEJA 3ANWB 5DQVA 1PHHA 4JY3A 4A99A 3DJBA 1XNRT 5FS8A 3T14A 1PJ6A 3HYWA 2C64A 2LKHA 2WEUA 4N9XA 4U74A 4NEWA 2VVLG 3JAEA 2AXDS 3RC3A 4Q4V4 4AP1A 2BBHA 2K48A 2RM24 5EOWA 3RKOA 1EBDA 3CQCB 2CXLA 4LFBT 4A5XA 3W15B 3FHNA 4Z2RA 3C4AA 4JI4T 4ISSA 3Q5EA 1BR1A 4NIQA 4RSLA 3AB3B 3AAAB 2QA2A 3C51A 4PK6A 1G8XA 2YLWA 4B67A 3CPZA 3SOLA 4CNJA 5IPYA 4KI0F 3PUYF 4GDEA 5E0OA 3GD4A 1OJTA 3LZXA 1IUSA 3PUAA 4HA6A 2PYLA 3T2KA 3CN8A 4PJLA 3NZPA 5A1LA 5L3BB 4HGAA 3ONXA 4DBQA 3T31A 3J7Yq 4A5LA 4USQA 2LM2A 2NTXA 1IJ5A 4DUZT 2IIDA 2RP4A 3LG7A 4DNAA 2WPCA 1BR0A 3E1TA 4JUYA 1M62A 2PZSA 2HH7A 2JBVA 4PW8A 4PJMA 5KMPA 3LBXB 2JB1A 4U8KA 2V7JA 4TWFA 2K5BB 2BG9A 5CGMA 3T1HT 3LB8A 1CJ4A 3ZKRA 2LLYA 2MTQA 3RH3A 2KLQA 1EZ3A 1RUC4 3K7QX 5J2TE 4I55E 2C3CA 3FI7A 1R8IA 4J56A 4DR2T 3AAIA 2OV9A 4X62T 1XHZA 2AQJA 3U3IA 5GRTA 4IL9A 2YG5A 3DK4A 4H2QA 4IIJE 2R6GF 5J0ZA 4WX1A 4O4JE 2BXSA 4JLEA 1B37A 3K3NA 4AQFC 2C5KT 4U2TA 2J4GA 5L3CB 2XY8B 3L3PA 4EQRA 2R4EA 4K0UA 3COXA 3ZT7A 1G73A 3PTRB 3MKDA 3NK0X 1PN0A 4OPCA 3FMWA 4DNDA 4JYAT 4IDNA 2F4VT 4GDPA 1YXRA 3AA0B 4H9PC 4QKNA 3DGZA 2WZHA 1KFYA 2D5UA 2X5ID 4GAPA 4J36A 1GV4A 1RUI4 2H88A 1LRZA 1KDGA 3L1RA 5HXRA 4H4XA 3A7MA 3E22E 3FBSA 4BK2A 3Q5WA 1IUUA 5ABFA 3NTAA 4ICYA 3UTEA 2X0HA 2MOZA 3AE1A 1V9DA 2XFPA 5HXCA 4EIWA 4QWNB 3RYCE 1TDKA 3AD7B 1ZOVA 2KWIB 3V3OA 1NHSA 3O4XE 4A9WA 3R9UA 3N9LA 1NHQA 3I0OA 1PBCA 4EMIA 3UULA 1P2HA 5JR9A 3AEDA 1EL5A 5JDGA 1IUTA 2NW7A 2VQFT 1N34T 3F8PA 1GRAA 2WETA 3EAMA 1HX1B 1LQTA 4L0RA 2W2UA 5KVHA 4H4PA 4X1YE 3EUHA 5JDHA 3B13A 3CTYA 3KBTA 4LF8T 3Q5DA 1F8WA 1KK7A 3PO7A 3ZLIA 3GD3A 3PUGA 4YY3T 2FJEA 5FP3A 4F8HA 2BG9C 2VL8A 1GALA 2CE7A 4H2NA 3GYJA 3NYEA 4O4HE 5ABFB 5EBKA 3RP6A 1EL8A 2C70A 3AXJB 4YTMA 3EHZA 3DJGX 4ZCCA 2JPFA 1OXZA 5AQRB 3T37A 1KSUA 3UOYA 4M1PA 1D4EA 1BR2A 2IDOB 4NPPA 1L0VA 2BBJA 3NHOX 2RS34 1O3XA 4JNQA 2VVMA 5ER0A 5JR9B 5KMRA 3EABA 3U78A 3KPFA 4TLZA 1MOKA 2LOPA 5FMHA 3RP7A 1VBA4 5JDNA 3AE2A 3AE5A 4P09A 4JDRA 3NRXA 4YHHT 5HHFA 3FZFB 4X1IE 1XPQA 3RGLA 5LOVE 1PJ5A 3CIRA 4MBQA 1D1BA 3B6DA 3GRSA 3T2ZA 2WOWA 1JNRA 2B9YA 3MA9A 1E6EA 3VR8A 3UTFA 3OYZA 2WU2A 3AE6A 3M12A 2OAMA 5JRCB 3FXDB 2JJ9A 4CN1A 1YKEB 2D0UA 3JSKA 1FEWA 3G06A 2JQHA 4GK0E 1UGOA 3ZYMA 2DWKA 4DV7T 3P4SA 4QHOA 1EV14 2Q6UA 2E9XA 1N36T 1Q1RA 2C4CA 1GREA 2EHOB 3GMCA 5FXWA 1MXTA 1NCQD 4IDOA 2WMNA 1SEZA 4YKFA 2R074 1K5MD 4I58A 3FZLB 2NR4A 1T8BA 1GPEA 4H4SA 2GRTA 3IC9A 3L8KA 4K2XA 3UKHA 4DV4T 1VBC4 4AKIA 5KX5E 2CA5A 2JRKA 1OJCA 4UR9A 4O5QA 1XDPA 5AQVB 4RHV4 4AIUA 1WRDA 2GR2A 2QYWA 4E7ZA 4ILCA 5LMNT 3LADA 3SZWA 3PU3A 5U1OA 5LHGB 5BRTA 3LXDA 1AR74 3ZJ2A 5KXJA 2Y6RA 4PABA 4HWDA 5HEOA 3RNMA 1YY5A 3UFGA 2WPFA 2X9XA 1BZLA 1DJQA 1CC2A 3O9XA 4B3ST 4TN7B 1T7SA 4II3A 2PG8A 4H4VA 2AAQA 4OPGA 4Z90A 5KVIA 4OPLA 2X0YA 4KHPT 4IE6A 2E9XD 3AEFA 3C4WA 3KV5A 1EAH4 2YKSA 3QC9A 4AQGA 3AE7A 4QH4A 2XFNA 2PY5A 2CMRA 2CM0A 1M7KA 4ILUA 4YT0A 3BQKA 1RMU4 5L3GB 4HE8A 2FBWA 3LK2B 3VHLA 2D2SA 2BK4A 1S94A 1K0IA 2YLTA 3SZ0A 2PW9A 3SM8A 4ZZCA 5CFBA 2BKNA 1BGJA 2RS54 5F5WA 4Z44A 1PBFA 1DOCA 4B63A 3AE3A 3QSEA 4LF4T 4NZHA 2A89A 2WP9A 1JOAA 1HXS4 2HWC4 1OEDA 2ZLYA 1X79A 3QSSA 2HHHT 3CKDA 2CBJA 3V5SA 3LDQB 3LK3B 5CKUA 3LK42 2BCGG 2K3WA 2WU5A 2W62A 2KT9A 4CI3B 2XQ9A 2XAQB 4K7ZA 3FBLA 4A98A 3UTGA 5IHYA 3NK1X 3ZMZB 2CLYB 2L9QA 4WW0A 1J5WA 5KMQA 2WESA 5EK3A 2XQ5A 4B1BA 2EX3A 3Q6JA 2H7VC 2WSSV 3C4ZA 4O8SA 5JCIA 3HKEE 3NRYA 4IHJE 2R9ZA 2X8CA 1IUVA 1W9RA 1FMWA 1MNDA 3ETUA 3DP7A 3E08A 3CK6A 1BR4A 1P2EA 4OPTA 4QX7B 2WY2A 1RUF4 1PBBA 5L4HA 5FKYA 2E5LT 3N9NA 1OJAA 4BA9A 2XLTA 5FXXA 3ZCIA 2OLNA 3Q2MA 3UP5A 3CGBA 4WBOA 2XJ7A 5ETWA 2GAGB 3FZMB 4GAVA 1QO8A 2GB0A 3C98B 4DV2T 4ZN0A 1ZP0A 5TAOA 2YEVC 2VVSA 2LSJA 1CC4A 3SGLA 3DK8A 3N9MA 1IAPA 1BF3A 4GOUA 2XAJB 3AWIA 2UXCT 1L9CA 2W61A 3GN5A 3D8XA 1PJ7A 2WM9A 4X66T 1IUWA 4YHJA 4L5GA 2L8KA 4O5UA 1Y64B 3PE0A 4A79A 2XUEA 4DR7T 3F31A 4TV8E 1CJCA 3T1YT 4GF7A 2E4GA 4PDWD 4J31A 1QSDA 4ZXLA 2ZMAA 4ZI3D 1REOA 1QLBA 3KVBA 2WMOA 2W0GA 2C5JA 3QVPA 4ERRA 1TRBA 1XZYA 2X68A 2C67A 3UUNA 3OYXA 1GOSA 4GUVA 2I59A 3RYHE 2J3NA 1FEAA 4J2WA 3H3AA 4ADZA 3R84B 4D03A 4IL4A 3DK9A 3GYXA 2ODVA 2VURA 4HFCA 2VKHA 3GWDA 4DV5T 2C76A 4CI2B 1ONFA 3C4NA 3OZ2A 3ANWA 3ALMA 3BQIA 4EEBA 3CX7B 2CRBA 5ADXL 4CN4A 1H7CA 1XMQT 2BS3A 3UFEA 5LP6E 1K0LA 1IJHA 4P9SA 4IE4A 3AEAA 4CXXA 2KSRA 2R7FA 4QH1A 3QJ4A 4GCMA 4Q4Y4 3C50A 4YWOA 3TLUA 4BK3A 3VQRA 5LNKA 5IYZE 4KUMB 1KNZA 3ESLA 2RGHA 3CPIG 4XWZA 4Z26A 4JBWF 2YDSA 4EZHA 3RIUA 1VQWA 3ZPOA 2D9DA 2HPLA 1H8TD 2IAKA 1DU2A 2BC0A 2XFOA 1VBE4 4X65T 3E0ZA 2CFYA 4U2LA 1JU2A 3ALJA 2C72A 4ZHQE 4ZEYA 4ZS3A 4H2PA 3NKSA 3DTOA 3NIXA 4AKLA 4HWCA 1UCUA 1Q9IA 1ZKQA 3F57A 4JI2T 1QJDA 5JREA 4EM4A 2CULA 1NAFA 2HWB4 4TUYE 4ZI2D 1DOBA 3PJAJ 1D0YA 2XAFB 4UF0B 1Y01A 2WBAA 2E2AA 5KOXA 4U2SA 3RHAA 4Z25A 1J1JA 2KXPB 4Q4X4 1WR6A 3G5SA 3NBXX 1PVC4 1XDIA 2VQ7A 3ZT5A 4D04A 3CGEA 3UKKA 2R0CA 3I9WA 2YU2A 4WNKA 4CN6A 2I0ZA 3LBXA 2X99A 4UVCB 3RLFF 4B3TT 4IDQA 1LPFA 4UDQA 1HNXT 3CQXC 2ZZCA 4U8JA 4AOXA 2AR8A 4H4WA 1AJ3A 2LFCA 4Z91A 2R064 1RHI4 3K7MX 4HWFA 3H37A 4UV9B 4F6RC 2BXRA 4ASKA 3CGCA 4Z24A 5IQ1A 3OPCA 4O4IE 4QH5A 5H6RB 3EI0A 1VRQB 5LA6E 4EM3A 2KWHA 3M65A 4KPRA 1YQ4A 4MJWA 3L39A 2GK9A 4HFBA 4LA1A 3PU8A 1GEUA 4U31A 5JH7E 2VASA 1I6ZA 3UKLA 1NENA 3KPKA 1XDOA 1DJNA 1Z8UA 3PURA 1PBEA 4QXHB 3CGDA 4EZ4A 3H8LA 3UUBA 3RIUC 3BHFA 2X66A 5DQWA 2JKCA 2UXNB 4DBRA 3D1CA 5KMSA 4HWIB 5HXEA 1D4CA 2V6OA 2VRMA 2VL0A 3B57A 4KHZF 2VKOA 2NW9A 3IBPA 3UP4A 3S61A 2GQWA 2OA5A 1MMDA 2BVLA 1UKVG 3CNPA 2BG9E 1NHPA 1D0XA 5KOWA 4ILAA 1RSGA 1XMOT 3AEEA 2Y48B 2Q7VA 2Z6EA 4HFVA 2FJAA 1MMGA 4KP3C 4GKKT 2UZZA 1VBD4 3KINB 3UU5A 1GNDA 3M0OA 3RRCA 2XFUA 1K0JA 1OWAA 4U3CA 2GR1A 3M13A 5FXZA 2XAHB 5FVLA 1CC6A 5FS7A 3ZDNA 1D5TA 4CXYA 2WP5A 1RUG4 1YD8G 3N5LA 1GRTA 4X9MA 4YKGA 4JNAA 3SFDA 2X3NA 4J57A 2EQ6A 1XANA 4YTNA 3AXJA 3C4XA 4H4TA 1IBKT 3UKQA 1LQUA 3GWFA 3AAEB 3RP8A 1ZMCA 5HXIA 5AQFB 4DR3T 2YWLA 1GQEA 4XXGA 3D0TA 2Y6XA 1KEYA 2YN6A 2HQMA 3IF8B 3LFMA 5FL1A 4RG4A 2BS2A 4II2A 2VVNA 3F8DA 3DJDA 1HNZT 1H81A 2W66A 5LGUB 1FEBA 4H4UA 2YINA 3V76A 4CY6A 2ODUA 1F8SA 1NWMX 2IVDA 2C73A 4KBMB 4OPUA 4EOZB 4DSHA 2RA1A 5LBMA 1JRYA 2C7GA 4Y4NA 1SE7A 3GMIA 1YKJA 2LKGA 2WOVA 3QFAA 3FZKB 2R45A 4YSXA 4AOSA 5BULA 1FIOA 3EDUA 4QXCB 3K3QC 5JRCA 2JMHA 4GYRA 1FOHA 5F3JA 2R0GA 1PXBA 5LJMA 4L9IA 4C90A 1UURA 2F5ZA 4A6NB 4H63H 1GRBA 1D4DA 5ABHA 1RUD4 2EHOA 2NTYA 2XLRA 4OHFA 2ZZ0A 3TKLB 4EAHA 1POV0 3OBVE 5AQTB 1CF3A 2WB5A 1F6MA 2RGJA 3PUZF 2WDQA 4LMJA 3UCLA 1YW0A 5JVDE 3JC6D 2ACXA 1VRBA 3AEGA 2VVLA 2BABA 4C77A 1WLXA 4IE7A 2DKHA 3NYCA 3CX8B 4BK1A 1RUE4 3R6NA 1N4WA 4ADWA 4EQSA 4DIDB 2GR0A 3FBZA 5F8PA 3A5XA 1GRHA 2BK5A 4GR1A 3BI5A 4DV0T 1CUNA 2V8SV 4OK0A 3NN6X 2XM1A 5FY1A 5GSNA 4CQIA 4U7YA 4GKJT 1VCSA 2LSYA 2BCPA 2B9WA 2X8GA 2I0MA 4HFDA 5HAXA 1H83A 2WZIA 3CNJA 4FX9A 5LHIB 3H3MA 4U72A 3RQWA 1RYIA 3G5RA 1RP0A 2UXXB 5JR9C 1Y56B 4J34A 2EHOD 1OJ9A 2W63A 3I0QA 5AQNB 1Q1WA 2XFQA 4B64A 4LIIA 3HYVA 2JIWA 3X1DA 3ZJ1A 4G74A 1D7LA 1FMVA 2RGOA 2NW8A 3MK7C 4BJZA 4EEDA 4PNIA 2E1MA 4FDCB 2UUCT 4BJMA 3RQUA 4IDZA 3FPZA 2JAEA 4KX6A 3II4A 2GVCA 3EANA 3N9QA 2VKDA 2K9AA 1DOEA 1LV0A 3CNTA 1BKWA 1W0AA 4X64T 3NT6A 3FXEB 5JTGA 2JK6A 3NGCX 4UV8B 4ZI7E 2GF3A 3IF9A 3ADAB 4TLXA 4TNWA 3NG7X 1LVKA 5CA1E 2A8XA 5EK4A 4IGUA 2YVJA 4CNKA 5HEUA 2B7SA 1H84A 2YLRA 1W09A 2YM1A 4EXTA 2YDQA 2CCQA 3BQLA 5FS9A 1U5PA 3L09A 1LKXA 3VRAA 2YOEA 5AQKB 2DCFA 4GK5E 4H9NC 2W00A 2QA1A 3UOZA 5FXVA 4FJOA 3AYIA 4UDPA 1S35A 2LOSA 2BVMA 2BKPA 2V5CA 4IE0A 4YJ3E 2YR5A 4DMWA 2NPXA 2RPAA 3ZSSA 2XQ7A 1F3PA 5J60A 1FECA 2WS3A 2VB6A 5JCKA 4AQYT 3CPJG 4NNJA 2E9XC 5KNLA 2J47A 2V6YB 2JQQA 3L8RA 2G0UA 2Q9QB 3PUWF 4XZCA 2Z5YA 4U7IA 1WYBA 3QNUA 4JI0T 4PK4A 1ZK7A 3BHKA 1L9EA 1OOPD 2XQ6A 1O5WA 5AQMB 3CPHG 3AE4A 4TWHA 5M0ZA 5LG3A 2BDEA 4ZCDA 2OLTA 2WDRA 2Q9QD 2W67A 4ANJA 4QXBB 1B7TA 4FI5A 2MBGA 5FNVE 1OEDE 2IC9A 1L9DA 2XQ4A 3K3OA 5M10A 3ZC1A 3BI2A 1H86A 1GRGA 5M4YA 2C3DA 4H9QC 5AQPB 2DKIA 3UOVA 4H9RC 1NDAA 4OPIA 1ASJ4 2ES0A 1MIWA 5HCMA 3OTOT 1NG4A 2ZM8A 4B69A 4C3XA 2GQFA 4YXDA 5L3EB 3UQ4A 2X51A 5H6QB 4NUUA 3DH9A 3PUXF 3ZYXA 4H7UA 1F8RA 1VRH4 4UXNB 2IVEA 1EL9A 4U8PA 4AP3A 3O0HA 3RIAA 1HG2A 4K8DA 1BEV4 5L3FB 2V3AA 4LMLA 3ISHA 5EB5A 4HB9A 2MAWA 3AECA 1M64A 4UDRA 2A87A 3PJAA 4Z2UA 4DR1T 3HI2A 5JCLA 2P9BA 3RYFE 2GMJA 5HXSA 4IV9A 3NZQA 1HG5A 3FZHB 3RC8A 4H4YA 2A2FX 4EV6A 4X1KE 3JADA 4AKRB 3SX6A 1FJGT 2GV8A 4FK1A 2ZZBA 1YQ3A 2LJLA 4A97A 4B6XA 4LF6T 3O1HA 1B4VA 1X31B 3P9UA 2M67A 1KNRA 2XLUA 2FUPA 2Z5XA 1JRXA 5KRQA 2LSGA 2UUAT 4YJ2E 2M6IA 5CB4E 1E1HB 2K24A 1NG3A 4B65A 1FL2A 2UXBT 1COV4 3NVOA 2DHRA 1OEDC 5LGTB 2WQYA 3VRBA 3V3NA 1ELIA 1FCDA 1H7XA 2PTFA 2X0LB 1T72A 4COFA 4AT2A 4AT0A 4TX5A 1E1NA 2XQ3A 5AFUL 4TWDA 3AYLA 4CXWA 3K8PC 2C65A 1XHXA 3ETVA 4I43B 3WAJA 2VRLA 4DV6T 5JQGE 3QOFA 1KNPA 1PS9A 3I6DA 2ZM0A 2C5IT 2B76A 4JN9A 3OVUA 2V7LA 2LHNA 2QCUA 3AA7B 3C64A 4E7SA 4X9NA 4NTDA 4NEVA 1DXLA 2XQ8A 4X20E 4NXNT 2H3RA 1I94T 4UEMA 1E1KA 3VRDB 2RS14 2X50A 4UF0A 1NHRA 1ZMDA 5LXTE 1YKHB 3N2KE 2ZM2A 3DJJA 2RMU4 4ZI3C 2OALA 4TM1A 2DNXA 2VKJA 3LJCA 2EQ7A 2YLZA 3PUVF 2R044 2VQET 2XCGA 2Y8DA 3GMBA 1B8SA 3V5UA 2LSIA 3AA6B 1YQZA 3ZN1B 1X9BA 3VKGA 3REDA 1AL24 2NWBA 2XSBA 3ZYKA 1IBLT 1VDCA 4X4JA 4REKA 4K5SA 4IA5A 1RUJ4 2XLPA 2W0HA 4I59A 3GYIA 2YVFA 2BK3A 1UX5A 4APNA 3J8F4 3KD9A 4U8MA 4YSZA 2Q0KA 1Y0PA 1D0ZA 2CHNA 1N1PA 4EQXA 4JEUB 3K30A 4A65A 3EDVA 1XI1A 2YAUA 3QB5K 4FK1C 4YLHA 1HCIA 1MO9A 4C91A 3N2OA 4PAGA 2VOUA 1AR84 1PBDA 1PXAA 4YSHA 5JDFA 2EQ8A 3MZKB 4OFZA 4V1Av 4Y4LA 4YSYA 5AQLB 3FG2P 2LRLA 2LM9A 4YTPA 3LZWA 1HRI4 4AQFA 2YU1A 4BJNA 3PUSA 4PAAA 1WCRA 1Z6LA 2CWOA 1GXFA 5CA0E 3B3RA 4DR5T 3PVCA 4EYUA 3RF1A 2BA9A 2XVEA 3P4RA 3UKAA 5FY7A 2WWUA 2ZBWA 4OCGA 2V60A 2CXFA 3AXBA 1ZY8A 4ZI2C 4P1NA 4TV9E 3HA4A 1VBB4 2QA7A 1ZDLA 2QAEA 3BI4A 3NN0X 4PK5A 1M6IA 3ONJA 1GTHA 3GQHA 3UQ7A 5C8YE 3KA7A 1PO14 2YK0A 1B5QA 5FYMA 4GRTA 4JI1T 5AQSB 2WBLA 4HFEA 3KDSE 4NXMT 3AVSA 2XPKA 2O9ZA 4B3RT 4HN9A 5BVAA 3P8CD 2V3BA 4LFAT 3ZEFB 3JBG4 2CWYA 3HZLA 5KMGP 1MMNA 5EZYE 3I1AA 3P50A 1AOGA 2YDRA 1GETA 1ZV4X 2L3LA 2V7KA 1VG0A 2WHDA 3CQGB 2YVGA 4U8IA 1LJ1A 3I9YA 2PLV4 1CJ3A 3DMEA 2HN1A 4TZ4C 5L3DB 1TDNA 1W4XA 1CL0A 5JCMA 3IA3A 2KMFA 3AD9B 4U8NA 3CWZB 3TLTA 2IW5B 1Z0PA 2ZM6T 3LOVA 4H4RA 4BAYB 3IEEA 2XVHA 2HPJA 4LF9T 4I4TE 3GQKA 5DBJA 5LMUT 1GESA 4UVBB 3GWHA 1IBMT 1K4QA 1TYTA 2PJQA 4OX9T 3ZMUB 2DWGA 4HTEA 1S3BA 3OC4A 5HYMA 4E0VA 3C96A 3O1IA 1N4VA 3BNMA 2EQ9A 4ZOLE 4U8LA 3T8OA 1HS7A 2XHEB 2J1DG 2CXDA 2QRXA 4DR4T 2JB2A 1H82A 4K0KT 1O95A 1HRV4 4G63A 4ZZBA 2HN2A 4UP3A 1NA1D 5J1GA 4IDPA 3UU4A 2XAGB 3ZYLA 4OYKA 2BG9B 1E1LA 3ITJA 4AKHA 1NEKA 4EQWA 4O4LE 3AA1B 2SPCA 4CI1B 1N4UA 2R4JA 3NNEA 4A6NA 3N2GE 1D7YA 5HEGA 2CPTA 2XZEA 3P7IA 2BKOA 3SRZA 2D0TA 1RUH4 2NP9A 4HEAA 2LHRA 1PIV4 1TDOA 3TLSA 3ZC0A 1U4QA 3GSIA 4G73A 1KF6A 2A3DA 1E39A 4LF5T 4Z8XA 1ZHCA 3PV0F 3T0KA 4IA6A 2E8IA 1XHCA 2GH5A 2IC6A 2IIUA 4MALA 4WYVA 4CY8A 2W4XA 3J9X1 2PFVA 2LT3A 3TLVA 3UTHA 5LCYA 5CJ5A 5KDMC 1HX8A 1LVLA 2X67A 3ZMTB 4G6HA 4YFSA 2IUBA 1S3EA 3FB2A 2IHR1 2GMHA 4GB34 4M52A 4I0UA 1UX4A 2XM2A 4XWRA 3MJXA 1TDEA 5JDQA 3EVYA 2R0PA 3UU3A 3QB5A 3HKCE 3WE0A 2QVAA 3GRTA 2UUBT 2XQYA 4O2BE 5L47A 2MPKA 3SZFA 2DL1A 1Y56A 1GERA 3NLCA 3SXIA 4NUVA 2JB3A 1CHUA 1BWCA 1O94A 3ZT6A 2N9DA 5AQHB 3RI5A 3ATRA 1AR64 2BS4A 4N78D 2UU9T 1H7WA 4Y4MA 1D4M4 1SHZC 3HYXA 4B66A 3UUMA 2PYXA 3ICSA 3B5MA 4BV6A 1E7PA 3KV9A 1JRZA 3JD74 5ABGA 4C74A 3AVRA 3OJAA 4C3YA 4JY2A 4H9SE 3SUCA 1DODA 1E2AA 1KSSA 2N2NA 4EIQA 4OPDA 4JI6T 4XBFB 4HFHA 4ILBA 4EMJA 5JDMA 4B68A 2YG3A 3HKDE 3PDYA 4PFPA 3RRWA 3CMLA 3ZMVB 5AQOB 3MACA 4HFIA 5HXHA 2YR4A 3LJPA 2B1EA 2VZ2A 3CVRA 4Z2TA 4H2RA 3NRNA 3UUXB 5AQGB 3JC6C 2YQUA 5LHHB 2BZBA 4DGKA 1MMAA 3AE9A 4AI6A 2XTLA 1E1MA 1MIVA 2JQKA 3AE8A 1MNEA 1HNWT 4ECHA 2YR6A 3KV4A 1GT8A 1JEHA 3MXZA 2PYJA 2BC1A 3S5WA 5FVKA 2FJBA 4U8OA 1N32T 1WFDA 1ZKEA 1JNZA 2LE8A 2WCAA 4JI8T 2XDOA 4EIPA 2H89A 5IQ4A 1J5ET 5FY0A 5HCJA 5HEHA 1GRFA 2J62A 3AYJA 2JQ9A 3RX6A 1D1AA 2B9XA 2YLXA 2BRYA 3QFBA 2B7RA 4CRTA 3NWIA 4WBNE 4G9KA 4P0BA 2YG4A 3VKHA 2N1GA 1IUXA 4MLKA 2PHHA 4NTEA 4HKAA 3RHWA 5IUXA 4WZXA 2VK9A 4IE5A 5HWXA 2V6YA 2EHOC 1VG9A 5TR3A 2Q9QA 3KKJA 1NAAA 2X8HA 3AD8B 2AE9A 2C0SA 4MFRA 5LBQB 4PJNA 3BK9A 1EL7A 4H4QA 2E9XB 4UIGA 1WR0A 1ZOYA 1VOMA 3RPUA 3ZN0B 1TYPA 2CEAA 4DO0A 2CBIA 3TLWA 2XQAA 2TPRA 4BURA 3SZCA 2LRKA 2IMLA 4DR6T 5AQJB 4TM4A 1GSNA 2XYOA 4CCRA 3O1JA 1PXCA 2X9HA 4IT4A 1W0BA 2WP6A 3EF6A 5FS6A 2DI4A 2JMKA 2APGA 3QUJA 4A7AA
chains in the Genus database with same CATH topology
4TM0A 3QVRA 3SY4A 1KNPA 1PS9A 3NTDA 3I6DA 3EAOA 3NK2X 4IVOB 4LA1A 3T37A 3UOXA 1KSUA 1GEUA 3UOYA 2B76A 2BRAA 4JN9A 1D4EA 1L0VA 4BJYA 3P4QA 1GTEA 2QCUA 3NHOX 3UKLA 4X9NA 1NENA 4JNQA 2VVMA 3KPKA 4NTDA 5JCNA 1DJNA 1DXLA 4NEVA 1PBEA 5ER0A 3CNDA 3CGDA 3KPFA 4TLZA 5KMRA 1MOKA 3H8LA 2WPEA 4C5OA 3P1WA 5FMHA 1S2QA 3RP7A 3BHFA 1E1KA 3VRDB 3AE2A 3AE5A 2JKCA 2X50A 5LV9A 1NHRA 3D1CA 4JDRA 5KMSA 1ZMDA 1PDHA 3DJJA 5HHFA 1D4CA 2V6OA 2VRMA 2OALA 1XPQA 4RG3A 3F8RA 4TM1A 1PJ5A 3CIRA 3KLJA 3UP4A 3B6DA 4H4ZA 3GRSA 2EQ7A 3T2ZA 2YLZA 3S61A 2GQWA 2WOWA 1JNRA 2B9YA 3I3LA 1E6EA 2XCGA 3VR8A 3H4KA 3GMBA 2E5VA 1B8SA 1UKVG 3CNPA 1NHPA 3UTFA 2WU2A 1YQZA 3AE6A 5KOWA 3M12A 2OAMA 3REDA 4CCQA 4TM3A 4X4JA 1VDCA 1RSGA 1TDFA 4REKA 4K5SA 4IA5A 2XLPA 2W0HA 4I59A 5J7XA 3GYIA 2YVFA 3AEEA 3JSKA 2XVFA 3K7TA 2BK3A 2Q7VA 4LU6A 5EB4A 2FJAA 4H50A 4APNA 2UZZA 3P4SA 3KD9A 4U8MA 4YSZA 2Q0KA 1Y0PA 1N1PA 2Q6UA 3ALLA 4EQXA 1GNDA 3M0OA 1Q1RA 3SFEA 2C4CA 2XFUA 3T2YA 1GREA 1K0JA 2Q0LA 3GMCA 4K5RA 3K30A 5HY5A 1MXTA 4A65A 3M13A 2GR1A 1HYUA 2YAUA 1CC6A 5FS7A 4FK1C 3ZDNA 1D5TA 2WP5A 1SEZA 1MO9A 4YKFA 1GRTA 4I58A 2RABA 4X9MA 1GPEA 2ACZA 1H6VA 2GRTA 2VOUA 3BNUA 3IC9A 3DGHA 3SFDA 2X3NA 1PBDA 1PXAA 2EQ6A 1DNCA 4J57A 4JNAA 4YSHA 4IVMB 3UKFA 2EQ8A 1XANA 4USRA 4YTNA 1OJCA 4H4TA 4O5QA 3UKQA 4Y4LA 1LQUA 4YSYA 3GWFA 3RP8A 3FG2P 4YTPA 3LZWA 1ZMCA 5HXIA 2YWLA 3SQPA 5KWFA 4XXGA 2WOIA 3AEBA 2GR2A 4JQ9A 3NYFA 4Z43A 3LADA 2HQMA 4PAAA 3SZWA 2XVJA 1Z6LA 3Q9TA 1GXFA 4RG4A 2BS2A 5U1OA 4II2A 2YM2A 3B3RA 4NWZA 4CBQA 3PVCA 5BRTA 3LXDA 3F8DA 3DJDA 5KXJA 2Y6RA 4PABA 3ABVA 3RNMA 1S2YA 1YY5A 1H81A 2BA9A 2WPFA 2XVEA 1FEBA 1OJDA 3P4RA 3DA1A 4H4UA 3UKAA 2VQBA 4NTCA 3V76A 4CY6A 2XVIA 1BZLA 1F8SA 1DJQA 2ZBWA 2V5ZA 1CC2A 2C73A 4OCGA 4OPUA 4G6GA 2IVDA 4DSHA 1JRYA 2C7GA 2V60A 2TMDA 4II3A 1COYA 3AXBA 1ZY8A 4Y4NA 4H4VA 3QSMA 2AAQA 4OPGA 5KVIA 3IHGA 4OPLA 1YKJA 2WOVA 1ZDLA 2QAEA 3BI4A 3AEFA 3QFAA 4WCTA 3URHA 2BACA 2R45A 3NN0X 4OVIA 4YSXA 1M6IA 1GTHA 3L8KA 4AOSA 3KVEA 5BULA 3GQHA 2YG7A 2ARDA 4J33A 3KA7A 3KU9A 3AE7A 1FOHA 1B5QA 3GDPA 2R0GA 2XFNA 2YG6A 1PXBA 4GRTA 1LTXR 4YT0A 3DJEA 1CBOA 2O9ZA 5BVAA 2FBWA 2OLOA 2F5ZA 2V3BA 4A6NB 3PS9A 3AB1A 1GRBA 2BK4A 1K0IA 1D4DA 2OA1A 2YLTA 1ZX9A 2YLSA 3HZLA 3SZ0A 3SM8A 2XLRA 1AOGA 1GETA 1BGJA 2C66A 2ZZ0A 2GR3A 4Z44A 1NPXA 1PBFA 1DOCA 4B63A 1CF3A 3AE3A 1VG0A 3QSEA 5U25A 3CMMA 2WHDA 1F6MA 2RGJA 2V61A 2WDVA 2YVGA 4U8IA 3H8IA 4NZHA 2A89A 1LJ1A 2WP9A 1JOAA 2WDQA 3UCLA 1CJ3A 3DMEA 3QSSA 1TDNA 1W4XA 2XLSA 3AEGA 2VVLA 3G5QA 1BGNA 5BUKA 1CL0A 2BABA 4K22A 2BCGG 5CKUA 5CQFA 4C77A 2WU5A 5JCMA 2DKHA 4U8NA 3AD9B 3NYCA 4EMWA 4BK1A 3SYIA 3LOVA 2Y6QA 3CNSA 4H4RA 1N4WA 3FIMB 4K7ZA 3P4PA 3ATQA 5C2TA 3IHMA 4ADWA 3IWAA 4EQSA 4DSGA 3UTGA 1V59A 2GR0A 2XVHA 1CJ2A 2R46A 3NH3X 3NK1X 2FJDA 1GRHA 2BK5A 4GR1A 3GQKA 5DBJA 5L46A 1GESA 3BI5A 1K4QA 1TYTA 5KMQA 2WESA 3NN6X 2GAHB 4B1BA 1S3BA 3EPTA 4YKGA 3Q6JA 5GSNA 2NVKX 3ICTA 3VR9A 2BCPA 2CVJA 2B9WA 2X8GA 3OC4A 5HYMA 5JCIA 2R9ZA 4E0VA 3C96A 1H83A 2X8CA 1IUVA 3CNJA 3GDNA 1N4VA 3BNMA 4FX9A 2EQ9A 4U8LA 1RYIA 2BYBA 5C3JA 2CDUA 1RP0A 3G5RA 5U63A 3ICRA 2JB2A 1H82A 1Y56B 4J34A 1OJ9A 1Q1WA 2XFQA 1O95A 1P2EA 2C75A 4LIIA 4OPTA 4B64A 3HYVA 2GEWA 4UP3A 1PBBA 1PHHA 4G74A 1D7LA 4JY3A 4A99A 1E1LA 3ITJA 5FS8A 3T14A 1NEKA 1PJ6A 2RGOA 3HYWA 1OJAA 2C64A 2XLTA 2WEUA 4EQWA 4N9XA 4BJZA 2E1MA 2OLNA 4FDCB 4NEWA 2VVLG 3UP5A 4A6NA 2R4JA 1N4UA 3FPZA 3NNEA 2JAEA 4AP1A 3CGBA 2GAGB 1D7YA 5EOWA 4K2XA 4GAVA 4KX6A 1QO8A 3II4A 2GB0A 2GVCA 3EANA 1EBDA 4ZN0A 1ZP0A 1CC4A 3SGLA 3DK8A 1DOEA 1LV0A 1TDOA 4Z2RA 3C4AA 1BF3A 4G73A 3GSIA 3CNTA 1KF6A 1E39A 1BKWA 3AWIA 1L9CA 3NT6A 4RSLA 2JK6A 3NGCX 3T0KA 2GF3A 3D8XA 4IA6A 1PJ7A 3IF9A 3ADAB 1XHCA 2QA2A 2GH5A 4TLXA 2YLWA 4CY8A 4B67A 1IUWA 3NG7X 2A8XA 4CNJA 4O5UA 5IPYA 2YVJA 4CNKA 4A79A 3UTHA 2B7SA 1H84A 2YLRA 4GDEA 1CJCA 3GD4A 4GF7A 2E4GA 1OJTA 2YM1A 3LZXA 1IUSA 1LVLA 4HA6A 4J31A 4G6HA 3T2KA 3CN8A 1S3EA 1REOA 5FS9A 3T31A 4A5LA 1QLBA 2GMHA 4M52A 4USQA 3VRAA 4XWRA 1TDEA 3QVPA 1TRBA 2R0PA 2IIDA 4DNAA 2C67A 2QA1A 3UOZA 1GOSA 4GUVA 3WE0A 2WPCA 3GRTA 3AYIA 2J3NA 4UDPA 1FEAA 4J2WA 3E1TA 4D03A 3DK9A 2JBVA 3GYXA 3SZFA 2YR5A 1Y56A 1GERA 2NPXA 3GWDA 3NLCA 3SXIA 1F3PA 2C76A 1ONFA 2JB3A 3C4NA 3OZ2A 5J60A 4U8KA 2JB1A 1CHUA 1FECA 1BWCA 5KMPA 3ALMA 2WS3A 5JCKA 1O94A 3CPJG 3LB8A 4NNJA 3ATRA 1CJ4A 5KNLA 2BS4A 1H7WA 4Y4MA 3HYXA 4B66A 3ICSA 2PYXA 2BS3A 4BV6A 1E7PA 2Z5YA 3K7QX 1JRZA 4A7AA 1ZK7A 3BHKA 1L9EA 4C74A 2C3CA 1O5WA 3CPHG 3AE4A 4JY2A 4C3YA 5M0ZA 1K0LA 1IJHA 4P9SA 4J56A 3UKPA 3SUCA 3AEAA 4ZCDA 1DODA 2WDRA 1KSSA 3QJ4A 4GCMA 2AQJA 4EIQA 4YWOA 5GRTA 4BK3A 4OPDA 3VQRA 2YG5A 3DK4A 4H2QA 4EMJA 4WX1A 4B68A 2RGHA 2BXSA 2YG3A 1L9DA 3CPIG 4XWZA 4Z26A 1B37A 5M10A 4U2TA 3BI2A 1H86A 1VQWA 1GRGA 2C3DA 2DKIA 3UOVA 4EQRA 2R4EA 2YR4A 3COXA 3LJPA 2VZ2A 1NDAA 4Z2TA 3NK0X 4OPIA 2BC0A 2XFOA 1PN0A 4OPCA 4H2RA 1NG4A 3FMWA 3NRNA 2CFYA 4U2LA 4B69A 4C3XA 1JU2A 3ALJA 2C72A 4GDPA 2YQUA 2GQFA 4H2PA 4YXDA 3NKSA 4DGKA 3AE9A 3DGZA 1E1MA 3NIXA 1KFYA 3AE8A 1Q9IA 1ZKQA 3DH9A 3ZYXA 4GAPA 4H7UA 1F8RA 4J36A 1GV4A 1QJDA 4EM4A 4ECHA 2H88A 2YR6A 2IVEA 1GT8A 1KDGA 2CULA 1JEHA 3L1RA 2BC1A 1DOBA 1EL9A 4H4XA 3S5WA 2FJBA 4U8PA 3O0HA 4U8OA 4AP3A 2WBAA 4K8DA 5KOXA 3FBSA 4U2SA 4BK2A 1IUUA 1JNZA 3NTAA 2XDOA 3RHAA 2V3AA 2H89A 4EIPA 4ICYA 4Z25A 3ISHA 5EB5A 4HB9A 3AECA 3UTEA 5IQ4A 1M64A 4UDRA 1GRFA 2A87A 3G5SA 4Z2UA 1XDIA 3AYJA 3AE1A 2VQ7A 2XFPA 4D04A 3CGEA 2GMJA 3UKKA 5JCLA 2R0CA 2B9XA 2YLXA 4IV9A 2BRYA 3QFBA 2B7RA 4H4YA 1TDKA 3AD7B 4CRTA 4G9KA 1ZOVA 2YG4A 3SX6A 1NHSA 3V3OA 2GV8A 4A9WA 1IUXA 2I0ZA 4FK1A 3R9UA 2ZZBA 1YQ3A 2PHHA 1PBCA 1NHQA 2X99A 4NTEA 4EMIA 1P2HA 1B4VA 1X31B 3P9UA 3AEDA 1EL5A 1IUTA 4H4SA 1KNRA 1VG9A 3F8PA 1LPFA 5TR3A 2XLUA 1GRAA 4UDQA 3UKHA 2WETA 2Z5XA 1JRXA 1NAAA 1LQTA 2X8HA 3AD8B 3KKJA 5KRQA 5KVHA 2ZZCA 4H4PA 4U8JA 4AOXA 2AR8A 1EL7A 3CTYA 4H4QA 4H4WA 2LFCA 1ZOYA 1NG3A 4B65A 1F8WA 1FL2A 1TYPA 3PO7A 3K7MX 2BXRA 3VRBA 2WQYA 3GD3A 2TPRA 3V3NA 1ELIA 1FCDA 1H7XA 3CGCA 3SZCA 2FJEA 4Z24A 4BURA 5IQ1A 4TM4A 1GSNA 1GALA 2XYOA 4H2NA 4CCRA 4AT2A 1PXCA 3GYJA 1E1NA 3NYEA 4AT0A 1VRQB 5EBKA 4EM3A 3RP6A 1EL8A 2WP6A 3EF6A 3AYLA 4KPRA 5FS6A 2C70A 1YQ4A 4YTMA 2APGA 4MJWA 2C65A 3DJGX 2VRLA 4ZCCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TM0 A;  3QVR A;  1KNP A;  1PS9 A;  3NTD A;  3I6D A;  3EAO A;  3NK2 X;  4IVO B;  4LA1 A;  3T37 A;  3UOX A;  1KSU A;  1GEU A;  3UOY A;  2B76 A;  4JN9 A;  1D4E A;  1L0V A;  4BJY A;  3P4Q A;  1GTE A;  2QCU A;  3NHO X;  3UKL A;  4X9N A;  1NEN A;  4JNQ A;  2VVM A;  4NTD A;  5JCN A;  1DJN A;  1DXL A;  4NEV A;  1PBE A;  5ER0 A;  3CND A;  3CGD A;  3KPF A;  4TLZ A;  1MOK A;  3H8L A;  2WPE A;  4C5O A;  3P1W A;  5FMH A;  1S2Q A;  3RP7 A;  3BHF A;  1E1K A;  3VRD B;  3AE2 A;  3AE5 A;  2JKC A;  2X50 A;  5LV9 A;  1NHR A;  3D1C A;  4JDR A;  1ZMD A;  1PDH A;  3DJJ A;  5HHF A;  1D4C A;  2V6O A;  2VRM A;  2OAL A;  1XPQ A;  4RG3 A;  3F8R A;  4TM1 A;  1PJ5 A;  3CIR A;  3KLJ A;  3UP4 A;  3B6D A;  4H4Z A;  3GRS A;  2EQ7 A;  2YLZ A;  3S61 A;  2GQW A;  2WOW A;  1JNR A;  2B9Y A;  3I3L A;  1E6E A;  2XCG A;  3VR8 A;  3H4K A;  3GMB A;  2E5V A;  1B8S A;  1UKV G;  3CNP A;  1NHP A;  3UTF A;  2WU2 A;  1YQZ A;  3AE6 A;  5KOW A;  3M12 A;  2OAM A;  3RED A;  4CCQ A;  4TM3 A;  4X4J A;  1VDC A;  1RSG A;  1TDF A;  4REK A;  4K5S A;  4IA5 A;  2XLP A;  2W0H A;  4I59 A;  5J7X A;  3GYI A;  2YVF A;  3AEE A;  3JSK A;  2XVF A;  3K7T A;  2BK3 A;  2Q7V A;  4LU6 A;  5EB4 A;  2FJA A;  4H50 A;  4APN A;  2UZZ A;  3P4S A;  3KD9 A;  4U8M A;  4YSZ A;  2Q0K A;  1Y0P A;  1N1P A;  2Q6U A;  3ALL A;  4EQX A;  1GND A;  3M0O A;  1Q1R A;  3SFE A;  2XFU A;  3UKP A;  1GRE A;  1K0J A;  2Q0L A;  3GMC A;  4K5R A;  3K30 A;  5HY5 A;  1MXT A;  4A65 A;  3M13 A;  2GR1 A;  1HYU A;  2YAU A;  1CC6 A;  5FS7 A;  4FK1 C;  3ZDN A;  1D5T A;  2WP5 A;  1SEZ A;  1MO9 A;  4YKF A;  1GRT A;  4I58 A;  2RAB A;  4X9M A;  1GPE A;  2ACZ A;  1H6V A;  2GRT A;  2VOU A;  3BNU A;  3IC9 A;  3DGH A;  3SFD A;  2X3N A;  1PBD A;  1PXA A;  2EQ6 A;  1DNC A;  4J57 A;  4JNA A;  4YSH A;  4IVM B;  3UKF A;  2EQ8 A;  1XAN A;  4USR A;  4YTN A;  1OJC A;  4H4T A;  4O5Q A;  3UKQ A;  4Y4L A;  1LQU A;  4YSY A;  3GWF A;  3RP8 A;  3FG2 P;  4YTP A;  3LZW A;  1ZMC A;  5HXI A;  2YWL A;  3SQP A;  5KWF A;  4XXG A;  2WOI A;  3AEB A;  2GR2 A;  4JQ9 A;  3NYF A;  4Z43 A;  3LAD A;  2HQM A;  4PAA A;  2XVJ A;  1Z6L A;  3Q9T A;  1GXF A;  4RG4 A;  2BS2 A;  5U1O A;  2YM2 A;  3B3R A;  4CBQ A;  3PVC A;  5BRT A;  3LXD A;  3F8D A;  3DJD A;  5KXJ A;  2Y6R A;  4PAB A;  3ABV A;  3RNM A;  1S2Y A;  1YY5 A;  1H81 A;  2BA9 A;  2WPF A;  2XVE A;  1FEB A;  1OJD A;  3P4R A;  3DA1 A;  4H4U A;  3UKA A;  2VQB A;  4NTC A;  3V76 A;  4CY6 A;  2XVI A;  1BZL A;  1F8S A;  1DJQ A;  2ZBW A;  2V5Z A;  1CC2 A;  2C73 A;  4OCG A;  4OPU A;  2IVD A;  4DSH A;  1JRY A;  2C7G A;  2V60 A;  2TMD A;  1COY A;  3AXB A;  1ZY8 A;  4Y4N A;  4H4V A;  3QSM A;  2AAQ A;  4OPG A;  5KVI A;  3IHG A;  4OPL A;  1YKJ A;  2WOV A;  1ZDL A;  2QAE A;  3BI4 A;  3AEF A;  3QFA A;  4WCT A;  3URH A;  2BAC A;  2R45 A;  3NN0 X;  4OVI A;  4YSX A;  1M6I A;  1GTH A;  3L8K A;  4AOS A;  3KVE A;  5BUL A;  3GQH A;  2YG7 A;  2ARD A;  4J33 A;  3KA7 A;  3KU9 A;  3AE7 A;  1FOH A;  1B5Q A;  3GDP A;  2R0G A;  2XFN A;  2YG6 A;  1PXB A;  4GRT A;  1LTX R;  4YT0 A;  3DJE A;  1CBO A;  2O9Z A;  5BVA A;  2FBW A;  2OLO A;  2F5Z A;  2V3B A;  4A6N B;  3PS9 A;  3AB1 A;  1GRB A;  2BK4 A;  1K0I A;  1D4D A;  2OA1 A;  2YLT A;  1ZX9 A;  2YLS A;  3HZL A;  3SM8 A;  2XLR A;  1AOG A;  1GET A;  1BGJ A;  2C66 A;  2ZZ0 A;  2GR3 A;  4Z44 A;  1NPX A;  1PBF A;  1DOC A;  4B63 A;  1CF3 A;  3AE3 A;  1VG0 A;  3QSE A;  5U25 A;  2WHD A;  1F6M A;  2RGJ A;  2V61 A;  2WDV A;  2YVG A;  4U8I A;  3H8I A;  4NZH A;  2A89 A;  1LJ1 A;  2WP9 A;  1JOA A;  2WDQ A;  3UCL A;  1CJ3 A;  3DME A;  3QSS A;  1TDN A;  1W4X A;  2XLS A;  3AEG A;  2VVL A;  3G5Q A;  1BGN A;  5BUK A;  1CL0 A;  2BAB A;  4K22 A;  2BCG G;  5CKU A;  5CQF A;  4C77 A;  2WU5 A;  5JCM A;  2DKH A;  4U8N A;  3AD9 B;  3NYC A;  4EMW A;  4BK1 A;  3LOV A;  2Y6Q A;  3CNS A;  4H4R A;  1N4W A;  3FIM B;  4K7Z A;  3P4P A;  3ATQ A;  5C2T A;  3IHM A;  4ADW A;  3IWA A;  4EQS A;  4DSG A;  3UTG A;  1V59 A;  2GR0 A;  2XVH A;  1CJ2 A;  2R46 A;  3NH3 X;  3NK1 X;  2FJD A;  1GRH A;  2BK5 A;  4GR1 A;  3GQK A;  5DBJ A;  5L46 A;  1GES A;  3BI5 A;  1K4Q A;  1TYT A;  2WES A;  3NN6 X;  2GAH B;  4B1B A;  1S3B A;  3EPT A;  4YKG A;  3Q6J A;  5GSN A;  2NVK X;  3ICT A;  3VR9 A;  2BCP A;  2CVJ A;  2B9W A;  2X8G A;  3OC4 A;  5HYM A;  5JCI A;  2R9Z A;  4E0V A;  3C96 A;  1H83 A;  2X8C A;  1IUV A;  3CNJ A;  3GDN A;  1N4V A;  3BNM A;  4FX9 A;  2EQ9 A;  4U8L A;  1RYI A;  2BYB A;  5C3J A;  2CDU A;  1RP0 A;  3G5R A;  5U63 A;  3ICR A;  2JB2 A;  1H82 A;  1Y56 B;  4J34 A;  1OJ9 A;  1Q1W A;  2XFQ A;  1O95 A;  1P2E A;  2C75 A;  4LII A;  4OPT A;  4B64 A;  2GEW A;  4UP3 A;  1PBB A;  1PHH A;  4JY3 A;  1D7L A;  4A99 A;  1E1L A;  3ITJ A;  5FS8 A;  1NEK A;  1PJ6 A;  2RGO A;  1OJA A;  2C64 A;  2XLT A;  2WEU A;  4EQW A;  4N9X A;  4BJZ A;  2E1M A;  2OLN A;  4FDC B;  4NEW A;  2VVL G;  3UP5 A;  4A6N A;  2R4J A;  1N4U A;  3FPZ A;  3NNE A;  2JAE A;  4AP1 A;  3CGB A;  2GAG B;  1D7Y A;  5EOW A;  4K2X A;  4KX6 A;  1QO8 A;  3II4 A;  2GB0 A;  2GVC A;  3EAN A;  1EBD A;  4ZN0 A;  1ZP0 A;  1CC4 A;  3SGL A;  3DK8 A;  1DOE A;  1LV0 A;  1TDO A;  4Z2R A;  3C4A A;  1BF3 A;  3GSI A;  3CNT A;  1KF6 A;  1E39 A;  1BKW A;  3AWI A;  1L9C A;  3NT6 A;  4RSL A;  2JK6 A;  3NGC X;  2GF3 A;  3D8X A;  4IA6 A;  1PJ7 A;  3IF9 A;  3ADA B;  1XHC A;  2QA2 A;  2GH5 A;  4TLX A;  2YLW A;  4CY8 A;  4B67 A;  1IUW A;  3NG7 X;  2A8X A;  4CNJ A;  4O5U A;  5IPY A;  2YVJ A;  4CNK A;  4A79 A;  3UTH A;  2B7S A;  1H84 A;  2YLR A;  4GDE A;  1CJC A;  3GD4 A;  4GF7 A;  2E4G A;  1OJT A;  2YM1 A;  3LZX A;  1IUS A;  1LVL A;  4HA6 A;  4J31 A;  3CN8 A;  1S3E A;  1REO A;  5FS9 A;  4A5L A;  1QLB A;  2GMH A;  4M52 A;  4USQ A;  3VRA A;  4XWR A;  1TDE A;  3QVP A;  1TRB A;  2R0P A;  2IID A;  4DNA A;  2C67 A;  2QA1 A;  3UOZ A;  1GOS A;  4GUV A;  3WE0 A;  2WPC A;  3GRT A;  3AYI A;  2J3N A;  4UDP A;  1FEA A;  4J2W A;  3E1T A;  4D03 A;  3DK9 A;  2JBV A;  3GYX A;  2YR5 A;  1Y56 A;  1GER A;  2NPX A;  3GWD A;  3NLC A;  1F3P A;  2C76 A;  1ONF A;  2JB3 A;  3C4N A;  3OZ2 A;  5J60 A;  4U8K A;  2JB1 A;  1CHU A;  1FEC A;  1BWC A;  3ALM A;  2WS3 A;  5JCK A;  1O94 A;  3CPJ G;  3LB8 A;  3ATR A;  1CJ4 A;  2BS4 A;  1H7W A;  4Y4M A;  4B66 A;  3ICS A;  2PYX A;  2BS3 A;  4BV6 A;  1E7P A;  2Z5Y A;  3K7Q X;  1JRZ A;  4A7A A;  1ZK7 A;  3BHK A;  1L9E A;  4C74 A;  2C3C A;  1O5W A;  3CPH G;  3AE4 A;  4JY2 A;  4C3Y A;  5M0Z A;  1K0L A;  1IJH A;  4P9S A;  4J56 A;  3SUC A;  3AEA A;  4ZCD A;  1DOD A;  2WDR A;  1KSS A;  3QJ4 A;  4GCM A;  2AQJ A;  4EIQ A;  4YWO A;  5GRT A;  4BK3 A;  4OPD A;  3VQR A;  2YG5 A;  3DK4 A;  4H2Q A;  4EMJ A;  4WX1 A;  4B68 A;  2RGH A;  2BXS A;  2YG3 A;  1L9D A;  3CPI G;  4XWZ A;  4Z26 A;  1B37 A;  5M10 A;  4U2T A;  3BI2 A;  1H86 A;  1VQW A;  1GRG A;  2C3D A;  2DKI A;  3UOV A;  4EQR A;  2R4E A;  2YR4 A;  3COX A;  3LJP A;  2VZ2 A;  1NDA A;  4Z2T A;  3NK0 X;  4OPI A;  2BC0 A;  2XFO A;  1PN0 A;  4OPC A;  4H2R A;  1NG4 A;  3FMW A;  3NRN A;  2CFY A;  4U2L A;  4B69 A;  4C3X A;  1JU2 A;  3ALJ A;  2C72 A;  4GDP A;  2YQU A;  2GQF A;  4H2P A;  4YXD A;  3NKS A;  4DGK A;  3AE9 A;  3DGZ A;  1E1M A;  3NIX A;  1KFY A;  3AE8 A;  1Q9I A;  1ZKQ A;  3DH9 A;  3ZYX A;  4H7U A;  1F8R A;  4J36 A;  1GV4 A;  1QJD A;  4EM4 A;  4ECH A;  2H88 A;  2YR6 A;  2IVE A;  1GT8 A;  1KDG A;  2CUL A;  1JEH A;  3L1R A;  2BC1 A;  1DOB A;  1EL9 A;  4H4X A;  3S5W A;  2FJB A;  4U8P A;  3O0H A;  4U8O A;  4AP3 A;  2WBA A;  4K8D A;  5KOX A;  3FBS A;  4U2S A;  4BK2 A;  1IUU A;  1JNZ A;  3NTA A;  2XDO A;  3RHA A;  2V3A A;  2H89 A;  4EIP A;  4ICY A;  4Z25 A;  3ISH A;  5EB5 A;  4HB9 A;  3AEC A;  3UTE A;  5IQ4 A;  1M64 A;  4UDR A;  1GRF A;  2A87 A;  3G5S A;  4Z2U A;  1XDI A;  3AYJ A;  3AE1 A;  2VQ7 A;  2XFP A;  4D04 A;  3CGE A;  2GMJ A;  3UKK A;  5JCL A;  2R0C A;  2B9X A;  2YLX A;  4IV9 A;  3QFB A;  2B7R A;  4H4Y A;  1TDK A;  3AD7 B;  4CRT A;  1ZOV A;  2YG4 A;  3V3O A;  1NHS A;  2GV8 A;  4A9W A;  1IUX A;  2I0Z A;  4FK1 A;  3R9U A;  2ZZB A;  1YQ3 A;  2PHH A;  1PBC A;  1NHQ A;  2X99 A;  4NTE A;  4EMI A;  1P2H A;  1B4V A;  1X31 B;  3P9U A;  3AED A;  1EL5 A;  1IUT A;  4H4S A;  1KNR A;  1VG9 A;  3F8P A;  1LPF A;  5TR3 A;  2XLU A;  1GRA A;  4UDQ A;  3UKH A;  2WET A;  2Z5X A;  1JRX A;  1NAA A;  1LQT A;  2X8H A;  3AD8 B;  3KKJ A;  5KRQ A;  5KVH A;  2ZZC A;  4H4P A;  4U8J A;  4AOX A;  2AR8 A;  1EL7 A;  3CTY A;  4H4Q A;  4H4W A;  2LFC A;  1ZOY A;  1NG3 A;  4B65 A;  1F8W A;  1FL2 A;  1TYP A;  3PO7 A;  3K7M X;  2BXR A;  3VRB A;  2WQY A;  3GD3 A;  2TPR A;  3V3N A;  1ELI A;  1FCD A;  1H7X A;  3CGC A;  4BUR A;  2FJE A;  4Z24 A;  5IQ1 A;  4TM4 A;  1GSN A;  1GAL A;  2XYO A;  4H2N A;  4CCR A;  4AT2 A;  1PXC A;  3GYJ A;  1E1N A;  3NYE A;  4AT0 A;  1VRQ B;  5EBK A;  4EM3 A;  3RP6 A;  1EL8 A;  2WP6 A;  3EF6 A;  3AYL A;  4KPR A;  5FS6 A;  2C70 A;  1YQ4 A;  4YTM A;  2APG A;  4MJW A;  2C65 A;  3DJG X;  2VRL A;  4ZCC A; 
#chains in the Genus database with same CATH topology
 4TM0 A;  3QVR A;  3SY4 A;  1HTJ F;  4EB6 E;  3NTD A;  3EAO A;  3NK2 X;  4IVO B;  4H9O C;  3UOX A;  5IWA T;  2BRA A;  2V7I A;  1PO2 4;  4BJY A;  3P4Q A;  3SWH A;  2LSK A;  1GTE A;  4DMV A;  5JCN A;  5ABE A;  2WAU A;  4LMK A;  3CND A;  3UT5 E;  2WPE A;  3K1S A;  3P1W A;  4C5O A;  2UXD T;  1S2Q A;  3ZCJ A;  2VWA A;  4AIS A;  5LV9 A;  4X5T A;  1LVF A;  3PUQ A;  1PDH A;  4A56 A;  5BMV E;  4B3M T;  4IST A;  4RG3 A;  1VCT A;  1SA0 E;  5EK2 A;  3F8R A;  4IRE A;  3Q5X A;  3KLJ A;  4GYS A;  4H4Z A;  5AQI B;  3OKQ A;  5FL0 A;  3I3L A;  5LG4 A;  3H4K A;  2NOX A;  2E5V A;  2XAS B;  1UK5 A;  2V1D B;  5FMN A;  2WWV A;  4CCQ A;  4TM3 A;  4JI3 T;  4KMC A;  1TDF A;  1D1C A;  4JI5 T;  5J7X A;  1US7 B;  2XVF A;  3K7T A;  3KBU A;  4DVD A;  4LU6 A;  5EB4 A;  3ONL C;  5GON E;  4H50 A;  3JAF A;  2I6H A;  3ALL A;  5LB7 B;  3SFE A;  3T2Y A;  3UKP A;  3HR0 A;  2Q0L A;  4K5R A;  4U2Y A;  5HY5 A;  2X9Y A;  1HYU A;  3VU7 H;  5L2L A;  1SUM B;  4U2Z A;  2V26 A;  2RAB A;  5HYA A;  1Z7S 4;  3BNU A;  2ACZ A;  3P4W A;  1H6V A;  4LF7 T;  4G6G A;  3DGH A;  1DNC A;  4IVM B;  2Q9Q C;  3UKF A;  4USR A;  1R08 4;  1OED B;  2A9U A;  5LYJ E;  1T98 A;  4HWH A;  2DLR A;  3SQP A;  5KWF A;  4EGW A;  1MQT D;  5AQU B;  3HL6 A;  3AEB A;  1N33 T;  2WOI A;  2V6X A;  4JQ9 A;  3NYF A;  4Z43 A;  2CLY C;  3ZMS B;  1IJ6 A;  4MHC A;  2XVJ A;  1QUU A;  3Q9T A;  4PFO A;  3LSV A;  5JDL A;  3ZST A;  1R09 4;  2YM2 A;  2PBI A;  4NWZ A;  4CBQ A;  2V7M A;  4OYJ A;  5LGN B;  5AQQ B;  3ABV A;  5DAB A;  2LEH A;  1S2Y A;  4U33 A;  4CZZ B;  1OJD A;  3DA1 A;  2VQB A;  4NTC A;  4XAX B;  2XVI A;  4G2A A;  4PJJ A;  2A72 A;  3IHR A;  2V5Z A;  4LFC T;  4TNV A;  2TMD A;  1UUS A;  1COY A;  4H63 V;  3QSM A;  3IHG A;  2X9W A;  4WCT A;  3URH A;  3WAK A;  2BAC A;  4AXP A;  4OVI A;  2KIN B;  1HF8 A;  3KVE A;  3SS1 A;  2YG7 A;  1XWM A;  2ARD A;  4J33 A;  5BR8 T;  1MIY A;  2CHO A;  3KU9 A;  4Q25 A;  1XNQ T;  3RYI E;  4JV5 T;  4UEL A;  3GDP A;  2KZ7 B;  2YG6 A;  1LTX R;  1IZN B;  2RR1 4;  3DJE A;  3KV6 A;  1CBO A;  4JEH B;  4GIW A;  2OLO A;  3RKG A;  4DV1 T;  4AKG A;  4P0A A;  3PS9 A;  3QK6 A;  3AB1 A;  3JCF A;  4I50 E;  5DJQ C;  2OA1 A;  1ZX9 A;  3GA8 A;  2YLS A;  3A8Y C;  5HWY A;  3UU8 A;  4UVA B;  2QGS A;  2M6B A;  2C66 A;  4DV3 T;  2GR3 A;  1NPX A;  1AR9 4;  3UTK A;  5U25 A;  3CMM A;  1HR0 T;  2V61 A;  2WDV A;  3H8I A;  3GN5 B;  1HFA A;  4JI7 T;  4O2A E;  2XLS A;  3G5Q A;  5BUK A;  1BGN A;  4K22 A;  5CQF A;  4QX8 B;  1RVF 4;  3Q9D A;  4EMW A;  3RIF A;  3N9P A;  2KND A;  3CX6 B;  2Y6Q A;  3SYI A;  3CNS A;  2XSA A;  3FIM B;  3P4P A;  3ATQ A;  3WI3 A;  5C2T A;  5LJN A;  3IHM A;  3IWA A;  4DSG A;  4Q4W 4;  1V59 A;  2MYS A;  1CJ2 A;  2R46 A;  5J2U E;  3NH3 X;  2FJD A;  4EYY R;  4DUY T;  3KFW X;  5L46 A;  3M3Z B;  4J2C A;  1ZEE A;  2GAH B;  3F2E A;  3EPT A;  2NVK X;  3ICT A;  3VR9 A;  1WYC A;  2CVJ A;  3NKZ A;  2H7O A;  3UU6 A;  3GDN A;  3N9O A;  2CDU A;  2BYB A;  5C3J A;  3S4U A;  5U63 A;  3ICR A;  3KVA A;  2V5D A;  2C75 A;  3HKB E;  4ZS2 A;  5L4E A;  2GEW A;  5HEJ A;  3ANW B;  5DQV A;  1PHH A;  4JY3 A;  4A99 A;  3DJB A;  1XNR T;  5FS8 A;  3T14 A;  1PJ6 A;  3HYW A;  2C64 A;  2LKH A;  2WEU A;  4N9X A;  4U74 A;  4NEW A;  2VVL G;  3JAE A;  2AXD S;  3RC3 A;  4Q4V 4;  4AP1 A;  2BBH A;  2K48 A;  2RM2 4;  5EOW A;  3RKO A;  1EBD A;  3CQC B;  2CXL A;  4LFB T;  4A5X A;  3W15 B;  3FHN A;  4Z2R A;  3C4A A;  4JI4 T;  4ISS A;  3Q5E A;  1BR1 A;  4NIQ A;  4RSL A;  3AB3 B;  3AAA B;  2QA2 A;  3C51 A;  4PK6 A;  1G8X A;  2YLW A;  4B67 A;  3CPZ A;  3SOL A;  4CNJ A;  5IPY A;  4KI0 F;  3PUY F;  4GDE A;  5E0O A;  3GD4 A;  1OJT A;  3LZX A;  1IUS A;  3PUA A;  4HA6 A;  2PYL A;  3T2K A;  3CN8 A;  4PJL A;  3NZP A;  5A1L A;  5L3B B;  4HGA A;  3ONX A;  4DBQ A;  3T31 A;  3J7Y q;  4A5L A;  4USQ A;  2LM2 A;  2NTX A;  1IJ5 A;  4DUZ T;  2IID A;  2RP4 A;  3LG7 A;  4DNA A;  2WPC A;  1BR0 A;  3E1T A;  4JUY A;  1M62 A;  2PZS A;  2HH7 A;  2JBV A;  4PW8 A;  4PJM A;  5KMP A;  3LBX B;  2JB1 A;  4U8K A;  2V7J A;  4TWF A;  2K5B B;  2BG9 A;  5CGM A;  3T1H T;  3LB8 A;  1CJ4 A;  3ZKR A;  2LLY A;  2MTQ A;  3RH3 A;  2KLQ A;  1EZ3 A;  1RUC 4;  3K7Q X;  5J2T E;  4I55 E;  2C3C A;  3FI7 A;  1R8I A;  4J56 A;  4DR2 T;  3AAI A;  2OV9 A;  4X62 T;  1XHZ A;  2AQJ A;  3U3I A;  5GRT A;  4IL9 A;  2YG5 A;  3DK4 A;  4H2Q A;  4IIJ E;  2R6G F;  5J0Z A;  4WX1 A;  4O4J E;  2BXS A;  4JLE A;  1B37 A;  3K3N A;  4AQF C;  2C5K T;  4U2T A;  2J4G A;  5L3C B;  2XY8 B;  3L3P A;  4EQR A;  2R4E A;  4K0U A;  3COX A;  3ZT7 A;  1G73 A;  3PTR B;  3MKD A;  3NK0 X;  1PN0 A;  4OPC A;  3FMW A;  4DND A;  4JYA T;  4IDN A;  2F4V T;  4GDP A;  1YXR A;  3AA0 B;  4H9P C;  4QKN A;  3DGZ A;  2WZH A;  1KFY A;  2D5U A;  2X5I D;  4GAP A;  4J36 A;  1GV4 A;  1RUI 4;  2H88 A;  1LRZ A;  1KDG A;  3L1R A;  5HXR A;  4H4X A;  3A7M A;  3E22 E;  3FBS A;  4BK2 A;  3Q5W A;  1IUU A;  5ABF A;  3NTA A;  4ICY A;  3UTE A;  2X0H A;  2MOZ A;  3AE1 A;  1V9D A;  2XFP A;  5HXC A;  4EIW A;  4QWN B;  3RYC E;  1TDK A;  3AD7 B;  1ZOV A;  2KWI B;  3V3O A;  1NHS A;  3O4X E;  4A9W A;  3R9U A;  3N9L A;  1NHQ A;  3I0O A;  1PBC A;  4EMI A;  3UUL A;  1P2H A;  5JR9 A;  3AED A;  1EL5 A;  5JDG A;  1IUT A;  2NW7 A;  2VQF T;  1N34 T;  3F8P A;  1GRA A;  2WET A;  3EAM A;  1HX1 B;  1LQT A;  4L0R A;  2W2U A;  5KVH A;  4H4P A;  4X1Y E;  3EUH A;  5JDH A;  3B13 A;  3CTY A;  3KBT A;  4LF8 T;  3Q5D A;  1F8W A;  1KK7 A;  3PO7 A;  3ZLI A;  3GD3 A;  3PUG A;  4YY3 T;  2FJE A;  5FP3 A;  4F8H A;  2BG9 C;  2VL8 A;  1GAL A;  2CE7 A;  4H2N A;  3GYJ A;  3NYE A;  4O4H E;  5ABF B;  5EBK A;  3RP6 A;  1EL8 A;  2C70 A;  3AXJ B;  4YTM A;  3EHZ A;  3DJG X;  4ZCC A;  2JPF A;  1OXZ A;  5AQR B;  3T37 A;  1KSU A;  3UOY A;  4M1P A;  1D4E A;  1BR2 A;  2IDO B;  4NPP A;  1L0V A;  2BBJ A;  3NHO X;  2RS3 4;  1O3X A;  4JNQ A;  2VVM A;  5ER0 A;  5JR9 B;  5KMR A;  3EAB A;  3U78 A;  3KPF A;  4TLZ A;  1MOK A;  2LOP A;  5FMH A;  3RP7 A;  1VBA 4;  5JDN A;  3AE2 A;  3AE5 A;  4P09 A;  4JDR A;  3NRX A;  4YHH T;  5HHF A;  3FZF B;  4X1I E;  1XPQ A;  3RGL A;  5LOV E;  1PJ5 A;  3CIR A;  4MBQ A;  1D1B A;  3B6D A;  3GRS A;  3T2Z A;  2WOW A;  1JNR A;  2B9Y A;  3MA9 A;  1E6E A;  3VR8 A;  3UTF A;  3OYZ A;  2WU2 A;  3AE6 A;  3M12 A;  2OAM A;  5JRC B;  3FXD B;  2JJ9 A;  4CN1 A;  1YKE B;  2D0U A;  3JSK A;  1FEW A;  3G06 A;  2JQH A;  4GK0 E;  1UGO A;  3ZYM A;  2DWK A;  4DV7 T;  3P4S A;  4QHO A;  1EV1 4;  2Q6U A;  2E9X A;  1N36 T;  1Q1R A;  2C4C A;  1GRE A;  2EHO B;  3GMC A;  5FXW A;  1MXT A;  1NCQ D;  4IDO A;  2WMN A;  1SEZ A;  4YKF A;  2R07 4;  1K5M D;  4I58 A;  3FZL B;  2NR4 A;  1T8B A;  1GPE A;  4H4S A;  2GRT A;  3IC9 A;  3L8K A;  4K2X A;  3UKH A;  4DV4 T;  1VBC 4;  4AKI A;  5KX5 E;  2CA5 A;  2JRK A;  1OJC A;  4UR9 A;  4O5Q A;  1XDP A;  5AQV B;  4RHV 4;  4AIU A;  1WRD A;  2GR2 A;  2QYW A;  4E7Z A;  4ILC A;  5LMN T;  3LAD A;  3SZW A;  3PU3 A;  5U1O A;  5LHG B;  5BRT A;  3LXD A;  1AR7 4;  3ZJ2 A;  5KXJ A;  2Y6R A;  4PAB A;  4HWD A;  5HEO A;  3RNM A;  1YY5 A;  3UFG A;  2WPF A;  2X9X A;  1BZL A;  1DJQ A;  1CC2 A;  3O9X A;  4B3S T;  4TN7 B;  1T7S A;  4II3 A;  2PG8 A;  4H4V A;  2AAQ A;  4OPG A;  4Z90 A;  5KVI A;  4OPL A;  2X0Y A;  4KHP T;  4IE6 A;  2E9X D;  3AEF A;  3C4W A;  3KV5 A;  1EAH 4;  2YKS A;  3QC9 A;  4AQG A;  3AE7 A;  4QH4 A;  2XFN A;  2PY5 A;  2CMR A;  2CM0 A;  1M7K A;  4ILU A;  4YT0 A;  3BQK A;  1RMU 4;  5L3G B;  4HE8 A;  2FBW A;  3LK2 B;  3VHL A;  2D2S A;  2BK4 A;  1S94 A;  1K0I A;  2YLT A;  3SZ0 A;  2PW9 A;  3SM8 A;  4ZZC A;  5CFB A;  2BKN A;  1BGJ A;  2RS5 4;  5F5W A;  4Z44 A;  1PBF A;  1DOC A;  4B63 A;  3AE3 A;  3QSE A;  4LF4 T;  4NZH A;  2A89 A;  2WP9 A;  1JOA A;  1HXS 4;  2HWC 4;  1OED A;  2ZLY A;  1X79 A;  3QSS A;  2HHH T;  3CKD A;  2CBJ A;  3V5S A;  3LDQ B;  3LK3 B;  5CKU A;  3LK4 2;  2BCG G;  2K3W A;  2WU5 A;  2W62 A;  2KT9 A;  4CI3 B;  2XQ9 A;  2XAQ B;  4K7Z A;  3FBL A;  4A98 A;  3UTG A;  5IHY A;  3NK1 X;  3ZMZ B;  2CLY B;  2L9Q A;  4WW0 A;  1J5W A;  5KMQ A;  2WES A;  5EK3 A;  2XQ5 A;  4B1B A;  2EX3 A;  3Q6J A;  2H7V C;  2WSS V;  3C4Z A;  4O8S A;  5JCI A;  3HKE E;  3NRY A;  4IHJ E;  2R9Z A;  2X8C A;  1IUV A;  1W9R A;  1FMW A;  1MND A;  3ETU A;  3DP7 A;  3E08 A;  3CK6 A;  1BR4 A;  1P2E A;  4OPT A;  4QX7 B;  2WY2 A;  1RUF 4;  1PBB A;  5L4H A;  5FKY A;  2E5L T;  3N9N A;  1OJA A;  4BA9 A;  2XLT A;  5FXX A;  3ZCI A;  2OLN A;  3Q2M A;  3UP5 A;  3CGB A;  4WBO A;  2XJ7 A;  5ETW A;  2GAG B;  3FZM B;  4GAV A;  1QO8 A;  2GB0 A;  3C98 B;  4DV2 T;  4ZN0 A;  1ZP0 A;  5TAO A;  2YEV C;  2VVS A;  2LSJ A;  1CC4 A;  3SGL A;  3DK8 A;  3N9M A;  1IAP A;  1BF3 A;  4GOU A;  2XAJ B;  3AWI A;  2UXC T;  1L9C A;  2W61 A;  3GN5 A;  3D8X A;  1PJ7 A;  2WM9 A;  4X66 T;  1IUW A;  4YHJ A;  4L5G A;  2L8K A;  4O5U A;  1Y64 B;  3PE0 A;  4A79 A;  2XUE A;  4DR7 T;  3F31 A;  4TV8 E;  1CJC A;  3T1Y T;  4GF7 A;  2E4G A;  4PDW D;  4J31 A;  1QSD A;  4ZXL A;  2ZMA A;  4ZI3 D;  1REO A;  1QLB A;  3KVB A;  2WMO A;  2W0G A;  2C5J A;  3QVP A;  4ERR A;  1TRB A;  1XZY A;  2X68 A;  2C67 A;  3UUN A;  3OYX A;  1GOS A;  4GUV A;  2I59 A;  3RYH E;  2J3N A;  1FEA A;  4J2W A;  3H3A A;  4ADZ A;  3R84 B;  4D03 A;  4IL4 A;  3DK9 A;  3GYX A;  2ODV A;  2VUR A;  4HFC A;  2VKH A;  3GWD A;  4DV5 T;  2C76 A;  4CI2 B;  1ONF A;  3C4N A;  3OZ2 A;  3ANW A;  3ALM A;  3BQI A;  4EEB A;  3CX7 B;  2CRB A;  5ADX L;  4CN4 A;  1H7C A;  1XMQ T;  2BS3 A;  3UFE A;  5LP6 E;  1K0L A;  1IJH A;  4P9S A;  4IE4 A;  3AEA A;  4CXX A;  2KSR A;  2R7F A;  4QH1 A;  3QJ4 A;  4GCM A;  4Q4Y 4;  3C50 A;  4YWO A;  3TLU A;  4BK3 A;  3VQR A;  5LNK A;  5IYZ E;  4KUM B;  1KNZ A;  3ESL A;  2RGH A;  3CPI G;  4XWZ A;  4Z26 A;  4JBW F;  2YDS A;  4EZH A;  3RIU A;  1VQW A;  3ZPO A;  2D9D A;  2HPL A;  1H8T D;  2IAK A;  1DU2 A;  2BC0 A;  2XFO A;  1VBE 4;  4X65 T;  3E0Z A;  2CFY A;  4U2L A;  1JU2 A;  3ALJ A;  2C72 A;  4ZHQ E;  4ZEY A;  4ZS3 A;  4H2P A;  3NKS A;  3DTO A;  3NIX A;  4AKL A;  4HWC A;  1UCU A;  1Q9I A;  1ZKQ A;  3F57 A;  4JI2 T;  1QJD A;  5JRE A;  4EM4 A;  2CUL A;  1NAF A;  2HWB 4;  4TUY E;  4ZI2 D;  1DOB A;  3PJA J;  1D0Y A;  2XAF B;  4UF0 B;  1Y01 A;  2WBA A;  2E2A A;  5KOX A;  4U2S A;  3RHA A;  4Z25 A;  1J1J A;  2KXP B;  4Q4X 4;  1WR6 A;  3G5S A;  3NBX X;  1PVC 4;  1XDI A;  2VQ7 A;  3ZT5 A;  4D04 A;  3CGE A;  3UKK A;  2R0C A;  3I9W A;  2YU2 A;  4WNK A;  4CN6 A;  2I0Z A;  3LBX A;  2X99 A;  4UVC B;  3RLF F;  4B3T T;  4IDQ A;  1LPF A;  4UDQ A;  1HNX T;  3CQX C;  2ZZC A;  4U8J A;  4AOX A;  2AR8 A;  4H4W A;  1AJ3 A;  2LFC A;  4Z91 A;  2R06 4;  1RHI 4;  3K7M X;  4HWF A;  3H37 A;  4UV9 B;  4F6R C;  2BXR A;  4ASK A;  3CGC A;  4Z24 A;  5IQ1 A;  3OPC A;  4O4I E;  4QH5 A;  5H6R B;  3EI0 A;  1VRQ B;  5LA6 E;  4EM3 A;  2KWH A;  3M65 A;  4KPR A;  1YQ4 A;  4MJW A;  3L39 A;  2GK9 A;  4HFB A;  4LA1 A;  3PU8 A;  1GEU A;  4U31 A;  5JH7 E;  2VAS A;  1I6Z A;  3UKL A;  1NEN A;  3KPK A;  1XDO A;  1DJN A;  1Z8U A;  3PUR A;  1PBE A;  4QXH B;  3CGD A;  4EZ4 A;  3H8L A;  3UUB A;  3RIU C;  3BHF A;  2X66 A;  5DQW A;  2JKC A;  2UXN B;  4DBR A;  3D1C A;  5KMS A;  4HWI B;  5HXE A;  1D4C A;  2V6O A;  2VRM A;  2VL0 A;  3B57 A;  4KHZ F;  2VKO A;  2NW9 A;  3IBP A;  3UP4 A;  3S61 A;  2GQW A;  2OA5 A;  1MMD A;  2BVL A;  1UKV G;  3CNP A;  2BG9 E;  1NHP A;  1D0X A;  5KOW A;  4ILA A;  1RSG A;  1XMO T;  3AEE A;  2Y48 B;  2Q7V A;  2Z6E A;  4HFV A;  2FJA A;  1MMG A;  4KP3 C;  4GKK T;  2UZZ A;  1VBD 4;  3KIN B;  3UU5 A;  1GND A;  3M0O A;  3RRC A;  2XFU A;  1K0J A;  1OWA A;  4U3C A;  2GR1 A;  3M13 A;  5FXZ A;  2XAH B;  5FVL A;  1CC6 A;  5FS7 A;  3ZDN A;  1D5T A;  4CXY A;  2WP5 A;  1RUG 4;  1YD8 G;  3N5L A;  1GRT A;  4X9M A;  4YKG A;  4JNA A;  3SFD A;  2X3N A;  4J57 A;  2EQ6 A;  1XAN A;  4YTN A;  3AXJ A;  3C4X A;  4H4T A;  1IBK T;  3UKQ A;  1LQU A;  3GWF A;  3AAE B;  3RP8 A;  1ZMC A;  5HXI A;  5AQF B;  4DR3 T;  2YWL A;  1GQE A;  4XXG A;  3D0T A;  2Y6X A;  1KEY A;  2YN6 A;  2HQM A;  3IF8 B;  3LFM A;  5FL1 A;  4RG4 A;  2BS2 A;  4II2 A;  2VVN A;  3F8D A;  3DJD A;  1HNZ T;  1H81 A;  2W66 A;  5LGU B;  1FEB A;  4H4U A;  2YIN A;  3V76 A;  4CY6 A;  2ODU A;  1F8S A;  1NWM X;  2IVD A;  2C73 A;  4KBM B;  4OPU A;  4EOZ B;  4DSH A;  2RA1 A;  5LBM A;  1JRY A;  2C7G A;  4Y4N A;  1SE7 A;  3GMI A;  1YKJ A;  2LKG A;  2WOV A;  3QFA A;  3FZK B;  2R45 A;  4YSX A;  4AOS A;  5BUL A;  1FIO A;  3EDU A;  4QXC B;  3K3Q C;  5JRC A;  2JMH A;  4GYR A;  1FOH A;  5F3J A;  2R0G A;  1PXB A;  5LJM A;  4L9I A;  4C90 A;  1UUR A;  2F5Z A;  4A6N B;  4H63 H;  1GRB A;  1D4D A;  5ABH A;  1RUD 4;  2EHO A;  2NTY A;  2XLR A;  4OHF A;  2ZZ0 A;  3TKL B;  4EAH A;  1POV 0;  3OBV E;  5AQT B;  1CF3 A;  2WB5 A;  1F6M A;  2RGJ A;  3PUZ F;  2WDQ A;  4LMJ A;  3UCL A;  1YW0 A;  5JVD E;  3JC6 D;  2ACX A;  1VRB A;  3AEG A;  2VVL A;  2BAB A;  4C77 A;  1WLX A;  4IE7 A;  2DKH A;  3NYC A;  3CX8 B;  4BK1 A;  1RUE 4;  3R6N A;  1N4W A;  4ADW A;  4EQS A;  4DID B;  2GR0 A;  3FBZ A;  5F8P A;  3A5X A;  1GRH A;  2BK5 A;  4GR1 A;  3BI5 A;  4DV0 T;  1CUN A;  2V8S V;  4OK0 A;  3NN6 X;  2XM1 A;  5FY1 A;  5GSN A;  4CQI A;  4U7Y A;  4GKJ T;  1VCS A;  2LSY A;  2BCP A;  2B9W A;  2X8G A;  2I0M A;  4HFD A;  5HAX A;  1H83 A;  2WZI A;  3CNJ A;  4FX9 A;  5LHI B;  3H3M A;  4U72 A;  3RQW A;  1RYI A;  3G5R A;  1RP0 A;  2UXX B;  5JR9 C;  1Y56 B;  4J34 A;  2EHO D;  1OJ9 A;  2W63 A;  3I0Q A;  5AQN B;  1Q1W A;  2XFQ A;  4B64 A;  4LII A;  3HYV A;  2JIW A;  3X1D A;  3ZJ1 A;  4G74 A;  1D7L A;  1FMV A;  2RGO A;  2NW8 A;  3MK7 C;  4BJZ A;  4EED A;  4PNI A;  2E1M A;  4FDC B;  2UUC T;  4BJM A;  3RQU A;  4IDZ A;  3FPZ A;  2JAE A;  4KX6 A;  3II4 A;  2GVC A;  3EAN A;  3N9Q A;  2VKD A;  2K9A A;  1DOE A;  1LV0 A;  3CNT A;  1BKW A;  1W0A A;  4X64 T;  3NT6 A;  3FXE B;  5JTG A;  2JK6 A;  3NGC X;  4UV8 B;  4ZI7 E;  2GF3 A;  3IF9 A;  3ADA B;  4TLX A;  4TNW A;  3NG7 X;  1LVK A;  5CA1 E;  2A8X A;  5EK4 A;  4IGU A;  2YVJ A;  4CNK A;  5HEU A;  2B7S A;  1H84 A;  2YLR A;  1W09 A;  2YM1 A;  4EXT A;  2YDQ A;  2CCQ A;  3BQL A;  5FS9 A;  1U5P A;  3L09 A;  1LKX A;  3VRA A;  2YOE A;  5AQK B;  2DCF A;  4GK5 E;  4H9N C;  2W00 A;  2QA1 A;  3UOZ A;  5FXV A;  4FJO A;  3AYI A;  4UDP A;  1S35 A;  2LOS A;  2BVM A;  2BKP A;  2V5C A;  4IE0 A;  4YJ3 E;  2YR5 A;  4DMW A;  2NPX A;  2RPA A;  3ZSS A;  2XQ7 A;  1F3P A;  5J60 A;  1FEC A;  2WS3 A;  2VB6 A;  5JCK A;  4AQY T;  3CPJ G;  4NNJ A;  2E9X C;  5KNL A;  2J47 A;  2V6Y B;  2JQQ A;  3L8R A;  2G0U A;  2Q9Q B;  3PUW F;  4XZC A;  2Z5Y A;  4U7I A;  1WYB A;  3QNU A;  4JI0 T;  4PK4 A;  1ZK7 A;  3BHK A;  1L9E A;  1OOP D;  2XQ6 A;  1O5W A;  5AQM B;  3CPH G;  3AE4 A;  4TWH A;  5M0Z A;  5LG3 A;  2BDE A;  4ZCD A;  2OLT A;  2WDR A;  2Q9Q D;  2W67 A;  4ANJ A;  4QXB B;  1B7T A;  4FI5 A;  2MBG A;  5FNV E;  1OED E;  2IC9 A;  1L9D A;  2XQ4 A;  3K3O A;  5M10 A;  3ZC1 A;  3BI2 A;  1H86 A;  1GRG A;  5M4Y A;  2C3D A;  4H9Q C;  5AQP B;  2DKI A;  3UOV A;  4H9R C;  1NDA A;  4OPI A;  1ASJ 4;  2ES0 A;  1MIW A;  5HCM A;  3OTO T;  1NG4 A;  2ZM8 A;  4B69 A;  4C3X A;  2GQF A;  4YXD A;  5L3E B;  3UQ4 A;  2X51 A;  5H6Q B;  4NUU A;  3DH9 A;  3PUX F;  3ZYX A;  4H7U A;  1F8R A;  1VRH 4;  4UXN B;  2IVE A;  1EL9 A;  4U8P A;  4AP3 A;  3O0H A;  3RIA A;  1HG2 A;  4K8D A;  1BEV 4;  5L3F B;  2V3A A;  4LML A;  3ISH A;  5EB5 A;  4HB9 A;  2MAW A;  3AEC A;  1M64 A;  4UDR A;  2A87 A;  3PJA A;  4Z2U A;  4DR1 T;  3HI2 A;  5JCL A;  2P9B A;  3RYF E;  2GMJ A;  5HXS A;  4IV9 A;  3NZQ A;  1HG5 A;  3FZH B;  3RC8 A;  4H4Y A;  2A2F X;  4EV6 A;  4X1K E;  3JAD A;  4AKR B;  3SX6 A;  1FJG T;  2GV8 A;  4FK1 A;  2ZZB A;  1YQ3 A;  2LJL A;  4A97 A;  4B6X A;  4LF6 T;  3O1H A;  1B4V A;  1X31 B;  3P9U A;  2M67 A;  1KNR A;  2XLU A;  2FUP A;  2Z5X A;  1JRX A;  5KRQ A;  2LSG A;  2UUA T;  4YJ2 E;  2M6I A;  5CB4 E;  1E1H B;  2K24 A;  1NG3 A;  4B65 A;  1FL2 A;  2UXB T;  1COV 4;  3NVO A;  2DHR A;  1OED C;  5LGT B;  2WQY A;  3VRB A;  3V3N A;  1ELI A;  1FCD A;  1H7X A;  2PTF A;  2X0L B;  1T72 A;  4COF A;  4AT2 A;  4AT0 A;  4TX5 A;  1E1N A;  2XQ3 A;  5AFU L;  4TWD A;  3AYL A;  4CXW A;  3K8P C;  2C65 A;  1XHX A;  3ETV A;  4I43 B;  3WAJ A;  2VRL A;  4DV6 T;  5JQG E;  3QOF A;  1KNP A;  1PS9 A;  3I6D A;  2ZM0 A;  2C5I T;  2B76 A;  4JN9 A;  3OVU A;  2V7L A;  2LHN A;  2QCU A;  3AA7 B;  3C64 A;  4E7S A;  4X9N A;  4NTD A;  4NEV A;  1DXL A;  2XQ8 A;  4X20 E;  4NXN T;  2H3R A;  1I94 T;  4UEM A;  1E1K A;  3VRD B;  2RS1 4;  2X50 A;  4UF0 A;  1NHR A;  1ZMD A;  5LXT E;  1YKH B;  3N2K E;  2ZM2 A;  3DJJ A;  2RMU 4;  4ZI3 C;  2OAL A;  4TM1 A;  2DNX A;  2VKJ A;  3LJC A;  2EQ7 A;  2YLZ A;  3PUV F;  2R04 4;  2VQE T;  2XCG A;  2Y8D A;  3GMB A;  1B8S A;  3V5U A;  2LSI A;  3AA6 B;  1YQZ A;  3ZN1 B;  1X9B A;  3VKG A;  3RED A;  1AL2 4;  2NWB A;  2XSB A;  3ZYK A;  1IBL T;  1VDC A;  4X4J A;  4REK A;  4K5S A;  4IA5 A;  1RUJ 4;  2XLP A;  2W0H A;  4I59 A;  3GYI A;  2YVF A;  2BK3 A;  1UX5 A;  4APN A;  3J8F 4;  3KD9 A;  4U8M A;  4YSZ A;  2Q0K A;  1Y0P A;  1D0Z A;  2CHN A;  1N1P A;  4EQX A;  4JEU B;  3K30 A;  4A65 A;  3EDV A;  1XI1 A;  2YAU A;  3QB5 K;  4FK1 C;  4YLH A;  1HCI A;  1MO9 A;  4C91 A;  3N2O A;  4PAG A;  2VOU A;  1AR8 4;  1PBD A;  1PXA A;  4YSH A;  5JDF A;  2EQ8 A;  3MZK B;  4OFZ A;  4V1A v;  4Y4L A;  4YSY A;  5AQL B;  3FG2 P;  2LRL A;  2LM9 A;  4YTP A;  3LZW A;  1HRI 4;  4AQF A;  2YU1 A;  4BJN A;  3PUS A;  4PAA A;  1WCR A;  1Z6L A;  2CWO A;  1GXF A;  5CA0 E;  3B3R A;  4DR5 T;  3PVC A;  4EYU A;  3RF1 A;  2BA9 A;  2XVE A;  3P4R A;  3UKA A;  5FY7 A;  2WWU A;  2ZBW A;  4OCG A;  2V60 A;  2CXF A;  3AXB A;  1ZY8 A;  4ZI2 C;  4P1N A;  4TV9 E;  3HA4 A;  1VBB 4;  2QA7 A;  1ZDL A;  2QAE A;  3BI4 A;  3NN0 X;  4PK5 A;  1M6I A;  3ONJ A;  1GTH A;  3GQH A;  3UQ7 A;  5C8Y E;  3KA7 A;  1PO1 4;  2YK0 A;  1B5Q A;  5FYM A;  4GRT A;  4JI1 T;  5AQS B;  2WBL A;  4HFE A;  3KDS E;  4NXM T;  3AVS A;  2XPK A;  2O9Z A;  4B3R T;  4HN9 A;  5BVA A;  3P8C D;  2V3B A;  4LFA T;  3ZEF B;  3JBG 4;  2CWY A;  3HZL A;  5KMG P;  1MMN A;  5EZY E;  3I1A A;  3P50 A;  1AOG A;  2YDR A;  1GET A;  1ZV4 X;  2L3L A;  2V7K A;  1VG0 A;  2WHD A;  3CQG B;  2YVG A;  4U8I A;  1LJ1 A;  3I9Y A;  2PLV 4;  1CJ3 A;  3DME A;  2HN1 A;  4TZ4 C;  5L3D B;  1TDN A;  1W4X A;  1CL0 A;  5JCM A;  3IA3 A;  2KMF A;  3AD9 B;  4U8N A;  3CWZ B;  3TLT A;  2IW5 B;  1Z0P A;  2ZM6 T;  3LOV A;  4H4R A;  4BAY B;  3IEE A;  2XVH A;  2HPJ A;  4LF9 T;  4I4T E;  3GQK A;  5DBJ A;  5LMU T;  1GES A;  4UVB B;  3GWH A;  1IBM T;  1K4Q A;  1TYT A;  2PJQ A;  4OX9 T;  3ZMU B;  2DWG A;  4HTE A;  1S3B A;  3OC4 A;  5HYM A;  4E0V A;  3C96 A;  3O1I A;  1N4V A;  3BNM A;  2EQ9 A;  4ZOL E;  4U8L A;  3T8O A;  1HS7 A;  2XHE B;  2J1D G;  2CXD A;  2QRX A;  4DR4 T;  2JB2 A;  1H82 A;  4K0K T;  1O95 A;  1HRV 4;  4G63 A;  4ZZB A;  2HN2 A;  4UP3 A;  1NA1 D;  5J1G A;  4IDP A;  3UU4 A;  2XAG B;  3ZYL A;  4OYK A;  2BG9 B;  1E1L A;  3ITJ A;  4AKH A;  1NEK A;  4EQW A;  4O4L E;  3AA1 B;  2SPC A;  4CI1 B;  1N4U A;  2R4J A;  3NNE A;  4A6N A;  3N2G E;  1D7Y A;  5HEG A;  2CPT A;  2XZE A;  3P7I A;  2BKO A;  3SRZ A;  2D0T A;  1RUH 4;  2NP9 A;  4HEA A;  2LHR A;  1PIV 4;  1TDO A;  3TLS A;  3ZC0 A;  1U4Q A;  3GSI A;  4G73 A;  1KF6 A;  2A3D A;  1E39 A;  4LF5 T;  4Z8X A;  1ZHC A;  3PV0 F;  3T0K A;  4IA6 A;  2E8I A;  1XHC A;  2GH5 A;  2IC6 A;  2IIU A;  4MAL A;  4WYV A;  4CY8 A;  2W4X A;  3J9X 1;  2PFV A;  2LT3 A;  3TLV A;  3UTH A;  5LCY A;  5CJ5 A;  5KDM C;  1HX8 A;  1LVL A;  2X67 A;  3ZMT B;  4G6H A;  4YFS A;  2IUB A;  1S3E A;  3FB2 A;  2IHR 1;  2GMH A;  4GB3 4;  4M52 A;  4I0U A;  1UX4 A;  2XM2 A;  4XWR A;  3MJX A;  1TDE A;  5JDQ A;  3EVY A;  2R0P A;  3UU3 A;  3QB5 A;  3HKC E;  3WE0 A;  2QVA A;  3GRT A;  2UUB T;  2XQY A;  4O2B E;  5L47 A;  2MPK A;  3SZF A;  2DL1 A;  1Y56 A;  1GER A;  3NLC A;  3SXI A;  4NUV A;  2JB3 A;  1CHU A;  1BWC A;  1O94 A;  3ZT6 A;  2N9D A;  5AQH B;  3RI5 A;  3ATR A;  1AR6 4;  2BS4 A;  4N78 D;  2UU9 T;  1H7W A;  4Y4M A;  1D4M 4;  1SHZ C;  3HYX A;  4B66 A;  3UUM A;  2PYX A;  3ICS A;  3B5M A;  4BV6 A;  1E7P A;  3KV9 A;  1JRZ A;  3JD7 4;  5ABG A;  4C74 A;  3AVR A;  3OJA A;  4C3Y A;  4JY2 A;  4H9S E;  3SUC A;  1DOD A;  1E2A A;  1KSS A;  2N2N A;  4EIQ A;  4OPD A;  4JI6 T;  4XBF B;  4HFH A;  4ILB A;  4EMJ A;  5JDM A;  4B68 A;  2YG3 A;  3HKD E;  3PDY A;  4PFP A;  3RRW A;  3CML A;  3ZMV B;  5AQO B;  3MAC A;  4HFI A;  5HXH A;  2YR4 A;  3LJP A;  2B1E A;  2VZ2 A;  3CVR A;  4Z2T A;  4H2R A;  3NRN A;  3UUX B;  5AQG B;  3JC6 C;  2YQU A;  5LHH B;  2BZB A;  4DGK A;  1MMA A;  3AE9 A;  4AI6 A;  2XTL A;  1E1M A;  1MIV A;  2JQK A;  3AE8 A;  1MNE A;  1HNW T;  4ECH A;  2YR6 A;  3KV4 A;  1GT8 A;  1JEH A;  3MXZ A;  2PYJ A;  2BC1 A;  3S5W A;  5FVK A;  2FJB A;  4U8O A;  1N32 T;  1WFD A;  1ZKE A;  1JNZ A;  2LE8 A;  2WCA A;  4JI8 T;  2XDO A;  4EIP A;  2H89 A;  5IQ4 A;  1J5E T;  5FY0 A;  5HCJ A;  5HEH A;  1GRF A;  2J62 A;  3AYJ A;  2JQ9 A;  3RX6 A;  1D1A A;  2B9X A;  2YLX A;  2BRY A;  3QFB A;  2B7R A;  4CRT A;  3NWI A;  4WBN E;  4G9K A;  4P0B A;  2YG4 A;  3VKH A;  2N1G A;  1IUX A;  4MLK A;  2PHH A;  4NTE A;  4HKA A;  3RHW A;  5IUX A;  4WZX A;  2VK9 A;  4IE5 A;  5HWX A;  2V6Y A;  2EHO C;  1VG9 A;  5TR3 A;  2Q9Q A;  3KKJ A;  1NAA A;  2X8H A;  3AD8 B;  2AE9 A;  2C0S A;  4MFR A;  5LBQ B;  4PJN A;  3BK9 A;  1EL7 A;  4H4Q A;  2E9X B;  4UIG A;  1WR0 A;  1ZOY A;  1VOM A;  3RPU A;  3ZN0 B;  1TYP A;  2CEA A;  4DO0 A;  2CBI A;  3TLW A;  2XQA A;  2TPR A;  4BUR A;  3SZC A;  2LRK A;  2IML A;  4DR6 T;  5AQJ B;  4TM4 A;  1GSN A;  2XYO A;  4CCR A;  3O1J A;  1PXC A;  2X9H A;  4IT4 A;  1W0B A;  2WP6 A;  3EF6 A;  5FS6 A;  2DI4 A;  2JMK A;  2APG A;  3QUJ A;  4A7A A; 
#chains in the Genus database with same CATH homology
 4TM0 A;  3QVR A;  3SY4 A;  1KNP A;  1PS9 A;  3NTD A;  3I6D A;  3EAO A;  3NK2 X;  4IVO B;  4LA1 A;  3T37 A;  3UOX A;  1KSU A;  1GEU A;  3UOY A;  2B76 A;  2BRA A;  4JN9 A;  1D4E A;  1L0V A;  4BJY A;  3P4Q A;  1GTE A;  2QCU A;  3NHO X;  3UKL A;  4X9N A;  1NEN A;  4JNQ A;  2VVM A;  3KPK A;  4NTD A;  5JCN A;  1DJN A;  1DXL A;  4NEV A;  1PBE A;  5ER0 A;  3CND A;  3CGD A;  3KPF A;  4TLZ A;  5KMR A;  1MOK A;  3H8L A;  2WPE A;  4C5O A;  3P1W A;  5FMH A;  1S2Q A;  3RP7 A;  3BHF A;  1E1K A;  3VRD B;  3AE2 A;  3AE5 A;  2JKC A;  2X50 A;  5LV9 A;  1NHR A;  3D1C A;  4JDR A;  5KMS A;  1ZMD A;  1PDH A;  3DJJ A;  5HHF A;  1D4C A;  2V6O A;  2VRM A;  2OAL A;  1XPQ A;  4RG3 A;  3F8R A;  4TM1 A;  1PJ5 A;  3CIR A;  3KLJ A;  3UP4 A;  3B6D A;  4H4Z A;  3GRS A;  2EQ7 A;  3T2Z A;  2YLZ A;  3S61 A;  2GQW A;  2WOW A;  1JNR A;  2B9Y A;  3I3L A;  1E6E A;  2XCG A;  3VR8 A;  3H4K A;  3GMB A;  2E5V A;  1B8S A;  1UKV G;  3CNP A;  1NHP A;  3UTF A;  2WU2 A;  1YQZ A;  3AE6 A;  5KOW A;  3M12 A;  2OAM A;  3RED A;  4CCQ A;  4TM3 A;  4X4J A;  1VDC A;  1RSG A;  1TDF A;  4REK A;  4K5S A;  4IA5 A;  2XLP A;  2W0H A;  4I59 A;  5J7X A;  3GYI A;  2YVF A;  3AEE A;  3JSK A;  2XVF A;  3K7T A;  2BK3 A;  2Q7V A;  4LU6 A;  5EB4 A;  2FJA A;  4H50 A;  4APN A;  2UZZ A;  3P4S A;  3KD9 A;  4U8M A;  4YSZ A;  2Q0K A;  1Y0P A;  1N1P A;  2Q6U A;  3ALL A;  4EQX A;  1GND A;  3M0O A;  1Q1R A;  3SFE A;  2C4C A;  2XFU A;  3T2Y A;  1GRE A;  1K0J A;  2Q0L A;  3GMC A;  4K5R A;  3K30 A;  5HY5 A;  1MXT A;  4A65 A;  3M13 A;  2GR1 A;  1HYU A;  2YAU A;  1CC6 A;  5FS7 A;  4FK1 C;  3ZDN A;  1D5T A;  2WP5 A;  1SEZ A;  1MO9 A;  4YKF A;  1GRT A;  4I58 A;  2RAB A;  4X9M A;  1GPE A;  2ACZ A;  1H6V A;  2GRT A;  2VOU A;  3BNU A;  3IC9 A;  3DGH A;  3SFD A;  2X3N A;  1PBD A;  1PXA A;  2EQ6 A;  1DNC A;  4J57 A;  4JNA A;  4YSH A;  4IVM B;  3UKF A;  2EQ8 A;  1XAN A;  4USR A;  4YTN A;  1OJC A;  4H4T A;  4O5Q A;  3UKQ A;  4Y4L A;  1LQU A;  4YSY A;  3GWF A;  3RP8 A;  3FG2 P;  4YTP A;  3LZW A;  1ZMC A;  5HXI A;  2YWL A;  3SQP A;  5KWF A;  4XXG A;  2WOI A;  3AEB A;  2GR2 A;  4JQ9 A;  3NYF A;  4Z43 A;  3LAD A;  2HQM A;  4PAA A;  3SZW A;  2XVJ A;  1Z6L A;  3Q9T A;  1GXF A;  4RG4 A;  2BS2 A;  5U1O A;  4II2 A;  2YM2 A;  3B3R A;  4NWZ A;  4CBQ A;  3PVC A;  5BRT A;  3LXD A;  3F8D A;  3DJD A;  5KXJ A;  2Y6R A;  4PAB A;  3ABV A;  3RNM A;  1S2Y A;  1YY5 A;  1H81 A;  2BA9 A;  2WPF A;  2XVE A;  1FEB A;  1OJD A;  3P4R A;  3DA1 A;  4H4U A;  3UKA A;  2VQB A;  4NTC A;  3V76 A;  4CY6 A;  2XVI A;  1BZL A;  1F8S A;  1DJQ A;  2ZBW A;  2V5Z A;  1CC2 A;  2C73 A;  4OCG A;  4OPU A;  4G6G A;  2IVD A;  4DSH A;  1JRY A;  2C7G A;  2V60 A;  2TMD A;  4II3 A;  1COY A;  3AXB A;  1ZY8 A;  4Y4N A;  4H4V A;  3QSM A;  2AAQ A;  4OPG A;  5KVI A;  3IHG A;  4OPL A;  1YKJ A;  2WOV A;  1ZDL A;  2QAE A;  3BI4 A;  3AEF A;  3QFA A;  4WCT A;  3URH A;  2BAC A;  2R45 A;  3NN0 X;  4OVI A;  4YSX A;  1M6I A;  1GTH A;  3L8K A;  4AOS A;  3KVE A;  5BUL A;  3GQH A;  2YG7 A;  2ARD A;  4J33 A;  3KA7 A;  3KU9 A;  3AE7 A;  1FOH A;  1B5Q A;  3GDP A;  2R0G A;  2XFN A;  2YG6 A;  1PXB A;  4GRT A;  1LTX R;  4YT0 A;  3DJE A;  1CBO A;  2O9Z A;  5BVA A;  2FBW A;  2OLO A;  2F5Z A;  2V3B A;  4A6N B;  3PS9 A;  3AB1 A;  1GRB A;  2BK4 A;  1K0I A;  1D4D A;  2OA1 A;  2YLT A;  1ZX9 A;  2YLS A;  3HZL A;  3SZ0 A;  3SM8 A;  2XLR A;  1AOG A;  1GET A;  1BGJ A;  2C66 A;  2ZZ0 A;  2GR3 A;  4Z44 A;  1NPX A;  1PBF A;  1DOC A;  4B63 A;  1CF3 A;  3AE3 A;  1VG0 A;  3QSE A;  5U25 A;  3CMM A;  2WHD A;  1F6M A;  2RGJ A;  2V61 A;  2WDV A;  2YVG A;  4U8I A;  3H8I A;  4NZH A;  2A89 A;  1LJ1 A;  2WP9 A;  1JOA A;  2WDQ A;  3UCL A;  1CJ3 A;  3DME A;  3QSS A;  1TDN A;  1W4X A;  2XLS A;  3AEG A;  2VVL A;  3G5Q A;  1BGN A;  5BUK A;  1CL0 A;  2BAB A;  4K22 A;  2BCG G;  5CKU A;  5CQF A;  4C77 A;  2WU5 A;  5JCM A;  2DKH A;  4U8N A;  3AD9 B;  3NYC A;  4EMW A;  4BK1 A;  3SYI A;  3LOV A;  2Y6Q A;  3CNS A;  4H4R A;  1N4W A;  3FIM B;  4K7Z A;  3P4P A;  3ATQ A;  5C2T A;  3IHM A;  4ADW A;  3IWA A;  4EQS A;  4DSG A;  3UTG A;  1V59 A;  2GR0 A;  2XVH A;  1CJ2 A;  2R46 A;  3NH3 X;  3NK1 X;  2FJD A;  1GRH A;  2BK5 A;  4GR1 A;  3GQK A;  5DBJ A;  5L46 A;  1GES A;  3BI5 A;  1K4Q A;  1TYT A;  5KMQ A;  2WES A;  3NN6 X;  2GAH B;  4B1B A;  1S3B A;  3EPT A;  4YKG A;  3Q6J A;  5GSN A;  2NVK X;  3ICT A;  3VR9 A;  2BCP A;  2CVJ A;  2B9W A;  2X8G A;  3OC4 A;  5HYM A;  5JCI A;  2R9Z A;  4E0V A;  3C96 A;  1H83 A;  2X8C A;  1IUV A;  3CNJ A;  3GDN A;  1N4V A;  3BNM A;  4FX9 A;  2EQ9 A;  4U8L A;  1RYI A;  2BYB A;  5C3J A;  2CDU A;  1RP0 A;  3G5R A;  5U63 A;  3ICR A;  2JB2 A;  1H82 A;  1Y56 B;  4J34 A;  1OJ9 A;  1Q1W A;  2XFQ A;  1O95 A;  1P2E A;  2C75 A;  4LII A;  4OPT A;  4B64 A;  3HYV A;  2GEW A;  4UP3 A;  1PBB A;  1PHH A;  4G74 A;  1D7L A;  4JY3 A;  4A99 A;  1E1L A;  3ITJ A;  5FS8 A;  3T14 A;  1NEK A;  1PJ6 A;  2RGO A;  3HYW A;  1OJA A;  2C64 A;  2XLT A;  2WEU A;  4EQW A;  4N9X A;  4BJZ A;  2E1M A;  2OLN A;  4FDC B;  4NEW A;  2VVL G;  3UP5 A;  4A6N A;  2R4J A;  1N4U A;  3FPZ A;  3NNE A;  2JAE A;  4AP1 A;  3CGB A;  2GAG B;  1D7Y A;  5EOW A;  4K2X A;  4GAV A;  4KX6 A;  1QO8 A;  3II4 A;  2GB0 A;  2GVC A;  3EAN A;  1EBD A;  4ZN0 A;  1ZP0 A;  1CC4 A;  3SGL A;  3DK8 A;  1DOE A;  1LV0 A;  1TDO A;  4Z2R A;  3C4A A;  1BF3 A;  4G73 A;  3GSI A;  3CNT A;  1KF6 A;  1E39 A;  1BKW A;  3AWI A;  1L9C A;  3NT6 A;  4RSL A;  2JK6 A;  3NGC X;  3T0K A;  2GF3 A;  3D8X A;  4IA6 A;  1PJ7 A;  3IF9 A;  3ADA B;  1XHC A;  2QA2 A;  2GH5 A;  4TLX A;  2YLW A;  4CY8 A;  4B67 A;  1IUW A;  3NG7 X;  2A8X A;  4CNJ A;  4O5U A;  5IPY A;  2YVJ A;  4CNK A;  4A79 A;  3UTH A;  2B7S A;  1H84 A;  2YLR A;  4GDE A;  1CJC A;  3GD4 A;  4GF7 A;  2E4G A;  1OJT A;  2YM1 A;  3LZX A;  1IUS A;  1LVL A;  4HA6 A;  4J31 A;  4G6H A;  3T2K A;  3CN8 A;  1S3E A;  1REO A;  5FS9 A;  3T31 A;  4A5L A;  1QLB A;  2GMH A;  4M52 A;  4USQ A;  3VRA A;  4XWR A;  1TDE A;  3QVP A;  1TRB A;  2R0P A;  2IID A;  4DNA A;  2C67 A;  2QA1 A;  3UOZ A;  1GOS A;  4GUV A;  3WE0 A;  2WPC A;  3GRT A;  3AYI A;  2J3N A;  4UDP A;  1FEA A;  4J2W A;  3E1T A;  4D03 A;  3DK9 A;  2JBV A;  3GYX A;  3SZF A;  2YR5 A;  1Y56 A;  1GER A;  2NPX A;  3GWD A;  3NLC A;  3SXI A;  1F3P A;  2C76 A;  1ONF A;  2JB3 A;  3C4N A;  3OZ2 A;  5J60 A;  4U8K A;  2JB1 A;  1CHU A;  1FEC A;  1BWC A;  5KMP A;  3ALM A;  2WS3 A;  5JCK A;  1O94 A;  3CPJ G;  3LB8 A;  4NNJ A;  3ATR A;  1CJ4 A;  5KNL A;  2BS4 A;  1H7W A;  4Y4M A;  3HYX A;  4B66 A;  3ICS A;  2PYX A;  2BS3 A;  4BV6 A;  1E7P A;  2Z5Y A;  3K7Q X;  1JRZ A;  4A7A A;  1ZK7 A;  3BHK A;  1L9E A;  4C74 A;  2C3C A;  1O5W A;  3CPH G;  3AE4 A;  4JY2 A;  4C3Y A;  5M0Z A;  1K0L A;  1IJH A;  4P9S A;  4J56 A;  3UKP A;  3SUC A;  3AEA A;  4ZCD A;  1DOD A;  2WDR A;  1KSS A;  3QJ4 A;  4GCM A;  2AQJ A;  4EIQ A;  4YWO A;  5GRT A;  4BK3 A;  4OPD A;  3VQR A;  2YG5 A;  3DK4 A;  4H2Q A;  4EMJ A;  4WX1 A;  4B68 A;  2RGH A;  2BXS A;  2YG3 A;  1L9D A;  3CPI G;  4XWZ A;  4Z26 A;  1B37 A;  5M10 A;  4U2T A;  3BI2 A;  1H86 A;  1VQW A;  1GRG A;  2C3D A;  2DKI A;  3UOV A;  4EQR A;  2R4E A;  2YR4 A;  3COX A;  3LJP A;  2VZ2 A;  1NDA A;  4Z2T A;  3NK0 X;  4OPI A;  2BC0 A;  2XFO A;  1PN0 A;  4OPC A;  4H2R A;  1NG4 A;  3FMW A;  3NRN A;  2CFY A;  4U2L A;  4B69 A;  4C3X A;  1JU2 A;  3ALJ A;  2C72 A;  4GDP A;  2YQU A;  2GQF A;  4H2P A;  4YXD A;  3NKS A;  4DGK A;  3AE9 A;  3DGZ A;  1E1M A;  3NIX A;  1KFY A;  3AE8 A;  1Q9I A;  1ZKQ A;  3DH9 A;  3ZYX A;  4GAP A;  4H7U A;  1F8R A;  4J36 A;  1GV4 A;  1QJD A;  4EM4 A;  4ECH A;  2H88 A;  2YR6 A;  2IVE A;  1GT8 A;  1KDG A;  2CUL A;  1JEH A;  3L1R A;  2BC1 A;  1DOB A;  1EL9 A;  4H4X A;  3S5W A;  2FJB A;  4U8P A;  3O0H A;  4U8O A;  4AP3 A;  2WBA A;  4K8D A;  5KOX A;  3FBS A;  4U2S A;  4BK2 A;  1IUU A;  1JNZ A;  3NTA A;  2XDO A;  3RHA A;  2V3A A;  2H89 A;  4EIP A;  4ICY A;  4Z25 A;  3ISH A;  5EB5 A;  4HB9 A;  3AEC A;  3UTE A;  5IQ4 A;  1M64 A;  4UDR A;  1GRF A;  2A87 A;  3G5S A;  4Z2U A;  1XDI A;  3AYJ A;  3AE1 A;  2VQ7 A;  2XFP A;  4D04 A;  3CGE A;  2GMJ A;  3UKK A;  5JCL A;  2R0C A;  2B9X A;  2YLX A;  4IV9 A;  2BRY A;  3QFB A;  2B7R A;  4H4Y A;  1TDK A;  3AD7 B;  4CRT A;  4G9K A;  1ZOV A;  2YG4 A;  3SX6 A;  1NHS A;  3V3O A;  2GV8 A;  4A9W A;  1IUX A;  2I0Z A;  4FK1 A;  3R9U A;  2ZZB A;  1YQ3 A;  2PHH A;  1PBC A;  1NHQ A;  2X99 A;  4NTE A;  4EMI A;  1P2H A;  1B4V A;  1X31 B;  3P9U A;  3AED A;  1EL5 A;  1IUT A;  4H4S A;  1KNR A;  1VG9 A;  3F8P A;  1LPF A;  5TR3 A;  2XLU A;  1GRA A;  4UDQ A;  3UKH A;  2WET A;  2Z5X A;  1JRX A;  1NAA A;  1LQT A;  2X8H A;  3AD8 B;  3KKJ A;  5KRQ A;  5KVH A;  2ZZC A;  4H4P A;  4U8J A;  4AOX A;  2AR8 A;  1EL7 A;  3CTY A;  4H4Q A;  4H4W A;  2LFC A;  1ZOY A;  1NG3 A;  4B65 A;  1F8W A;  1FL2 A;  1TYP A;  3PO7 A;  3K7M X;  2BXR A;  3VRB A;  2WQY A;  3GD3 A;  2TPR A;  3V3N A;  1ELI A;  1FCD A;  1H7X A;  3CGC A;  3SZC A;  2FJE A;  4Z24 A;  4BUR A;  5IQ1 A;  4TM4 A;  1GSN A;  1GAL A;  2XYO A;  4H2N A;  4CCR A;  4AT2 A;  1PXC A;  3GYJ A;  1E1N A;  3NYE A;  4AT0 A;  1VRQ B;  5EBK A;  4EM3 A;  3RP6 A;  1EL8 A;  2WP6 A;  3EF6 A;  3AYL A;  4KPR A;  5FS6 A;  2C70 A;  1YQ4 A;  4YTM A;  2APG A;  4MJW A;  2C65 A;  3DJG X;  2VRL A;  4ZCC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...