3VRIA

Hla-b*57:01-rvaqlenvyi in complex with abacavir
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
275
structure length
275
Chain Sequence
b'SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDGETRNMKASAQTYRENLRIALRYYNQSEAGSHIIQVMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, B-57 alpha chain
publication title Immune self-reactivity triggered by drug-modified HLA-peptide repertoire
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 81
structure length 275
sequence length 275
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vriA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vriA01
2F19H 2QV2A 3NFPA 4XNYL 1JWMA 1UT9A 4PP2B 2AJZB 4L1HA 3S4SB 1GZPB 5C0JA 4JEGB 1CE6A 3G5VA 2ZUXA 5HDOA 4AMKL 5DT1H 4OCRH 1RK0B 4RGNE 5DRZB 2YD3A 3RL1A 1E6OL 4FQHB 1O5DT 3NTCH 4LPYA 2VXTH 5C0BD 1K4CB 3MRMA 1JNHA 4M8QB 5E2WL 4UNVA 1EUTA 1LO4L 3FQNA 1CU4L 3EOYG 1UB5B 2WUCL 4I3SL 4JZJC 4MJ6B 5EZJB 2ZOLB 32C2B 4KV5E 1ZLWK 2WINA 2HTLC 1MAKA 1U8HA 3LPGA 3WNOA 3C5JA 2Q8BH 4YDJA 4HPOL 3PDGA 3QDJA 2K9UA 2EDHA 5LXGL 2Y72A 4F3FB 2BVTA 1UACH 4LPUA 1NEUA 2A74A 4X6CE 5T1LA 1XR9B 3MGAA 3O3UN 3C6SB 2C4FT 3OKMA 2H2SC 4OCSL 5IIEA 1E4KA 4PY7B 2X4OA 3BEVB 3MOQA 5TQ2L 1LO3L 1DQQB 1DQDH 1I9RL 2C3HA 1JV5B 5DJCA 4WTWA 1FZJA 4AQOA 2DI7A 1X7QA 4FQ2L 2ZCKH 1JF1B 1Z2KA 2JB6A 2VR5A 2DQDH 5AWNH 4YQXL 1NCCL 5ICZA 4V1DB 5FYKD 3VFOA 3NIDE 4GW5A 2NX5E 2KQMA 5F8QC 5DK2B 2HP4A 1B88A 3SGJC 4QHLB 1EHNA 1TZIA 4ELMB 2O5ZH 5F7WC 4RSVA 1D7FA 3D85A 5E1HB 1MPAL 1UA6H 5FM4A 1S9XB 3IDUA 2X41A 2H32A 1OSZA 3ERYA 5F7DB 4IRSA 2J8UF 3H3BC 2VERN 2G60H 4QGYA 2NZ9C 4I48B 1I3RA 4U3CA 5FGBA 1WCBA 3U9PL 1CD1B 5D7SH 4QNPF 1CGYA 5GS1B 2NYYC 1OF2A 4F7TA 5DVOA 1P9MA 5CGYD 3S36L 1VFBB 3ZHKA 5ENWB 1YC8A 4LMQE 5E1AB 2XA8L 3BN9D 4M6MH 1LQVA 4P57B 4PJIF 1G7IA 5D5MA 3HFMH 2ESVB 5F7FA 2NY0B 5DJ8A 4JM4H 4JM2C 1I1AC 3KPNB 3PWPB 1MY7A 5IB2A 3SY0B 2IAND 5CILH 5FAAA 5D1ZC 3KYKH 1T5XA 1XGPB 4ZAKD 2FATL 2FZ3A 1MCSA 4R4NC 4W4NA 3TVMD 1OB1B 4CVXB 1I8IB 4AENB 1G7LB 3NZHH 2ZCLL 5DJAB 4HBQA 4H0HB 5E8PB 3SKMA 3ZE0E 5TDPA 3WCYA 4ZTOL 3F58H 1NGPL 1JWUA 4HF5H 4W6YB 4YHKL 1OM3L 1U3JA 3QNXB 3RIAK 1BP3B 2M2DA 4F9PC 3VI4E 2B2XH 1WWWX 3PHQA 5JW4Q 3UTSE 3VXRB 1KPRA 4XNQA 4JQVA 5F72S 4LEXL 1T4KA 5AG8A 1RK1A 5D1XC 4XNMA 3UBXA 2PW2A 3GSOB 4OB5H 4NNXA 1F90H 3T3ME 3IDNA 1DLFH 3WFHB 4OCYL 3MA7A 2H2SD 1T0NB 4X9IA 5D6CA 2NTSP 1PLGH 4M43H 1PKQA 5I1IH 1EBPA 5LGKA 1WAAE 4JB9H 3U82B 1T3FB 5JW5B 1EVUA 4Z7VB 2R15A 4LOUC 3PNWB 2XG4A 3IJSA 3Q6FA 4R2GB 5D7KD 2AW2A 1Y0LA 4UQ3B 5KAQF 3RWEB 2FX9L 1B4RA 3VGHA 3IJHB 1YC7A 3HMXL 1IC1A 1U8NA 5DTFB 1MAJA 3HG1E 3N0PB 4KJWD 1MWAB 1WWBX 2V9RA 4GRLC 4L5FH 4WY7H 5C6PB 3VXQA 5KJRH 3O8XC 3GMOB 3KYMB 3U4AA 4EZMA 3PWJB 4JR9L 4KRPC 2BDNL 1N59A 1G7MA 3OF6D 2NZ9D 3D5OF 1QYGL 4XP1H 2J7LA 4NCC1 5GHWL 2R2HB 1B6UA 3CD4A 2IF7A 1PDKA 4D9QD 3BISA 5JW4R 2VMFA 3EYOB 2WAHA 5DQJB 2DL9A 3RZWA 2NY5H 2PUQT 5AUMB 4JG0H 4WDIA 4YEFA 1LP9F 4JM2D 4N68A 1CXIA 3ESUF 2CXGA 5BV7C 1DDHB 1CDGA 1RZKC 1C1EL 1JYXA 4KKAD 4ODSL 1JNNL 2OP4H 5ILTH 2JIXB 4QHKJ 2ZNXA 3QEUA 2CUIA 5CD5D 3QUMA 3MCLL 4DGYL 1A6WL 1J12A 1U41A 1KCVL 3TYGL 3VGBA 3DTXB 5ISZE 2VKXA 5DMKA 3X14B 4KRLB 4YO0A 5JPMA 5F9OH 1E4WH 2V9TA 1FSKC 1CG9B 3I9GH 1KB9J 4M62L 4NO5B 3FQWA 2PO6C 1IM9D 2R0ZL 4PJ7E 3CXDH 2WANA 5KVGH 2H9GA 5D1XD 3VU2A 4OUOA 1ETZA 4RISH 4JPKH 5CCKL 4XXCC 3HR6A 3MLTA 3TBYA 1KFAH 2R0KL 2MCG1 1F8TH 4U1KB 2OJEA 3HS0B 1ED3B 5ACZA 4DFHA 1SEQL 3BGFC 4LOUD 5SWSB 1FH5L 4YXLH 3QEQA 4OZFA 4O02L 1QFOA 3HZVA 5IB5A 4JFZH 4XCCH 3WUWG 5I74C 1KBGL 4K71B 3LKOB 3OAZH 3QUYB 4R9HA 1GRWA 3E3QA 4HXBH 5FYKH 1MCPH 1NEZB 4JPWH 1CK0H 4UT6H 1JYWA 2X05A 2ITCA 5D7LE 3QXAA 4J2XA 1EAJA 1MOEA 3B9DA 4PRID 3RGVC 5TDNA 2MNUA 3O8XD 2YRPA 3SJVE 2NQCA 1VFMA 4RNRB 4ZUUA 4LK4A 1K85A 2D7QA 4EDXA 3VW3H 3BH8B 1OCWH 5KS9B 3VD9A 3HI5H 5TQ0H 4M48L 1UH3A 3WHXB 5FUCE 4KXZI 1IQDB 2QBWA 3HAEH 1JFQL 1W0WA 1FGVH 3U7YH 1FNEA 1ZGLP 4GQ9L 4G8GD 1UH4A 5SX4I 2Y06H 5GGUB 3PIQA 1A4KA 4X7SL 5GGRA 1BVKA 3ZDZE 2ADJB 4PJ5E 1YPZA 2DQCL 2OTPA 5L8JB 1KG0B 1N7ML 2GK2A 3QIUA 2EZ0D 1U8MB 3X12A 4N0UE 5C0CA 1S7VB 5T3ZL 3CVHH 5J06A 2KUTA 3HNSH 3VE0A 1WBZB 5GGVH 3OX8A 3BT2H 5T5NF 4U0RB 1G9NC 4MAYB 1M6OA 1SJHB 5D6DC 1AD9B 3UTZB 4Z0XB 4LLMA 2HYMA 1UM4H 4S10A 1GSMA 4QRSB 4S1DC 5I2IB 4TQEL 3UTTB 2BOCB 4TSAH 5DD0L 3EO1B 5DUML 5FK9B 1EUUA 3T8XA 1MREL 2PO6D 3HRZB 4Y16B 4D0BB 4OZGB 3ALPA 2BSRA 3G5XB 2ADIB 2P45B 4D0CB 1D3CA 3WKNA 3QISA 4RFNB 25C8H 1ND0B 2VXUH 4LCWB 1IC7L 4YHZH 3QQ9C 1KGCD 2Y5TA 4CN4A 3VWJD 1N6VA 3NAAL 5DK0A 4WCYH 3EYVA 4WW2A 5CGMA 2CLVB 3O4LB 1MJJA 1D5XA 2XWBA 4LDOB 5FYKU 1QFHA 5F7EH 2APVA 2H1PL 5E5MA 4HZAA 1XIWC 4HGWA 2J8HA 4X4ZA 3HCVA 2XN9E 4OUUA 5IBTH 1DFBL 3MODH 1KLGB 1ZTXH 2DQJH 4KTDH 2DLFH 4OZHF 1NBVH 3BP6B 1JL8A 4DEPC 3RGVD 3A6CL 4MAUL 3FT4A 3ZT7A 4H26A 1P7QD 5MEOB 2R4RL 5FYJE 5C07E 4B53A 3I84A 1TETL 5ESAA 3X17A 4LCUA 3L3DB 3EO0B 1KN2L 1JGEA 1RAMA 2I9TB 3S96A 3MRJA 2E7LA 3RWJA 5L2JA 3GIZH 4HUXB 1RZKL 4UI2A 1MCEA 3QEGL 4PJ9C 1OP5K 4AEIH 4GMTL 4JO1H 3F6IA 3Q5TA 5IFHL 2Z92A 4PJEB 2G5BB 4ZYKB 4HJJL 5JA9A 2DAVA 3OB0H 4X98A 3NIGF 3D39E 4UIKL 3AXLA 2YD1A 5ADPL 5FOBA 2V5RA 3CJJA 2EC9U 1IBGH 1INEL 4DWHA 1P84K 1ZT4B 1N64H 4KQ4H 1NCBL 5CLWA 3ECBB 5GS0C 1LO5A 4Y2OA 4BZ1L 1D5IH 5CD3B 4WFED 3VFSB 3T0XA 4XRCA 4GMSH 2Z91B 4S1DD 5I1JL 4KK5C 1P4BL 3ULVE 2VLRD 5IHBA 1HHIA 1M7DA 2VLJA 3GDBA 3MRKB 5D7IE 4Q0XL 3TCXA 1MRDH 3L3HB 1NUGA 2KH2B 4LGSB 1F2QA 1L0YA 5BW7C 4I0KA 1R3KB 3D3VD 1KB5L 3HA0A 2JJUA 2XWJA 4G8IA 3QQ9D 5HHMD 3QDGA 2AJ3B 3FN0H 2XZZA 5EN2A 4YR6B 2E7CA 4FZEH 4GAGL 1S7TB 1MCBA 4MXVF 1TNNA 3BKCL 5C0RL 3LH2H 4HWUA 2YOCA 3MC0A 3MRRB 3DJ9A 2ICWJ 1XIWD 3PP3H 5FIEA 1A2YA 1HHKB 3VXSA 3MQIA 4UDUA 3KS0J 2AK4E 4RBPK 3LKQA 4UV4H 1AGEB 4M5ZH 2EDEA 3MV7A 3RRQA 3L5JA 2DQEL 3TC9A 4WFHD 3WFBH 5DQ9A 5B3JF 5ABDE 3HAEA 5L2KD 4DKEH 4ISVB 5I71B 1KXQE 1J1OH 1AIFB 2GSIA 4G7VL 4GSDL 4HHAB 4DGIL 3OKEA 4QY8B 3SDXB 3X3GL 3VXTB 1LEKB 5J13C 1VPOL 4K7PX 4Z5RB 4OJFL 1BEYH 3IS1X 2XG5A 4XI5C 4XP4L 5DFVC 1G9MC 4TUJB 1YN6A 4HX1B 1DN0B 4FFEX 2GFBA 3RWFB 4QKXB 3CVHA 1XF1A 3UPRA 3O0RH 1DBBH 4NM4L 2IANA 5I73B 4K07A 3O41B 4PJXE 4M7LH 2IQ9H 2V17L 4DAGH 2HLAB 4Z7UB 5BRZE 4IHOB 4PJ9D 4RX4A 12E8L 3BD5A 4MWFA 4X4ME 1MCOL 3U2SB 3P9LB 5F89A 3IRZA 1T03L 2B39A 1NAKH 3RNQA 3UTPD 3MZTA 3MJ8A 2E9JA 4LU5L 4LQFL 7CGTA 2EKSA 1NJ9B 4Z7VF 3U36A 5BV7H 2DKUA 1LD9B 3MBEB 1G9NL 3KYNB 1NQBA 1TQBB 2VABB 1CXLA 4NKMB 3ZL4L 3K46A 1SMOA 2AJUH 4LSRH 3GMLA 5JHDD 1BQHA 3V6FB 4U1LB 2VR4A 5CINL 4KK5D 2GJ6D 3ILQC 3D0VA 4L8SC 1JGLH 2XY1A 3OR6A 5C09A 1AD0B 4GAJL 2EDNA 3BPNC 3T0DA 3ROLB 2D03L 3PL6D 2NXYB 3W0WA 2WP3T 3KPOB 1X5ZA 5BJTA 1CT8B 4LPWA 4OFDA 4IIQB 1ZGLB 2Y9RT 2ARJA 4RMSA 4TOYH 1I3GH 3MR9B 1PAMA 4OD1H 2BOBB 2ZSVB 3QUZA 4AM0B 4M6OH 3NA9H 1T21A 1ZWIB 3WO3B 4A2LA 3GMPA 5J1AA 3U4BH 5J11C 2H3NB 5FUOH 2BNQD 4JDVA 4P2RE 4OQTL 4JFED 4X6DB 4Y4KD 3SOBH 5MI0C 4M03A 2P44B 4O9HH 5TDOA 2A9ML 1TCRB 3DX9B 2CKBH 3T4YA 4ZD3H 3K8KA 3JTTB 3WUWB 4L9DA 3GKWH 4XI5D 4UNUA 3VXME 2UWEF 5DFVD 4NHUE 4PRAB 1CICA 1MRFH 5L0QC 4PTTB 4HGKC 4OCLC 3SKJL 5JDJA 4P2CG 4HKXB 1AXIB 1QFWL 1NC2B 1ZS8B 2AJYL 1CGSL 1GGCL 3FTGA 2UUDH 3V5HB 1ZSDA 4PRHA 1DZBA 3BHBA 3QHFL 4LRNL 3MO1A 1U92A 4NO0A 1VDGA 1FORL 2AJSH 1TQCC 4HUUA 2WBJC 1HIMH 1KOAA 1T83C 1JPST 4Q74A 1FIGH 3VRIA 1FCCA 2DDQL 3QA3B 5I15L 3O9WC 4PJBE 1Q94B 3UCRA 1MF2L 3BWUC 3QXVA 5GS0L 3NBNA 4DKDC 3IFNH 4K3JH 4HIJA 4U1NA 1RUKL 1XF4B 3F7VA 3D87B 2LU3A 4LSPH 4S1SH 5A2JH 4O5LL 1OD7A 2YZ1A 3KPQB 3DPBA 1I1AB 2P8MB 4WIQA 3RUGF 4BZ2H 2C3WA 5D1ZB 2IPTH 5EOQL 4Y2DA 4CW1A 3GRWL 4HJGB 4U7SA 3O2WL 4DZBA 3PWLB 4PGBB 3IB4A 1UZ6E 1HH6B 1KCUL 1RZJH 4HK0A 3OGOE 4PJAE 3HI1B 4MZ3A 3SE4C 1QPPA 3HUJF 4XC1H 4JANA 3VGGA 3GJEA 3EDFA 4XP5H 1ZHKB 3SGEH 4DN3H 2FECL 3TPUA 2J3SA 1QSFA 5KG9A 3TT3H 3TJHA 3FB7B 4UDTB 4P5TA 3LDBC 5ANMB 4QOKE 2FEDD 1K8DA 3NCMA 2A6KB 3GBML 4TTDD 3TGXA 1FAIH 2WMPA 3LKSB 1X4YA 5F96H 4I3GA 4PG2C 2HG5B 4WUUD 1IJ9A 4FNLL 3FOMA 3TN0A 2Z8WC 4HV8A 2BVPB 4OF3A 1CGTA 4F58H 2VDML 5IV2B 3SDYH 2FJGA 1N8ZA 4EXKA 5JDSB 1G9ML 1T1WB 5GQBA 3RDTD 3I6LD 3CC5B 1ZLWH 1G7PA 1S7RB 2W9DL 3BZFA 3MGOA 5CEZE 3E2HA 1QFWM 2NXZB 3QCUH 5KZCB 2C3XA 4FQIH 4JO3L 4MDJB 3WUZA 1A4JB 3PGCA 1NCWH 4GRLB 1J8HE 3RL2A 4AL8H 1YEHH 2BFVH 3DVGB 4WENB 1NLDL 1QFUL 3WS6C 1A6AA 4F7MA 5HVWA 2DBJA 4KRPB 2R0LL 2WBJD 1CFTA 1U8JB 4MQSB 4HQQL 4JGUA 4NNPH 3ZE2E 3C5SB 3KHOA 4NT6A 2Z31D 4IOFC 3M8OL 2P5EA 4GKOA 5D2LE 3O9WD 4MNGE 4C83B 4E41B 1SM3H 5BVJA 1YNLL 2NY2B 3MV11 3UDWC 5C0NC 2YSSA 3T4AB 4U6YB 1J0HA 2BVQA 4XPFH 3VJ6B 3TWCL 3PXJA 2D7NA 3BXNA 1RZFH 4RGNC 2EIDA 4QHMB 3FFCE 4ONHA 3JUZA 5GJTH 3P0GB 5AEAA 1UZ8B 1YNTA 3LS4L 3GEWB 4MMXC 4MLSA 2BERA 4U6HA 5ERWA 1PGRB 3CLEL 4KHTH 2XWTA 1JYNA 3L6FB 3G6JB 5HDBF 1N5YL 4PJCE 4EN3A 2OJZL 1MI5D 1DJSA 4R7NB 1ERNA 3OG6B 4C56A 3QEHB 2KZ1B 1EX0A 4LCYA 1R5WB 4GXUN 1FE8L 2VN7A 3QYCA 1KNOB 2XYCA 1F58L 5ESVA 3LOWA 4JDZB 3Q1SL 4LVOC 2BHYA 5CP7A 3QFJA 2CKBA 3INUH 1BD2B 4YAQB 2YMXL 4PJEF 4X8JA 2MCPL 3T0VA 4YWGH 1FLTX 1H3WM 4M02A 3C8HA 1IARB 1TNMA 1UJTA 2Q3AA 4JFQB 4C54A 5IEKB 4FOMA 5HPMA 3L3OA 3V52H 3ZLQC 1IAOA 4OLUL 5DR5H 2YPLE 4OLZL 1KB5B 1WVZA 1LO0H 4R3SA 3WJJA 5DJXB 1AO7A 4XMKH 2LAAA 4JFXA 5LGHL 2QSTA 3QIBD 4E9LA 4ZNEE 2YBRB 3MACL 5HGDB 5HGAB 1YUHB 4FXLA 5C9JA 3C08H 1OAUH 1XT5A 1YY8A 1WSST 4EIZC 1DUZA 4FQLL 3FB8B 1ZHLB 2FGWH 5D2NC 5F1NA 3ARDA 4ZXBD 5E9DD 1FZMA 2CRZA 4DK6A 4FQXD 4GAYA 2YXMA 3FFDA 3GSXA 3P9WB 2M1KA 4GLRH 1JWSA 4IOFD 4NRZB 5FV2A 4UOW1 5I1HL 2BNUB 4ZO6A 5C8JA 4PRPB 2PXYA 4N8CL 4PREA 3EJYC 5TE6H 5E4EC 3ZDYF 3JTSB 3SCMB 4NQUA 3HNTH 5D96B 1T20A 1UFUA 2MSPA 3MV9A 3K3QA 3QJFB 4RGMB 1XGRA 5HHVL 2GCYA 1QSEB 4HKJA 4H1LH 3MLUH 1S7SB 4LHJB 4PB0H 1FRGH 1P4LB 2NY6B 4Y4FC 1KCKA 1T66D 2ADFL 1RUML 2ICWI 5DEFB 4CMMB 4LCCB 3NZ8B 5EO0B 2F74B 1TDQA 2EICA 5DURD 4KK8C 4KMTH 4PV8B 1EO8L 1JMZA 1TZGH 2Q8AH 3ZT5A 5ALCH 5E70A 1UEYA 2HVKA 4U1MB 3WLWC 2FGZA 3OKDB 1QLEH 2I9LB 4XH2A 3I75A 5EC2A 4N1EA 3MOAH 1IM3B 5L2KA 1WTGT 1GHFL 3IFPB 3DV6B 5I1AA 4JRYE 2DWDB 1CLZL 2HH0L 5C3LD 4M7KL 3ARBC 2CDFB 2P5WB 4YHMH 3EOAB 5DMYA 2GQHA 5SWQB 2DL2A 4QWWC 4L3ED 3O2DH 3O45B 3RY5A 5E2VL 4K94H 3H9ZA 1OW0C 5T33H 4XHJC 3LEYL 3UX9B 4WI4A 2W9LA 1XR8A 4R90H 5DVNA 5KSBF 1BIHA 2UVEA 2R1XB 1C08A 2UY6A 1XZ0A 5C0GA 1A9EB 2ZKHH 3VFRA 4LBEB 4XXDB 3ZKMC 1A7OL 1Q9LB 4DEPB 3FQUB 3P0YH 4K3GA 3WXVH 3MFFA 2SEBA 1F3JA 1IC5L 4ZOEA 4OAWA 3QJHA 3V0AC 1SJXA 2MFNA 4Q6IB 3AM8C 3FJTA 4PP2A 2AJZA 3S4SA 5IT2L 1GZPA 1RJCA 1YDPB 5JHDA 1MJ7H 1U3YA 2HT4C 3VXUB 3EJYD 4OCXH 1AE6H 1RK0A 4QXGL 5DRZA 3ARQA 4RIRB 4X5XB 1R24B 4O4YL 4P48A 4M8QA 1FNSH 5I75B 2CJUH 1ADQH 3I2CH 4X6DF 5C71A 3QI9C 3K1KC 3O6LL 5C6TH 4MJ6A 4Y4FD 5EZJA 2ZOLA 32C2A 5HGGS 1A1MB 3PJSB 3K81A 3UJJL 4YC2C 4FHBD 4KROC 3QB7C 3QG6B 4U6VL 4F3FA 4NKIH 5J12B 1O7SA 3V6OA 5IP4A 4YDKL 3WSQL 2FB4L 1XR9A 5ADOL 2FWOB 1VA9A 3C6SA 4PR5B 5E8DH 4PY7A 3MJGX 5D71L 5IOPB 3M45A 5HY9B 5EC1B 4U1HB 3BEVA 1DQQA 1Z9OA 4JFEA 2X5PA 3O3AA 3STBA 5J9PB 2WQRA 1M7IB 1JV5A 2ZZUT 2ARJQ 3L1OL 4HIIB 3CVIH 1JF1A 4NP4L 5EDXA 1DQLL 1Z9MA 4HZLB 4V1DA 5EORH 5HVHB 4UOW0 3ARBD 4I0CC 3DUHA 3ABZA 5I1LB 4QHLA 5TGBB 5JIKA 5SX5K 3EFDH 4EBQH 3G6DL 3EGSB 2B0SL 3BW9B 3ARVA 1LEGB 3OPZH 5ETUB 4I48A 4KC3B 5DHXB 3UYOD 4JFYA 1CD1A 3ZKMD 5GS1A 2VLKE 3DUSB 4TPRL 5BO1H 4LHQB 2DBLH 1OGAD 1VFBA 3MOBH 4NBXB 5ENWA 5E1AA 2IJ0C 4PBWD 4Z18A 4P23C 1L4IA 3DO3A 5DHVH 5ESQB 2ESVA 1CZ8H 1L6XA 3BMWA 3PWPA 3KPNA 3BESR 1UM5H 3QIWC 2DYPB 4N90D 1FVCA 3SY0A 3VMOA 4LP4A 5DUBB 1XGPA 2P24B 3CFDB 4KK6C 3L3GB 3V0WL 2HN7B 3H7BB 3O3EB 1KEGH 1OB1A 1YNKH 1I8IA 1JMXA 4KK9C 1G7LA 3V8CA 5A43C 1A22B 4P2QD 3BDYL 5DJAA 2D2OA 5E8PA 1MIMH 2ITDB 1CGXA 4DW2L 3CPLB 3LRSB 4W4OA 3FO9B 3I6KB 3MNWB 3BQUB 3QNXA 2ICEB 5IQ7H 4KH2A 2VZVA 2VIRB 3OKYA 1O7VA 1UEMA 3BE1H 4GS7C 3EFFB 3WD5H 4J6RH 3VXRA 2Z8RA 4PUBL 4L9LC 1CIDA 2QLVB 4X9FA 3WN5C 4EUPB 3SGKA 2VZ3A 3UJTL 2BVYA 5JHLL 4KROD 4YFEA 5J6GA 1GIGH 2Y6SC 3GSOA 1U3HD 3JV5A 2VXSL 3ZZ1A 5F1KC 3WFHA 5DWUH 1T0NA 4AEFA 1PG7H 1OP5H 4I3RH 4JQIH 5CWSB 1DQMH 4X7DC 1T3FA 4L8SB 4Z7VA 5JW5A 4HPYH 2FLBT 1NKOA 4XNYH 1MSPA 3PNWA 1I1FB 2E3VA 4V3DB 2IG2L 1HYSD 3BGMB 4LPVA 4NHCH 3BPNB 3PWUB 4R0LC 3RDTA 3RVWD 4UQ3A 4D9RD 2XFXB 3RWEA 3BX7C 2KDGA 3IJHA 3NABH 1RIHL 4ONFH 4JRXB 2P1YA 1DBAL 3ZDXF 1MWAA 5IMMB 2LFGA 5BVPH 1Q1JH 4P9HC 5EU6B 5IW1B 1AY1L 2AABL 2GIYA 4OM0H 4XNUL 5JIHA 1BLNB 5E7BA 3GMOA 4K23L 1Q0XH 5DRXB 3MXVH 3KYMA 5JMOC 1N0LA 2XZQH 4JFDD 2OXHA 1MCFA 3D18A 5J11B 3MLVH 2VDOH 5D1QC 1JIBA 5E56A 2XZCL 4OLXL 4MA8L 3LQZB 5DUPL 5CBEB 2R2HA 4TYUA 3JTCA 4OBSA 1U3ZA 5J1SC 2NW2B 4R26L 2H26B 5F21B 3G6JF 4OCWL 1K2DB 3CSYB 1IKFL 3P4MB 5BMFL 4Q2ZB 5DQJA 5AUMA 2EE3A 4LSTL 4PD4K 5EG6C 5KSUB 4KJQD 3NIFF 4F9LA 4DVRH 4OLEA 5HHOE 1DDHA 1TENA 4KK6D 4NQCE 1OQOA 2JIXA 4KK9D 3NCJH 4RBPH 4L4TB 1JRHL 2DOCA 4TSCL 5T3XE 4C4KO 3PQYE 4FQCL 3PP4L 2XY2A 3KPRE 3CX2A 5HYSG 3DTXA 3VA2C 5JQ6H 3SBWC 3IRPX 3X14A 2UWEA 3MUHL 4FFZH 3TO4B 2JKXA 1N6QH 4P3CL 4JY6B 5F7LB 1CG9A 2R4SL 4GRMB 5GSVB 3VFTB 4RMRA 1UCTA 2VC2L 4CJ0A 4NO5A 3VGEA 3T1FB 2GY5A 3U9PH 3RY6C 2EE6A 1UWGH 2XKUA 2AQ1A 4OM1L 4WO4C 4LLDB 3OXRB 4U1KA 1BFOB 5DGQA 3HS0A 1ED3A 1JK8B 3BAEL 3WE6B 2Z8SA 5JUEL 4Y89A 5SWSA 1YEEL 3QCTH 4LARH 2XTJC 1P6AB 5GJSH 4Y1AB 5FYLD 2WBKA 3QUYA 4W6WB 4GG8B 1NEZA 4AT6B 2LQRA 1CE1H 4GXVL 1QR1A 1HQRA 3U83A 4YHKH 3D48R 1YEDB 2F8VA 1OM3H 3PGFH 5IMKA 1CDYA 2FHCA 4JCMA 5DC9B 1C12A 1DE4B 2WIMA 1FBIH 1CF8H 2QQNH 3ARYA 4XNXH 4RNRA 5FXCH 1HKFA 3BH8A 3W2DL 1QBLL 2R29L 5KS9A 1PBYA 1VFUA 5DJ0B 3WHXA 1IQDA 3WIHL 3FRPA 1MJUL 2H2PC 4RFOL 4S1RH 3F7QA 2H8PB 5E2TL 4BH8A 1GPOH 5M95B 3BRFA 4K3DL 4YXHH 2FX7L 2VQ1B 3KPSB 2ADJA 2L7UA 1KG0A 1LILA 1QEWB 2PYFB 1U8MA 5TFSL 3OGCB 1S7VA 5D72H 3VD7A 2W60B 3HC3H 1D9KB 1WBZA 3GKZA 1Q9OB 1OAKH 4RMVA 4WFGE 4XVSH 3QDMD 3LZFH 3VDAA 1J9CT 3V4PL 1NLBL 4MAYA 4YHIB 4NWUL 2NY1C 3DGGB 4ELME 1SJHA 4OGZA 1H3XA 3UTZA 1OAZH 3NOIA 4NJ9H 4Z0XA 4UTAH 4GKNB 4BFGA 4J3XA 3UTTA 2X1WL 2BOCA 3EO1A 5FK9A 2VH5L 1QYGH 4NFCA 2DMCA 3HRZA 2N56A 4Y16A 5BXFB 4D0BA 4U4BA 3EYSL 3OAUL 5DEGB 3G5XA 2ADIA 4D0CA 3WIIL 4RGNB 1ND0A 4LCWA 4WO4D 2NTFA 1A5FH 1YY9C 2QQLH 1B4JH 5I8KL 3O4LA 4I2XA 3MRLB 4XCFH 2XTJD 3MA9H 4P9HL 1AGCB 1UQSB 3NFSL 1KLGA 3GBNL 4OZ4A 3GJFK 1A0QL 3I3EA 4BELD 5JZ7C 1INDH 3BP6A 5I6XB 4CNIB 4LVOB 4HH9B 4X6CB 5LWYL 4GKSB 3BKYL 5DC4B 3HN3A 5MEOA 1P7KB 3N85L 5IUSA 2BRRL 4L4VE 3MLRL 4HWZB 3ZYIA 4PP1C 3I3BA 4G42B 3U9UB 5E95B 1RMFH 2VLMD 5I18L 3BIKB 1MFDL 1YEGH 3L3DA 3EO0A 3MPCA 2AGJL 2DQUL 1EGJL 2YRLA 1QBBA 4I0PB 4NCC2 3U0TB 1I75A 2NX5B 5HPOA 2I9TA 2H2PD 1RQ5A 2VITB 3DGCR 2R0KH 4P4KD 1NDGB 4X5WB 4HUXA 5FKAB 1V05A 1WT5A 1MAMH 3VWKC 5DJYB 4PJEA 3TESA 4ZYKA 3VA6A 3W9DB 5E8NA 4UT7H 1XCQB 3SKOB 3D2UD 4JN1L 1NCAL 2YA2A 4PDCE 2ATPB 2MQ3A 5T5FL 4MVBC 4F57H 5I8OL 2EXYD 3L9RB 4WV1C 1RURH 5EOCH 3GSRB 1ZT4A 4MD0B 4YLQT 3V8OA 4KVCH 3SPVB 3ECBA 5A40E 2NY1D 2ZPKL 3IDMB 2DIBA 1MHPL 3VFNB 5CD3A 1H3VA 3LN4A 3VFSA 4G9FD 1FFNB 5DQDL 2Z91A 3K4AA 5EU4A 4HEPG 2VZ1A 4Z7QF 5K9KB 5E4EB 3ULVL 1S3KH 3WNKA 4IOIB 3D69B 4IS6B 3MRKA 3TIEB 3L3HA 4KHXH 4UNTA 3RKDC 3QO1B 3GI8H 1H9VA 5HHNB 2CIIB 1YY9D 2AJ3A 4RAUB 5DJZB 3J7HA 4U3HA 4YR6A 2CR6A 4X7SH 5DMIL 3TLRA 3DYOA 3MRRA 5IF0B 5I0ZA 1UKTA 3G5ZB 4FTVE 4DQOH 5T3ZH 5HD8D 3G04A 2WIIA 1HHKA 3H9SE 1A3RL 5SV3A 4UZGA 4PB9H 5FYLH 1A7NL 4MA7L 2XQYG 2OMNA 2ZUTA 4GT7A 4ISVA 1AIFA 4HMDA 4NQDE 4HHAA 3SDXA 1OARH 1MFCL 3VXTA 5JOPE 1FNAA 1LEKA 4Z5RA 1Q72H 5J8OA 2EH8H 4P2YA 4TTGA 1CXFA 3RA7H 4I77H 3WNPA 5LAXB 1DN0A 3RWFA 4R7DB 5TE7H 3T77B 2IGFH 3O41A 3SDAC 2DLGA 2WSKA 3M07A 2HLAA 2R56H 3HG1B 5AZEL 4Z7UA 3ET9F 4IHOA 2CDGB 4JFFD 4QRPE 3U2SA 5HYJE 3P9LA 3KJ6L 3RPIB 1FQ9C 2Z9TA 1NGQL 5T1KB 3RGHA 4YX2H 1FV1B 2ZUUA 1NJ9A 3F7YB 4YHPB 2IADB 3MBEA 1JGUL 3KYNA 2FL5B 3QXTA 1DFBH 1TFHA 5L6YL 2GKIA 4X80L 4CN1A 4WHDA 1JTOA 5ITFB 4HSQA 2VABA 5T1DL 2VE6B 1IKNC 1D6VH 3P40A 4NKMA 2NMSA 1QHOA 1FLRL 3AC0A 1T2QL 1VEMA 2JJTA 5ALBH 2V2TB 1HHHB 2VDKL 4FFVC 3V6FA 4U1LA 1K6QH 2DKSA 5GGSY 1EMTH 1KEML 2CGRL 1AD0A 4RDQF 1NMAH 4OLVL 3ARGC 3IT8D 1CLCA 4XVJL 2E5EA 3TZVB 1DEEB 2YUVA 4TUKL 4ACPA 3L95A 3QEQE 4LLVB 1U36A 3RKDD 3ROLA 3QI9B 1I9EA 1F3DH 3BPOB 4LSSL 3EBAA 3Q6GL 2IMNA 3KPOA 1CT8A 5DHYB 2BMKB 4IIQA 1W0VB 1ZGLA 3BKJH 3MJ9H 5ISZB 3E3QE 2QHRL 3MR9A 2D7OA 3DECA 4HBCL 2BOBA 4YC2B 2ZSVA 4CBPA 2BHZA 4AM0A 1BFVL 4FP8H 3MV8E 1ZWIA 1BJMA 2E27L 2CK0L 2BHUA 2H3NA 2HJLB 4PJ7B 2ZUWA 1DVFC 4PV9B 2WM0A 3GO1L 4X6DA 3MRQB 4WU7B 5C7XH 3U6RB 1NCNA 5MERB 2X42A 5FKPB 5EIVA 3BP7B 4BZ1H 1TCRA 2ZOKB 4LLUB 3P77A 5LQBH 3WUWA 5GS3A 2X10A 4PRAA 5L7XL 1BVLB 4PTTA 3BEWB 3W81A 3SGJA 3RAJL 4HKXA 4XVUC 1MQKH 1NC2A 1ZS8A 3O3DB 5F1IB 2VDPH 3SDAD 3V5HA 4KRNA 3MLXH 4F37K 1PFCA 4JVWA 4FXGB 1A6VH 1C5BL 5D7LB 1KJMB 2OXGA 5I8CA 1CD0A 5DA0B 2BCKB 4JREB 4JY5H 4WFFE 4BSVB 2GAZB 5I1EL 1BJ1H 5C0RH 1FP5A 3BPCB 3SJVB 1WC7B 1ACYL 2UY7A 4N8VG 1KELH 1Q94A 4PJFE 4XP6L 5ICXB 4HUWB 4A2MA 1UH2A 3CU7A 5EO9B 5MEND 1GH7A 2J8OA 4P23B 1ONQB 3WBDA 3KPQA 1I1AA 3LQAL 4X7TB 1DUYB 2V5TA 2P8MA 3QIWB 4TSBH 4FFVD 5D1ZA 3KJ4B 1JPTH 3QWOA 1YMME 4XWOC 1XGYH 4HJGA 5C08D 5IMOB 3EDKA 3PWLA 1N6UA 2XZAH 4PGBA 4PJ5B 4Z95L 1HH6A 1E6JH 5JXEC 4HAGA 3CLFH 1FZKB 3O2VL 3ARGD 1I8LC 4N0UB 1X9QA 3HI1A 4ZODA 5FA3B 2W91A 2XICA 1HE7A 2HJKB 2YWYA 3EO9L 5LVEA 4MJ4A 4F9PA 1ZHKA 1LGVA 2W59A 1QRNE 4ZOCA 3QXWA 1X4ZA 43C9B 3ARPA 5KVFL 4ZFZB 3UO1H 4FQ1H 2RCSH 4UDTA 3WN5B 1KCGC 5ANMA 3PUCA 3DROB 5EUOE 5TE4L 2BNRD 2A6KA 3MUJA 4N5ED 2ZJSH 3HNVL 1JPSL 3LKSA 5CZXC 5SWZD 2D31B 1WFNA 3N50A 5HI3C 2HG5A 3K7UA 1BX2B 4PJ8C 3LD8B 1SVCP 4KKBC 5I76B 2CMRL 2BVPA 1NSNL 5JDSA 3RFZC 1INQB 3S37L 1SY6H 3WKMH 3GSNL 4D3CH 1T1WA 3SDCC 43CAB 1RIUH 4HWEH 2WLYA 3OG4B 5CEZL 4KZEH 3T2QA 2HJFB 1SEBB 3Q3GB 1H3GA 4MNQD 1YJDH 4XVUD 2QADC 3WFZA 4EI6B 4MDJA 4MJID 5C0BE 1A4JA 2C3VB 1CI5A 4GRLA 5I1GL 3QWRD 2VN4A 5CSGA 5B21A 2O61B 2D03H 3CZFB 3DVGA 1BF8A 4S0UC 1NFKA 3B5GA 3LAFA 15C8L 4ESKA 1L9NA 3P9MB 1U8JA 3B9KD 4QTIL 3TBWB 2GEEA 3CK0H 3LS5L 4Y19D 3C5SA 2D4DA 1XGUB 5BS0D 5D1QB 2F8XC 1MCHA 5F44A 4Q9BA 5ACLA 5C07B 3B4NA 4NOBA 4E41A 4IEFB 2F5AH 3U46B 4QRQB 2YR3A 2ZUSA 2W92A 3CFCL 5DFWH 1L6ZA 5E2UH 2EIZB 4KV5F 1JHKL 1B0GB 2EDTA 3T4AA 3UJIH 3U30B 4U6YA 4OKVA 4OSUH 3DV4B 3VJ6A 5SX5H 1JFMA 3V4VL 4ODVL 1S7QB 1HHGB 1NFDF 4QHMA 4K2UL 1SBSL 1WK0A 3KPTA 1R3IH 3MJ9A 1GZQB 1UM6H 3S98A 5FYKE 4PLOB 1GXEA 2HRPH 4OLWH 1E28B 1LVEA 1EERB 3D39B 3G6JA 2EC9T 3IS0X 4HEME 4WTXA 5C0FB 3FAXA 3DO7B 3QEHA 3T0EC 5JO5B 3JZ7A 1QO3B 1FFQA 4HMCA 1R5WA 2OTUB 1KNOA 2ZUQB 2HT3D 4JDZA 1JCKA 5DXWA 5DD3H 2JLLA 1HINH 3VGFA 4WU5B 5EU7E 3PG2A 3RX5A 4YAQA 2WUBL 1UYWL 5CZXD 1Q38A 2FDBP 2HKHH 4XXCA 4PJ8D 5D7IB 3BIAX 4KKBD 4JFQA 5IEKA 4FQPA 4JQXC 1QLRB 4RFEB 4YH6A 4XCYB 5K59E 1KB5A 4M7JL 2PNDA 5DJXA 3EHBC 3NCEB 4XZUB 2IANE 3ARXA 5IVXF 2DJUA 2J5LC 4G6ML 4OIAA 4NRYB 3GMMB 3DYMA 2YBRA 3MLZH 3Q0HA 4TVPD 1BQHG 5HGDA 5HGAA 1R0AH 1AI1H 1YUHA 4GBXC 2ED9A 3FQXB 3GI9H 2AK4B 3FB8A 1MHCB 1ZHLA 2OX5A 2XA3A 5DI8B 1G6RB 3HC0B 5EU3B 4M9PA 4LNVA 3ZE0F 4NQED 4J3UA 4MJ2A 5BZWB 5EO1B 3VFVB 4LHUG 3ZKND 3DRTB 4Y4HC 2BNUA 4MNHB 3RZCC 4PRPA 4YPJA 2X4RB 3VI4F 4ZFFB 3AU1B 5HHPA 3JTSA 1QD0A 1Y18B 4NPYB 4NUJB 3SCMA 1MFAH 4EQ2A 2ATKB 1BQSA 4AEEA 5C0EB 3QPQC 2YKLH 4PJXB 3QRFM 3QJFA 4G5ZH 3R1GH 1S7SA 3KXFD 4LSVL 5BRZB 1P4LA 4X99B 2Y5EA 1F6FB 3QULB 3ULUF 1VKXB 4LIQL 5FO7B 1QKZL 1X5GA 2OMBA 5D7KE 4CVUA 4UIMB 1QP1A 4N0YH 5DEFA 1Q9KB 2JJSC 3W0WE 4WUKL 4CMMA 1QFPA 1S9KC 1IGIL 2B7DT 4LCCA 3NZ8A 5EO0A 3LRGA 2F74A 5FV1L 1LDPL 1WGOA 3FKUS 3MRGB 5GRWA 4PV8A 3UP1A 4FMKA 5FGRA 5D6DA 3T0ED 4YUEL 1I9JL 2F8OA 3D25B 4ETQB 5L9DH 4U1MA 4H25B 4NJAH 3V6ZB 4KVNL 3OKDA 4TRPL 4BQBA 2UZXB 5FA4B 1KPVB 5FGSA 2FNBA 3X3FH 5J0BA 5IGXL 4HQQH 2I9LA 1SY6A 3MRDA 4OGAC 3LN5A 1IM3A 3ARFC 4V2BA 3IFPA 3M8OH 3DV6A 1HXMA 2DWDA 4ZTPH 1MNUL 3P30L 4G80B 1AGDB 4D9QE 2XQYK 1DBKL 2CDFA 2P5WA 4JFHD 5I1CH 3SE8L 3U4EB 1NC4B 4HUVB 3EOAA 5SWQA 1DBJH 3O4OB 1NBZA 3TWCH 2JJWA 3O45A 5FEBA 3L5XL 1PQZB 1A3LH 5TF1H 1T6VN 3AREB 1U8OB 4JZOB 4F37F 5IFJB 1I7TA 4ORZC 2ED7A 5AD0B 5B38G 1JVKA 2O5XL 2R8SH 3BIBX 2R1XA 1RZGB 3SGEI 2A6DB 4GBXD 1KCRH 1A9EA 1N5YH 3HHRB 5E5UB 4LBEA 4XXDA 3WFCL 4Z8FH 2VWEC 1Q9LA 2OJZH 3FQUA 4MZ2A 4XC3H 4ZOBA 4RWYH 4P2RB 4MQ7B 4Y5YC 4OD3H 3RI5K 4OQTA 4QRRD 3DVIA 1R5IB 2AI0L 4HIEB 4O51B 1IGMH 1FL6B 4RMWA 1F58H 4MA1B 4M7LT 4Q6IA 1YYML 1F11B 3HR5B 3VD3A 2FCBA 2B4CC 3IYLW 4Y4HD 5DD1H 1NCDH 1YDPA 1MLCB 4GG6E 1YYLL 4G3YL 3VXMB 3VXUA 4NHUB 3HE7C 3TT1H 2J8UE 1HWHB 2NY3B 4RIRA 1MUJB 1R24A 3PF2A 3QPQD 4I1NB 4O58L 4HS3A 4OLUH 3VWKB 4QNPE 2DQGH 2IFGA 1S9VB 3QO0B 4FABH 2AK1L 2BJMH 4N8VB 1GOFA 5CJXC 4PJIE 1A1MA 1P84J 1FL3B 2X44D 4RRPA 3PJSA 1IAIH 1RFDH 5K33A 4PJBB 3QG6A 2O93L 1NAML 2D3VA 3FQRB 4I9WD 4ORGB 4UTBH 4X83A 4PRIE 3K74B 5FUZH 4F7EB 2FWOA 4NC0B 5C6WH 3DMMC 2HFEB 3HI6L 4C4KT 5IOPA 4H20L 5HY9A 5K9QI 5EC1A 4U1HA 3GSQA 1M1SA 1X5IA 4OGAD 4H88L 2QSCH 1JN6B 5J9PA 1KJ2H 3ARFD 1B0WA 4HIXL 4HIIA 4M5YL 3GRWA 1QG3A 2HFGL 4X4YB 1C5CL 4HZLA 4DKFH 1KCSL 5BW7A 2BSSB 7FABL 4HT1H 1OD9A 4PJAB 1H8OA 5TGBA 3RHWK 4G8GE 1FYTD 5CJBA 1LO2H 5D7JB 4P46C 3EGSA 4BQ8A 3JUYA 4NUGH 3BW9A 5I30H 4PS4L 2ADFH 5KSAD 2F53D 1LEGA 1J10A 3SO3C 5ETUA 1G1CA 4JKPH 3S35X 1GAFL 2VXVH 3ULUD 4ERSH 4TVPH 5C0AD 4K7PL 1PSKL 3DUSA 1CGUA 1CFSB 1HOCB 1RVFH 3C8DA 2OTWB 3VFGL 4U1SB 3L5WB 5DJDA 5LBSL 3RU8L 5CUSH 2DF3A 5CMAB 3OJDA 3OL2A 1JGDB 3QBTB 3VFWB 5C2UB 4WTZG 3GSNB 3P3YA 3QQ3B 1HZHH 4QHUB 2DYPA 3FQTB 4NO3B 1BM3L 5DUBA 1JGVH 2P24A 3CFDA 3L3GA 2HN7A 1A6UH 3O6ML 1TITA 3U1SH 4K9EC 3H7BA 3O3EA 3HE7D 2IPUK 5HDQH 3C5ZC 3GJFH 4GQPH 1KGCE 3TYFB 1EEQA 4LVHB 2ITDA 3CPLA 2X4QB 3LRSA 3T08A 1J8HB 3FO9A 3I6KA 3CUPB 3H9HB 3BQUA 5E2VH 5H94B 3S7GA 3RTQD 2ICEA 1CDUA 2A77H 2VIRA 3EFFA 1SBBA 3CU1A 4XAKD 4RGOL 1RULL 3IFLL 2J4WH 1UGNA 3ISWA 1LP9E 5IK3B 5INCB 4EUPA 3N1MC 1YEJH 3PGDB 3U0WH 5D2LB 1EFXD 1UVQB 2DWEB 2YD4A 4MNGB 4P9ML 1X5FA 3MLSL 5HI4C 3C60D 3ZSTA 4P5KB 2DQHH 2VDRL 3IU4H 4G6JL 3MRNB 4AIXA 4RZCB 5H35A 5DMJB 1ZVSB 4O2EB 5KVEL 3F7PC 2OR9L 6FABL 2R0WH 4L8SA 4MJ5A 1FFOA 2F54D 4WWKD 1J86A 3FFCB 4AEHH 1J1XH 5IESL 4FQJH 2VKWA 1J0JA 1I1FA 2J1KA 2EYRB 3DVNB 3BGMA 3HE6D 4YE4L 5MP6L 1I9IL 2BZDA 4AH2B 4FFWC 2XFXA 4YDVB 4EI5B 1EA9C 1I8KB 4JRXA 4KFZC 4PJCB 1MFEL 3FB5B 2X2YA 1UKQA 1AFVL 4F15B 5EU6A 5IW1A 1ZEAH 4LRIC 5C0DB 3MNVB 1BLNA 2X70B 3WFDL 5DRXA 5B4MC 4IRSC 1ACZA 1RV6X 5F6HJ 3U7WH 5FGBC 1DVFB 2ICCA 3VG0H 2VISB 3LQZA 5CBEA 1SVZA 3RWGB 3SDDB 3K2UL 1P9MC 4YBLC 4P59H 2NW2A 2Q6WB 2H26A 3LB6C 1X5AA 1K2DA 3CSYA 3IDGB 4Q2ZA 4WFEE 2Y07H 2UZIH 4C57C 1OSPL 2YPLB 4HXAL 2VLRE 3GK8H 4FZ8H 2YHGA 1P7HL 1PY9A 2ENSA 4S1QL 5TH2B 2GHWB 3D3VE 3MUZ1 4L4TA 1WISA 5HHME 1BFSA 3QH3A 5T3XL 4AQ1B 3ULVF 3O6KL 1RUQL 1QSZA 5D7IF 2PTVA 2NW3B 3FMGL 4XTRD 1T83A 5IHUH 1TPXB 1MHEB 4PBXA 1NUFA 1CXEA 4UILL 4LHUB 3TO4A 4JQVC 5F7YC 1OAYL 3BZEB 4JY6A 3QDJD 2HAZA 4GRMA 5GSVA 3FAWA 3VFTA 3GHEH 1U6AL 3AS0A 4KWUA 3T1FA 1SJVA 3ZHDA 4FG6D 1IGCH 3QHZL 1IEBB 5HI4D 2PYED 3TBVB 4WFHE 3H3PL 2YK1H 5L2KE 3DURB 5MEPA 1R3LB 1QACA 1E0OB 1N4XL 4LLDA 4FQQB 2Y36L 5JXAH 1BFOA 2IFFL 5IB4B 1JI1A 1JK8A 3WE6A 4APQB 3SE9H 5IFAL 2YPVH 1F45A 1MIEH 5GS2D 2AQ3A 1EHAA 3WFEL 3H9YA 4PJDE 1OLZA 4Y1AA 5GRUH 5ICYB 2MKLC 4LLWB 4GG8A 2H6PB 1NMBH 5IMLB 2PR4H 2AEPH 4AT6A 4Q9RL 4WGWB 2KBGA 3LHPL 3D85D 3H42H 4DW2H 5IHZB 4MB5A 1YEDA 4M00A 2OK0H 3HRPA 1FO0H 3ZTNL 2HFTA 4O2CB 3UTPE 1M71A 5AYUL 1H0DB 3WDHA 1GGBH 4IRSD 5B4MD 4JHWL 3RI5F 1LDSA 2WWKO 3P4OA 4PUBH 4KMQA 5EOCJ 4LSQH 1T1YB 2AV7B 2NR6C 3TA3B 1CDBA 4OLYH 1YQVH 2JTDA 4YDIL 4JRYB 5DJ0A 4OD2B 4LPXA 3TEUA 4U6TA 3ULUH 4UOJA 4BUGA 3SDCB 2CO7B 5JHDE 4OZHE 1U58B 1FDLL 2H8PA 1AXTH 5EB9A 4YJZL 3CFBB 4KUCF 1BQLL 1NL0H 1TVBB 3UEZA 4OGXL 4K9EL 4PRDB 3AY4A 2GJ6E 3KPSA 1JNJA 1WZKA 2X7LB 2QADB 3TJEH 1QEWA 1NBYB 2DMBA 2PYFA 3UYRH 1JZ5A 4LSUL 2Y7QB 4Q9QH 1F4XL 5IEHA 1QNZH 4GW4B 1MRCL 1MEXL 2W60A 1IVLA 1FNGB 3MCG1 5IW6B 1D9KA 2DD8H 4DN4L 1Q9OA 3T2NL 1CVSC 4HS8L 1LK2B 4M93C 5B39B 3OZ9H 1A7BA 4OI9A 3V7MA 4YHIA 3JWOH 4NQEB 3ROOB 1N0XH 3WYRA 4K23H 4BFBD 5I0DA 1J88A 2BY3A 4GKNA 2A1WL 4WEMB 4AIZB 2BNQE 5BXFA 3UC0L 1A7QL 3CMOH 4JFEE 5DEGA 4WVRA 1BJ8A 1KIRB 4GRWE 4OCMC 1TXKA 5ECJE 4L3AA 1IFHH 1OGTB 1WBYB 1CCZA 1R3JB 3FT3B 5CP3H 3RHWF 4OT1L 3TIDB 3DVFA 3MRLA 4MDIB 1FL5B 4HFUL 1AGFB 4KTYA 1L7TH 4OFPA 5J57B 3E3QC 1EHLH 3V5KA 1AGCA 1UQSA 1UWEH 4KI5F 3MLYL 2CIKA 3LEXB 4DCQA 1DN2A 3I3DA 3MFGB 4ODTH 4YFLF 1J1PL 1NAMB 5DDHA 4CNIA 5ITBL 4JHAH 3S3JA 3RWIA 4K7FB 4HH9A 4X6CA 1I3UA 4PIRF 2AP2A 4GKSA 3GM8A 1XEDA 3AUVA 4QRRA 4P3CH 2X1XR 3DSFL 5GGTH 4HWZA 5KW9H 4G42A 3U9UA 3HC4L 4HS6B 1Z6JT 1F4WH 4IMKA 1XGTB 1J05B 3BIKA 1MCJA 2OSLB 2GJZA 4YHNB 2AXGB 3U0TA 4I0PA 2NX5A 1B2WH 2OL3H 5T1MB 2VUOA 1NDGA 4ZDHA 4X5WA 2EDFA 4IRZH 4XWGL 3HPJB 5B3JE 5DJYA 1VGEL 3QIUC 3W9DA 4Z9KB 1XCQA 3SKOA 2DM2A 3HB3C 2ATPA 1F3DJ 4NQXB 3GIVB 4M7ZB 2P43B 3L9RA 1IQWH 4OFYA 4NCDA 3CZJA 3GSRA 4MD0A 3VG9C 1UZ6F 5KSVB 2VLKB 3SPVA 4G7YH 4HUNB 3TP4A 3IDMA 1HILB 1TJHL 3JV6B 3EOBB 1ZLSL 3VFNA 4HLJA 1ZT7B 3PV6A 1KN4L 1OPGL 3RZCB 5FECB 3WL9B 5K9KA 4B0MM 5C70A 3D69A 3QQNA 5E08H 2R29H 4MXWH 4WUUE 4XNZB 4UT9L 5CHNA 3K2MC 1V3JA 4ODBD 1LWRA 5D70L 5E7FA 3WIHH 3QO1A 4WW2C 5HHNA 5DD5L 2CIIA 3I6LE 4RAUA 3QPXH 2EDDA 5DJZA 4Z7OE 5JR1H 4K3DH 1V3MA 2HVJA 2G2RB 3G9AB 3UAJD 5IF0A 3MYJB 3UTSA 2VSCA 5KVDH 1NH6A 1TJIH 2Y1VA 1B90A 1Z3GL 1DSFH 4HWBH 2HMIC 3THML 5EZOH 4N9OB 2B1AH 2F19L 1TTUA 1BJ1J 2AEQH 1G0XA 4L8CB 2NY5C 4M1CC 4K7PY 1PX4A 5DT1L 4NZTH 2IH3B 3NTCL 4L1DA 3L3KB 1NGZB 4PJHE 1NANI 5LAXA 2ICWB 3EJZC 4TN9A 2B5IC 3ZE2F 4L8BB 4R7DA 1V7NH 3T77A 5FF6B 2MQ0A 1W2KT 4U6XB 3STLB 5EA0H 3AB0B 5D2LF 1FPTL 5FM5O 4M1DL 4YK4C 1EHXA 3HG1A 2JK5B 5IVNA 4PRBB 2CDGA 2Q8BL 1WWAX 3IJYB 4LP5A 3QIUD 3RPIA 5C0CD 4ZFGH 1FV1A 3T09A 1LE5A 2A9NH 3IXTB 1UACL 3F7YA 3OAYK 4YHPA 1FNLA 1NUDA 4G8EB 4V3EB 2HRLA 5EWIH 1MI5E 2UWEE 4ALAH 2FL5A 3VXNB 2JCCE 3FRUB 4U7MA 5GSRA 1DQDL 4DTGH 3UROR 5ITFA 4MYWB 2VE6A 9CGTA 1JNLH 3AVEA 4KI5D 5AWNL 2DQDL 4PJCF 1EDQA 2MPAH 3GHBH 1NEZG 5EU5B 2V2TA 4EEEA 1EJOH 5CP3A 5HGBB 5FYJH 2BRRH 4Q97A 5HHOB 3REVB 2F54A 3MGTB 3NGBC 3PHOB 4XBEL 3RBSA 2VDNL 4EOWH 2O5ZL 4NQCB 3TZVA 1DEEA 1A6PA 2VB5A 4LLVA 4KQ3H 3TV3H 3QI9A 1OTTC 3IGAB 5DHYA 4NN7B 2G60L 2BMKA 1U2HA 1W0VA 3PQYB 3KPRB 5ISZA 1CGWA 5HHXH 5D7SL 3RUGE 5F6HI 4PP8C 2XACC 3O6FB 4DJMA 1X4XA 3FO0H 3QZWG 4BSJA 4M6ML 4AZ8A 2HMID 4KUZH 3BUTA 5KANG 1HNGA 4PJ7A 3CX5K 3DMMB 4WHYH 4PV9A 2PF6A 4JM4L 5C0IB 4DOHE 5E9DE 4DVBB 3MRQA 3TH2T 3V7AE 3PE9A 5AAWA 3HUJE 4M1CD 4WU7A 3MV01 3U6RA 4OFIA 5MERA 4JPVH 5FKPA 2IQAB 3BP7A 3BKML 1JZ7A 3ARSA 3TFKA 2ZOKA 1AGBB 3OSKA 5JMRA 4XPTH 3NZHL 3S34H 5F9JB 4YDLC 5C2BH 4HDIB 3F58L 1BVLA 1SYSB 1CBVH 3EJZD 3X11A 4ZAKC 3O3DA 4LFHD 1U8QB 2FIRT 5F1IA 4F2MB 4LKCB 2B2XL 4NKOB 3TVMC 1NGXB 4P46B 4UU9B 2J88H 2VAAB 4HKBB 2MOVA 5D7LA 1KJMA 3SO3B 4XMPH 2BCKA 3UTQB 4BSVA 2XIDA 2GAZA 5DMIH 1N5AB 3RKPA 1FGNH 3BPCA 4OB5L 3SJVA 1F90L 1WC7A 3PDOB 1DLFL 4LSDA 4GUPB 2EDQA 3WXWH 4HUWA 5EO9A 1PLGL 5K9JH 1XH3B 3GGWB 4HJ0C 4M43L 5I1IL 4JB9L 4MA3B 1XFPA 3QUMH 3EYQC 1G6RH 1A7NH 3P4LA 4P23A 5DZOA 4MA7H 1UB6B 3WIHA 1ONQA 3ARTA 3OTTA 2PYEA 4X7TA 1DUYA 3JV4B 3QIWA 3BP4B 4LAQH 3IAPA 2BSTB 2LVEA 3B3IA 2P8PB 5IMOA 1CFQA 2VLJD 4KDTC 1SHMA 4PJ5A 3C5ZB 1KULA 2MTPA 3WO4C 1FZKA 4L5FL 4N0UA 4WY7L 4TNVF 5EUKB 5FA3A 3FQNB 5KJRL 4L3EE 3QDGD 4HWBA 4I2XE 2HJKA 5GXBB 3WV0A 3KWWB 1OTTD 1BOGB 4TULH 43C9A 5DFTA 5AZEH 4ZFZA 1CFNB 4OCNC 4KJWC 2XQBH 4YDJB 3MMEB 1HHJB 3BWAB 4X6FB 4OZFH 3DROA 3VMPA 4MGXA 4J23A 3B2VH 2LU4A 3N9GH 4NZUH 3VXSD 4NKDB 5T1LB 1EBAA 3IFOB 4NZRH 4DZ8B 3MV7D 2D31A 5L6YH 1BX2A 5D2NE 1KCLA 1PVHA 1I8MA 1H3PH 1MCCA 5I76A 1ZVHA 4IRJB 4CDGC 3KLHD 4LL9A 1INQA 1BBDL 1FLRH 1FNFA 2X9XA 4XMLH 1T2QH 5ICZB 43CAA 2OP4L 5ILTL 4KRMB 4JJ5A 4LEOA 3B43A 1CICC 3LIZH 3HZKA 3QUXA 2HJFA 1SEBA 4JGJA 3Q3GA 4EI6A 1EFQA 4KKAC 1H8SA 1P1ZB 1HDMB 5ID1B 2XN9A 2NLJB 1F4HA 3ULSB 5IVOA 3G6AB 4RX4D 1E4WL 2EECA 5F9OL 5CD5C 5IWLA 2O61A 2H32B 1OSZB 3I9GL 2YRZA 5CGTA 3TBWA 3CXDL 1XGUA 5KVGL 3HPLB 5D1QA 4P2OB 1GVIA 2GTWB 4RISL 4JPKL 4IOSD 4F7TB 5C07A 4YBHA 1KFAL 2E9IA 2FLRT 4L4VB 1F8TL 2B8OT 4XPBH 4PD4J 3U46A 4HJ0D 2CLZB 2EIZA 3GB7B 2ZCHH 1B0GA 3EYQD 5D5MB 4S2SB 2DQIH 3CDGB 1G84A 1S7QA 2IALA 4Z7WE 1HHGA 2JB5H 4JFZL 4XCCL 4Y2DC 3L3JB 5LCVH 3DXAD 4Z78B 4QF1A 3IDXH 2ZG1A 1JUFB 1P5VA 3KPLB 1GZQA 5C09D 3D0LB 5FYKL 1MCPL 4JPWL 4NBZB 1CK0L 3UXFA 4L29B 4OZIE 3OB8A 5J6HB 1R6VA 3D39A 4R97C 3W0WD 3S37X 3DO7A 3ZDYE 3D1MC 3SBWA 3EDJA 5JO5A 4ELKB 2DTMH 1QO3A 5GRVK 3TJHC 4NGHL 3VW3L 4G6FD 2OTUA 4JDTH 4WRLA 5CIPB 1MCNA 1OCWL 5IM7B 3HI5L 5TQ0L 3QUZD 3D9AH 2RBLA 4WU5A 1P69B 4NNXB 2FYYA 5IBUB 4UB0H 4OF7A 1FGVL 3U7YL 4JJHA 3VFMA 4A6YB 5D7IA 1OGAE 2AJVH 5E94A 1QLRA 3K4ZA 1KENH 4RFEA 4S0TD 3IJSB 4XCYA 4XP9H 4NC1C 4KU1A 2AQ2A 3LQAH 3CVHL 1X3DA 4N90E 4XZUA 3HNSL 1MJ8H 5GGVL 3E2HC 1P4IH 1CICD 3SN6N 4EQ3A 4NRYA 3WHE1 1JHTB 3BT2L 3GMMA 4NQSB 3P73B 4D0DB 1AR1D 4CUCA 1G7JA 4P2QE 5JIPA 2EZ0C 4FTVB 4PYHA 4PRHD 4Z77A 1IMHC 1IGYB 1TTGA 2R1WB 1A64A 3E8UH 3FQXA 2IAMB 3H9SB 4NO0D 3C6LD 1UM4L 2AK4A 3EO9H 3U7AA 5DI8A 1G6RA 3HC0A 1P6FA 4TSAL 1LE9B 5KVFH 2CR3A 3KYOB 4BK4A 2P7TB 3ARZA 4NQDB 1QVOA 3X13A 3RVUC 5BZWA 3OQ3B 5EO1A 3VFVA 25C8L 3DRTA 2VXUL 2BP3A 5KSBE 1M7XA 4MNHA 4YHZL 1JPSH 4ZFFA 3AU1A 2JELH 1KIUA 4WCYL 4X9HA 1ZHNB 4NUJA 2ATKA 1DP0A 5F7EL 3VGAB 5EFIB 1RJLB 3EYUH 4Y2DD 2ERJC 2ICES 1KTLB 4M6AA 3GSNH 5BRZA 4H0IA 3VWJC 4X99A 2GJJA 3QULA 5IBTL 1VKXA 4X4MA 3MODL 4QRPB 1ZTXL 2DQJL 5FCSH 5HYJB 1T80A 4UIMA 2DLFL 4OV5B 1NBVL 1Q9KA 5CEZH 4D9RE 1FVDB 4EN3C 1XF3B 4M93B 8CGTA 3RVTC 1ZANH 1F97A 3MRGA 5I1GH 1QSFD 1NCTA 4N0CA 3L7EB 3D25A 3TJHD 4ETQA 3HZYB 5F93C 3P0VH 4H25A 4P5TD 3V6ZA 2EO9A 3QQ4B 3R0NA 1HKLH 4P4RB 3KGRA 5FA4A 1KPVA 4JFDE 4K55A 4MSWB 1DLHB 2R69H 3S3PA 4HC1H 1IGTB 2DI9A 3TBYB 1WQVT 3GIZL 4G80A 1WFOA 1AGDA 3TN0D 2X4PB 5CBAB 1XCTB 3CFCH 4AEIL 4JO1L 3U4EA 1NC4A 3OR7B 4HUVA 2RAMA 3WJJC 3QEQB 3R06A 1RZ7H 3V4VH 1IAKB 1PQZA 4J3SA 1FN4B 1OWRM 1J8KA 1SBSH 2OR7A 3AREA 1U8OA 4JZOA 4M3JA 5IFJA 4YZFE 1WFUA 5AD0A 1MCWM 1WZ1H 1IBGL 4NBYB 1Q0YH 3QZWB 1RZGA 1N64L 1N3NA 4KQ4L 4R8WH 2A6DA 2HT2D 3KYAA 3VXPB 3EOTH 3KG5A 3CDYA 3MV8B 2R2BB 5GRZA 4F7PB 3A67H 1D5IL 2O5YH 1A02N 3K8MA 1KJVB 4GMSL 5L8LB 3IAGC 3TF7A 1RU9H 5FGCE 4P2RA 4MQ7A 4RQQA 4ZPVA 5JW3L 3IXAB 1R5IA 4HIEA 6CGTA 1FL6A 3V6BR 3RX8A 1A7PH 1AQKH 2P5ED 2VL5A 1MRDL 3DYPA 3VFUB 3ZYJA 3RVUD 1F11A 4XPHH 3HR5A 4R4FH 5IQ9B 4OFKA 3SO5A 2PXYC 2I26N 3RWHB 1MLCA 2FIKB 3VXMA 1RZJC 4NHUA 1YA5A 3FN0L 4JZNB 2CSPA 1S78C 2EIBA 1MUJA 1Y6NR 4FZEL 1T2JA 4ONGH 1BVKB 3LH2L 1HH9B 2NY4C 3DARA 1T6WA 2VZTA 4HK3J 1RZ8B 1S9VA 2DN7A 3CDFA 3QO0A 4N8VA 2VDLH 5F7NC 4GKZA 4MVBA 4UV4L 5FYLE 2KPNA 3UYPA 4M5ZL 5A16B 5TPWL 3WFBL 4EN3D 5CJOL 3WHE0 4DKEL 3RVTD 1OTUD 1J1OL 4PJBA 4C56D 3VG9B 4PJFB 2UYLB 1CS6A 1NGWA 2D0GA 2F5BH 3FQRA 4F7EA 5K93A 3P11H 1BEYL 1AKJB 2HFEA 3IDYC 1OVZA 5C1MB 3QFJD 2AVGA 2ZSWB 3O0RL 1DBBL 1JN6A 4BSWB 1YMMB 4M7LL 2IQ9L 1KJ3H 4X4YA 1H5BB 4DAGL 2WQ8A 5E6IB 5F9WC 5FHAH 2BSSA 2DQTH 5DK0B 2WWMC 4WW2B 1WFTA 4PJAA 1YEKH 1D5XB 1NAKL 2YD7A 1AO7D 1G1YA 5D7JA 3KVQA 5GGRY 5BV7L 1QRNB 5E5MB 1YEFH 4HGWB 1E27B 1P2CB 2C4XA 5J1TC 3JVGC 4QOKA 1HEZB 5AZ2H 4WUKH 3V5DB 5EUOB 1JF6A 5DJ2B 2AJUL 4LSRL 3QDME 1H8NA 3TH3T 3WJLA 1MCLA 2OLDA 3ARDD 3RWDB 3E6HB 1NFIB 1CFSA 1HOCA 1JGLL 2OTWA 1MQ8A 4U1SA 3MLPA 3L5WA 5KAQG 3VFWA 1JGDA 5IGXH 3GSNA 3QQ3A 4LCUB 1U8KB 4JFPB 4QHUA 3FQTA 4NO3A 5JPNB 1EXUB 4KY1H 2PXYD 2WWKT 5I17B 2HA1A 4ELMF 3S96B 2ZNWA 1GL4B 1DBKH 1S78D 3QFDA 3VDCA 3MV9D 3B8SA 5C0BB 5HDLA 1I3GL 1CR9H 2NY4D 4OD1L 5IJKC 1J8HA 3CUPA 3H9HA 5H94A 4M6OL 4X98B 1RZIA 3NA9L 3PL6C 2RHEA 3AXLB 2HTKD 2XTJE 3U4BL 4LPTA 5FUOL 2CDEB 2VZUA 5IK3A 5INCA 2ZUYA 2O5XH 4H5SB 4HC1A 5I66B 3SOBL 3PGDA 5D2LA 2DWEA 4MNGA 3V6OC 4O9HL 5FFLA 2CKBL 4P5KA 3MRNA 1Q9WA 3GKWL 4RZCA 3S5LG 1QLFA 1CXKA 1FFRA 1ZVSA 4Y4KC 1VESA 1MRFL 5GGQH 2WV3A 2EO1A 2P4AB 3FFCA 1G6VK 2X1OA 3M17A 2VLME 2EYRA 3DVNA 2A2QT 3S3SA 2D7PA 3NPSB 3BGAA 4AH2A 3DHMA 4YHOH 2NZIA 5SV4A 2WWMD 4EI5A 1F02I 2AJSL 2CRMA 1ITCA 5EN2B 1HIML 1I8KA 4PJCA 3FB5A 1S5HB 3B83A 4L3CA 2FJHB 5HI5D 1FIGL 4LCIH 5E8OB 5C0DA 3MNVA 2X70A 1J5OH 5FHBH 4ZS7H 2J12B 2B1HH 4X7CC 3IFNL 2CD0A 4K3JL 3B5TA 4LSPL 4S1SL 2Q87A 4N8PA 5B8CC 2VISA 5CKAA 5A2IH 3RWGA 4YNYB 5IG7B 3SDDA 4X7FC 4BZ2L 2XXMB 2IPTL 4JO4H 2Q6WA 1VB9A 3IDGA 4G9FE 2OI9B 4YDLB 4F8QA 2YPLA 1RZJL 4QXWA 3CVHB 4M3KB 2IANB 4XC1L 4ZAKB 3DXAA 4XP5L 4DN3L 4ZNEA 3TVMB 3VI3E 2EDBA 1T22B 3TT3L 5TH2A 2BY1A 1A7RH 2F58H 4WEBH 4WI9A 4W4OC 3ZKXC 4GOSA 1T7ZA 3DOSA 1MELA 4J12A 5HHQB 2V7HB 2NW3A 1QZ1A 2Z4QB 4WI5A 4JZJB 1MHEA 1J0IA 4UQ2B 4LHUA 5F96L 1EH9A 1TJGH 3BZEA 3SGKC 3AFLA 5HXMA 1EZVY 2GITA 5JOFB 2FEDC 3EZJB 1GAFH 3SDYL 4E5XB 1IEBA 2VQUA 4TTDC 1VCAA 1RUPH 3GNMH 3DURA 4PTUB 4W81A 3LEVL 5GISH 3GM0A 1R3LA 3GMQB 4KPHH 4NYLB 4K94C 3VFGH 1ZA3B 3QCUL 2DM7A 4FQQA 1N2RB 1JHLH 3TNNB 2DIJA 4APQA 3UMTA 2NY7H 4KKLC 3GSUB 1NCWL 4R2GC 5JXEA 2M26A 5T5NG 4V1DD 3RDTC 3OAYH 2W07A 4AL8L 1YEHL 2BFVL 4OGYH 3W0WB 5ICYA 1A14H 4LLWA 5GGVY 4PGJA 3PDDA 2H6PA 3A6BH 4QHKI 4NQVB 2AERT 5EBGA 4NNPL 4NM8H 1DQJB 2FO4B 4J4PA 4JFFE 3QR2A 1RHHB 4MS8A 2X9WA 4N9GB 5IHZA 4NWTH 2GT9B 1IAII 1SM3L 2Z0BA 4O2CA 3C6LA 1H0DA 4NZDA 3ZTJG 5J1AB 4RWHA 3CH1B 3N1QC 4ODWB 1VACB 2FH8A 4OTXH 4XPFL 5K9QG 2Z31C 4Y8DC 3TA3A 4JRYA 1B0RA 1RZFL 2HWZH 4OD2A 1R3HB 5TDOB 3FN3A 2ARWA 4RRPG 5GJTL 1GGIH 3SDCA 4X6EB 2VDRH 1CDIA 2ESVD 4I5BB 4NOFA 2NY0D 1U58A 5F6IC 3DBXB 3PWPD 3CFBA 1CICB 4KHTL 4QT5A 4F9LC 2DTSA 2OR9H 4PRDA 3LMJH 4JM2B 3HZMB 1WJ3A 5B38A 3BRDA 2PTTB 2X7LA 3DWTA 1NBYA 3M1BB 4XVTH 2Y7QA 4GW4A 4MHHG 1FNGA 5IW6A 1FVEB 3ESVF 3RNKB 3SGDH 1YECH 5KOVC 1U8LB 5DGRA 4HLZH 1LK2A 2WBWB 4K3HA 5B39A 3INUL 5KS9F 1ZE3C 1EEYB 4U0QB 3ROOA 2XPGB 3VXRD 1JZ6A 4YWGL 4KZDH 2E9BA 4TUOB 1ZT1B 2VL4A 1X5JA 4YEEA 1FZOB 3MRIB 4AIZA 1U93B 3V52L 1IM9B 3QG7H 2RQ8A 5EBMB 1GGUA 5GRJH 4GG6B 1LO0L 5D1XB 2BVEA 4XMKL 1KIRA 2J8UB 4Y2DB 5H2BB 1OWWA 1OGTA 3HMWH 1V7ML 1WBYA 3KLAB 1I4FB 4RAVB 1R3JA 3FT3A 3TIDA 4KKLD 2FBJL 4HK0B 1R5VB 3C08L 1OAUL 2D0FA 4R2GD 2AJXH 4MDIA 3CDCA 1FL5A 1IAMA 4R97B 3W82A 2CO6B 4DK3A 1AGFA 5DS8B 4PJIB 3O3BB 2FGWL 3QIBC 4Z7QE 3KR3H 3I50H 1PD6A 3NH7H 5HSFA 3MYZA 4G9DA 4F33B 4PRIB 5EZIH 3OHXB 4K7FA 4OZGF 3AAZA 3H0TB 4QXUH 3O8XB 4LF3B 4OV6F 5TE6L 4ZXBC 1HNFA 1DR9A 1XGQB 4FQXC 1HXYB 3HNTL 5MENE 5I16B 3STZA 3RWCB 1U6AH 4CVZB 1XGTA 1IC4H 4R6UA 2OSLA 2KKQA 4YHNA 3MLUL 5EBWB 4PB0L 2AXGA 1FRGL 4EUPG 4B5EA 5E99H 3GUTA 1FCGA 3BO8B 4N0FB 2FJFA 1W72H 5T1MA 3BZDA 3PHSA 4PJFF 4CU8A 4G8GB 2GTZB 3HPJA 5C08E 3CSGA 5BV7B 1LEIB 1CQYA 5IKCB 4KMTL 1X6NA 1TZGL 2EYSB 2JIXD 2YEZB 2CLRB 5ALCL 3RL2B 1OP9A 1T66C 4LNRB 4NQXA 3GIVA 4OIIH 4PYGA 1G0YR 2R9HD 4D94A 4BK5A 5FCUH 1QLEL 3JWDH 1QBMH 1QOKA 2FRGP 2VLKA 3W9EA 4MCYB 1HILA 2QQKH 3FONB 2EEDA 2GY7B 3EOBA 2P5EB 4WTZA 1A9BB 5CZVH 5JQHC 5DVKA 3PABB 2BNRE 5AYUH 4YHML 1FSKB 5SWZE 5FECA 3IF1B 4Y16C 3MRCB 3WL9A 2BVQB 2PO6B 1QQDB 1T7WA 3O2DL 4UMGA 4K94L 4RFNC 4WEUD 5T33L 1S8DA 4Z7NF 5EUOF 4KKCC 2VUYA 2ERJB 4R90L 1YNTB 1KC5H 3G9VA 3VWJB 1AHWC 5SWSD 1OAQH 3BGFB 2VTFA 2ORBH 2ZKHL 2G2RA 3SKNB 1AH1A 4MNQE 3P0YL 3WXVL 3QUYD 5I74B 3MSPA 4MJIE 4LSUH 3S8WA 2X4TB 2EH7H 1LP9B 1CLYH 1PYWB 1TMCB 5I1KH 5HYEA 5JW4N 3HKFA 5J3HC 1ZV5A 1Z0NA 3S5LB 3T2NH 2P47B 1A21A 4NIKB 2HFFB 5CP7B 1DBMH 1T7VA 2CKBB 4DGVH 2LE9A 4UV7H 4P49A 4Y19E 4EIGB 3RGVB 5BS0E 4I4WB 3NACH 1MJ7L 5JORB 2QR0B 4OCXL 1AE6L 1P7QB 2IH3A 4JFOB 3L3KA 1NGZA 1FNSL 1QR4A 2ICWA 2CJUL 1ADQL 4L8BA 1KPUA 3I2CL 3TH4T 5FF6A 5C6TL 2HKFH 3STLA 2ZUVA 1L7IH 4XAWL 4JFXB 2JK5A 4PRBA 4HK3N 1CN4A 3IJYA 1D5MB 2OQJA 2PN5A 2K3TA 3BDXA 1J0ZA 4HIHB 3B2UC 3IXTA 4NKIL 5B3NA 4LAJH 4LIQE 1V3LA 1DUZB 4H8WH 3E6FB 4G8EA 4D9LH 4BFIB 3QCVH 1BFTA 5E8DL 3SDXF 1RIVH 2YD9A 3F6LA 3VXNA 4WNQB 4MAYD 3FRUA 4H0GA 3IVKB 3GSXB 4WI7A 2GI7A 2JE8A 1F4YH 3CVIL 5EU5A 5EORL 5EIQA 2EDLA 1WEJH 4NDMA 3UTTD 4HKZB 5HGBA 3QXDB 4Y16D 4NNYB 5DVMA 4Z7UF 2NPLX 5HHOA 2VLRB 3REVA 4G6KH 5AAMA 1MFBH 3PHOA 3EFDL 1BZQK 4EBQL 4NQCA 3MCKB 5F3BB 4LCWD 1SYVB 2H41A 1BAFH 3NCBB 2PKDA 3DX6B 3QNZB 4KKCD 3D3VB 1EV2E 5HHMB 2VDQH 5EIIA 3OPZL 4K8RH 3O4LD 4OF8A 4DKAA 3KPRA 3BJLA 3KNBA 3C9NB 4AYFA 4TVPE 3I6GB 4JO2H 1YQ2A 4R96B 5EPMB 1AJ7H 4BH7B 5BO1L 2BC4B 1XIWB 3O6FA 2MQCA 3MOBL 4X6BB 1XF5B 1E4XH 5J3HD 3KDMA 3SEPA 3CFIC 3DMMA 3IDYB 1CZ8L 3CGTA 4ZSOE 5C0IA 1VGKA 4XH2B 3I75B 1MWAH 5EC2B 1UM5L 4DVBA 5L2KB 5CIPH 4BZYA 5D8JH 1W72A 4NQEE 2IQAA 5I1AB 2VXQH 2PCPA 1IGFH 1KEGL 5E6YA 1A1NB 1AGBA 1YNKL 4I8DA 1KN4H 3V7AG 3ILPB 5F9JA 5F9WB 1MIML 1A8JH 3W5MA 1P53A 1SYSA 2E7MA 2APXA 4PJDB 5D9SB 5I73C 3AS2A 4A6YH 5IQ7L 4YHYC 5BQ7B 1U8QA 4F2MA 4LKCA 5MHSD 3BE1L 4NKOA 5D70H 1NGXA 4P46A 4UU9A 4J6RL 3S35L 4QXTB 2VAAA 1SJEB 4LLYB 3KXFE 4FQHA 4HKBA 1K4CA 4PJ9B 3L3IB 4CGTA 1M05B 5IROC 2GSGB 4NQTA 3UTQA 1GIGL 4AG4H 3QWQB 1UB5A 2L7JA 1N5AA 3B2UD 4CMHC 1UCBH 1Z5LB 1HCVA 3PDOA 3U48A 4GUPA 5DWUL 5IR1B 1TQBC 3T0EE 1XH3A 3GGWA 2XRAH 4I3RL 1W0YT 1DQML 4MA3A 4HPYL 1GC1H 2D7TH 4WI2A 35C8H 1UB6A 2PETA 1J11A 3EIFA 2JJTC 1U3HC 1CL7H 4ZG1A 4NHCL 3JV4A 3F5WB 5JHDB 3BP4A 4OZHB 5CLTA 2BSTA 2P8PA 3NABL 4ONFL 2GJ6B 1X5XA 3C5ZA 1I85A 4JFHE 1VFAB 5BVPL 3BSZH 1MCDA 1Q1JL 2XOTA 4L8DB 1HYSC 4IJ3C 5EUKA 4OM0L 3RVWC 3S88H 2NXYC 2E9WA 1Q0XL 3PL6B 3MXVL 5GRYA 1FPTH 2XZQL 4C55A 4M1DH 1TTFA 3KWWA 4IIQC 5DK2A 3QNYB 3RVVD 1BOGA 1WIUA 3OXSB 3MLVL 1CFNA 1L9MA 4XPAH 2VDOL 3VMNA 4PLKC 4ELMA 1JJUA 3MMEA 1HHJA 1NFDE 3BWAA 4X6FA 1RUAH 3EZ8A 1OAXL 1S9XA 4JM2F 4KTEH 4NKDA 4UINH 3IFOA 5F7DA 5E0QA 1UJ3C 1KTDB 1H3UA 4DZ8A 2BNQB 4QCIB 4JFEB 4QRRE 3O3AB 4Y4KB 4DVRL 4IRJA 1KV3A 4GRWB 3CXHK 1IGJB 2YN5A 5J13B 2OZ4L 3NCJL 4P57A 4XX1E 5L8KB 4KJQC 2FD6H 4MD4B 4PJGE 5CJQH 5H37G 1PEZA 4XBEH 4U2YA 3H7LA 2AKRB 2VDNH 5JQ6L 4IMLB 1P1ZA 1HDMA 4WJ5B 5E5RB 5ID1A 4CVXA 2NLJA 4AENA 4FFZL 3ULSA 5KTEH 3G6AA 1AXSB 4LRIA 1N6QL 4GG6F 5LGJB 4XHQA 3TCLB 4LASH 1DL7H 1S5IH 4WHTB 3HPLA 4JFYB 3FZUD 4P2OA 3WS3B 5B8CB 3MBED 2GTWA 2EKJA 5IVXE 2AEWA 1GYAA 3CFEB 4L4VA 1UWGL 4MXQA 2OCFD 3MLWH 4I9WE 1ES0B 1KYOK 3MRPB 2CLZA 5LG1A 3GB7A 1TVHB 3N1PC 4QRUB 4H1LB 4S2SA 2RFXB 1ZMYA 1CGVA 1RY7B 3CDGA 1FVCB 1LK3L 3QCTL 4LARL 4Q58C 1U8IB 3GSWB 1CTOA 2M8XA 3BYTA 5DLMH 3L3JA 5GJSL 1G0DA 4Z78A 2IWGA 3BKMH 3L5HA 3T3PE 4I18C 1JUFA 2DJSA 4CAGA 1QHPA 3KPLA 1IEHA 3D0LA 4Y5XC 1YEIL 1UWXK 4L29A 1CE1L 1HSBB 5J6HA 2C26A 2YS4A 1C8PA 1EAPB 3NPZB 3ZKXB 3PGFL 5C9KA 4HG4K 2NXYD 1FYTE 3BDBA 4AMKH 1TZHB 3VRLF 3ETBF 1FBIL 1CF8L 2QQNL 4ELKA 1UXWB 4XNXL 5DTFA 1E6OH 2HTLD 2W0PA 5E2WH 3D6GA 3O11B 5CIPA 4PLKD 5IM7A 4PGEB 2F53E 1LO4H 4M6NL 2FHBA 5J6GB 1CU4H 2WUCH 4I3SH 4HULB 3ULUE 3PWJA 5C0AE 4S11A 2VJXA 2VWEE 4JLRB 2WNGA 4S1RL 4FFYL 5DVLA 4HPOH 1GPOL 4A6YA 4WUUB 4YXHL 5LXGH 5MI0B 1NCUA 3EYOA 5DA4A 1NGYB 5D72L 3RDTB 3HC3L 4OCSH 2QTEA 3IDJB 2NXZC 3UBXI 5TQ2H 1LO3H 1OAKL 5DJ6B 1JHTA 1I9RH 2I60L 4XVSL 5L0QB 4NQSA 3NFNB 3P73A 1NC2D 3LZFL 5FB8B 4D0DA 1FHGA 4FQ2H 4FTVA 5M7QA 4YQXH 1NCCH 1BZ7B 1IGYA 2XTLA 2R1WA 1OAZL 4NJ9L 4UTAL 2IAMA 3H9SA 3MRFB 5L88L 2Y25A 4HGMA 2FO1A 1LE9A 1D5BB 3D18B 1TQCB 4XAKE 2WBJB 3KYOA 3H2WA 3U79A 2P7TA 3MRHB 5BCAA 4NQDA 2V7NB 2Z31B 4YIQB 2OM5A 4BQCA 2NYYD 1MPAH 2LU7A 1CFVL 3O9WB 2BXYA 2NY2C 3GZKA 4X9GA 4PJHB 1A5FL 2QQLL 3GMNB 1B4JL 2W1NA 1EZVX 1ZHNA 5F6IB 1KSRA 5HBBA 1I1AD 5JLZB 4WI6A 4XPGL 5CFHA 3REWB 5EFIA 1RJLA 5D1ZD 4XCFL 2F54E 4B41A 5I19L 1BBDH 1KTLA 3MA9L 3S36H 3ZSSA 4XGZB 4R4ND 2XA8H 4QRPA 5CSBA 5HYJA 4ETYA 3W39B 4DUWA 1INDL 4OV5A 2YD8A 5T3ZD 1FVDA 1XF3A 1MY5A 2K7QA 2FATH 3LKOA 1MI5B 2UWEB 2F9BT 3L7EA 2JCCB 2ZCLH 1V5JA 1WTLA 3HZYA 2G9HB 5CKGA 4ZTOH 3QQ4A 1NGPH 4P4RA 1RMFL 4P99A 1E4JA 3LDBB 1YEGL 4MSWA 4HH8A 1DLHA 2W38A 2A73B 1IGTA 3WMSA 1BGXL 5DRNB 2Y23A 2X4PA 5CBAA 1XCTA 4LEXH 4ZMAT 1MAML 2BSED 4BM7A 3OR7A 4P5MB 4UT7L 1IAKA 4OCYH 4P4KC 2IPKB 4F57L 1FN4A 1N26A 3RJDA 3QXUA 3LSOB 3CFJB 5GGUA 4CDHA 2NXZD 4LLAA 5KZCD 1HN1A 3QIBB 1FG9C 1RURL 3QZWA 5EOCL 3RUGB 1QR1B 4GRLD 4KVCL 1HQRB 3VXPA 2EYTB 3MV8A 2R2BA 4F7PA 5IMKB 2V5SA 1C12B 5HYIA 2FX9H 2EXYC 1UKSA 1KJVA 5DHVB 1EEUA 4KRPD 3HMXH 1RSFA 1NDMB 4NGHH 1ZOXA 4ZXBB 4DOHB 1S3KL 3IXAA 5E9DB 5IVZB 4FQXB 3HUJB 4J7RA 3QDJE 1AD9A 3BFOA 4RAHA 3VFUA 5IQ9A 4KHXL 4JPIB 4E41D 3G08B 4JRWA 2APFA 3RWHA 3F12B 2FIKA 2NY2D 4JR9H 2PYEE 4QRSA 4CJ1A 5I2IA 3GI8L 2BDNH 3IDIB 2GK0B 2DMKA 4JZNA 3SCMC 4BH8B 5D96C 4OZGA 1U91B 4RGMC 5GHWH 4ZUTB 2YXFA 2YPKB 4KJYB 1HH9A 1J0YA 1WF5A 2NY6C 4DQOL 1RZ8A 1WUNT 3JWNC 4RMUA 2CLVA 4PB9L 5E24E 5FYLL 1ZGLM 1HWGB 4LCCC 5A16A 3UPCA 4XB8A 1C1EH 5F7UA 5DURB 4ODSH 3ARRA 4PJFA 2UYLA 5HD8C 1JNNH 3BVNB 1OARL 4NN5C 2I25N 4MMZC 4PJDF 1Q72L 2EH8L 1AKJA 5FDWB 1T89C 3MCLH 3NCYS 4DGYH 1A6WH 3DX7B 3RA7L 4I77L 1KCVH 3TYGH 1C5DB 1BD2D 3KHQA 2ZSWA 5IJVB 2R39A 4BSWA 4QTHB 5TE7L 4URTB 2IGFL 1YMMA 4ODHL 3T0AA 3SE3C 1H5BA 1YJDC 5E6IA 2R56L 4M62H 2NTFB 5J7CC 2P8LB 2R0ZH 5D5ME 1AHWB 1JTPA 2EXWC 4L3EB 4YX2L 4LLQB 4I2XB 4YFLI 5CCKH 3OKKB 4OF6A 1QRNA 5CAYB 4L4JA 1E27A 1P2CA 1GCFA 4OZ4B 5DEZA 2Q7NA 1LNUB 1SEQH 2G5BA 1HEZA 3LPFA 1FH5H 3V5DA