3VRLC

Crystal structure of bmj4 p24 capsid protein in complex with a10f9 fab
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
SILDIKQGPKESFRDYVDRFFKTLRAEQCTQDVKNWMTDTLLVQNANPDCKTILRALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A10F9 Fab heavy chain
publication title Structure of the HIV-1 capsid protein p24 in complex with the broad-spectrum antibody A10F9
rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system/viral protein
total genus 23
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3vrlC00
2L6EA 2JO0A 2BUOA 5HGMA 4M0IA 2M8PA 2JYGA 3G26A 3G1GA 4QNBA 4U0DA 2LF4A 3DS3A 3DS1A 2M8NA 1A43A 4IPYA 2XV6A 4PH1A 3H47A 4XFYA 1AUMA 1EIAA 3DS0A 4U0AA 4U0BA 3VRLC 1D1DA 3DS4A 4XFXA 3G29A 2EIAA 2JYLA 4U0EA 5HGOA 1QRJA 5HGNA 1E6JP 3G21A 4XFZA 3MGEA 4COCA 3DS2A 2XXMA 1BAJA 4XROA 4COPA 4WYMA 5HGLA 2XT1A 5DCKA 3G0VA 5I4TG 5JPAA 2M8LA 3DS5A 3G28A 3G1IA 4XRQA 4U0FA 2KODA 3NTEA 4U0CA 4PH0A 1A8OA 3H4EA 3DPHA 3LRYA 1EOQA 2ONTA 3DTJA 3P05A
chains in the Genus database with same CATH superfamily
4U0DA 1AYIA 2WPTA 1GXHA 4U0BA 3DS4A 2EIAA 2FQ2A 1Q7YQ 4BPGA 5KP6B 1IMQA 2QA4P 1YJNP 3CMEP 3H0DA 3G0VA 1ACPA 3G1IA 1DV5A 1FR2A 1VQ7P 2ONTA 3GZMA 4F37A 2L9FA 3DS1A 4IZ6A 3CCJP 2PEIA 2P9XA 7CEIA 2JYLA 3RG2A 1NJIQ 1AF8A 2EG5A 1L0IA 1YHQP 2K0DX 3EJBA 1VQKP 2JB0A 2K5XA 1BXIA 3NTEA 3M1MA 2K0YA 2M5RA 3GZLA 2LTEA 4PH1A 2JBGA 1JJ2O 2K93A 3G21A 4XFZA 5F2KA 4CA3A 5I4TG 3CXCO 1YJWP 2AVAA 2N98A 2FADA 4U0FA 2L6EA 2X2BA 2JYGA 3G1GA 2PEJA 1NQ4A 1D1DA 2GZIA 1X3OA 1YIJP 2VSQA 3I56P 2KOPA 1S72P 2BHVA 2DNWA 2PENA 1E0HA 3EJEA 2PY8A 1VKUA 5BS1A 3DPHA 4H2YC 3P05A 4PXHB 1M6NA 3CD6P 1OR5A 3CE7A 1VQMP 1K73Q 1W2BO 1M74A 3I55P 3U43A 2FACA 3RG6C 1RO0A 4WYMA 5HGLA 4BPFA 5F2OA 2GZFA 5JPAA 2M8LA 2OTJP 2CGQA 4U0CA 4GR6A 2FVFA 2N50A 2KGCA 2AFDA 2JAZA 3G6EP 2Z44A 3CCSP 3VRLC 3G29A 2PEMA 2MR8A 3HYBA 1YITP 2GYKA 2VLNA 4XROA 3CC7P 1VQ6P 2N6ZA 2XZ0D 1IMPA 2JU2A 2GDWA 4M0IA 2M8PA 4QNBA 4GR2A 3CC4P 1A43A 3H47A 3B5IA 1AUMA 2LPKA 2L0QA 4H2XC 2JGPA 2KG8A 2KORA 5KP8B 1T8KA 2GZEA 2N5IA 2LL8A 3LRYA 3G4SP 2JO0A 2GDXA 2CG5B 3Q20A 3CCRP 2N5HA 3G71P 2L4BA 2M8NA 3NY7B 2XV6A 2Z45A 4XFXA 2Z46A 1QRJA 2MD9A 2XXMA 3CCEP 1VQ5P 1QVFO 2ROQA 3DS5A 1F80D 2KGAA 1UNKA 1L0HA 1ZNVA 4HKGA 1CEIA 3CCVP 4PH0A 3OW2O 1EIAA 1EMVA 1DNYA 1K8AQ 3DS2A 1KLPA 1VQNP 1RNIA 1A8OA 3H4EA 1IUQA 1EOQA 2JU1A 1HY8A 3WBHA 4MRTC 5HGMA 1Z6MA 3CCUP 2MVVA 4U0AA 3DS0A 2E1MA 2CQ8A 1N8RQ 3CCMP 1UJZA 3E2DA 1Q82Q 5HV8A 2FVAA 2K92A 2FHSC 4DG9A 4UHPB 2KG6A 4H2WC 5KP7B 2VLQA 1KQSO 4QKOA 4PWVB 5HGOA 2GZJA 2MY5A 2OARA 1VQLP 4COCA 2FQ0A 2NO8A 2MR7A 3CCQP 2FVEA 1YJ9P 2OTLP 1Q81Q 3CC2P 2KW2A 2PEQA 1MZ8A 2L22A 2K0XA 1E6JP 2DGYA 2FQ1A 2ERHA 3G28A 1HQBA 2KODA 1K30A 5EJDA 2KGDA 2LMLA 2QNWA 2XZ1C 3EJDA 1ZMBA 2LF4A 3DS3A 4COPA 2LKIA 1M6EX 1VQ4P 2K2QA 3CMAP 4U0EA 1K9MQ 5HGNA 2KWLA 2GDYA 2QEXP 2KGEA 3LMOA 2CWOA 2VLPA 2MVUA 3MGEA 2GZGA 2JQ4A 2AFEA 2PNGA 3DTJA 2BUOA 3HZQA 2KOOA 1VQOP 3B4QA 2AF8A 1VQ8P 1VHNA 1KD1Q 2LIWA 3CCLP 5BS2A 2K94A 5DCKA 2KR5A 2EFJA 1M1KQ 2VLOA 2KG9A 2N6YA 1Q86Q 1QVGO 2FAEA 2KOQA 5HVCA 2PEKA 2MF4A 3CPWO 5F2NA 3GKLC 2PEOA 2EHSA 5EW5E 2EHTA 1BAJA 2LOLA 2XT1A 4XRQA 4XFYA 3G26A 1RO2A 4IPYA 2KOSA 1M90Q 1VQ9P 4BPHA 1YI2P 4NEOA 1GXGA 2CNRA 1GPJA 4R0MA 2LIUA 1VQPP 3GJNA 1KC8Q 5CZDB
chains in the Genus database with same CATH topology
1M6NA 3CD6P 3CCVP 1ZMBA 4U0DA 2LF4A 3DS3A 4PH0A 4COPA 1VQMP 3OW2O 1K73Q 4U0BA 1EIAA 1M6EX 1W2BO 3DS4A 1VQ4P 2EIAA 1M74A 3CMAP 4U0EA 1K9MQ 5HGNA 3I55P 1Q7YQ 1K8AQ 3DS2A 3RG6C 2QA4P 1YJNP 3CMEP 3H0DA 1RO0A 4WYMA 5HGLA 1VQNP 3G0VA 2QEXP 5F2OA 5JPAA 2M8LA 1RNIA 2CWOA 3G1IA 4U0CA 2OTJP 1A8OA 3H4EA 1IUQA 3MGEA 1VQ7P 1EOQA 2ONTA 3DTJA 4GR6A 3WBHA 2BUOA 5HGMA 3HZQA 3CCUP 1VQOP 3DS1A 3G6EP 2Z44A 3CCSP 3VRLC 3CCJP 4U0AA 3DS0A 2PEIA 2P9XA 3G29A 2PEMA 2E1MA 1VQ8P 2JYLA 1N8RQ 3HYBA 1NJIQ 3CCMP 1YITP 1KD1Q 3CCLP 5BS2A 2EG5A 3E2DA 4XROA 1Q82Q 3CC7P 1VQ6P 5DCKA 1YHQP 1VQKP 3NTEA 3M1MA 2EFJA 1M1KQ 1Q86Q 1KQSO 1QVGO 4M0IA 2M8PA 4QNBA 4GR2A 4PH1A 2PEKA 1A43A 3CC4P 3H47A 3B5IA 1AUMA 3CPWO 5F2NA 5HGOA 1JJ2O 2PEOA 2OARA 3G21A 1VQLP 4XFZA 4COCA 5F2KA 3CCQP 1KC8Q 1BAJA 2XT1A 5I4TG 3CXCO 1YJWP 1YJ9P 2OTLP 1Q81Q 3CC2P 4XRQA 3LRYA 4U0FA 4XFYA 3G4SP 2L6EA 2JO0A 3G26A 2JYGA 3G1GA 1RO2A 2PEJA 3Q20A 3CCRP 3G71P 2M8NA 2PEQA 2XV6A 4IPYA 1D1DA 2Z45A 1M90Q 1VQ9P 4XFXA 2Z46A 1YIJP 1QRJA 1YI2P 1E6JP 3I56P 2DGYA 2XXMA 1S72P 2BHVA 3CCEP 1VQ5P 1QVFO 2PENA 3DS5A 3G28A 2KODA 2PY8A 1K30A 1VQPP 5BS1A 3DPHA 3P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6E A;  2JO0 A;  2BUO A;  5HGM A;  4M0I A;  2M8P A;  2JYG A;  3G26 A;  3G1G A;  4QNB A;  4U0D A;  2LF4 A;  3DS3 A;  3DS1 A;  2M8N A;  1A43 A;  4IPY A;  2XV6 A;  4PH1 A;  3H47 A;  4XFY A;  1AUM A;  1EIA A;  3DS0 A;  4U0A A;  4U0B A;  3VRL C;  1D1D A;  3DS4 A;  4XFX A;  3G29 A;  2EIA A;  2JYL A;  4U0E A;  5HGO A;  1QRJ A;  5HGN A;  1E6J P;  3G21 A;  4XFZ A;  3MGE A;  4COC A;  3DS2 A;  2XXM A;  1BAJ A;  4XRO A;  4COP A;  4WYM A;  5HGL A;  2XT1 A;  5DCK A;  3G0V A;  5I4T G;  5JPA A;  2M8L A;  3DS5 A;  3G28 A;  3G1I A;  4XRQ A;  4U0F A;  2KOD A;  3NTE A;  4U0C A;  4PH0 A;  1A8O A;  3H4E A;  3DPH A;  3LRY A;  1EOQ A;  2ONT A;  3DTJ A;  3P05 A; 
#chains in the Genus database with same CATH topology
 4U0D A;  1AYI A;  2WPT A;  1GXH A;  4U0B A;  3DS4 A;  2EIA A;  2FQ2 A;  1Q7Y Q;  4BPG A;  5KP6 B;  1IMQ A;  2QA4 P;  1YJN P;  3CME P;  3H0D A;  3G0V A;  1ACP A;  3G1I A;  1DV5 A;  1FR2 A;  1VQ7 P;  2ONT A;  3GZM A;  4F37 A;  2L9F A;  3DS1 A;  4IZ6 A;  3CCJ P;  2PEI A;  2P9X A;  7CEI A;  2JYL A;  3RG2 A;  1NJI Q;  1AF8 A;  2EG5 A;  1L0I A;  1YHQ P;  2K0D X;  3EJB A;  1VQK P;  2JB0 A;  2K5X A;  1BXI A;  3NTE A;  3M1M A;  2K0Y A;  2M5R A;  3GZL A;  2LTE A;  4PH1 A;  2JBG A;  1JJ2 O;  2K93 A;  3G21 A;  4XFZ A;  5F2K A;  4CA3 A;  5I4T G;  3CXC O;  1YJW P;  2AVA A;  2N98 A;  2FAD A;  4U0F A;  2L6E A;  2X2B A;  2JYG A;  3G1G A;  2PEJ A;  1NQ4 A;  1D1D A;  2GZI A;  1X3O A;  1YIJ P;  2VSQ A;  3I56 P;  2KOP A;  1S72 P;  2BHV A;  2DNW A;  2PEN A;  1E0H A;  3EJE A;  2PY8 A;  1VKU A;  5BS1 A;  3DPH A;  4H2Y C;  3P05 A;  4PXH B;  1M6N A;  3CD6 P;  1OR5 A;  3CE7 A;  1VQM P;  1K73 Q;  1W2B O;  1M74 A;  3I55 P;  3U43 A;  2FAC A;  3RG6 C;  1RO0 A;  4WYM A;  5HGL A;  4BPF A;  5F2O A;  2GZF A;  5JPA A;  2M8L A;  2OTJ P;  2CGQ A;  4U0C A;  4GR6 A;  2FVF A;  2N50 A;  2KGC A;  2AFD A;  2JAZ A;  3G6E P;  2Z44 A;  3CCS P;  3VRL C;  3G29 A;  2PEM A;  2MR8 A;  3HYB A;  1YIT P;  2GYK A;  2VLN A;  4XRO A;  3CC7 P;  1VQ6 P;  2N6Z A;  2XZ0 D;  1IMP A;  2JU2 A;  2GDW A;  4M0I A;  2M8P A;  4QNB A;  4GR2 A;  3CC4 P;  1A43 A;  3H47 A;  3B5I A;  1AUM A;  2LPK A;  2L0Q A;  4H2X C;  2JGP A;  2KG8 A;  2KOR A;  5KP8 B;  1T8K A;  2GZE A;  2N5I A;  2LL8 A;  3LRY A;  3G4S P;  2JO0 A;  2GDX A;  2CG5 B;  3Q20 A;  3CCR P;  2N5H A;  3G71 P;  2L4B A;  2M8N A;  3NY7 B;  2XV6 A;  2Z45 A;  4XFX A;  2Z46 A;  1QRJ A;  2MD9 A;  2XXM A;  3CCE P;  1VQ5 P;  1QVF O;  2ROQ A;  3DS5 A;  1F80 D;  2KGA A;  1UNK A;  1L0H A;  1ZNV A;  4HKG A;  1CEI A;  3CCV P;  4PH0 A;  3OW2 O;  1EIA A;  1EMV A;  1DNY A;  1K8A Q;  3DS2 A;  1KLP A;  1VQN P;  1RNI A;  1A8O A;  3H4E A;  1IUQ A;  1EOQ A;  2JU1 A;  1HY8 A;  3WBH A;  4MRT C;  5HGM A;  1Z6M A;  3CCU P;  2MVV A;  4U0A A;  3DS0 A;  2E1M A;  2CQ8 A;  1N8R Q;  3CCM P;  1UJZ A;  3E2D A;  1Q82 Q;  5HV8 A;  2FVA A;  2K92 A;  2FHS C;  4DG9 A;  4UHP B;  2KG6 A;  4H2W C;  5KP7 B;  2VLQ A;  1KQS O;  4QKO A;  4PWV B;  5HGO A;  2GZJ A;  2MY5 A;  2OAR A;  1VQL P;  4COC A;  2FQ0 A;  2NO8 A;  2MR7 A;  3CCQ P;  2FVE A;  1YJ9 P;  2OTL P;  1Q81 Q;  3CC2 P;  2KW2 A;  2PEQ A;  1MZ8 A;  2L22 A;  2K0X A;  1E6J P;  2DGY A;  2FQ1 A;  2ERH A;  3G28 A;  1HQB A;  2KOD A;  1K30 A;  5EJD A;  2KGD A;  2LML A;  2QNW A;  2XZ1 C;  3EJD A;  1ZMB A;  2LF4 A;  3DS3 A;  4COP A;  2LKI A;  1M6E X;  1VQ4 P;  2K2Q A;  3CMA P;  4U0E A;  1K9M Q;  5HGN A;  2KWL A;  2GDY A;  2QEX P;  2KGE A;  3LMO A;  2CWO A;  2VLP A;  2MVU A;  3MGE A;  2GZG A;  2JQ4 A;  2AFE A;  2PNG A;  3DTJ A;  2BUO A;  3HZQ A;  2KOO A;  1VQO P;  3B4Q A;  2AF8 A;  1VQ8 P;  1VHN A;  1KD1 Q;  2LIW A;  3CCL P;  5BS2 A;  2K94 A;  5DCK A;  2KR5 A;  2EFJ A;  1M1K Q;  2VLO A;  2KG9 A;  2N6Y A;  1Q86 Q;  1QVG O;  2FAE A;  2KOQ A;  5HVC A;  2PEK A;  2MF4 A;  3CPW O;  5F2N A;  3GKL C;  2PEO A;  2EHS A;  5EW5 E;  2EHT A;  1BAJ A;  2LOL A;  2XT1 A;  4XRQ A;  4XFY A;  3G26 A;  1RO2 A;  4IPY A;  2KOS A;  1M90 Q;  1VQ9 P;  4BPH A;  1YI2 P;  4NEO A;  1GXG A;  2CNR A;  1GPJ A;  4R0M A;  2LIU A;  1VQP P;  3GJN A;  1KC8 Q;  5CZD B; 
#chains in the Genus database with same CATH homology
 1M6N A;  3CD6 P;  3CCV P;  1ZMB A;  4U0D A;  2LF4 A;  3DS3 A;  4PH0 A;  4COP A;  1VQM P;  3OW2 O;  1K73 Q;  4U0B A;  1EIA A;  1M6E X;  1W2B O;  3DS4 A;  1VQ4 P;  2EIA A;  1M74 A;  3CMA P;  4U0E A;  1K9M Q;  5HGN A;  3I55 P;  1Q7Y Q;  1K8A Q;  3DS2 A;  3RG6 C;  2QA4 P;  1YJN P;  3CME P;  3H0D A;  1RO0 A;  4WYM A;  5HGL A;  1VQN P;  3G0V A;  2QEX P;  5F2O A;  5JPA A;  2M8L A;  1RNI A;  2CWO A;  3G1I A;  4U0C A;  2OTJ P;  1A8O A;  3H4E A;  1IUQ A;  3MGE A;  1VQ7 P;  1EOQ A;  2ONT A;  3DTJ A;  4GR6 A;  3WBH A;  2BUO A;  5HGM A;  3HZQ A;  3CCU P;  1VQO P;  3DS1 A;  3G6E P;  2Z44 A;  3CCS P;  3VRL C;  3CCJ P;  4U0A A;  3DS0 A;  2PEI A;  2P9X A;  3G29 A;  2PEM A;  2E1M A;  1VQ8 P;  2JYL A;  1N8R Q;  3HYB A;  1NJI Q;  3CCM P;  1YIT P;  1KD1 Q;  3CCL P;  5BS2 A;  2EG5 A;  3E2D A;  4XRO A;  1Q82 Q;  3CC7 P;  1VQ6 P;  5DCK A;  1YHQ P;  1VQK P;  3NTE A;  3M1M A;  2EFJ A;  1M1K Q;  1Q86 Q;  1KQS O;  1QVG O;  4M0I A;  2M8P A;  4QNB A;  4GR2 A;  4PH1 A;  2PEK A;  1A43 A;  3CC4 P;  3H47 A;  3B5I A;  1AUM A;  3CPW O;  5F2N A;  5HGO A;  1JJ2 O;  2PEO A;  2OAR A;  3G21 A;  1VQL P;  4XFZ A;  4COC A;  5F2K A;  3CCQ P;  1KC8 Q;  1BAJ A;  2XT1 A;  5I4T G;  3CXC O;  1YJW P;  1YJ9 P;  2OTL P;  1Q81 Q;  3CC2 P;  4XRQ A;  3LRY A;  4U0F A;  4XFY A;  3G4S P;  2L6E A;  2JO0 A;  3G26 A;  2JYG A;  3G1G A;  1RO2 A;  2PEJ A;  3Q20 A;  3CCR P;  3G71 P;  2M8N A;  2PEQ A;  2XV6 A;  4IPY A;  1D1D A;  2Z45 A;  1M90 Q;  1VQ9 P;  4XFX A;  2Z46 A;  1YIJ P;  1QRJ A;  1YI2 P;  1E6J P;  3I56 P;  2DGY A;  2XXM A;  1S72 P;  2BHV A;  3CCE P;  1VQ5 P;  1QVF O;  2PEN A;  3DS5 A;  3G28 A;  2KOD A;  2PY8 A;  1K30 A;  1VQP P;  5BS1 A;  3DPH A;  3P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...