3VRLC

Crystal structure of bmj4 p24 capsid protein in complex with a10f9 fab
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
73
structure length
73
Chain Sequence
b'SILDIKQGPKESFRDYVDRFFKTLRAEQCTQDVKNWMTDTLLVQNANPDCKTILRALGPGATLEEMMTACQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords A10F9 Fab heavy chain
molecule tags Immune system/viral protein
source organism Human immunodeficiency virus 1
publication title Structure of the HIV-1 capsid protein p24 in complex with the broad-spectrum antibody A10F9
rcsb
total genus 23
structure length 73
sequence length 73
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-04-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3vrlC00
5HGMA 4M0IA 2KODA 2L6EA 1EIAA 1QRJA 3G0VA 1AUMA 2M8PA 3DPHA 4QNBA 4U0FA 4U0BA 2M8LA 3H47A 2BUOA 2JYLA 4XRQA 4WYMA 2JO0A 5HGLA 4U0EA 3LRYA 5HGOA 1A8OA 3MGEA 2M8NA 3DS4A 3NTEA 5JPAA 3DS2A 3DTJA 3G28A 4U0CA 2XXMA 4U0DA 4U0AA 4XFZA 4XFXA 3DS0A 5HGNA 3G21A 1E6JP 1D1DA 2LF4A 3DS3A 2XV6A 3H4EA 4PH0A 4XFYA 3DS1A 5DCKA 4XROA 2EIAA 1EOQA 4PH1A 5I4TG 4COCA 3G1IA 1BAJA 2XT1A 3P05A 3G1GA 3G29A 4IPYA 3VRLC 4COPA 3DS5A 2ONTA 1A43A 2JYGA 3G26A
chains in the Genus database with same CATH superfamily
1M6EX 2M8LA 3CMAP 2KOPA 2JO0A 1CEIA 1JJ2O 2Z45A 4U0DA 1VQLP 2FACA 2LF4A 3DS3A 2XV6A 2K92A 2Z46A 1UNKA 2LOLA 3GZLA 2PEIA 2WPTA 2KG8A 3CMEP 1W2BO 3CC2P 4M0IA 2KOSA 3CXCO 3CCEP 2GDWA 2E1MA 3CC4P 2CG5B 4CA3A 3CCVP 2LKIA 2EHTA 4MRTC 3WBHA 1VQ8P 1RNIA 2XZ0D 1T8KA 2PEMA 2MY5A 1L0IA 2FADA 1BAJA 5CZDB 1KLPA 3G26A 2DNWA 2LIUA 2GZGA 2MF4A 1GPJA 2FHSC 3B5IA 5BS1A 1Q7YQ 2FVFA 2CWOA 2EG5A 1VQ9P 2AVAA 2GZJA 2N50A 3CCMP 4BPHA 1HQBA 2KOQA 1VQ7P 3G1IA 1AYIA 3G4SP 1BXIA 2LL8A 2BHVA 3DPHA 1KC8Q 3EJBA 1AF8A 2KGEA 2GZFA 1YJ9P 3CC7P 2VSQA 5F2NA 4XFZA 3G6EP 3CPWO 5DCKA 1GXHA 1DNYA 2K0XA 1A43A 1YHQP 2MD9A 2L0QA 1E0HA 1VHNA 1EIAA 2PEQA 1FR2A 4WYMA 3DS4A 1UJZA 2GZIA 2KWLA 4QKOA 2OTLP 2LTEA 1F80D 2LMLA 4PH0A 2OARA 1EOQA 2GYKA 5HGMA 2PEKA 2KODA 2L6EA 1IMQA 2OTJP 3G0VA 1AUMA 4GR6A 4U0BA 1QVFO 2BUOA 2AFEA 2N6ZA 3I55P 1YJNP 2M5RA 1EMVA 1QVGO 1DV5A 2EIAA 1MZ8A 1VQ6P 2JBGA 2QA4P 4XRQA 2FVAA 4U0EA 2CQ8A 2MR7A 2L9FA 2AFDA 1YITP 1E6JP 3H4EA 4HKGA 3DS1A 4BPFA 2VLOA 4COCA 3CCLP 2XT1A 4IPYA 1VKUA 5HVCA 1ZNVA 2P9XA 1VQ5P 5JPAA 5F2KA 2ERHA 3CCQP 2PEJA 1K73Q 1Q82Q 2FVEA 4R0MA 2K94A 2KGCA 3CE7A 2GZEA 4PXHB 1VQ4P 5HV8A 2KW2A 2N6YA 4H2YC 4QNBA 2MR8A 5HGLA 3E2DA 2M8NA 2KGDA 1IMPA 4XFXA 2KG9A 3B4QA 5HGNA 3EJEA 2LPKA 3EJDA 2K0DX 1VQKP 1NQ4A 2FQ0A 2KOOA 2VLPA 2QNWA 4H2WC 1NJIQ 3M1MA 1Q81Q 1L0HA 4DG9A 2L22A 2CNRA 1K9MQ 2KR5A 5F2OA 3RG6C 3U43A 2PY8A 3LMOA 3I56P 1Z6MA 2X2BA 2VLNA 2AF8A 2FQ2A 2MVUA 1KD1Q 2GDYA 2FQ1A 3CCRP 1X3OA 4UHPB 5KP6B 2LIWA 3GKLC 1K30A 1M6NA 5EW5E 3MGEA 1Q86Q 2EHSA 2KG6A 3GJNA 2Z44A 1RO2A 3G21A 2DGYA 3CCJP 1M74A 3G1GA 2JQ4A 2N5IA 2KGAA 3H0DA 1RO0A 3DTJA 4U0CA 7CEIA 4PWVB 2K2QA 4NEOA 2JU2A 5HGOA 4U0FA 4COPA 2MVVA 2M8PA 2JGPA 2JYLA 5BS2A 3NY7B 5KP7B 1A8OA 2GDXA 3OW2O 3GZMA 1YI2P 3G71P 2PENA 3P05A 3G29A 4IZ6A 2ONTA 2JYGA 1K8AQ 4H2XC 2QEXP 2XZ1C 2PEOA 3LRYA 2ROQA 2N5HA 3G28A 2XXMA 4U0AA 1GXGA 1D1DA 3Q20A 2JU1A 1VQNP 4XROA 1VQPP 2CGQA 5I4TG 2KORA 2NO8A 2FAEA 2VLQA 4BPGA 3CD6P 3CCUP 2JB0A 2N98A 3HYBA 1YIJP 1QRJA 3H47A 1M90Q 2K93A 1M1KQ 2JAZA 3NTEA 3DS2A 4GR2A 1IUQA 3HZQA 4F37A 3DS0A 2L4BA 1OR5A 1ACPA 4XFYA 4PH1A 1HY8A 5EJDA 3DS5A 3CCSP 1ZMBA 1VQOP 3RG2A 2K0YA 2K5XA 5KP8B 1VQMP 1S72P 2EFJA 2PNGA 1N8RQ 1YJWP 1KQSO 3VRLC
chains in the Genus database with same CATH topology
1M6EX 1EIAA 4U0FA 4QNBA 2M8PA 2PEQA 2M8LA 4COPA 3CMAP 5HGLA 2JYLA 3E2DA 4WYMA 2JO0A 5BS2A 1A8OA 2M8NA 3DS4A 1JJ2O 2Z45A 4U0DA 1VQLP 4XFXA 5HGNA 3OW2O 2OTLP 2LF4A 3DS3A 1VQKP 2XV6A 4PH0A 2OARA 2Z46A 1EOQA 1YI2P 2PEIA 3G71P 1NJIQ 3M1MA 2PENA 3P05A 3G29A 1Q81Q 3CMEP 1W2BO 3CC2P 2ONTA 2JYGA 1K8AQ 5HGMA 2PEKA 4M0IA 2KODA 2L6EA 3CXCO 2QEXP 1K9MQ 3CCEP 3G0VA 2OTJP 1AUMA 4GR6A 4U0BA 1QVFO 5F2OA 2BUOA 2E1MA 3RG6C 3CC4P 2PEOA 3LRYA 2PY8A 3CCVP 3I56P 3WBHA 1VQ8P 3I55P 3G28A 2XXMA 4U0AA 1YJNP 1RNIA 1D1DA 3Q20A 2PEMA 1QVGO 1KD1Q 4XROA 2EIAA 1VQPP 5I4TG 1VQNP 1BAJA 3CCRP 1VQ6P 3CD6P 2QA4P 3CCUP 3G26A 3HYBA 1YIJP 1QRJA 3H47A 3B5IA 5BS1A 4XRQA 1K30A 1Q7YQ 4U0EA 1M6NA 1M90Q 2CWOA 2EG5A 1M1KQ 1VQ9P 3MGEA 3NTEA 1Q86Q 3DS2A 3CCMP 4GR2A 1IUQA 3HZQA 2Z44A 1RO2A 3DS0A 3G21A 2DGYA 3CCJP 1YITP 1E6JP 3H4EA 4XFYA 1VQ7P 3DS1A 1M74A 4PH1A 4COCA 3G1IA 3G4SP 3CCLP 2XT1A 4IPYA 3G1GA 3DS5A 2P9XA 3CCSP 1ZMBA 2BHVA 3DPHA 1VQOP 1KC8Q 3H0DA 1VQ5P 1YJ9P 5JPAA 1RO0A 1VQMP 3CC7P 5F2NA 3DTJA 4U0CA 5F2KA 4XFZA 3G6EP 3CCQP 2PEJA 1K73Q 1S72P 2EFJA 1N8RQ 3CPWO 5DCKA 1Q82Q 1YJWP 1KQSO 3VRLC 1VQ4P 1A43A 1YHQP 5HGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGM A;  4M0I A;  2KOD A;  2L6E A;  1EIA A;  1QRJ A;  3G0V A;  1AUM A;  2M8P A;  3DPH A;  4QNB A;  4U0F A;  4U0B A;  2M8L A;  3H47 A;  2BUO A;  2JYL A;  4XRQ A;  4WYM A;  2JO0 A;  5HGL A;  4U0E A;  3LRY A;  5HGO A;  1A8O A;  3MGE A;  2M8N A;  3DS4 A;  3NTE A;  5JPA A;  3DS2 A;  3DTJ A;  3G28 A;  4U0C A;  2XXM A;  4U0D A;  4U0A A;  4XFZ A;  4XFX A;  3DS0 A;  5HGN A;  3G21 A;  1E6J P;  1D1D A;  2LF4 A;  3DS3 A;  2XV6 A;  3H4E A;  4PH0 A;  4XFY A;  3DS1 A;  5DCK A;  4XRO A;  2EIA A;  1EOQ A;  4PH1 A;  5I4T G;  4COC A;  3G1I A;  1BAJ A;  2XT1 A;  3P05 A;  3G1G A;  3G29 A;  4IPY A;  3VRL C;  4COP A;  3DS5 A;  2ONT A;  1A43 A;  2JYG A;  3G26 A; 
#chains in the Genus database with same CATH topology
 1M6E X;  2M8L A;  3CMA P;  2KOP A;  2JO0 A;  1CEI A;  1JJ2 O;  2Z45 A;  4U0D A;  1VQL P;  2FAC A;  2LF4 A;  3DS3 A;  2XV6 A;  2K92 A;  2Z46 A;  1UNK A;  2LOL A;  3GZL A;  2PEI A;  2WPT A;  2KG8 A;  3CME P;  1W2B O;  3CC2 P;  4M0I A;  2KOS A;  3CXC O;  3CCE P;  2GDW A;  2E1M A;  3CC4 P;  2CG5 B;  4CA3 A;  3CCV P;  2LKI A;  2EHT A;  4MRT C;  3WBH A;  1VQ8 P;  1RNI A;  2XZ0 D;  1T8K A;  2PEM A;  2MY5 A;  1L0I A;  2FAD A;  1BAJ A;  5CZD B;  1KLP A;  3G26 A;  2DNW A;  2LIU A;  2GZG A;  2MF4 A;  1GPJ A;  2FHS C;  3B5I A;  5BS1 A;  1Q7Y Q;  2FVF A;  2CWO A;  2EG5 A;  1VQ9 P;  2AVA A;  2GZJ A;  2N50 A;  3CCM P;  4BPH A;  1HQB A;  2KOQ A;  1VQ7 P;  3G1I A;  1AYI A;  3G4S P;  1BXI A;  2LL8 A;  2BHV A;  3DPH A;  1KC8 Q;  3EJB A;  1AF8 A;  2KGE A;  2GZF A;  1YJ9 P;  3CC7 P;  2VSQ A;  5F2N A;  4XFZ A;  3G6E P;  3CPW O;  5DCK A;  1GXH A;  1DNY A;  2K0X A;  1A43 A;  1YHQ P;  2MD9 A;  2L0Q A;  1E0H A;  1VHN A;  1EIA A;  2PEQ A;  1FR2 A;  4WYM A;  3DS4 A;  1UJZ A;  2GZI A;  2KWL A;  4QKO A;  2OTL P;  2LTE A;  1F80 D;  2LML A;  4PH0 A;  2OAR A;  1EOQ A;  2GYK A;  5HGM A;  2PEK A;  2KOD A;  2L6E A;  1IMQ A;  2OTJ P;  3G0V A;  1AUM A;  4GR6 A;  4U0B A;  1QVF O;  2BUO A;  2AFE A;  2N6Z A;  3I55 P;  1YJN P;  2M5R A;  1EMV A;  1QVG O;  1DV5 A;  2EIA A;  1MZ8 A;  1VQ6 P;  2JBG A;  2QA4 P;  4XRQ A;  2FVA A;  4U0E A;  2CQ8 A;  2MR7 A;  2L9F A;  2AFD A;  1YIT P;  1E6J P;  3H4E A;  4HKG A;  3DS1 A;  4BPF A;  2VLO A;  4COC A;  3CCL P;  2XT1 A;  4IPY A;  1VKU A;  5HVC A;  1ZNV A;  2P9X A;  1VQ5 P;  5JPA A;  5F2K A;  2ERH A;  3CCQ P;  2PEJ A;  1K73 Q;  1Q82 Q;  2FVE A;  4R0M A;  2K94 A;  2KGC A;  3CE7 A;  2GZE A;  4PXH B;  1VQ4 P;  5HV8 A;  2KW2 A;  2N6Y A;  4H2Y C;  4QNB A;  2MR8 A;  5HGL A;  3E2D A;  2M8N A;  2KGD A;  1IMP A;  4XFX A;  2KG9 A;  3B4Q A;  5HGN A;  3EJE A;  2LPK A;  3EJD A;  2K0D X;  1VQK P;  1NQ4 A;  2FQ0 A;  2KOO A;  2VLP A;  2QNW A;  4H2W C;  1NJI Q;  3M1M A;  1Q81 Q;  1L0H A;  4DG9 A;  2L22 A;  2CNR A;  1K9M Q;  2KR5 A;  5F2O A;  3RG6 C;  3U43 A;  2PY8 A;  3LMO A;  3I56 P;  1Z6M A;  2X2B A;  2VLN A;  2AF8 A;  2FQ2 A;  2MVU A;  1KD1 Q;  2GDY A;  2FQ1 A;  3CCR P;  1X3O A;  4UHP B;  5KP6 B;  2LIW A;  3GKL C;  1K30 A;  1M6N A;  5EW5 E;  3MGE A;  1Q86 Q;  2EHS A;  2KG6 A;  3GJN A;  2Z44 A;  1RO2 A;  3G21 A;  2DGY A;  3CCJ P;  1M74 A;  3G1G A;  2JQ4 A;  2N5I A;  2KGA A;  3H0D A;  1RO0 A;  3DTJ A;  4U0C A;  7CEI A;  4PWV B;  2K2Q A;  4NEO A;  2JU2 A;  5HGO A;  4U0F A;  4COP A;  2MVV A;  2M8P A;  2JGP A;  2JYL A;  5BS2 A;  3NY7 B;  5KP7 B;  1A8O A;  2GDX A;  3OW2 O;  3GZM A;  1YI2 P;  3G71 P;  2PEN A;  3P05 A;  3G29 A;  4IZ6 A;  2ONT A;  2JYG A;  1K8A Q;  4H2X C;  2QEX P;  2XZ1 C;  2PEO A;  3LRY A;  2ROQ A;  2N5H A;  3G28 A;  2XXM A;  4U0A A;  1GXG A;  1D1D A;  3Q20 A;  2JU1 A;  1VQN P;  4XRO A;  1VQP P;  2CGQ A;  5I4T G;  2KOR A;  2NO8 A;  2FAE A;  2VLQ A;  4BPG A;  3CD6 P;  3CCU P;  2JB0 A;  2N98 A;  3HYB A;  1YIJ P;  1QRJ A;  3H47 A;  1M90 Q;  2K93 A;  1M1K Q;  2JAZ A;  3NTE A;  3DS2 A;  4GR2 A;  1IUQ A;  3HZQ A;  4F37 A;  3DS0 A;  2L4B A;  1OR5 A;  1ACP A;  4XFY A;  4PH1 A;  1HY8 A;  5EJD A;  3DS5 A;  3CCS P;  1ZMB A;  1VQO P;  3RG2 A;  2K0Y A;  2K5X A;  5KP8 B;  1VQM P;  1S72 P;  2EFJ A;  2PNG A;  1N8R Q;  1YJW P;  1KQS O;  3VRL C; 
#chains in the Genus database with same CATH homology
 1M6E X;  1EIA A;  4U0F A;  4QNB A;  2M8P A;  2PEQ A;  2M8L A;  4COP A;  3CMA P;  5HGL A;  2JYL A;  3E2D A;  4WYM A;  2JO0 A;  5BS2 A;  1A8O A;  2M8N A;  3DS4 A;  1JJ2 O;  2Z45 A;  4U0D A;  1VQL P;  4XFX A;  5HGN A;  3OW2 O;  2OTL P;  2LF4 A;  3DS3 A;  1VQK P;  2XV6 A;  4PH0 A;  2OAR A;  2Z46 A;  1EOQ A;  1YI2 P;  2PEI A;  3G71 P;  1NJI Q;  3M1M A;  2PEN A;  3P05 A;  3G29 A;  1Q81 Q;  3CME P;  1W2B O;  3CC2 P;  2ONT A;  2JYG A;  1K8A Q;  5HGM A;  2PEK A;  4M0I A;  2KOD A;  2L6E A;  3CXC O;  2QEX P;  1K9M Q;  3CCE P;  3G0V A;  2OTJ P;  1AUM A;  4GR6 A;  4U0B A;  1QVF O;  5F2O A;  2BUO A;  2E1M A;  3RG6 C;  3CC4 P;  2PEO A;  3LRY A;  2PY8 A;  3CCV P;  3I56 P;  3WBH A;  1VQ8 P;  3I55 P;  3G28 A;  2XXM A;  4U0A A;  1YJN P;  1RNI A;  1D1D A;  3Q20 A;  2PEM A;  1QVG O;  1KD1 Q;  4XRO A;  2EIA A;  1VQP P;  5I4T G;  1VQN P;  1BAJ A;  3CCR P;  1VQ6 P;  3CD6 P;  2QA4 P;  3CCU P;  3G26 A;  3HYB A;  1YIJ P;  1QRJ A;  3H47 A;  3B5I A;  5BS1 A;  4XRQ A;  1K30 A;  1Q7Y Q;  4U0E A;  1M6N A;  1M90 Q;  2CWO A;  2EG5 A;  1M1K Q;  1VQ9 P;  3MGE A;  3NTE A;  1Q86 Q;  3DS2 A;  3CCM P;  4GR2 A;  1IUQ A;  3HZQ A;  2Z44 A;  1RO2 A;  3DS0 A;  3G21 A;  2DGY A;  3CCJ P;  1YIT P;  1E6J P;  3H4E A;  4XFY A;  1VQ7 P;  3DS1 A;  1M74 A;  4PH1 A;  4COC A;  3G1I A;  3G4S P;  3CCL P;  2XT1 A;  4IPY A;  3G1G A;  3DS5 A;  2P9X A;  3CCS P;  1ZMB A;  2BHV A;  3DPH A;  1VQO P;  1KC8 Q;  3H0D A;  1VQ5 P;  1YJ9 P;  5JPA A;  1RO0 A;  1VQM P;  3CC7 P;  5F2N A;  3DTJ A;  4U0C A;  5F2K A;  4XFZ A;  3G6E P;  3CCQ P;  2PEJ A;  1K73 Q;  1S72 P;  2EFJ A;  1N8R Q;  3CPW O;  5DCK A;  1Q82 Q;  1YJW P;  1KQS O;  3VRL C;  1VQ4 P;  1A43 A;  1YHQ P;  5HGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...