3VSTA

The complex structure of xylc with tris
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
total genus 238
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vstA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vstA01
2Z8GA 1UD2A 4HPHA 2BY3A 2D2OA 3LRKA 1KWKA 1U30A 4XQFA 2ZUWA 4XKWA 3UEQA 5CXPA 1BG9A 1LWHA 2NSXA 2VBMA 1QI4A 4H7VA 4J3WA 4YZXA 4XM3A 3HG2A 1KBBA 1PEZA 2Y5EA 2FH6A 2YA0A 3BUBA 4AEFA 3ZT7A 1KCKA 4UOQA 3BCFA 2NSPA 4CGTA 1U2YA 1LWJA 1TCMA 1ZJAA 1UOKA 1KGUA 3ZR6A 3DHUA 2X85A 3HJEA 2YFOA 2Y4SA 2PWDA 3DX4A 1T0OA 3DX3A 3LXCA 3OLGA 2D0GA 4PEEA 3VMWA 1UASA 2XIBA 4U2YA 5E6ZA 1JF6A 1XCWA 3BLBA 2OYMA 3K8MA 3KLLA 5HPOA 1IDKA 4YEJA 2DIJA 3S2CA 3VX0A 4W8TA 4XLHA 1KBKA 4JFWA 2ZUSA 5DO8A 1CPUA 3OLDA 4XOPA 1TQUA 2WKGA 2ZX6A 1AQHA 1QHOA 2OW7A 4AYSA 3VGDA 1O8EA 1G1YA 1DBGA 2BXZA 5C1CA 3BCDA 2PYHA 3B90A 4XLAA 4HOWA 1UH4A 4LQ1A 3UCQA 5AMVA 4CKQA 1BVZA 3VGBA 1KB3A 3UG5A 3CZLA 5DFAA 1CLVA 4OGZA 1S46A 3WEMA 4U4BA 3IJ7A 3AXHA 2E0PA 2BSPA 1HL8A 1MVYA 1OGSA 1RP8A 1G5AA 2ZX8A 3ZSCA 1PS3A 1KCDA 2D73A 7TAAA 1MFVA 2F1AA 3S5ZA 4AW7A 5EMYA 1KGXA 1VFMA 1E3XA 1AVAA 3L4WA 2UVFA 2IQ7A 1OFMA 1MXGA 2WVVB 3VMVA 1R75A 2VRQA 2ZX7A 4OKDA 3WNPA 2XVGA 3OLIA 4MXNA 5I23A 4GO9A 1G94A 1R33A 5CGMA 1WP6A 2ZXBA 1EO5A 2C7FA 3DDFA 5CGTA 2WPGA 1SZNA 1UD8A 5E70A 1OB0A 3B4NA 2OSXA 1QJVA 1XH2A 3VM5A 4WF7A 2F7OA 5CLTA 2X2HA 2GVYA 3LRLA 3WDIA 2VNCA 3D51A 2NT0A 3A24A 3LX9A 1BF2A 2TAAA 1PPIA 2CXGA 3K8KA 3BAXA 3WY3A 1UH2A 1ZS2A 2QX3A 2FE0A 2NTBA 4J7RA 3GXNA 3M07A 4HA1A 1XV8A 3ZR5A 1VFUA 1A47A 3BMWA 3KL3A 3WY2A 3RIKA 1HXKA 2QLYA 3ECQA 2X3HA 5HXMA 4U49A 1IB4A 1KXVA 1M7XA 3KEHA 3D52A 3D50A 2ZE0A 3K8LA 4NK6A 1HVXA 1JL8A 4GI6A 2XWDA 1VAHA 3A47A 4UOZA 1BVNP 1ODUA 1UA3A 4H2CA 2X6YA 2BY1A 2DH2A 3AMKA 3VSTA 4FLRA 1JRGA 2EABA 2XVKA 2X2IA 5KEZA 1R47A 1JXJA 2X2JA 4XKVA 1E43A 1JD7A 2CHNA 3UG4A 1Y7VA 4NX0A 1XG2A 2FGZA 2OW6A 2X6XA 4JFTA 4PSRA 3T9GA 1BAGA 2EO7A 3K1DA 4NZJA 3EJQA 1WZAA 2BHYA 3VX1A 4XORA 3L2LA 1DTUA 1JI1A 3A23A 3LXBA 4H8HA 1RMGA 2EWEA 2WSKA 1QI3A 1WMRA 1WE5A 2F7RA 1PE9A 1RU4A 3WNKA 3VMOA 1R46A 4URRA 2PWEA 1CXEA 1UD6A 2YA2A 3L4XA 1B2YA 4UZUA 2J25A 1CXKA 2F7QA 2XN1A 1W9XA 2D3LA 3BAYA 3L4TA 1OGOX 1NM9A 5I0DA 2PWFA 3WNMA 2EJ1A 2FHFA 4JCMA 2YKKA 1UD3A 2FHBA 4UQCA 4FNRA 1O8IA 5E1QA 2XN0A 3BUQA 3CTTA 2OSWA 3WNNA 2FH8A 1JDDA 1JG9A 2NT6A 2VUYA 3HG5A 1HL9A 2WVSA 3BLPX 3GXPA 4UQDA 1CGWA 3CZNA 3IJ9A 3GQ7A 4HOZA 1MXDA 1V3MA 4JFSA 3GQ8A 3DDGA 3DC0A 1BPLB 1TQSA 1CXFA 4NZFA 3WNLA 6TAAA 1JFHA 3LXAA 2UVEA 2VJJA 1CGUA 4XONA 1HT6A 2INVA 4AVZA 3WWGA 3CZKA 1CGVA 1KTWA 1V3LA 3QGVA 3ZO9A 1CGXA 1HWWA 1QWUA 3FW6A 3KL0A 4J27A 4AMWA 2ZUTA 3GQAA 3GTNA 1BN8A 5BRQA 1XD0A 1VJSA 1O8FA 3CPUA 4I84A 3AMLA 1RPKA 5F7UA 3BVTA 2O0VA 2DH3A 1OT1A 3TOPA 4E2OA 1MFUA 1TQTA 2OYKA 1CXHA 4H8UA 1EE6A 4ATWA 1OGMX 3A4AA 3CLWA 3WEOA 2WCGA 2EQDA 1MW1A 1IZJA 4U31A 5A2AA 1PZ3A 3H53A 4JFUA 4WSJA 1EHAA 5I5RA 4FMVA 2ZX5A 2ZUUA 3IGUA 3EDJA 2FYVA 1UKQA 3CGTA 1MW3A 4LXFA 4FNPA 4UNIA 4JL2A 2NT9A 1CGYA 2PWGA 5E6YA 3VMNA 1O8KA 1QHPA 2VR5A 3WNOA 1CYGA 5E9AA 1Z32X 4OJ6A 5TD4A 4DO5A 1IZKA 1CGTA 3B8YA 4AEEA 2ZICA 4MAZA 4NXSA 3L4ZA 3VNZA 3VSVA 1IA5A 4OJ5A 4HWVA 2O1DA 2BHZA 3BLKA 3KRGA 1JF5A 3BAJA 1QW8A 2WSPA 3ZSSA 4AIOA 2WKLA 2YIHA 4OIFA 4XNFA 1KCLA 3LPOA 3VO0A 1XSIA 2V3DA 3GXIA 2VBEA 1ZJBA 2V3FA 2E9BA 2GJRA 4OZYA 2F1BA 3EDKA 2EEXA 1H3GA 2BY0A 4M56A 1MWOA 3H54A 3VGHA 1J0IA 3FAXA 2YJQA 4H8VA 4XLEA 3WMSA 3GXMA 3GQ9A 3CV5A 3VU2A 3DX2A 2OYLA 3UERA 3VMPA 3W37A 2F2HA 1EA9C 5BRPA 3GXTA 1VB9A 4GI8A 1SMAA 3BSHA 1IV8A 3VGFA 3DHPA 3BVXA 4EW9A 3ZSTA 2VRKA 4J3TA 3VGEA 3BVUA 4OJLA 2ZXQA 1JTAA 1KTBA 1CXLA 3TV8A 1WPCA 3EDFA 3GBEA 1O8HA 3GXDA 2ZWYA 2EADA 1GQ8A 1HG8A 4J3VA 1EH9A 4UQEA 3AXIA 4CN4A 3BSGA 1RWRA 2G3MA 4XLCA 1G9HA 3BUDA 3L2MA 3ZT6A 2EAEA 1J0HA 1AMYA 1PIGA 2ZXAA 4XR6A 1JI2A 1AIRA 3HG3A 1OT2A 1JXKA 3IK2A 1DEDA 1MW2A 4KMQA 1JIBA 4OZZA 4Z05A 2BY2A 2WVTA 1PZ2A 1AQMA 1GCYA 3BUIA 3II1A 2OSYA 1CDGA 3VSUA 1XGZA 3UG3A 4HOXA 1KXQA 2WCSA 4DO6A 1B0IA 2VT0A 1BHEA 4JFVA 1QI5A 1QPKA 4NK8A 1KXHA 9CGTA 2ZX9A 3AJ7A 3BC9A 5A2CA 1VFOA 1SMDA 2INUA 1XCXA 2YOCA 3HZ3A 1TQWA 4OJOA 3A6OA 3EJUA 3BMVA 2PYGA 2FHCA 1UKSA 2QPSA 4CN6A 1NHCA 3BAIA 4X9YA 1JDCA 2XIIA 2G3NA 1UA7A 1PJ9A 2E4TA 1UD5A 4GO8A 1P6WA 1UD4A 2XVLA 4YZ0A 4XN0A 5I24A 1E40A 3EDDA 1PIFA 3GBDA 2C8NA 3KL5A 2NT1A 6CGTA 1VBLA 3GRHA 4FNQA 1D7FA 2D0HA 2ZXDA 4GQRA 1QCXA 3L4VA 1OFLA 3FY3A 2NTPA 4B9ZA 1KXTA 4JCLA 2F61A 4FNTA 1J0KA 2QMJA 2Z1KA 4YZAA 1M53A 3EJRA 2DIEA 3MI6A 1JDAA 4FLOA 3WN6A 2O04A 2PECA 1V3KA 2E8ZA 3EQOA 3EQNA 4J3XA 4WLCA 1U33A 3A5VA 2X6WA 4FLQA 3BAWA 2WANA 3UW0A 2ZIDA 4YELA 1OOCA 2ALWA 3ZQ9A 1DBOA 4GQQA 4GINA 2WNWA 4W93A 3VNYA 4XN3A 3KWXA 2O17A 4FNSA 1UH3A 2V3EA 4X0NA 1KTCA 3A21A 5A6MA 4HP5A 1KGWA 1H80A 4U3CA 2E8YA 2D0FA 2O0WA 4B9YA 3BH4A 3OLEA 1MW0A 4J28A 4PSPA 4XL9A 1KCCA 2AMGA 3WDHA 4OJYA 2YA1A 3CZSA 1TMQA 3KLKA 1CZFA 1K5CA 3CZEA 3WY1A 1O8DA 1EO7A 7CGTA 3BAKA 5C1EA 1HX0A 3WDJA 3EJTA 3H55A 5A6LA 1WZKA 2NSTA 3VM7A 1Q4NX 2VJIA 1GJWA 1WZLA 2XWEA 1O8GA 3FAWA 2PWHA 4YZQA 2QPUA 4XMYA 3JURA 4GI9A 4J3SA 1XH1A 2WVVA 1J0JA 1KWGA 4U33A 1JGIA 5A2BA 4XLFA 3WELA 4CN1A 3EJPA 1O7DC 1CXIA 1BSIA 4QAWA 4BZYA 1BLIA 1XD1A 4MB1A 2GJPA 1JD9A 4TVUA 3EDEA 1HNYA 1GVIA 2ZUVA 4J3UA 2F7PA 4M8UA 4AMXA 4NXKA 1O8JA 2QMKA 3DX1A 1XH0A 2F18A 3VGGA 4U2ZA 3BVWA 1R34A 3LRMA 5E0FA 3W38A 3ZPPA 4W8QA 3CZGA 3CC1A 3S5YA 1E3ZA 2AAAA 1QWNA 1NOFA 2D3NA 4BA0A 4UQ9A 3D4YA 4PCSA 1QW9A 1CIUA 1QX1A 2IGTA 4JL1A 3DX0A 3RILA 1L0PA 4UQAA 1IDJA 4W8SA 4AYGA 2BXYA 3BVVA 3A22A 3HG4A 2BHUA 1PLUA 1WO2A 1PXZA 1XSJA 4GIAA 1D3CA 4C2LA 2Y24A 4Z06A 4NI3A 3ZOAA 2ODLA 4PMHA 1I75A 3GXFA 3EJSA 1GJUA 2NZMA 1WZMA 3WFZA 5HDRA 3TTYA 2QY1A 4AIEA 1OSEA 3L4YA 4FLSA 2QXZA 3LMWA 4OJPA 1V3JA 4PCTA 1JAEA 1XSKA 3SUCA 4Z03A 1O88A 4W8RA 1X0CA 4CVWA 2VBKA 2WC7A 2YFNA 2XN2A 2GUYA 8CGTA 3WY4A 4MR0A 3L4UA 1HTYA 1VIWA 1PAMA 1RP9A 2Y2WA 4FNUA 1UKTA 4GKLA 4UCFA 3TTSA 3WENA 2NTQA 3D4ZA 3BUPA 1O8MA 1TQVA 3ZT5A 4XOTA 2ZWZA 1O8LA 3LPPA 4KWUA 2WVUA 4UZSA 3KE0A 4XB3A 1DHKA 4DO4A 2CPUA 1C8QA 4WSKA 4UQBA 3IJ8A 2EACA 5CLWA 3TONA 4LPCA 2QV4A
chains in the Genus database with same CATH superfamily
3PJSA 4L4TB 1AAJA 3C08H 2YUHA 3HS0A 3O3EB 3QXAA 2Z7WA 3DUSB 1HKLH 4HYTB 1AGEA 3SHSA 2XT2A 3LIZH 2VBMA 2DTMH 4YDIH 3D8MA 4WU7A 5BNXD 2APVA 1BBDH 5J9PB 3TVMB 5I1DB 2ADIA 2X4OA 3QFJA 4JM2B 1LLWA 5JLZB 2XQBH 4G9FA 2Q76B 3BHBB 3OMZA 4BQCA 3P30L 5JXEA 1NGPL 2E4FA 5IESL 1NC4A 5CD5C 1N7MH 5HGGS 3B9KA 4JPSA 4F58H 4MMXB 1ZTMA 3VXSE 1HESA 5E6ZA 3P54A 1JF6A 3OM3B 4IGBD 1IC4L 3IE4A 5H94B 4YHML 5DVMA 1KBKA 3AU1B 5DO8A 3GMNA 4PJXE 2R8SL 2YJLA 1OSZA 3ULUH 1ZPUA 2XI9A 3LJ3A 4QO1B 2FBJL 3WFDL 4NBXB 1ZLEA 1AKJD 2OMTA 2ZKHL 1RUQH 4P23B 5GGQH 3ULVC 2EVGA 1RLBA 4A55A 4HIHA 5T5NF 5TFSH 4R4FH 1LYQA 4XVSH 3DO7B 4ODBD 3WFCL 1U2HA 4FEMA 3U4EB 1FO0B 1TZ8A 3EH1A 4HC1L 1U93B 1T5KA 3PWLB 4MX7A 3VD1A 4GYBA 2E0PA 4Z23A 1MAMH 4PMEA 2HT4D 2JI1A 3NCCB 4AQAA 2YHGA 5KWYC 5E6IC 3MTRA 3SD5A 4RRPA 3RNQB 7TAAA 5JIMA 3S5ZA 4K94C 1UXMA 1VFMA 5BZXA 2UVFA 3ABZA 1EDYA 1FE8L 4UANA 4LCWA 3LZFH 3W9DB 3VMVA 1CD1A 1JHTA 3SCMD 1MVUA 4UB0L 1R5IB 3IXTA 3I02B 1INDL 4OD1H 1E2ZA 2NQDA 4JJOA 4ANUA 3L9EA 1WP6A 2IQ9H 3S3SA 5CEYA 1FLRH 2KL6A 4FYRA 1NJ9B 1U8HB 1WC7A 3EFFA 4NM8L 2F7IA 4LPTA 2WLIA 2W80C 3VFSB 2V37A 3LNGA 4QLWA 5E7FA 3AREB 5LN8A 3LX9A 4KI1A 4ODWB 1EEZA 4FQQB 2WXKA 2DQHH 3L3HB 1P4BL 1F3JA 5IG7B 5BCAA 3D2UA 3FQWA 4XMWA 3GXNA 5KVDL 4AYFA 4NLHA 4N6RB 2Z8RA 3QXDA 5SX5K 5C08B 1A47A 1E4XH 4BFRA 3TU6A 2VMEA 3QEHA 1HOCA 3IS0X 4JHBA 4AC4A 1VGEH 2K70A 1BFVL 4M1GL 3BZFA 4UUJB 3ILEA 1X9QA 2X41A 3C8KA 3S5LA 4DZ8A 4PJXF 1MHPL 4QTHB 4ODVL 3VACA 2VQTA 5CN2A 5EN3A 3VJ6B 1CUOA 1WEJH 3QWOA 4KJPC 4PW3A 4L18A 3NIDE 1YNTF 5KS9B 5DD6A 1MFDL 4ORGB 3FYEB 5I8EB 1DQJB 4K8RD 1ES0A 2YAOA 2H2PC 4KDTC 2WP3T 4JPQA 1JI1A 4D8PA 3EYSH 2HRGA 4LCIH 2IBZX 3CC5B 3UOAB 1A9VA 3OAYK 1I7ZB 3DETC 2ESVB 2P5EB 5JHMA 3L6FA 3D4GA 4WKZB 4UYPA 2HB0A 2Z0BA 1W72L 1ZT1A 2XN1A 5I1IH 2HSIA 4L4VD 5C0JB 2BX6A 1G9ML 1R3JA 3PJSB 3EBGA 4OB5L 1IE4A 1SN0A 3HS0B 3K2UH 3QXAB 2FHFA 1AGEB 2F19L 1Q1PA 3HHRB 1H6UA 4WU7B 5CJ8A 4C57C 1N26A 2DMHA 3ARBD 1E4XI 2NT6A 1JG9A 3BT2H 2ADIB 1QPXA 2CCLA 2X4OB 3IU3A 3QFJB 3VFPA 3FCBA 1R19A 3CMOH 4G9FB 1AR2A 1SBBA 3IJHA 1PZAA 5MEQA 5KYWA 6TAAA 5EU6A 1JFHA 2MCMA 1SXSA 2WXOA 4GSDL 5BO1L 2B39A 5L2KA 2AAVA 3QQ3B 4MXWH 2JSFA 5D70L 4N8CH 1SDYA 1BX2A 2O5XL 2WOBA 3ZGHA 2HT2C 1K9TA 1FCCA 3GMNB 4M5SA 1NCWH 1TLMA 2YUZA 3LKSA 4OQTH 1OSZB 4S11A 4NBYB 1PKQA 2QDWA 3TOPA 1MFUA 4XWOD 2OMTB 3CHQA 4ZSOE 4YWGH 2N56A 1SOSA 2CH8A 3K6DA 4HIHB 3GHBL 4L3CA 4KAQH 3JV6A 3IDUA 3IWUA 3NIDF 4NSKA 1EPFA 4ZJ9A 3U4BL 1NCCH 4MX7B 4G7YL 4P48A 3QIUC 1GSMA 1U8NA 4B9FA 4AQAB 3NQIA 1DVXA 3MV7A 2DBLH 1LMKA 5D1QD 43CAB 2HFGH 1GGYA 1T20A 1KV7A 2LAAA 4ACPA 4NDMB 3QT2A 3Q5TA 3KMDA 3KVQA 3H3PH 3EGSA 3LZPA 3KD4A 1NLDL 4FNPA 4TNGA 1TTRA 3O2DL 4LCWB 1CTNA 4XCFL 1WWBX 4A6YL 3ARTA 2UX6A 3MYZA 1CD1B 2QQNH 4MAYC 1U4FA 1MVUB 3EXJA 3IXTB 1ZA6A 4LIQL 4NXSA 4KQ0A 1IA5A 3W39A 4ADIA 3ARGC 4LB8A 2ARJQ 4LLYA 3OMNB 4OJ5A 1KCRL 5D1QE 2XA8H 1GHFL 2XQYG 3F6IA 4KXCA 5CEYB 2F8OA 3UZQA 2WO4A 1WC7B 4YHPA 2WLIB 2V3DA 4YOKA 4PRIA 3GDCA 2HN7A 2NTFA 3ZZ1A 3VXTA 1EEZB 4X6EA 1Q9WA 3BWSA 1KBWA 1E5AA 1T1YA 1WZ1H 4WIQA 3QRBA 1AR1C 5F0LB 5GGSA 3O45A 1F3JB 3W0WD 1WD8A 3D2UB 2CRYA 3FQWB 4AYFB 4G82A 1D7DA 2VFMA 2JH2A 4K3DL 3FONA 1HOCB 4WU5A 4X6DA 5KSUA 5I8OL 3GZQA 1GMIA 4L1TA 4E5XA 4AJVA 3BZFB 5DFVD 3VGEA 1HHHA 4A2LA 1IVTA 4HG4K 1FAKT 3K4ZA 3T6XA 3E3QE 3Q8EA 2PPDA 2RACA 3C8KB 3R7RA 4NQCD 3S5LB 4DZ8B 4P59H 1MFAH 5B4MD 2UYLA 3SKNA 3W0WE 1GQ8A 4GS7C 1J9SA 3BGFB 3QWOB 4ZS7L 4ONFH 3C09B 4DGVL 4X9BA 2FK9A 5DD6B 4QNPE 2QHLA 1ZOXA 2VMCA 3CNKA 4OLXL 5K69A 1XWVA 1ES0B 2HRHA 2EVJA 5F9WC 1DVFD 3JVGA 1JV5A 1OT2A 5F6HJ 4HEME 2AQTA 3MRNA 4NQCE 4OM0L 1CIDA 4HQQH 2XLLA 3U7YL 2D7PA 4D8PB 4NOBA 3JSSA 4PS7A 1A7PL 3F84A 5C09D 1I9RL 1XGZA 3C5ZD 1IBBA 5EU5A 3PF2A 4RFNC 2PCFA 4M5ZH 3L6FB 3VH8A 1AKPA 4NWUH 1ZT1B 1MRFH 1FVCA 4AVIA 1VZHA 1R3JB 3UO1L 4DQOH 1TQWA 2GBVA 1WAAF 3FS9A 3FN0L 3BMVA 5CSBA 2ADGA 3VXSA 3VD7A 4MS8C 4ZX6A 1JGLH 3O6FA 3COOA 3N40P 5C09E 3ARQA 1FLTX 3DSFH 3VFPB 3IU3B 1SYSA 2B1HH 5I24A 3KL5A 3PUCA 5J12B 5DD3L 5MEQB 3T0BA 3MZTA 5EU6B 1GXEA 1RY7B 4TQEL 1YEHL 1LE5A 5GS0C 2G60L 5L2KB 2OZ4H 1E9PA 1DABA 3HRPA 1QEXA 4Y5VA 3O9WC 2QMJA 4DP1X 2X6BA 4TQPA 1BX2B 4XO4A 2X9ZA 1U8JA 4OR1A 4WWKD 3LKSB 2VWEC 3BQVA 5DGRA 5L4JA 3BAWA 5DWUH 1ETB1 1PKQB 1ZTXL 3F7QA 2DRUA 4S0TD 2Y23A 5D6CA 1SHXA 1NM4A 3MRDA 4WI7A 2HP4A 1L9MA 3ZPDA 2BCKA 3Q8AA 3B1UA 1I7RA 3JV6B 2ZWKA 2FECL 4DPAX 3QZNA 4NSKB 2Z31B 4QNPF 2G5BA 1KTLA 3ET9F 1D6EA 4Y4FD 2ODHA 4GP5B 1U8NB 3DRTA 2ENJA 1RK0A 1C5CH 1U8MA 3ZQXA 1EO7A 1YPZA 3NDZE 5CJ5A 1T20B 3RFZB 5EUKA 3FN9A 5T1LA 3BPLC 1HZHH 4B7LA 1DVSA 4ZYKA 2BDNL 5A6LA 3EGSB 1WZKA 1U6AH 3BH6B 1TNMA 1OO2A 2CM5A 1ZXKA 1JHKH 1URIA 4K9EL 2FO1A 4L3ED 1D9KD 3W39B 1CDYA 4U7KA 3NJXA 1KXVC 4LLYB 4FZ8H 5H37A 3UC2A 2OM5A 3QUXC 2NY4B 5IW6A 1O7VA 3H7LA 1CXIA 1I31A 4QAWA 4YHPB 5TE4L 4RQQA 1D6VH 4PRIB 3AB0B 4LSQL 1TUPA 2HN7B 2NTFB 3RVVD 3L9BA 4FJYA 1S5IH 4DKEL 1G6VK 4X6EB 1G6RH 1Q9WB 1TYEB 3VTAA 1T1YB 4U2ZA 4JPIA 2OTWA 5GGSB 4KV5E 4L3EE 5E2WH 1FH5H 3O45B 4P5TC 4F15C 1MEXH 1KYDA 2CWRA 3NFSL 3HUJE 3AWEA 3DK0A 4LSSL 3U9PH 3FONB 4WU5B 1J1XL 2LU5A 4X6DB 4PCSA 5AW1B 5KSUB 2D9CA 1P5VA 4E5XB 1JZ3A 1HHHB 2GPZA 1TQBB 1X5AA 4AYGA 4JFXA 4L37A 3PQYD 3ULVE 3QZMA 3QAQA 1FFNA 1RJYA 2IFFL 4I87A 1XR9A 2UYLB 3R8QA 3SKNB 4HUKB 1RMFH 5SWSE 1MQKH 5FM4A 1KEMH 3E6FA 1ZPLA 3MJWA 2RCSL 4OIBA 2Q86A 1YEIH 2XY2A 1SDDA 2QY1A 3QI9C 4FLSA 4HJ0C 2V4LA 2W94A 1JV5B 2BCMA 4LVOC 4U1SA 4FJZA 3IDXL 1LEGA 2KYIA 3GKWH 3MRNB 3PQYE 5GJTL 4FKHA 4RWYL 5E4OA 2IWFA 1UENA 4K7FA 4XNBA 2O6WA 2N59A 2E7LC 1XQ4A 4PW9A 3UZVB 3TPKA 5EU5B 4OCWL 1RP9A 2KLTA 5F1NA 2PCFB 5FWQA 1JNHA 3E80A 4NUJA 4RH4A 2HFTA 3VH8B 5D7LE 4ZNCD 1R1CA 2YQ2A 2P1YA 1FVCB 2LGNA 4AY0A 1ML0A 2WN3A 4PW4A 5CLWA 2ADGB 3VXSB 4HK3J 5A2JH 2ICCA 4MQXD 2VN5A 1FQ9C 1SYSB 3C6SA 4G6AC 2E6PA 3TN0A 4E0RA 2C1PA 3Q6GL 2Y5EA 4AK1A 2FH6A 5B3SB 3MROA 4L8DA 1LE5B 4UOQA 3W81A 4EOWL 1TEYA 3PETA 1E9PB 1ZJAA 5MI0B 2V5IA 4H0LC 4PRPD 4Y5VB 3QUZD 2JI3A 3H9HA 5JHLA 3U46A 3HUJF 5KVGE 2Q1EA 4IGBB 1AY1H 1JN6A 1U8JB 2PYED 4OGAC 1DSFH 2AKRA 1JF1A 2OYMA 5CINH 3QNXA 4UWQB 1U8QA 4L5FL 1JPGA 6PCYA 1KYAA 3ULVF 5E2UL 5D6CB 2ZX6A 5LAPA 1RZJL 4UU9A 1O8EA 2O6PA 4R7DA 1EFQA 2Y3NA 2BCKB 5I1EH 4PRPE 4P2QD 3QAZC 1I7RB 4WO4D 1ZK9A 5AOJA 3FO0H 2XBZA 2PYEE 2G5BB 1KTLB 3FU5A 1D6EB 4N0CC 2UZIH 4N2GA 1E2WA 5F7HA 5D2LA 3DRTB 1RK0B 1U8MB 4GEIA 4H0GA 4JN1H 1YPZB 2ICEC 4MCYA 4P5KA 2X44D 1ZANH 3AXHA 4P99A 4QJ5B 4BHUI 5LXGH 1OQXA 5EUKB 5T1LB 5TJWK 4ZXBA 4ZYKB 3W2DL 1PAZA 4WO0A 2H8PA 1AD9A 2XZZA 3IS1X 4HCIA 2VZ1A 3TF7C 1H5BC 4HSQA 4P2QE 3QSKB 2CJUH 4JDVA 4XPFH 5EMYA 4M7LL 1BP3B 3M6DA 2P48B 4Y5XC 3HMWL 4ZUTA 1LLAA 5AAWC 1AO7E 1HQ4A 4FG2A 4UIKH 5BUGA 3T3PB 3OPZH 5F71A 2JXMA 2XKUA 4P9HC 3R4DA 4JO1L 4QRSA 3CLFH 5IW6B 4QXGL 2JKSA 2A4EA 4RQQB 3DDFA 3T9WA 3FQXA 5SX4H 1CZ8L 1I1FB 1OAZL 3B56A 3E38A 5LO7A 2CJSA 5CLTA 4V2CB 1O5PA 2OTWB 3N42B 4JPIB 4KJYA 5I30H 4UIMA 2VNCA 1JPSL 2CJ3A 2G0LA 2NY6D 3D51A 4LLUB 4PB9H 3JUYA 2X6CA 4OJDH 4WV1C 3IDYC 3K8KA 3NIDB 1RUKL 2HUEA 1TYJA 1X9RA 1E9QA 3L3JB 4FADA 3M07A 4XGZA 3SE3A 1QD0A 1P5VB 3GIVB 1FG9C 3BMWA 1TVBA 5EV7A 3QUMH 4JFXB 3T65A 4L37B 2BK8A 4XMPH 4XNXH 1W0WA 4IHOA 1FFNB 1RJYB 5CCHE 5I15H 1Z9OA 1JZ5A 4NK6A 2WWMC 3E6FB 4Y9GA 1X4XA 3ALPA 1UA3A 1ODUA 2Q86B 1HAWA 4Z7VE 1BV8A 1SDDB 5GZND 3EF4A 4M8VA 1IGIL 5EFIA 1RIHL 3CHSA 3K5RA 4NC1E 1J5IA 3QWRA 3WTXA 3MJ6A 4U1SB 4WI0A 1LEGB 3ELQA 2P7TA 1VZIA 4YDLC 1WWWX 3MBED 2EDKA 2FEEI 3K6FA 1QUPA 4K7FB 1H19A 3K1DA 4BE5A 3NAAH 4OJFL 3QCVH 4BGDA 3ZHLA 3UP6A 4D3CL 1SLUA 5KVGL 5F1NB 4Y16A 3OJDB 5SX4I 1D5BA 4NWTL 1JNHB 4NUJB 5D96B 1SJXA 5I8CA 5KOVC 1R46A 3RWFA 5D1XC 5F97E 3IJYA 2QSCL 3MJ9A 1CXKA 2TSAA 3OMIB 1W9XA 3BKCL 4EE2A 1LO2L 4RSVA 1YY9D 2FX9L 2PWFA 1MWAA 5DGQA 2H32A 3ZL4H 3C6SB 4A63A 1QMUA 3TN0B 1F2QA 4E0RB 1DBMH 1J9TA 2C1PB 2KERA 4K7PH 4EN3A 1UURA 1X3DA 3MROB 4L8DB 2IGFL 3VG9C 2BVOA 5KUMA 4BCYA 1G4MA 3P3TA 1ETJA 3T0XA 3FT4A 1GGBH 3H9HB 3U46B 2B4CL 1SEQL 4ZX5A 1JN6B 5I1JH 3KAAA 4J27A 3EO9L 3GXUB 2AKRB 1JF1B 4HJSA 3WIHH 1ED3A 3QNXB 5FAAA 2WXLA 5IVOA 1U8QB 3VGAC 1X4ZA 2BW4A 1JPGB 1H6EA 4YSUA 3SPVA 4LO9A 1NCAH 1VGKA 3UIZA 3S37L 3LV3A 2CLVA 4UU9B 4R7DB 5TE7L 1Y0LA 4QJ4B 4P05A 3KPMA 3FU6A 2BHFA 4NRXB 4JRXD 5D5ME 3LB6D 4CC4C 4N2CA 4Z7VF 1C8PA 1OGMX 4PI0A 2DQCL 5D2LB 1F58L 5GGVL 4I0KA 2AP2A 3BWUF 4MCYB 4P5KB 4A7VA 3NJGA 2DB8A 1I1AC 4ZXBB 3VRIA 2H8PB 4FMVA 1AD9B 2C9AA 2ZUUA 4C55A 2WLNA 2NX5A 1S3KL 4KVNH 4JDVB 1XCTA 1UKQA 4ZUTB 2W9EL 1NCBL 1HQ4B 4U1GC 1CDIA 1E8ZA 2IF7A 3ECUA 2JXMB 1FFRA 4LHUA 4BA8A 2J8KA 4YDNA 1BM7A 5E9AA 3TO4D 3DGDA 3GGWA 3HUJA 4QRSB 3ZBMA 4APXA 2ZICA 2BHZA 1R3HA 1JF5A 1K4CB 1P4UA 1DLFL 2EECA 3FQXB 1A7QL 2WSPA 2AERT 3BFQG 4Q14A 1HI6A 4DEPB 3HAEG 1JNLH 4KK5D 4KJWD 1D2OA 4KJYB 2VZ3A 1AIZA 4UIMB 5CM1A 4JUSA 5SWSA 3DIVA 4XX1G 4EZKA 1RUPL 3BSZA 4E9RA 5AOLA 3ZK0A 3ULUD 4X50A 4FAAB 4XLEA 1NCJA 5D93C 2X53A 3SEPA 1E9QB 3ZYJA 1SOQA 2DWDB 5CCGE 4QAMB 2PO6D 1A8JH 5E6IA 4XGZB 2ZUQC 1UM5H 4LL4A 3DHPA 3T65B 2CHDA 5JYMA 3HNTL 4HDIA 5C07A 1W0WB 4IHOB 4WTWA 4JY4A 5CLYA 4NNXA 3FTUA 5GGRA 1CLOL 1I7UB 4PVLA 3ULUE 3LKOB 5I17A 3RKDD 3S0PA 4F7EA 5DD5L 3JWDC 2P24A 1EH9A 2JFCA 1PBYA 5EFIB 5ABZA 3SKJH 5D7LA 4ZUSA 4R3SA 4WTQA 4MCMA 2MWCA 1M3JA 4WI0B 2J20A 1NKGA 3G6AA 4PY7A 2EDJA 3KGSA 4PWIA 1K3IA 3KGUA 1KT2A 2BVTA 4Y1SA 2AABH 1WICA 4QRRA 4N2LA 2AJYH 4FI6A 1D5XA 4J23A 4PJ8D 4Y16B 1ET5A 4BINA 3VSUA 1HINH 4RCAA 4NKIH 5L88H 2IQAA 5DD1L 1P7KA 2DMKA 1N6UA 5I8CB 3MA9L 3MLVL 1UWYA 4R2GD 3DI3B 3RWFB 2HFFB 4Z3GA 3IJYB 4MNGA 3VI3E 2VJXA 5EO0A 1PZDA 3LRHA 2ZP8A 3KJ4B 1MWAB 2C9QA 4MJ4A 2H32B 3EGXB 1BG1A 1UA7A 1PJ9A 2C4XA 2NYZA 2VN6A 4XVTH 4KKLC 4EN3B 4F8TA 1VDGA 3R06B 2BVOB 3B1TA 4POZD 5BZDA 1UXWA 1NBQA 4KTYA 2ZQKA 3FT4B 1A6AA 2J4WL 4Y2OA 4YXLL 1J7VR 4AMKL 1PG7H 2WWKT 1QBML 4KDTA 3B7YA 4BH8A 2VMJA 3Q1EA 4B9ZA 5L4MA 2VO5A 4WWKB 1IBHA 2NNCA 3U79A 1MFMA 1ED3B 1KGYE 2Z34A 4K2UL 4GT7A 4GW4A 4H40A 1IGCL 3G5ZA 1OAKH 3MLUH 1PSKL 5K1VA 2Q8AL 3SPVB 5HVFB 1FAIH 3ULSA 2F08A 1VGKB 3DA0A 1JZIA 3LV3B 2CLVB 4K23L 4YBLB 3C08L 1IAII 2DI9A 5LWYH 1Y0LB 3BKJL 3ULUF 4B9IA 3KPMB 3FTXA 4BZ1A 1P7QD 3VNYA 3EJZC 4MSWA 4Z76A 4XN3A 1CI5A 1AO7A 1LMIA 1AGFA 4HP5A 3WJLC 1NGZA 2OL3H 5AB1A 4IU3A 5JLVC 1Z9LA 1UM4H 2VSKB 1MW0A 4JR9L 4CW1A 2FZ3A 3K0WA 3MLSL 4OJYA 3VRIB 1N7ML 2O5YH 2B7DT 1OLZA 4X80H 3LOWA 2NX5B 1MDTA 4A2FA 5B39A 5E5MA 2FQFA 4ANKA 1QSEE 1XCTB 2XN9D 4P3CL 3SKMA 5AZ2L 2ZKYA 2VC2L 3W11C 1F4YH 5KANI 2W9DL 1KGJA 3PHQA 1PLGH 4LHUB 2YD0A 4DAGH 4PJ9C 5CNHA 4G8AC 1L4IA 1E7UA 3GGWB 2PR4L 3HUJB 1F45A 4QWWD 4APXB 3JURA 3HRZC 4HF5L 5EZOH 3V0WL 1GYUA 3EBIA 3SDXE 1I3GL 1XF1A 3OKEA 5GGQL 4FYTA 1HI6B 1BSIA 4KKBD 2MMXA 3HMXL 3IMTA 2B15A 2W0KA 1MHEA 3TC9A 4ZDHA 1QBBA 3CK0L 4OJAA 5SWSB 2PCXA 3F62A 3LS4H 1MAML 3M1OA 4AYMC 3HB3C 1XH0A 2F18A 2YAHA 3ZPPA 2DIBA 3OAWA 3QIUA 2NY0D 3CWGA 4P2CG 2WBJC 3CZGA 1NCHA 5E6IB 1MOEA 5IBTH 5LNGA 1JPTH 3D9AL 3LZFL 3PQYB 3KHQA 4OY9A 4HDIB 2XXGA 3ML9A 5C86A 4JY4B 4MAYA 4NNXB 5GGRB 2IPTH 3FJTA 5I17B 5E56A 1KGCD 5JDSA 4GIAA 4F7EB 1D3CA 3ARGA 3BN9C 1TTUA 2P24B 3B2VH 2FWLB 3ETSA 3HOGA 2OJEA 2F3LA 3T0DA 2FNWA 4NLAA 5D7LB 4ZUSB 2BNRA 1QRND 4J2QA 3ULAB 1NAKH 1A0QH 3G6AB 2EYRA 3TEXA 1V3JA 4PY7B 2AJXL 1QOKA 2NXZC 1E4JA 4UQ2A 4N9OB 3S4SA 1XSKA 1T0MB 1B3IA 1KT2B 4XC3H 3VQMA 3I74A 4QRRB 1A1OA 1VFAA 4U7SA 1D5XB 2JMRA 2X6VA 5LBSH 2EH7H 3N41B 2RHEA 4WHYG 1NLBH 2NMSA 2IQAB 2IGLA 3QRGL 1P7KB 1VIWA 2YMXL 3FUJA 5GGTH 4R26L 4XP6L 2I85A 3WENA 4MNGB 3KPSE 3RVTC 4UTAA 5EO0B 4G7QB 4JDTL 5HHPA 4XB3A 2CBTA 2GI7A 1ZEAL 3S35H 5IVXE 4BZ2A 3SDXF 1TZAA 4BFEA 2Y9RT 2BY3A 5E1HB 3VU1A 1BJ1J 1EUUA 4K7PX 1CICD 3IU4H 1UXWB 3HS9A 2IBBA 3QG7H 1PD0A 1A6AB 2A2QT 4Y2OB 1KCKA 2NYYC 4K3GA 4BH8B 4LCIL 1WV7T 1U2YA 4GRLC 5D5MA 2Y6TE 1LQSR 1GGIL 4QXUH 1FO0L 1NPJA 4HFUH 2VDMH 2WO2B 2ALAA 2I7OA 3B43A 3JWOH 4GW4B 3G5ZB 1PZ5A 2DY2A 2X4PA 4GP8B 2BNQA 3ULSB 1G1OA 4P46C 2WD0A 2DBJA 5ALCL 4XLHA 4GIPD 1SN5A 1CPUA 4Q6YA 3KWTA 4YSEA 4NO3A 4ZMNA 4MSWB 3VGDA 2FBRA 4Z76B 1AO7B 4PUBL 4F93B 1ZIAA 5A2IH 1AGFB 1JWSA 4XLAA 1NGZB 4RGMC 1S6NA 4IU3B 4V02C 1TJHH 2Y2YA 4CW1B 4CKQA 2FZ3B 2YKLH 3QORD 4OF8A 2XV2A 1OZTG 1CLVA 1KPVA 1N0XL 3LIZA 3U4KA 2GTZA 4L0PB 2BSPA 3DIDA 5B39B 4C54A 5E5MB 1EEYA 3HE7D 4N8CL 2KQMA 3SKMB 3IN0A 2E9WA 4YNYA 1VACA 2V6HA 3BH9A 3O9WA 3PHQB 4NP4H 5FK9A 1KN4H 1KGXA 1NWOA 1RZKH 2ZG3A 3JBG7 4LSUH 4NZTH 4Q4IA 4AXWA 5JQIB 1QATA 3VRLE 1DQDH 2UWEE 2ZOTA 3OKEB 2HVJA 4EAEA 5INDA 3PRZA 1F6FB 2ZCLH 5DVLA 1R33A 1KLUA 1RURH 5DJ0A 1MHEB 2WPGA 4ZDHB 2WQ8A 4LOUD 2IIJA 4YH6A 5IKCA 2PPCA 5HHOA 4KY1H 4N3UA 5AVXB 3VE0A 1A02N 3QIUB 4NCC2 2AGJH 2WV3A 2YR3A 5DLLA 3TJEL 5GS2H 3QISA 2R0LL 5TGBA 3WNIA 3MKGA 5F9JA 1CQKA 3QCUH 3H3PL 1HDMA 5ICUA 3I3DA 2YXVA 2FGWH 3G3LA 1UXSA 2QQNL 2WWOA 2VXTH 3UMTA 3BZDA 1LXMA 4JN2B 3US9A 2CGYA 4MAYB 1BIHA 5HGDA 3GRWA 4YL9A 1IC5H 2QLYA 5HXMA 1GS7A 1YC7A 3ARGB 3T2NH 1KXVA 1EO8L 4K3HA 4Y1AD 5J3HD 1HVXA 2OJEB 3QUXA 1IEAA 2D9QB 2BNRB 1E5BA 3NOIA 5JQHC 2BY1A 1IGTA 2EYRB 3MJ8B 2ZUXA 3VI3A 4UQ2B 4UT6H 3S4SB 3E8VA 4YMPA 1O6TA 5GRUH 3BESR 1II4E 4MJ6A 3TX4A 1AR1B 4GKZA 3GKZA 4KKPA 2D4FA 4P5TA 1A1OB 1VFAB 2QDVA 4H0HB 3W56A 4F8LA 2Y5QA 3B3IA 4Y1AE 4WJG3 5TQ2H 2EDHA 4JO2H 4G7SB 3Q2NA 4B9KC 1MCOH 2PMZA 3K2KA 4ZMQA 1QA2A 4XHJD 3C5SA 5FYLH 2LLGA 4KH2A 3SQVA 4TSCH 5FGRA 1Z9PA 2Y2TA 5HHPB 2JJTC 2W92A 4MA8L 1AS6A 1J1OL 1YJDC 1B2YA 4O02L 4TVPL 4UZUA 2CUIA 2VLJE 1SQMA 4IMKC 3NA9H 3VRLF 1FBIH 2CM6A 4GS7B 2Y7OA 4HJJH 4J4PD 4XO5A 3WNMA 2DLFL 3AZUA 1LWRA 5A3IC 3V0IA 4TNVF 2VXQH 5E1QA 1BECA 3QI9A 5F7EL 4N8PA 4HUVA 3TYGH 1OCCB 1OCOB 1ROWA 5F9WB 3BLPX 3GXPA 1CGWA 3MBXH 3K2MC 1IKFH 2NNFA 4PV9A 3ASNB 5D5MB 2QPEB 3BQUD 1PG7X 2EE0A 1TQSA 1Z3GL 2H2SD 1NQBA 3FT3B 5DC9B 3N85H 1CGUA 3V0FA 2E7LA 4AVZA 5IBUG 4M5ZL 2EIKB 4BFKA 2IXQA 2YMOA 4RFNB 2RAMA 2OKMA 1U91A 2VLKA 1PZ5B 3FW6A 2X4PB 1NIDA 1MRFL 2NZ9D 3CU1A 1VJSA 3V4PH 1YNLL 1HNGA 4PLOB 4DQOL 1H0DA 1UB6A 4LF3A 1O8FA 4XMZA 1I1YA 5IFJA 3MXVH 4R4ND 4LQFH 3U1SL 1WCQA 4NO3B 2W1NA 1QSEA 3ZYIA 2E9IA 1TQTA 1JWSB 3ESNA 3GJFH 5IGXH 4JRAC 2LAGB 1KFAL 4FQXD 5D6DC 1N8OE 2IC2A 5ICZA 1T2QL 3FUHA 2FB4H 4R5VA 3FQ2A 5D7JD 1P4IH 4WW2F 1AHMA 1KPVB 3TH2T 2QFPA 4P4KD 1IZJA 2GTZB 2OZ4L 2ZYIA 4LAQH 3VYNA 4YVUA 2VW7A 4KPHH 4D0BA 4G5ZL 2ISDA 4OCRL 1OTTC 4XNDA 4YNYB 4AL8L 3VFUA 1VACB 3BH9B 3O9WB 4K3EH 1INQA 4PP1C 4XP5H 5FK9B 1FA4A 1CLZL 1S7WA 2NXYD 5DWUL 4AXWB 4DTGL 1ZLDA 3PP3H 5E23A 2GJZA 2HVJB 1DBKL 2BERA 5INDB 3ZDYB 3D85A 3Q06A 2WW8A 1KLUB 2P8LA 3ABGA 5DJ0B 2YIHA 2ICES 2JIXA 5C0CD 5IKCB 4P3DA 5KYYA 4ETYA 4M7JH 5HHOB 4BQ6A 3VE0B 5IZ7A 3H4FA 1G7JA 5KBKA 1CCZA 1ZT4A 1C12B 2PO6B 2ZONA 2ICEA 2YJQA 5TGBB 3WTTA 1HDMB 1U6AL 3RZCD 4H8WH 2WXIA 3BPLB 3DX2A 4TTDD 4PS4H 1DN0A 2E5EA 4XPGH 5EZIL 5AW5B 1GS6X 4Z3EA 3AG2B 2Z35A 4F33A 3AK5A 1SMAA 5C0CE 2QVMA 5HGDB 4Y5XA 2N7BA 3ARUA 3WEXA 4HIQA 3QQ4A 5AAWA 1NUNB 1OTUC 3BVUA 1CT8A 4OJLA 2EICA 2JJSC 1TPXC 2BP5M 4JFHE 2RJMA 1I3VA 2FATL 3QUXB 3VXNA 4P8QA 1PW3A 3HR5B 1NC2A 3JTTA 4M7LT 5ESQA 3KPQA 2QTEA 3KPSA 4MA1C 5IQLA 3VI3B 4X6CE 4A67A 2L7QA 2LE9A 1FH5L 4GRWB 1NWPA 3BE1H 3QHTC 4MJ6B 1MEXL 3VVWA 5IVXA 1PIGA 4GKZB 1CJYA 2V8MA 4OZFH 4F15B 3T71A 2LFGA 2F8XC 4WV1A 3B3IB 1KB5H 1SLXA 3Q13A 1AOZA 1PZ2A 3FH5A 3C5SB 4UAOC 4DW2H 1XVSA 3VXMD 2J1YA 3I3EA 1J10A 3F8UB 3MGAA 2G2PA 4BFBD 1VEOA 1LDPH 4XAWL 1YEWA 4A7SA 1JXGA 3AY2A 4I88A 1KEML 3OZ9L 4FDWA 3DXAA 2PPFA 3CIQA 4PJDE 1U3HC 3QZOA 4XBEH 3WKMH 3VXME 4JHZA 1EHLH 3QI9B 4I8DA 4HUVB 1YN7A 4YGAB 3FZUD 1N19A 1NAMA 3STZA 1KV3A 4LVOB 2XTYA 5EOCJ 2ZYHA 3WTSA 3QA3A 2BRQA 1F18A 3GBDA 3M8OL 3MRBA 3R1GL 1AZCA 4PV9B 2H1PH 3OMAB 3Q01A 4Q9RL 3ZTJG 2DL9A 2CPCA 3EH2A 2M83A 3EOTH 2I5YH 4GMTH 1DQMH 5EPMA 3ZU8A 1U91B 4X9HA 1WS7A 5GIRA 3MI6A 2EDFA 1H0DB 1UB6B 4LF3B 4PJEE 5IFJB 3S3JA 5D1XA 1QSEB 5GRVL 3JWOC 3OKNA 4AQ1C 1XT5A 1AG0A 1CDHA 3CX2A 3NDYE 4I5BA 4HZLA 3LNHA 4W6XB 3VTMA 4LVNC 1HKFA 2AI0H 4GINA 1ETZB 4AOFA 3SIKA 5ICZB 3MOAL 1TFPA 1I8AA 2H3XC 4X6CF 2O26U 2UWEA 5IK3A 1E7VA 3QIBC 3U82B 4N2IA 4D0BB 2XJKA 3RDJA 4HWBA 5FUCE 1THCA 3WDJA 4PBXA 1IARB 1INQB 1TZOA 4YXKH 2DM4A 3H55A 5HDQL 3AQDA 1TZGL 1S7WB 2WXPA 3TEUA 3MU3A 1J9RA 3MLPA 3SE8L 3CQQA 1E4HA 3RJQB 4XZ4A 3D85B 3C6LC 4K71C 1RZKC 2K8MA 4RMBA 4Y0GA 2P8LB 1P5UC 5D1ZD 4CN1A 3QAZB 3B9EA 5ITFA 4RGNC 2JIXB 3T2OA 4P3DB 5KYYB 4JLRA 4CC4A 2DWTA 4HLZG 1HNYA 2BVQA 2NY0B 5I16A 1N4XL 1G7JB 1ZT4B 3H9ZA 1P84J 4R9HA 1A6WL 2ICEB 1KYFA 3N1GC 4NKDA 5DUML 3VGGA 5CD3A 5EIIA 4OLYH 3SDAD 1I1AA 4W8QA 3X3GL 1DN0B 4MA7L 2C1OA 3AS2A 1BWMA 2GTQA 1ESOA 3PYCA 2R27A 2Z35B 2AAAA 1QWNA 4F33B 2Y69B 3IFLH 3OPZL 25C8L 2DQTH 3WEXB 4Y5XB 3FOLA 1N70A 4HXBH 3QQ4B 4KK9C 1CT8B 1CU4H 3CLFL 4W8SA 3A22A 2B9AA 3GMQA 4PJEF 3VXNB 4PR5A 4W9GC 4FXKB 3DHMA 2EVHA 1NC2B 3JTTB 2Z8VC 3GMPA 5ESQB 3KPQB 5K93A 2BSED 3N2JA 1FGVL 3KPSB 2G5UA 1WZMA 2R69H 2YWZA 5E08H 2X89A 1WYJA 2Y07H 3P1VA 4GP4B 4HX1A 4P04A 3MLYL 4QOKA 1XB8A 4X5QA 5IVXB 4OJPA 2IAMC 2WXNA 1H9VA 1JAEA 2VLJA 3DI2B 3SUCA 4WV1B 4HKZA 3IDYB 4N2FA 5IJKC 1LNUA 2ATPB 2VXSL 1LDSA 2C9UA 2D03L 2DWYA 4PJGA 3QUML 4MR0A 1T0NB 2YD3A 1JZGA 2NZMA 2IV8A 2VL4A 3TTSA 4AVHA 3D4ZA 4ICWA 2BOLA 5HYJD 1REIA 1UWXK 1A21A 3DXAB 3SE9H 4EBQH 1N6QL 3UPRA 3LRGA 4TNFA 5DK3A 2DPKA 4APQD 3N90A 1RL1A 1OE2A 3TONA 1CICB 5HHNA 4W68A 1MCNA 1YN7B 5D72L 1U30A 1NAMB 2XNAA 3STZB 1VF5C 2CBPA 2FT6A 4JK0D 1OGAD 2VZTA 3N91A 3QA3B 1DJIA 4J3WA 1DFXA 3MRBB 4XHQA 2FEDC 4YDLB 1YMME 2ZPKL 1IAIM 2E59A 1MRCL 1CFMA 3FQNA 3ZE0E 5IQNA 2VZSA 4EMZA 5EPMB 1KGUA 4G1EA 3UCRA 1AHKA 2X85A 1QSZA 1FNSL 3IYLW 4P07A 3RWJA 5GIRB 3BDBA 3ZXAC 4JZJC 1OGAE 2CO7A 4CSPA 4TSBH 5MEND 4AE0A 2WUBL 3EAKA 4H1LH 5CU9A 3OAYH 1TFHA 3OKNB 4H4NA 3MA7A 4I5BB 4HZLB 3OLDA 3GMRB 4DP4X 1UOWA 1MRDH 3O2VL 4ZTEA 2XYCA 5D9SA 3GFUA 4KMLB 4Y2NA 1T4WA 1OP5K 2L3BA 2UWEB 1YEKH 2OCCB 5EC1A 5IK3B 1EZVY 4M1DL 3VG9B 3F01A 3EJYC 5MENE 2BSDA 2HLFD 1S46A 3V9FA 4PPTA 3X1BA 1J88A 5I1JL 4KK8C 5J13C 1RLWA 2HCZX 4ENEC 1G5AA 5DVNA 1RPUA 1NDMA 1VEPA 4DEWA 3T6ZA 1TZIA 2F58L 4N0YH 1ZK5A 3DMMD 3VGAB 4Z6AT 2DYRB 2IQ7A 1MJ8H 5CILH 3D06A 3PDDA 1B3JA 1D5ZA 2ATKA 3EH3B 4JQVC 3FUIA 3DTUB 4OBSA 5ITFB 1HE8A 1WFTA 5I23A 2O5ZL 2M1KA 3A4EA 4JLRB 2WTPA 1OB0A 3WJLA 2BVQB 5I16B 4F80A 1NANH 3SDDD 1LTXA 4NKDB 5CD3B 5EIIB 3DJSA 4MFHA 5KVEL 1I1AB 4HWEH 5EEYA 2C1OB 3QK0A 3ZE0F 1GOFA 1R6VA 2NTBA 5DR5L 4C56A 3BJLA 2NY2D 1G9EA 3FOLB 3Q3GA 3WXWL 5D7KD 4U1GB 4UOW1 4Y9FA 2AQ3A 5CU5A 1MNUL 4PJ9A 3WY2A 3GMQB 4LEOB 3VFWA 1E5ZA 4GXUN 2I26N 4PR5B 3HRZA 4DFHA 1KCUH 2B14A 4YJZL 4YQXH 3GMPB 3KXFD 3QZBA 4NQSA 4YSRA 3P4MA 1JUFA 1H6FA 5IB1A 4QOKB 2BIOA 4HX1B 2DH2A 3FFCE 3V4UL 2JJVA 5D7KE 4AEHH 2VLJB 4PIBA 1BA9A 1JZJA 5B7MA 4HKZB 1XF3A 4RRPG 4PJDA 1LNUB 4NX0A 3NT0A 3MYJA 5D93B 2X6XA 2WBJA 3DV6A 1G6RB 3T9GA 1NGWA 3KXFE 4OTXH 1HYSC 3TT1H 3RJDA 3DJZA 4PJGB 4Z18A 2ZUQB 3VX1A 4L48A 3VD2A 4H8QA 3OBAA 3HKZA 5TF1H 1PE9A 2AITA 2ZXCA 1JRHH 4BRVA 1F90H 3UPRB 4KVCH 1EMTH 4ABQA 3JWNC 3HHSA 2DQGL 2OMXB 1KSRA 3GSNH 4S1RH 5HHNB 1UA6H 2DICA 2VDNH 3NCMA 1NH6A 2XNAB 1Z3RA 2H41A 5L4FA 2VABA 4OFVA 4FFYL 4R90L 2P4AB 4FNRA 2XQ0A 1N64H 2WQXA 5DQDL 1JXFA 4IRSC 4DP2X 4I0PC 3KLDA 5HDBF 1QKZL 4O5LH 2E9GA 3FQNB 1WAPA 3ZKNC 2C4FT 1CLCA 4JAMA 3D25A 4ZQKA 1BZEA 1X5IA 4ODSL 5AVUB 4G1EB 1HSAA 3LXAA 3RWJB 4Q52A 3VXRA 2H1XA 1VRSA 2CO7B 2CKNA 4BH7A 1TDQA 2BIIA 1NCNA 3MA7B 1U8PB 5K1JA 4EQ3A 2K8QA 4I84A 2LVEA 4L3FA 2N01B 2DH3A 3FK3A 3NN8B 1GY1A 4JM0A 5D7JB 1DUYA 4CBPA 5EC1B 4YBQD 3LQAL 3VWJD 43C9A 3KVDD 4PU2A 2Q8BH 3RTLA 4AQZA 3PDGA 1DVYA 2FJUB 4O58H 5JW4M 4U31A 1FC1A 4JFUA 2FAUA 4JO3H 3NABH 1K2DA 4GRLA 5LVEA 1AHWC 1CGSH 1NDMB 2EE3A 3V4VA 4DK5A 3IF1A 3BH7B 1TZIB 4MZIA 3ELAT 3OKDA 5DA0B 2QV2A 4NNPH 1OAKL 4UDTA 2AQQA 3W3BA 4YSPA 4F7KA 3QR1A 3PU7A 2NT9A 1AXIB 1AYOA 2P52A 3VMNA 1D5ZB 1MCRA 2ATKB 1ZRUA 5C0NC 4OJ6A 4P46A 2XZAL 2PETA 3L4ZA 4WCYL 2N7SA 5C0CB 3ZIMA 1PZUB 3ZSSA 3GWJA 2P5WD 4QY8A 5IBLD 5JOEA 5E2TH 3PREA 2OXHB 3I50H 1MCKA 5F7FA 3MHZA 3QPXH 3RZCB 2EEXA 1H3GA 2V9TA 2DD8H 3FO2A 1NIFA 4JKPH 3INUL 3VGHA 1NUFA 4QXVA 3N0PB 3O0RH 4H8VA 1JK8A 4XVUC 3GQ9A 1UGKA 3FF8A 3QC6X 4C56B 4UV7H 2QLVB 3ATFA 2FLMA 4DAGL 3C2SA 3Q3GB 4K15A 5GPRA 2P5WE 1U8KA 3PWPD 5DMKA 1XGPA 1NFDA 2CAKA 5EZOL 2QKIC 3F7PC 4WQOA 3VFWB 3HRZB 3FNKA 1F3DH 2V9UA 3KBHE 4PP2B 4EDXA 5LHDA 2NW3B 2BFGA 1OD7A 5DZLA 4BWWA 4MZ2A 3AW5A 3EDFA 4NQSB 3CZJA 3P4MB 1JUFB 3TZVD 1DBAH 5ES4B 1BZOA 5IB1B 2X38A 2B1AH 3MJ9L 4MTMA 1JCKA 3A0OA 3BD5A 3T2QA 3HB3B 1XF3B 1MWAL 4PJDB 1JYNA 3MYJB 5DXWA 2WBJB 1V10A 3DV6B 3SZKC 4AX3A 1NGWB 4JJ5A 1Q72L 3QUYC 3ZUCA 5T8IA 5CZKA 5TDOA 1OB1A 2ZXEB 2H0JA 2VMFA 3NG5A 4HCGA 3FQTA 3O11A 4AKQA 5J1SC 4MRCA 5AW6B 2VKWA 2QJDA 1YMMA 2WIMA 4CL7A 5GS2D 1OFDA 2BC4A 1B0IA 1HHJA 3QHFH 2IV9A 3OX8A 3EFOA 3B2VL 2OMVA 4KJPD 3DNKA 5CR1A 1JGDA 3HHSB 1AC0A 3NMEA 5ID1A 4OJOA 4YBHA 3UZEC 1FHGA 2VABB 4D9RD 2PW1A 1U8LB 3WFEH 1F4XH 1KDJA 5DT1L 5AVQB 5AL0A 5EBLA 2NXZB 4XC3L 1EQWA 1BXVA 1IAOA 4I3RH 2NY7H 1K5WA 4JAMB 4ZQKB 1TCRA 3TASA 4S10A 2DDQH 3MN8A 2IPUK 1FG2A 4Z0BH 4AC2A 1D7FA 3PLYA 1HSAB 2X9YA 4FQCL 4MXQD 4B5EA 2XX1A 4KKNA 4E5XG 3SYOA 4D9RE 1UVQA 1HFUA 4GBXD 1J0KA 2BSTA 4BH7B 1FNEA 3OL2A 4UINL 5T1DL 1FZMA 4HIJA 1Y1DA 5F3HA 2JJTA 5EU7C 3VXOA 1W8EA 1U33A 5KAQG 4OSUL 4IMKA 5FYLD 2DZEA 1GTFA 2B0SL 1DUYB 1DBOA 1RK1B 4RESB 4EEEA 4K3JH 4Y19A 2A0LD 3NRFA 4P2YA 4PJIE 3RVXC 43C9B 3QG7L 4R6UA 2O0WA 4YIQA 4NIKB 1NIEA 3IAQA 3JUZA 4J28A 2F8VA 3SOBH 5BUPA 2EILB 3KLKA 3QEQE 4QXUL 5IIEA 2VXVH 1K2DB 5DEFA 2QVFB 5IEKA 4I77H 5FYLE 3V4VB 3IF1B 3OKDB 3IMUA 3BSZL 1HIMH 4UDTB 3DMMA 4Y7MA 3CLEL 4WFFD 2GABA 4P46B 4GI9A 2DKMA 1XH1A 3BKYL 5AOMA 1I9EA 4PLKC 3NH7L 1E3FA 2P44B 2E6JA 2WINA 2WYIA 1TJHL 5L9DH 2YKLL 4RGMB 5GHWL 5D6DA 1BLIA 1YEFL 2GBAA 1C5BH 4BQ9A 4M6AA 3H42L 4J3UA 5IHHA 4WFFE 5F96H 3FO2B 3F12A 3FB5A 5EO9A 3LZRA 3EH4B 1RFDH 4XCCH 2GJ6D 5T33L 5E0FA 1JK8B 1SLWA 3WOVA 4OH2A 2ZXGA 3B6SB 3OXSA 5DJDA 3WN5C 3MC0A 3P4NA 1E3ZA 3FFCA 4MQ7A 1PGRB 2WJ7A 1U8KB 2XZCH 3FB8A 1INEH 2GUOA 5DMKB 3D4YA 4IOSA 3AVEA 1XGPB 1NFDB 4NZTL 1QW9A 1B90A 3Q43A 1T66C 2BM6A 3ARXA 3RGVD 4EDXB 1CL7L 5LBGA 5ADPH 3SPCA 1ET7A 3TBCA 4HIIA 3RUGE 5DURD 1MZZA 4Z3IA 3Q8FA 4MMYA 5KOMC 4NI3A 4OD2B 5JPMC 3L1FA 2DJMA 3EJSA 3APNA 1PCSA 1LD9B 3QUGA 4JFFD 1UQSA 5AB9A 3I2CL 1S3RA 4PJIF 2G4GA 1OAJA 2J5WA 1PFOA 3QCUL 3UJTL 4RBPH 5KZCB 3CBJB 4JJ5B 5HPMA 1QNZH 4IKIA 5TDOB 1JVOA 1OB1B 2VXTL 1EJ8A 3FQTB 3O11B 5LNEA 5K9QG 4I2XA 3WU1A 3TNNA 2R39A 4YN3A 1MFBL 1YMMB 2F5AL 4FNUA 4JFFE 5DA4A 2BC4B 3ZE0B 1HHJB 3OX8B 5H37G 3EFOB 4JO5A 3U7WL 2VLRD 4DF9A 4FFZH 1OT4A 2OMVB 1E2VA 1E4KC 1O8LA 3NUKA 1WT5C 3VXPA 1JGDB 2JJSA 4PFEA 1S78C 3LN5A 5ID1B 3WD5H 2PW1B 4HKBB 4QRQB 4ABUA 3MRRB 2XY1A 4IJTA 3RHWF 2Y7NA 4JHVA 3MBWA 4KITB 2WLZA 35C8L 4HIEA 4LGRB 5EBLB 5HD8D 3UEQA 1IAOB 2BZDA 2I9TA 4A7GF 3QDGE 4BZ1L 3M17B 1F4AA 1TCRB 5TK4A 2XT4A 1FG2B 4AEFA 2AJVH 4TQHA 1RIVH 3BCFA 3EUDA 5FYLL 2EUXA 2OBGA 2VDLH 2BSTB 1JNNL 2EXTA 1AS7A 1FNEB 3VI4E 1FZMB 2MRYA 5LBSA 3VMWA 4HIJB 5F3HB 2ENSA 4AKOA 3VXOB 2DQJH 4S1QH 1FBIL 5GGTA 5JTWA 1HHKA 3BH8A 3T0VA 4J6RL 5FHAL 5AYQA 3RUGF 1U3HA 4PJHE 3TYGL 2BXZA 2UX7A 1EVUA 1BHGA 1CLYH 4ZW7A 1D5IH 4QPEA 1BVOA 3UL4A 4YL4A 3QJVB 1RVFH 5IIEB 3MACH 4NQDE 2HWZH 5IEKB 1G9NH 4JM4H 2E7CA 3MRPA 3DMMB 4RGOH 4AW7A 4ORZC 2D8KA 4ODHH 1EJOL 3QRFM 1NFIA 3QDJD 5JQ6L 2YXWA 1ITBB 2H6PB 4J3OD 1QFPA 5KYUA 2VM4A 3E6HB 1DFBH 2WUCH 3CVHH 2AJZA 2WINB 4AQ1A 1IGML 4PRHD 1UCBL 2ZXWB 4ZG1A 5CGMA 2CMRH 3K6OA 1NUGA 4EPSA 3LN4A 3QDJE 3F12B 3FB5B 5EO9B 4KPHL 3L7FA 3STLA 2OL3B 3E2HC 3NGBB 3OXSB 1ACZA 2FX8L 5DJDB 3QIBA 4F5CE 2NY2B 2Q3AA 2OTUA 2CK0H 3FFCB 3P4NB 4MQ7B 3Q05A 1CDBA 4PRHE 1NBCA 3FB8B 1GW6A 3L3OC 2GUOB 3WE6A 4M7ZC 3NZ8B 3NZSA 1F3RB 4W9LC 5KBNC 3AG1B 4CILA 4KK6C 3RWHA 1HILA 2JK5A 3UGUA 3VI4F 4I3GA 2VSDA 3AT9A 2OULB 2P49B 5D71L 5JW5A 4HIIB 1M42A 1BXUA 4ZAKD 3C6LA 1KACB 4MMYB 1P5UA 5DHMC 4UTAL 1YQVH 2EZ0C 4M7JL 4P2OD 3QPQC 3TCLA 1FV1A 1UQSB 3P9MA 4PJHF 3WIAA 4BD4A 2YUVA 5JZ7C 3SQBA 4M5TA 3NCBB 5BOJA 5HPMB 3EXLA 4EVNA 2YBRA 2FGZA 2OW6A 4KHXL 3LHPH 2KKQA 4GSUA 4I2XB 3TNNB 2K78A 4NZ8A 3IMVA 1AG6A 3LXBA 3POHA 2VN3A 3NIFB 3HFMH 4YE0A 3NSXA 4FFVC 3VXPB 5JIQA 1TPXB 4CBZA 4XOBA 3L4XA 1JSYA 1FZOA 2PTVA 3LN5B 3SDYL 4ZFGL 7FABH 2NR6C 1XEDA 3CVIH 4FQLL 1UACL 5DS8A 5EOQL 2G9HA 1ACYL 3MBWB 4QRBA 4MA1B 2W91A 4A2EA 1J8SA 3R19A 4HIEB 3GHEH 1KXQE 2I9TB 2B20A 4Y5YC 5AVSB 4OGYH 2IAMA 1TO4A 3APCA 4IBTA 1Q38A 4FYSA 1V3MA 2OS7A 5IJKA 4UT6A 4J3OF 3L16A 5B1BB 1FGNH 5C6TH 4PJIA 4G59C 4UAOB 4XONA 2IOUG 4DP9X 1V3LA 1KY6A 2B16A 4TL5A 5BZZA 1RSYA 4AMWA 2V5YA 3QEQA 5GS0L 4ONGL 4KH3A 3BAEL 4JPKL 1HHKB 2V17H 3BH8B 3WKML 2MQ0A 2O0VA 2CKBH 1U3HB 3G04A 1VENA 2GKIA 2UZXA 2WAHA 3TYFA 4AYID 1K6QH 1IM9D 1AS8A 4IRZH 3ETBF 1OF2A 4KTEL 1Q0XH 4MCZA 3A4AA 2ADYA 1IFGA 3UTOA 3AS1A 1NIAA 4Z3JA 3ILPB 4HS6A 4PRAA 3EOTL 2I5YL 4GMTL 3BRDA 4P5MA 1G87A 2Q3ZA 4IDJL 3T4AC 4E9VA 4GUOA 3MRPB 4YAQA 2GITA 1G7QA 3IGUA 1RERA 1M05A 2B0RA 4MJHA 4HWUA 1WITA 1NFIB 1HEZA 2DEXX 4HBCL 4RA3A 2WTRB 2IAAC 4JZJA 2VDKB 4M5YH 1SY6H 2DI7A 1CGYA 2PWGA 5E99H 1WBYA 4B0MM 1O8KA 2EUVA 1QHPA 2QKSA 3WNOA 2VDMB 5KYUB 3ZW3A 2BVUA 1IZKA 4MKMA 2AJZB 4LL1A 4MJ2A 4AQ1B 1A65A 4DN3H 1TNNA 4Q56A 4LVNB 3FPYA 3GRWL 2E7MA 5CJOH 1GGCH 2FO8A 3ZMEA 4F24A 1IM3D 4M6OL 1EVTC 4XPAH 1WHPA 3LPOA 3LN4B 1XSIA 2WOYA 1HXMA 1XCQA 1BQHA 3GJFA 3L7FB 4L0ZA 4YLCA 5D7IF 3MUZ1 1GC1L 3QDMD 3QIBB 5DD0H 2OTUB 1CTMA 2HPOA 1MCWM 3VU2A 3WE6B 4B5ZA 3NZHL 3MUGA 5GRJL 2X4TA 3K6IA 3GXTA 3RWHB 3L1EA 4LRNH 2VQUA 1PZSA 3BSHA 4M43H 2J12B 2JK5B 3FXIC 1A7NL 3BWAA 3VGFA 1IQWH 5LQBH 1TYVA 4J3TA 2VUOA 5E95B 1BAFH 2FVNA 3QDME 3C6LB 4K71B 2PXYC 1KULA 2C9RA 3T2LA 2B8OT 4JQVA 5IFHL 1P5UB 3LEVL 4QF1B 5E24E 2QZ5A 4LLVA 1HG8A 4RGNB 3TCLB 1FV1B 3P9MB 5C0RH 4FFWC 3ARDC 5T1KD 2A77L 3FFOA 4U6XA 3VD0A 3RTQD 3SQBB 3DV4B 1G9HA 3UP1A 4CGUB 4RFEA 3RGBA 3NIGF 5HHQA 1DVTA 2AXFA 1AMYA 4EVNB 5AWNH 4FA8A 2YBRB 4XR6A 1WD9A 4O9HL 1F97A 2YEZA 5FGCE 4GAJH 3RDTC 2P80A 2NLJA 4LHUG 1NUDA 3GBML 3BISA 4P3WA 4WEMB 3QDGA 3Q7JA 4FNLH 4L1LA 4OJEH 1R5VA 1A6TA 4RMRA 3O8XC 1NEUA 5TF0A 3S9DB 3UYRH 5D7HA 1QI5A 1FZOB 3ARPA 1O9VA 1HJBC 2BIQA 2VR4A 5DS8B 2G9HB 1OARH 3RBSA 2DOCA 3KHOA 1RZFH 4G6KH 1SFHA 2XBTA 2WLJA 4JFQA 2NSMA 2GJJA 2G3NA 2ROYA 5EEZA 3PABA 4AM0A 4LL9A 5F7YC 1XB3A 2VDRB 2CR0A 2YXMA 5FDYA 5GGVY 5LXVA 4N0FA 3L13A 3RAJH 1S4IA 3WLWD 2R59A 4GBXB 5ADOL 4PJIB 3MGTB 4PWGA 3VG0H 1OFLA 2GY7B 1MCBA 3ISYA 1PEWA 3QE5A 5IHBA 4ZFQA 1A7RH 4WHCA 4X4MA 3WTWA 4L0YA 2WIIA 3QEQB 4NQDA 2A74C 4EBQL 3RWGB 2YEVB 5GZOC 3EYQC 4IQHA 5EOCL 1RV6X 1UWEL 4MD5A 2WANA 3RB5A 3UW0A 3G04B 3G5XA 1T2XA 3TYFB 2OR9H 5IREA 4GQQA 4JHWL 3FTGB 5K9JH 3EFDL 3FSZA 5A6MA 3B2UC 4XC1H 1OF2B 4MCZB 1Q1JH 3FT0A 4I0PA 4ALAC 4HS6B 4PRAB 4JCWA 4P5MB 2CDGA 5IHUL 1K5CA 1RZ8A 1Q0YL 2GITB 3FF7A 4YAQB 5DUJA 7CGTA 4ODTH 1PX4A 1HEZB 3TBWA 1G9NC 4JZJB 3GSOA 1K8FA 1WBYB 4JHAH 2E7DA 4ACTA 4F5CA 1JPFA 2YAMA 3L17A 5ACLA 3ASOB 2WVVA 2E9JA 1FSKC 3KYNA 2V5MA 3VFMA 3W82A 2PABA 4JRFA 4P9HL 2YO3A 2GJPA 1HXMB 1JD9A 1BQHB 1TJGH 1XCQB 1YUKB 3GJFB 1ETA1 2X3BA 3L1OH 3PUUA 1UCTA 1LLZA 3D39A 3PNRB 5EA0L 1R34A 2ZOWA 3HC4L 3NCYS 5E4EC 4N20A 1W0YT 1JVLA 5LDSA 3MUGB 1AHWA 5EUOE 2YPVA 4YX2L 2X4TB 4JQIH 4POYA 4XWGH 2YRBA 4W9JC 5ICXA 1CF8L 4HETA 3VCLA 1NCTA 1QA9A 4IS6A 5CILL 2CK2A 4G6ML 5MHSE 4XO8A 4AW4A 4KZDL 2BM7A 1M2OA 3V2AR 3P11L 1JFQH 1XTLA 3NSYA 5DHVA 4S1SH 1AACA 1PXZA 1J18A 2EXYC 2Y24A 1KN2H 4LLVB 4LASL 4OCYH 4HH9B 3ZOAA 4U6XB 4NZUL 1QSFE 3G9VA 5CS7A 4MMZB 2CO1A 4RFEB 1AJ7H 5HHQB 5L0QC 2Z93A 2AXFB 5GRVK 1DQIA 5B39G 5C6WH 2FX7L 4LK4A 2YEZB 4W8RA 2NY3D 1NAML 5IQMA 1VERA 3X3FH 3HG1A 2NLJB 5BVPH 2XCMC 1FYTA 3QDGB 2WXRA 2GUYA 3TVMC 1IL1A 1NKOA 4ZUWA 3WY4A 3UDWC 3KNBA 1T6WA 4LCYA 3HC0A 1R5VB 4P2RA 1A6TB 3HG0A 4LRIC 1BLNA 2DLGA 2QKIA 4M6NL 4BHUA 5M95B 2WXMA 1OP4A 1RUMH 2OMWA 4OPWA 2WVUA 2I32A 3P30H 1NGPH 1OM3L 5IESH 1IEHA 4FP8L 2TRHA 5ISZA 3VI4B 5I1KL 2QV4A 3BVNB 4JFQB 2HKHL 1MJ7L 1W6WA 3GEFA 3PABB 4ZX4A 4AM0B 5EEVA 1IC4H 4U7MA 5CWSB 1DQLH 4YHMH 2W65A 3KLHD 3QO0A 4YZXA 4BCZA 5ID0B 2R69A 4N0FB 2R8SH 3GLAA 1XZWA 3BUBA 3QRLA 4G43A 4I0CC 4N24A 3QUYA 4AEIL 2FBJH 2XPGA 2WKOF 3IGAA 3WFDH 4JG5A 2ZKHH 5TF1L 2WBXA 3UTSD 5CCKL 1JRHL 5EUOF 3HJEA 2WIIB 3KDPB 3UACA 4NQDB 3WFCH 3DX4A 4HWBL 2LLNA 4HC1H 5B3JE 4KO6A 2BIPA 3TFKD 5HPOA 3K8MA 4MD5B 2D2CC 2DIJA 1UA6L 2HT3C 4KKAD 3G5XB 5FW7A 4KKLD 3I6LD 4PYGA 1QO3A 5I6KA 3JQOB 1N64L 1WTLA 3UZEA 4MBOA 1ADQH 1DBGA 2EDDA 1CMOA 1R3LA 3F05A 4LQ1A 1FE8H 2AXGA 3QIWD 4KNTA 2HRPL 2EO9A 4UB0H 1VKXA 2CDGB 4CC0A 3VGBA 1CE6A 1INDH 1RZ8B 3WEMA 4U4BA 3ARWA 3I6LE 4LSRH 1MPAL 2A9ML 3ZSCA 3TBWB 5I9QC 1MLBA 4NM8H 3GSOB 3SYCA 3O41A 5IJCC 5MP6L 2QADD 1JPFB 1JTPA 1K72A 2XICA 4QTIH 3BRFA 3SN6N 3WI9A 4KNSA 5E9DD 2WVVB 2VRQA 5IWLC 3OAZH 1P4BH 5AG8A 3KYNB 3VFMB 3X14A 5KVDH 1GPOL 5AYUL 2CD0A 4ZW8A 3WO3B 1G94A 4BFJA 4RAUA 4JGUA 2X05A 4C58B 3C2AH 1BF8A 3FRPA 1BFVH 3K4AA 4M1GH 3D39B 1KCVL 3MRMA 1CVSC 3NABL 5E9DE 1CGSL 1U2CA 4XOEA 1MHPH 3UYPA 1AHWB 5AKRA 5I0WA 2QX3A 4BBWA 2EEFA 5ICXB 1B4LA 2ZSWA 2M8XA 5EF0A 1QA9B 3CQPA 3VCLB 4DUVA 2V0AA 4IS6B 1MFDH 3IDNA 3KPNB 5C0AD 3PGDA 1YEGL 4E9YA 5IB3A 1J1PL 5DHVB 3ECQA 1ILSA 5DVOA 3MXWL 2JQMA 1G7PA 1NTDA 1VPOL 3TJPA 3P77A 3KEHA 2O1AA 1DSYA 4NM4L 4AUYA 1VAHA 3A47A 5AW0B 5DJ6A 4KHTL 2Z93B 1SEBA 3AMKA 2EABA 2XVKA 5C0AE 3JWDL 1MFNA 3BRGC 4XKVA 2K9FB 3T09A 1KCBA 3C60C 3QZWA 3HR6A 1C7TA 3HG1B 3WN5A 4OB5H 4PSRA 1FYTB 4M00A 1B6UA 2QR0A 1WZAA 4UBDD 4RISL 1IL1B 2F19H 4X2UA 4ZUWB 3UFIA 1DTUA 3KNBB 3D0LA 3HC0B 4LCYB 4NZRL 2MKWA 4P2RB 3RA7L 1BD2D 4WI2A 1HHIA 1BLNB 2QKIB 2WSKA 1D5MA 1YSOA 3TH0A 5JXEC 1ASQA 2OMWB 3WNKA 1EFXA 32C2A 4N6QA 2PWEA 3VXUA 3ZGIA 2UXTA 3ZDXB 3PJNA 4FL4C 5ISZB 4WUKL 2J25A 3K71A 5BO1H 1P2CA 3KR3H 4HU8A 4E68A 2XTJD 1CC3A 5JPMA 4TUOB 4S1DC 5D70H 4WY7L 1NZRA 2CDFA 3FO1A 5CZXC 5KVMC 1BD2E 3FRUA 4A39A 2AXJA 2O5XH 3KLQA 3BUQA 2ENPA 1NOLA 2W65B 3QO0B 2JCCA 2LLLA 4HCRA 3MOBL 4DGIL 4OZIE 1IT9L 1UEYA 4UQDA 3GS7A 4G43B 4AGMA 5DS1A 3SDCD 3IGAB 3UEZA 1EHNA 4L3AA 3X1EA 2XTJE 2M26A 1WF5A 4BFIA 2K45A 3GHBH 5AUMA 2W81C 3T3ME 3MPCA 2WZAA 2DM3A 5KSBA 2NUPA 2BVYA 3GTNA 1XD0A 3MV8A 1E4KA 2B5IB 1WT5A 1YG9A 1PJWA 3MRQA 3GLDA 4KFMA 1SHWA 2X6AA 5K5YA 2CGRH 4WUUD 3LKPB 4OGQC 3S3PA 4XN7A 5FEBA 1R3LB 1IX2A 1NLDH 4XPBL 2AXGB 3O2DH 4U3SA 4A6YH 2NY7L 4WAFA 1RZIA 4GKNA 1PYWA 4HV8A 2FUQA 3GSNA 4FXTA 1VKXB 4KGJA 3L5IA 1CE6B 4Z0BL 5J5EA 4LIQH 3OKMA 4TULH 3JTSA 1AP2A 3IDMA 1EZVX 1MLBB 4WUUE 1T1XB 3O41B 2XV6B 1ASPA 4PV1C 1NSNL 4HSAC 3L54A 4ZFOA 1MW3A 1EAPA 4PWFA 4JL2A 3ILQD 4YHKL 5E6YA 1B0RA 4AG4L 2VR5A 1A4CA 1CYGA 3L3GA 5EUOA 3I9GH 3X14B 2W07A 3VNZA 4B0MB 3SZ6A 4K3JL 2O1DA 5I6XB 2Q9OA 3KRGA 4K3DH 3RBGA 4RAUB 4F1SA 1N0LA 3D0AA 3OF6A 4F8NA 4GRMB 3FRPB 3G5WA 2QGBA 3B5HA 3P2DA 4X9FA 3MRMB 2ZTBA 4TVSa 1TETH 1ACCA 3BGFC 4NKQB 5K9QI 4OZIF 1J0IA 2NY5C 3UYPB 2HKAA 4YC5A 5AQ0A 3OG4B 2UUDH 1QSFA 4ZS7H 1HQRA 2ZSWB 3GSRA 3VA6A 4DGVH 4N1HB 1HWHB 1QWHA 2EDQA 1EA9C 2O72A 3BZ5A 3IDNB 4WEEA 2BSSA 5KVFL 3CSGA 3PGDB 4OLXH 3BN3B 5IB3B 5EZLA 3FTYA 1QASA 3ZHKA 2C9VA 1NGQL 5AL8A 3ZSTA 2VRKA 4B9JA 1G7PB 1QA3A 2GTWA 3IDIA 1JTAA 1KIPB 4KROD 3P77B 2CQVA 5L9DL 2WNKA 4TQIA 3DK2A 1XF2A 1J5HA 1A7PH 1C5BL 2ARWA 4BKLA 2N0KA 3H4HA 1I9RH 1NCIA 3HAEH 4ELDA 5DJ6B 3FU3A 1SEBB 2OXGA 4XPTL 1RFDL 3TS8A 2HTKC 3ZY7A 1MI5D 3QZWB 3UO1H 1T1WA 3M7OA 3WN5B 3CSTA 4N8UA 2WSDA 3FN0H 2QR0B 4OAWB 3MMEA 1W6LA 2CO6B 4W9CC 4HPOH 1TLKA 2MOGA 2P46B 3D0LB 3CSBA 4U05A 3L3OA 5JXAL 1HHIB 3GK8L 3BUIA 5I1GL 1CDJA 1D5MB 1UTDA 4AK2A 2YD9A 3UG3A 1P4LA 2OQJA 1EFXB 32C2B 2A83A 1MI5E 2LTQC 3VXUB 3V6ZA 1QPKA 4TQEH 1KXHA 1YEHH 3K71B 3KPTA 3GT6A 9CGTA 4PREA 1P2CB 2G60H 3VFVA 5A2CA 5C0BA 4LZKA 3O3AA 4PJCE 4DESA 4YS4A 2CDFB 3FO1B 2UXGA 3FRUB 3O4LD 4TTGA 3FHQA 2C4FU 1C08A 1RZPA 1LK2A 4YR6A 4X4YA 2JCCB 3KYMA 2XVLA 3O6ML 5FM5M 1UWGL 2XWJA 1EDQA 4OM1L 1ROCA 1KJVA 4V11A 1ZTXH 6CGTA 4UT9A 2XOTA 2C3VA 2VL5A 4U0RC 1GCFA 1A14L 2HVBA 5DZJA 4BFIB 2Z31C 5AUMB 5IEHA 1U58A 3O4LE 3MX0A 3ZYZA 3T0EC 1ORSA 2RR3A 2NUPB 4JRYD 5KSBB 4JPVH 4FTVD 1MAJA 1JYVA 1WBXA 3MV8B 1M53A 3BP5A 2WNGA 5IT2L 3V4VL 3E1F1 1KJ3L 3WD5L 1SNRA 1DL7L 4RVBA 3MRQB 1DLHA 1G7LA 3MNMA 4FLQA 2NR6A 3HNSL 2BDNH 2BLFA 2J21A 4NUQA 4JFDA 4QCIA 3KWXA 1RZIB 4GKNB 1PYWB 4HV8B 3US1A 3GSNB 4Y4HD 3KWUA 4K9EH 4JRYE 3GSQA 4Y5YA 3L81A 4FTVE 2J73A 1AZRA 1MN4A 1L1IA 3OKMB 4XL9A 1BEYL 1NFKA 1ZSHA 1GSKA 3AAZA 2XBDA 2VDLL 3HE6C 3ZMRA 3JTSB 1AP2B 3IDMB 4G80A 1J5CA 3AB0C 3AS3A 5TE4H 3MRIA 2Z65C 1MFEL 4HGMA 4D0DA 3EOBA 2QSTA 4ZFOB 1ZVYA 1V54B 1MCSA 4IOFD 2DQJL 1EAPB 4S1QL 1Q4NX 4DKEH 1GJWA 1YHPA 2CHZA 3FAWA 1I8KA 1B0RB 1XO8A 3QQDA 3L3GB 4PJ7A 4QGYA 5EUOB 1QLEB 2W07B 2KZBA 2VOTA 3NFSH 3H3KA 1KWGA 4NO0D 1M7DA 2W9LA 3BGMA 4NC2B 5IV2A 1A6ZA 1N0LB 5BJTA 1J1XH 5EDXA 3M86A 4XXCA 4PJCF 3GM0A 5C6PB 1RVFL 5D8JL 1OP5H 3F83A 4AMXA 1CE1L 2K4AA 1I4FA 4U1LA 1A9EA 2IFFH 4BQ8A 2BP8A 4MJJA 4WJKB 1LEKA 4EI6A 5DQJA 3SYJA 1QSFB 3T4AA 1HQRB 3GSRB 2RCSH 3PGFH 5HGBA 2BSSB 4FHBD 4G70B 4DPCX 4PRNA 5EZLB 4NJ9L 3IDXH 5GJTH 3DWTA 3RPKA 2GTWB 3IDIB 1QRCA 1N67A 4RWYH 4X5WA 3VW3L 4DGUA 2BHUA 1XF2B 5MEPA 1JE6A 2CMRL 1EGJL 4RMQA 4BKLB 1AZBA 4OCWH 4RZKA 5BV7C 2OXGB 4KMTL 1OQOA 3FQRA 2CDEA 4FX5A 3N40F 5FX3A 1QSVA 1L3WA 1OSEA 3WO4C 1T1ZB 1BFSA 3OJVC 3D7PA 1T1WB 1J8KA 3E2HB 2IFGA 3F3HA 3G6JE 4M48L 5SV4A 3MCKA 1SUJA 5IHZA 3L3OB 4M7ZB 2WC7A 5EF3A 3M1BA 2VCOA 3HI1A 1G9MC 4YDJA 2FBOJ 4PIRF 1P4LB 2OQJB 4M93C 3Q6GH 4TSAL 2A83B 4EXPX 3V6ZB 5MI0C 5J7CC 3T6WA 1IAIL 4PREB 2N4IA 4R84A 1OIOA 2WLYA 3VFVB 2PXYA 1YQVL 3NCFB 4IGBC 4XP4L 5EIVA 2TSBA 5C0BB 3O3AB 3A6BL 2QYUA 2GHZA 2XZQL 2VN4A 2EACA 5T1JA 1G7IA 3ARDA 4UQIM 1C08B 4YR6B 5EIIG 4X4YB 1KWKA 3KLSA 3KYMB 4W9HC 4OIAA 4OJCA 4XKWA 1H3XA 2XWJB 5F3BA 1KJVB 4L5FH 5SV3A 2Z92A 4Z95L 5E2UH 4ZMOA 3U4AA 5HYIA 15C8H 1KBBA 2C3VB 5DFWH 4AV5A 4YHNA 5GS3A 3RDTA 4PJAE 5TTRA 4NZDA 5DJXA 1LWJA 1U58B 3JV4A 3HZKA 2HT4C 3DHUA 1GH7A 3V0VA 1NMAL 1ORSB 4ZZFA 1ZGLM 4GJTB 1WBXB 2C9XA 3R4RA 3BP5B 3OLGA 4Z3TA 3O8XA 5GGSY 3VDCA 4YDTA 1KC5L 7FABL 3KJ6L 3OKKA 1UASA 2BZ7A 2R29A 1DLHB 1G7LB 6FABH 3NB2A 4KXBA 1RKRA 3GD1C 1KTKE 2AK1L 4JFDB 3SCMC 4NQVA 1L7IL 3DVIA 3ZKXC 3P3SA 4QCIB 4XP1L 5CJXC 1G1YA 3H6JA 2IDCA 4OGYL 3BCDA 5DLML 5JMOC 4N0UE 3GSQB 3UCQA 4Y5YB 3JZ7A 1EXGA 3KW8A 1F8TL 2WYTA 3L5WA 5AVZB 1TYXA 3AAZB 1BZ9A 2EDRA 3QBTB 5CHNA 3GINA 4JO1H 1ZHKA 4QXGH 3SGKC 4X5LA 1LP9E 1LJMA 2BJMH 2HX7A 4G80B 3T6VA 3G6JF 3WYRA 1X7TA 3MRIB 3QVAA 2Y1ZA 3K6SA 4XMUA 5HGHA 2QADB 1OGSA 5IMLA 4WNQB 4D0DB 1CZ8H 3EOBB 1KCDA 2ORBL 1OAZH 2F1AA 4AQ8C