3VSTA

The complex structure of xylc with tris
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
molecule keywords Xylosidase
total genus 238
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vstA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vstA01
3VGBA 1KXQA 4MR0A 1UD3A 2Y24A 1QJVA 3VU2A 1PE9A 3CZEA 2XVLA 2ZX5A 3VGFA 1NHCA 2GVYA 3VSUA 2BHYA 2XN0A 2XN2A 2ZICA 2D73A 1OOCA 1UKQA 3WEOA 4XOPA 3LRKA 4WF7A 2YA0A 3VNYA 2NSTA 1BAGA 1MW0A 1PZ3A 3A6OA 1IA5A 2NSPA 3VX0A 4J3VA 3A47A 3ZT5A 4XB3A 3FW6A 2C8NA 2E8YA 3WY2A 4HOXA 1OT1A 2EWEA 1GCYA 1W9XA 4YZAA 3L2LA 3VO0A 1R33A 3A24A 1KGXA 2V3EA 2BHUA 3W38A 2WKGA 3GQ8A 1WO2A 3HG5A 1O8LA 4W8QA 2EJ1A 3LX9A 4YZXA 1JDCA 2ZUUA 2XVKA 1O8FA 1HL9A 1QX1A 1RU4A 4OJPA 1XH1A 1TCMA 1MXGA 4UQEA 2G3NA 3BUBA 4XNFA 1O8EA 1O8JA 1OFLA 1CGYA 3BAJA 1VAHA 4H7VA 1QHPA 3VSTA 1EA9C 8CGTA 5HDRA 6CGTA 5E70A 4HWVA 2PWDA 4M8UA 3WDIA 3FY3A 2Z1KA 3IJ9A 2D0GA 3CV5A 3K8KA 1JFHA 3DC0A 1J0HA 2YKKA 3WELA 1WZKA 4GKLA 2DIJA 3BLBA 4WSKA 3WY3A 1KXHA 3UG3A 2PWGA 2ZWZA 2ZX7A 2E9BA 4Z05A 3CZKA 3VSVA 1CLVA 4CN4A 1D3CA 3GRHA 3ZT7A 4CGTA 3L4VA 3VGDA 2VRQA 3BVTA 2XIIA 1IZJA 1JG9A 1D7FA 1WP6A 4CN6A 6TAAA 1P6WA 2XIBA 4UOZA 4AMXA 2FYVA 2OYKA 4U49A 1B2YA 2F7RA 1PZ2A 3SUCA 2BXYA 3AXIA 1XSKA 4OJ6A 1ODUA 2EQDA 2QPSA 1UKSA 1PXZA 2EAEA 3BSGA 1BF2A 3GXFA 1CPUA 1XCXA 1AVAA 3GXTA 3CTTA 1E3ZA 4PSPA 2BY0A 4PSRA 1JAEA 3CLWA 1PAMA 2WANA 1JXKA 1VB9A 2QY1A 2ZXAA 1WPCA 4B9YA 1VFOA 3EJTA 2PWEA 2X6WA 3CGTA 4GQQA 1HNYA 4FNRA 2WVTA 2VNCA 3WNKA 3VMWA 1O8GA 1E40A 4OGZA 4CVWA 1WZLA 2ZWYA 3GXDA 2J25A 4UCFA 1AIRA 2D0FA 3WNLA 3DHPA 3GXPA 2OSYA 4PCTA 4CN1A 4CKQA 1JRGA 2E8ZA 1KTBA 3RILA 1IDJA 2BY1A 1JI1A 4AW7A 3DX4A 2BHZA 3GBDA 1CXEA 4NZFA 3H55A 1JL8A 1KGWA 1BN8A 2WCGA 4UQAA 4GO9A 3IJ7A 4EW9A 1V3LA 2CXGA 2OSXA 1EO5A 4XLFA 3VGHA 2FHBA 3GBEA 2VJIA 2YJQA 4JL2A 4J27A 5A2BA 1CGUA 2YA1A 3DHUA 4DO5A 3B8YA 1UH3A 3EDEA 1E43A 4XLAA 3VMOA 4M56A 1XGZA 2XWEA 1TQUA 2F7QA 4FLRA 4FNPA 2XN1A 3WDJA 1KBBA 2BXZA 3AJ7A 1Z32X 1PJ9A 1OSEA 4J3WA 1ZJBA 1HTYA 1MFUA 1J0KA 2QX3A 4NX0A 1OGSA 3HJEA 5C1CA 1CGTA 3UW0A 1J0IA 3OLEA 2PYGA 5CGTA 1RMGA 1TMQA 3HG3A 3L4YA 4JFUA 3UG4A 3ZR6A 4DO6A 1WZMA 1IDKA 4WSJA 1E3XA 1JI2A 1BPLB 3BLKA 3BVVA 2NT1A 3LMWA 4YEJA 4FLQA 3DX3A 1KTCA 4GQRA 4H8UA 4YELA 1U33A 1CXLA 5A6MA 4OIFA 3VNZA 2X2HA 3KL3A 1TQWA 1JXJA 2FHFA 3BAYA 2NZMA 2YFNA 4LQ1A 5A2CA 4JFVA 1O8DA 1V3MA 3JURA 1ZS2A 2NT6A 3DDFA 5CXPA 3ZR5A 2XWDA 3GQAA 4XLCA 4MAZA 2VT0A 3DX2A 1BVZA 4KWUA 4J3SA 4HP5A 3VX1A 4XQFA 3EQNA 3EJSA 1UA7A 3WNMA 3K8LA 3ZOAA 4PEEA 1WZAA 3L4XA 4U4BA 2WNWA 1JD9A 2X2JA 2C7FA 3IGUA 2X6XA 2V3FA 1JTAA 2WPGA 1L0PA 1R46A 3DX1A 5DFAA 4UQDA 1AMYA 2OYMA 3QGVA 3BVWA 2QV4A 4URRA 1CXKA 4J3UA 3TV8A 3BVUA 1CXHA 4XM3A 1LWJA 3OLGA 4OJYA 2WVSA 4WLCA 4H8VA 2NTBA 1VJSA 1AQMA 2IQ7A 2EO7A 4ATWA 1XD0A 2ZXDA 4LXFA 3WNNA 4YZ0A 4XORA 2OYLA 3D51A 2OW7A 2PYHA 1MVYA 4AIEA 2O0VA 3BMWA 1MW2A 1OGOX 1A47A 4NXKA 4UOQA 4GI6A 1H3GA 5A2AA 3VMNA 5KEZA 1KWKA 3BLPX 1RP9A 1MFVA 1R75A 4PCSA 3L2MA 4KMQA 2WVVB 5BRPA 3GQ9A 3OLIA 3ZSCA 3HZ3A 3L4WA 4J28A 3HG2A 3KL5A 2F1AA 1JDAA 1U2YA 5I0DA 1QCXA 3AMKA 1K5CA 4LPCA 3VM5A 5CLWA 2ZUVA 3WNOA 3GXNA 2NTPA 3MI6A 1JDDA 1HG8A 1S46A 4FMVA 1QI4A 1O8IA 3TONA 4FNSA 1DHKA 4FNQA 5A6LA 3A21A 4NK8A 3L4UA 1C8QA 1MXDA 1VFUA 2VBMA 4XKVA 1BVNP 3WDHA 5HXMA 2NSXA 3TOPA 3BCFA 3ECQA 2ZUSA 2BY3A 1KWGA 1CGVA 1DTUA 1KXVA 5E0FA 1BSIA 4JCMA 3LXCA 3EJUA 3VGGA 1SMAA 2FHCA 3BAKA 1KCKA 2O0WA 2WC7A 1G5AA 1UD4A 2EADA 4MXNA 5EMYA 2EACA 4GI8A 4W8TA 2VBEA 4XN0A 1CGWA 4UQCA 1U30A 4UNIA 2WSPA 1H80A 2UVFA 4UZSA 4XL9A 4AYGA 3TTYA 3WNPA 2EEXA 1O88A 4AMWA 5C1EA 2ODLA 1QHOA 1HL8A 2X3HA 4XOTA 4XR6A 4JFWA 1O8MA 1SZNA 1XH2A 1RP8A 3BCDA 1HX0A 3A4AA 1CZFA 4H8HA 4HA1A 2NT9A 1VIWA 1BHEA 1IB4A 2ZX9A 3KWXA 1DBOA 4JFSA 4U3CA 2D3LA 1GQ8A 2OW6A 1CGXA 3EDFA 3WEMA 2XVGA 2VRKA 5BRQA 3D50A 3KL0A 3UERA 4H2CA 4HOZA 2ALWA 4XLHA 1KBKA 1MW1A 1V3JA 2INVA 1R34A 3T9GA 3IK2A 3B90A 2YA2A 3A23A 1LWHA 4JFTA 2QPUA 4C2LA 1NOFA 2F18A 5CGMA 2PECA 2OSWA 1CIUA 3HG4A 3EDDA 3WY1A 4U2ZA 2X2IA 3KE0A 3K8MA 4GIAA 3KLLA 4AYSA 1JGIA 1JIBA 2WKLA 4AIOA 4W93A 3WN6A 2VBKA 4XKWA 3RIKA 4JCLA 2QMKA 2Y4SA 2UVEA 4U31A 1O8HA 3GTNA 1WE5A 1PEZA 1R47A 5HPOA 2FH6A 3A5VA 1OT2A 3CZSA 1OGMX 1QI3A 4DO4A 3GXMA 4FLOA 1TQSA 1IV8A 1NM9A 4J3XA 5CLTA 2Y5EA 5DO8A 1IZKA 4X9YA 1ZJAA 3AXHA 3BUDA 3LPPA 1AQHA 3A22A 4PMHA 3LRMA 3LXAA 3CC1A 3CZLA 5E6ZA 2D3NA 3S5ZA 4FNTA 3BAIA 2CHNA 4OJ5A 2GJPA 4XONA 3EJRA 1Q4NX 1UOKA 1SMDA 1UASA 3GXIA 2E4TA 1TQVA 2INUA 1J0JA 4Z06A 1RPKA 1UD6A 1CXIA 3ZSTA 3L4TA 1KCDA 3BUIA 1QPKA 2PWFA 1CYGA 3WMSA 4U2YA 2F61A 4BZYA 4OZYA 2CPUA 3WWGA 4XMYA 1VFMA 3TTSA 5E9AA 1XSIA 1B0IA 1G9HA 1KB3A 3EDKA 2ZX8A 3DDGA 2F7OA 3CZNA 3VGEA 2ZX6A 4BA0A 2F1BA 1MWOA 3WY4A 4OKDA 5E6YA 4AVZA 3EJPA 1M53A 2QLYA 2GJRA 2AAAA 1KCLA 1PIFA 3BVXA 1QI5A 2DH2A 2VR5A 4QAWA 3WFZA 1QWNA 1CXFA 1RWRA 3VMVA 1Y7VA 4TVUA 1KGUA 5I24A 2V3DA 2Y2WA 3BMVA 1BLIA 2X85A 2TAAA 1EE6A 4FLSA 2NTQA 2YIHA 1EH9A 1CDGA 2PWHA 1GJUA 2DH3A 4OJOA 1G1YA 3FAXA 4Z03A 3H54A 3LPOA 1G94A 1JF6A 1UD5A 2G3MA 3BH4A 1JF5A 2YOCA 2WVVA 3BAWA 4J7RA 2F7PA 1HXKA 5E1QA 2QXZA 1XD1A 4OJLA 1X0CA 2NT0A 3CPUA 2Z8GA 3EQOA 3BUQA 3EDJA 2BSPA 3LXBA 3D52A 1UH2A 2ZXQA 1XV8A 4XLEA 3CZGA 2ZUTA 3KEHA 5AMVA 2AMGA 2ZUWA 5F7UA 3DX0A 2D0HA 1GVIA 1TQTA 2O04A 1WMRA 3VM7A 4OZZA 2O1DA 2QMJA 4UQ9A 1HT6A 2ZIDA 3BAXA 1OB0A 3IJ8A 4HPHA 4E2OA 1DEDA 3BUPA 1PLUA 2GUYA 2O17A 3AMLA 3D4YA 3UEQA 3VMPA 4NXSA 2F2HA 4AEFA 4NZJA 1OFMA 1KCCA 2ZXBA 2IGTA 4GINA 1JD7A 2D2OA 3WENA 2FGZA 4I84A 4U33A 1UKTA 1XCWA 3OLDA 2WSKA 2ZE0A 1UD8A 1UA3A 1PPIA 2FH8A 1QW8A 4J3TA 2VUYA 1XSJA 1V3KA 2WCSA 3UCQA 1O8KA 2EABA 4W8RA 1HVXA 3M07A 1EO7A 1XG2A 5TD4A 3KLKA 7TAAA 2FE0A 1M7XA 3BSHA 1KTWA 3GQ7A 3ZPPA 2VJJA 1BG9A 3II1A 1MW3A 4MB1A 3ZSSA 1DBGA 3BC9A 2X6YA 4GO8A 3ZT6A 1I75A 3ZQ9A 4UZUA 1T0OA 3K1DA 5I5RA 1QW9A 3S2CA 1VBLA 1UH4A 3S5YA 4GI9A 4YZQA 4X0NA 4JL1A 3H53A 4AEEA 2YFOA 1KXTA 3LRLA 4W8SA 2BY2A 1QWUA 3FAWA 4NI3A 3KRGA 4B9ZA 1HWWA 4FNUA 1O7DC 1EHAA 3D4ZA 3ZO9A 5I23A 3EJQA 1UD2A 7CGTA 1PIGA 2DIEA 1XH0A 9CGTA 4NK6A 1GJWA 4HOWA 2E0PA 2WVUA 3L4ZA 3UG5A 4XN3A 1PS3A 3B4NA 3W37A 4UQBA
chains in the Genus database with same CATH superfamily
2C9PA 3KPPA 2HUHA 3FQRB 3QFDB 2HWZH 5LGJA 3NEOA 3C6LA 2G2RB 3GSWA 1K4CA 3CXDH 3GI8L 4NRYB 3ILDA 4YDIH 2ZICA 3PGDA 4HWBA 2BZ7A 5C92A 3DVGB 1FH5L 3WEOA 1IQDA 3E8VA 4LLUB 4O2CB 2AC0A 3GSRB 5ANMA 2DEWX 5DD6A 4FD0A 4J3VA 3NFNA 5IF0A 1CD1A 5E2WL 1FG2A 4PJIA 3MNWB 3C6LB 3WTTA 3IWUA 5C0BD 2W0LA 2BHUA 2NX5A 3M88A 3OHMB 5AOJA 1AAJA 2XIDA 4AWJC 3C9NA 1TTBA 4YZXA 3HHMA 1MHCB 2OI9C 2F9BT 2C9UA 2UY6A 4MXQC 5FFGA 3RURA 5E00A 1TCMA 3SDDD 4PJIF 4IRSA 2Z93A 1OFLA 2P5WA 3BT0A 3DSFL 2A99A 1OTTC 3FTXA 4KK9D 5E2VH 4MSWA 2ITFA 3ABMB 3VCLB 3BAEH 3EHBC 1LD9A 5HPMA 3LN4A 5J6HA 1T0MB 5JPNA 4XI5C 3N42B 1GGCL 2H47C 5CNHA 2AQRA 1NCAL 4XNUH 1NMBL 2LAGB 1CGSL 3VG0H 3VXPB 2IG2L 1KTRL 5LAXB 5A16A 4IYKA 4K3DL 1NCHA 5J56B 2P43B 2G75A 2XZQL 3B3IA 4IKIA 4B9CA 3FQXB 1SLWA 2PR4H 4IS6B 1QRBA 3GRHA 4AEHH 1QZNA 5DD6B 5I0WA 3LPGA 4UDTB 1X5HA 1HHGA 2A74A 3VYPA 3SKOA 4PJAB 3BP7A 5I1LA 1JV2B 2QADC 3JWNG 1A9BB 1WIOA 1MJJA 1YUHB 4KO9A 4WWNA 3TBTB 5J13C 1I8IA 3L7EB 1PXZA 4X6DF 3K2IA 3DX7A 3G5XB 2AEWA 1XCXA 1AO7A 2JJTA 3LRGA 3Q8EA 2F8OA 3NRQA 4LKCB 3IAPA 4PJFF 4FXKB 2B1OA 3VG9B 3GSVA 4OLXH 5F3BB 5HYEA 4D3CH 5T33H 3KJ6H 5TE6H 2ZUQC 4ZZKA 5FO7B 4FERA 1D2PA 4HLJA 5J11C 4RA3A 5E1IA 5JHLH 1TNNA 2YKLH 2VNCA 1A7OL 3QB7C 1OE3A 2XBZA 3F7QA 1T5XA 2O6FA 5G5DB 4ODVL 4GAGL 1NGQL 5EF1A 3CN2A 2IBZY 4L4VE 4P06A 2BSED 3D69B 3IMVA 3MBED 3K4AA 1NEZG 1F4YH 2O5ZH 4BXSV 1DLFL 1YECH 3O45A 2OK0L 4WY7L 3HPJA 1BXVA 3RAJL 3L13A 5KSVA 1BN8A 2BIQA 3SKOB 1IKFH 4Q7DA 1ID2A 4NSKA 3NSCA 3FB7A 4QRTB 3TNNA 4ZFFB 4LDOB 1HYSD 3KJ6L 2XWBA 2VJIA 4NKIH 1QFWH 3PJLA 4XWOC 1YA5A 3EOTL 4NUPA 4P59H 5EZIL 2J56A 2CRZA 2EYTB 1F11A 4V33A 3MLRL 4QYOB 1EVTC 1TQUA 4NEHB 2XQYK 3S3DB 4MMYA 3WXVL 4L18A 4AIZA 3BFWA 4MQXC 1P4LA 2BXZA 1Z32X 4RMSA 4N8CL 5EO0B 4HG4K 1OSEA 5E8DL 4UQIM 3BEWB 4X6CF 4HIPA 5LB1A 1QLFB 4XX5A 2EDBA 2BSRB 4Q6IC 5CCJA 1EAJA 3LS5H 4EN2A 1GKOA 1T22B 1MCCA 4FQLL 5CGTA 3BSZH 4NRXA 1JI2A 3BVVA 3PL6A 4UT6L 4EE2A 2ZYRA 1U91A 2D3JA 3DMMD 3R19A 4X6CA 3RX8A 2V5MA 3LZLA 3FQNB 4ZMNA 2WGNB 1MFEH 5A2CA 1SJEA 1XXFC 1MCBA 4LBEA 4TQEH 5CD3A 1IAIL 1CB4A 2YLHA 5KYXA 2BS9A 2CHWA 4RMUA 3JBG7 1UCBH 4RQQA 5J7CC 2R69H 4IIQA 1AXTH 1TT6A 4W1TA 5L2JB 4PS4L 1NDGB 4OLUL 3L5WA 4KWUA 5I19L 4E9YA 1JMXA 3IMWA 4Z78A 4WQOA 2LHAA 3Q6GL 4N90E 5ESVB 5HDBF 4RSVA 5C09E 4QRBA 1ACCA 4R4BB 5GS2D 5D1QE 4C47A 2WNWA 4KKNA 2BIIA 2JCCF 4Z7OE 3PRZA 4P5TA 3BPLC 4F7CB 4ODTL 1I1RA 5AW3B 4ZX3A 1R46A 4JPWL 3F04A 5DFAA 5E99H 4MA7H 3N1MC 4U05A 2YK1L 1GKEA 5GS1C 1PZ5A 4WTQA 4C56A 3E3QC 1CXHA 1ZEAH 3GZKA 3U6RA 2W9EL 4PJ7A 3SQOL 1N6QH 2FQGA 5HHMD 3BT2L 3PF2A 1JTTA 4U1JB 1GAFL 1P4IL 4XPTL 3UYPB 1XF3B 3CUPB 2X4OB 4OV5A 1HQRA 4DP9X 3T0DA 2OYLA 1PG7X 1U58A 4IRJB 1URZA 1S7SB 3BP6A 3FTWA 3V6ZA 2D7TL 3LKSB 2DEXX 1MUJB 3GPSA 4I85A 1OFDA 1A47A 3K7UA 2Y72A 1KPVA 1UXWA 3MN8A 5D1XA 4KXZI 4L8DB 5E2UH 3CVCA 3H6JA 3HG2A 4AL8L 5LDSA 2VLKD 3ULUH 3EUUA 1JYVA 4X6FA 3CFEB 4JRXE 1HIML 1DE4A 1SDDA 3I3BA 4M4RA 1X5MA 2H3NB 4MDJB 2QGEA 2XC8A 3GPEA 2SEBB 5A2LH 1O8IA 5TDPA 4HHGA 3RWDB 3T0XA 3B5GA 4YC2C 5CHNA 1TZHB 3UBXB 3QEUB 4UBDD 2J88H 4EUPH 3DTUB 5C0CA 4MJ6A 1I7RB 2AJSL 2LU5A 4W4OC 1U92B 1BSIA 2X89D 2XV2A 2YR3A 2FT7A 2J1XA 3L3GB 5KBDA 3TWCH 2YC1A 4UZSA 3BH9B 3OR7B 1T5KA 4Z77A 5FR3A 5ISZE 2KI6A 2WB7A 1J8SA 4WUKL 5EN3A 2CO7B 4GSDH 4H8WL 1A9EA 3D30A 3BPLB 1O8MA 3RDTC 1TU2A 2VZOA 4X8GA 1RP8A 3FKUS 3ECBA 3SZKC 3GTVA 1SUJA 3NP3A 1YC8A 5I2IA 1HQRB 2IDCA 2X4QA 2WQXA 5I26A 4APQC 2XC1A 2ZG3A 1THCA 4S1RH 5DMIL 1R34A 4GKNB 3G5VA 5IMOB 2VAAA 4D7BA 2QPUA 3PQYD 4NC0B 4MNHA 3RZCA 1KLUA 2Y7SA 1ACYL 1NOFA 2F18A 3BQUD 2EIKB 2F19L 3H2PA 4HXBL 3WY1A 2O6WA 2MJWA 1E27B 4GIAA 4PV9B 5I17B 2WLYA 1HZHL 1FE8H 4X5WB 5GRXG 3MROA 2V37A 3LIZL 2KT6A 1NAKL 5BVPL 1RLBA 3JWDC 2VLRA 3OG4B 2ZG2A 1RMFH 4W93A 2O6DA 3AGWA 1TQCB 3L3IA 3UZEA 1T83C 2Z7UA 5F2FA 5SWZD 5I1KL 3O3EB 3K6FA 4UTAA 4U1KA 1WWBX 4KRPB 2A5UA 4XMPL 3IDIA 4GRWF 1FNAA 4NM4L 4MSWB 3FPXA 3WAJA 3HN3A 4NZTL 3C8HA 2J20A 4FTVB 1JK8A 5CBAB 3V6FB 5PAZA 3K6DA 4G1MA 2YUWA 4MCYA 2DM2A 4UT9H 5L7XH 1K4DB 2ETWA 4HD9A 5LHDA 3BAIA 4RX4A 3CFJA 5KBMA 3HBPA 2V2TB 2RTTA 3KH4A 3EGSA 4U1LB 2G3XA 2NY1C 1SMDA 5HHVL 3LY6A 2NXYD 1FL3B 1N10A 4DGIH 2E4TA 4ZPVA 4JPSA 5C7XH 4Y9GA 1I7TA 3ZSTA 3F8UB 2WWKO 1EEUA 3SJVA 2XXFA 4LVOB 2ADYA 4UDTA 3QR2A 3PE9A 3JVFC 1FVDA 4PBDA 1NPJA 5DR5L 5DT1L 4CADA 1PNDA 1XSIA 4N2EA 4F8PA 4KZEL 3UABA 4GG6E 5KVFE 3NUKA 1Z3RA 1D5XB 4NWUH 4IIZA 4QXUL 5TH2A 3QJRB 4OCYH 2QQNH 4OFQA 1KYOJ 1PKQA 3C9NB 1J1PL 2PW2B 3C6LD 1KYAA 2AXGB 2CDEA 4AGPA 3QUML 5IY5B 5KN5B 5KSAB 1X9RA 5I15L 3PFUA 1FNGB 3TBVB 3INUL 4JAMA 4U1NA 1JVLA 3OKLA 2FJFA 1N19A 1KGUA 1SYSA 4JN2A 4U6YB 1SOQA 2J4WL 2A9ML 4G1EA 4XZUA 1F6FB 1ZVSA 1G4RA 2OM5A 2CBOA 4L9DA 5BQ7B 1MOEA 1AHKA 1G6RL 1LK3H 5DLML 4OD2A 5IB4B 1VGKB 4H20H 5C07E 3H0TB 4JZNA 3NZSA 1OTSD 5JDSB 2QPFA 1RPUA 4OJLA 2V8MA 5DUBB 2HT4D 2WXOA 3KWTA 3SGEI 3B5HA 4FXTA 5AW8B 3CNKA 3ZYJA 1A1OA 2OJZL 3FFCE 3VWJA 3QXAA 3NMEA 4DGUA 3NYKA 3DX0A 1FL5A 4RGNC 5E8PA 1EEYA 4XVJL 2HJFA 1MI5D 3G08B 4HK0A 1PQZA 3Q3GB 5EZLB 4XPBH 1MI5E 4F9PC 4X4YA 4BZ1L 4GRWB 4MASA 4BKLB 2QSCH 3VMPA 1QBML 5BCAA 4AEFA 4NS0A 4NZJA 3FUNA 2WTPA 1DJXA 4XOBA 4KJYA 1A0QH 1PD1A 4BJLA 2WWOA 4X9HA 1MCOL 5EU4A 2Z31C 3UBXG 5I1DA 4Z3EA 1MVUB 1R24B 4WJ5B 2E9WA 4F33B 3HNSL 4FG2A 2YAQA 3PWJB 3BXNA 3CD4A 5I1EL 1XGUB 5LQBH 4ZUTB 3RUGE 2GBAA 1HVXA 3ZKXB 1F90H 2D3VA 4JZOB 4OGXL 1AFVL 1ZHLA 4MAYB 4MQ7B 4Y16C 4YBQD 1SN0A 3ZDXF 4M1CC 3O6KL 5CGYD 3O4OC 1JHTB 5J6HB 1J88A 3D69A 5I73B 2R9HC 3OMNB 4I3SH 4ZFGH 3VCLA 1CD9B 1TZOA 1LP9F 4JL1A 2C9VA 2J6EH 5LGHH 3BYYA 3PQYE 2Z0BA 4L1HA 3LVEA 3EOTH 1IL1A 3IETB 3EHBB 1F2XK 3BQUB 5D1QA 3NZ8A 3JWDL 3VW3H 2BC4B 4Z7VF 5IVXF 2DIEA 1SLUA 5E03A 3RAJH 4XMUA 4HS8L 3RWHB 4JRYA 3ZMNA 4MZ3A 3V6OC 3EYVB 4AK2A 2A6IB 5DUBA 4M43H 1WDAA 4GBXD 5ES4B 4KNSA 3X17A 4LSQH 2OMVA 5IHZA 4XP1L 4V2CB 2XVLA 3MUJA 4M00A 1E4KC 4XO9A 2MCPL 3SDDA 4F93B 1WAAF 3OKNB 3CZJA 5F8RC 4DGYH 1RZ7H 4Z7VA 4OZHA 3W0WB 2HJFB 3SYOA 1YQ2A 2L8AA 4LEXL 2FK9A 2HVJA 2E5EA 1QRKA 1FV1B 4OF8A 5I74C 4HZLA 2CDFA 2MMXA 4XB3A 2EWEA 2VLRD 1UUNA 2DD8H 4Z7VE 3ZX1A 3HNVH 3QNZA 1JUFB 2B4CL 1G7MA 3K1KC 1BQ5A 4LP5A 3M1CA 1GRWA 5HYSB 1KPVB 4EVNA 1R3JA 3SQRA 4LCUB 2VQ1A 1XF5B 2Z8VC 3MNZA 1J86A 1O8EA 4K8RH 3FQ1A 4NP9A 2VR3A 1ZIBA 1E6JH 4EXPX 1J5DA 5DC2A 2AQ2A 1RIVH 1ECYA 4UINH 1VGEH 5IMLB 3OR6B 4HWVA 1ZCRA 3VFNA 5I30L 2DQHL 2CKNA 2LU7A 3ESPA 1ONQB 1J0HA 2YKKA 1RZFH 3WS6A 3WELA 2DLEA 1PLBA 5F7EH 2CIIA 4FQHA 5C08E 3RWCA 1LDPH 3ZE1F 3QDMA 2PWGA 5ADOL 2I69A 3FFDA 4GY4A 2VFPA 3U6RB 5FHAH 3ENEA 3ILQC 1FV1A 3BAEL 4M8VA 1A7QL 5H2BB 4ZODA 1RK1B 1G84A 4H26B 4PJ7E 1SHXA 1D9KC 2EQDA 5FKPB 3ZHDA 3REVA 4CKVX 4XO4A 3KD4A 2XY1A 1SYVA 3GMPB 4XBEL 2VN4A 4GW1A 2D7TH 5TF1L 1GY1A 2A3TA 2Y06L 3VI4E 5ITFA 5IB1B 1IKNA 2WMPA 4PB0L 3UL4A 2R69A 5PCYA 2ZXAA 4AEIL 4TL4A 4PJ6A 1G7HB 2E6JA 4UOJA 1VFOA 4M03A 4WCYL 4HD5A 1TZGL 2ITDA 3QI9A 4CMHC 2ZSWA 2P8MA 3VMWA 1NM4A 1E40A 4N24A 1A3ZA 3EKCA 2IBGA 2QJDA 3GZQA 4HJ0D 5BMFH 2APWA 1JZEA 3PDOA 4XB7A 1DN0A 2HWZL 3FPYA 2RALA 3TYGL 4ZTOL 3V6BR 3L3JB 4PV9A 3X13A 2R83A 2H7WA 2ZNXA 4P2OD 3U0WL 3FRUB 2JKXA 4L29A 3FN0H 2O26U 4GAYA 1ZHNA 2WY3B 1P1ZB 3H55A 3LYCA 1XCTB 2BFVH 2WCGA 4GO9A 3HE7B 3AREC 2UY7A 4HUNB 4PJEF 4WCYH 3AQYA 4JL2A 1E2ZA 3NZHL 1KOAA 2AP2A 5IV2B 5F7KC 4WI3A 1YEIH 3SE9H 2Q8BL 3DIDA 3FHEA 4QRAA 2WTRB 4ANWA 1KCUL 1NC2A 3UAEA 5D4IA 1Q90A 2JQAA 4DESA 1ORQA 2XN1A 5JXEC 1S4IA 3UMTA 3JVGC 4KX8A 4ZXBA 1CT8B 4XP9L 1XGYH 1WC7B 2JXMA 4KKBC 2VZUA 2Y25A 4XMKL 3NRPA 1J0KA 2WNXA 3HMXA 4TUKH 5C1CA 1M1SA 5HI5D 3UW0A 3ORJA 4I8DA 2R0KL 5DJ2A 5HI4C 1OVZA 4IRZA 5D7KD 4DO6A 4NKDB 1V7NL 2WKOF 3FBQA 5D7KE 5DJXB 5MEQB 1IQWL 4P57A 3QDHA 1HCVA 2APBA 4OIFA 3QXDB 1UACH 1UM4L 5GGVY 3LHPH 5IVZA 1N0LB 5TDNB 4A7QA 1JF1A 2VN5A 1Z5LA 3MR9B 4RCAA 5FYKE 1CI5A 5DUML 5ESQA 3CK0H 1YPZA 5B38B 2WXFA 1AY1H 2VIRA 3LNGA 3OB0K 1FYHB 4HCFA 5FYLE 1VGEL 1QFWL 3LEYH 2WNGA 3NTCH 4HIIB 4C4BA 2J21A 1CDIA 2FZ3A 4ZMOA 3OKLB 4U6YA 4RRPM 4U1NB 3Q1SL 1KB5L 3FN9A 4LEBA 4ANUA 2YMTA 2DYPA 5EORH 1HK6A 3NJKA 3O8XD 1INDL 2IFGA 2EP6A 4WHYH 2N7AA 2YGPA 2NLJA 2E27H 4QTIL 1N7ML 3GRWH 3OXSB 2RACA 2R1XA 3OJMB 2VLLA 2F74B 5CP3A 2WYTA 4DT2A 1CFBA 3WHE1 2YEQA 2K7PA 1DBML 3GS7A 1Q9LA 5B1CA 1AHMA 2MHAA 4M1DH 3OZ9L 1ZKAA 2X1OA 1IE5A 2W65A 2ADGA 4PPTA 1X5JA 1FNFA 4TNVF 4HIHB 3QS2A 4BKLA 3ARBB 4N0YL 5AVZB 3WJMB 1W8EA 2ZONA 4EDWH 1RP9A 5I8OL 3VTMA 1DQDH 1R75A 4O58L 3RBSA 3OHXA 2FBJH 5KZCD 2XTYA 4CC4A 4CVXA 2F1EA 3QH3B 2QT6A 5FUCE 4YVNA 1ZGLA 1DEEB 3T0AA 1TTCA 1QBAA 1N8ZB 4O02H 4IGBA 3VFSB 1LO4H 1AKJD 1IEAB 3F85A 3UYRH 1SXAA 3QUYA 4LSRH 4EI5A 4FNSA 3O9WB 3A21A 1RUPL 2UZIH 4NNPL 3MXWL 1YJDC 2UYLA 3VXTA 5IUCA 3LHAA 4N86A 2ZUSA 5I71C 1CR9H 1I3VA 4OF6A 1B3JA 5HVWA 2Z9TA 1HJCA 3EJUA 1OSPH 5IVXB 3B2MA 3FDWA 3FH5A 2NNXA 1PX4A 2GTZA 5DK3A 5GZNC 2OLDA 3EJYC 1CL7L 1X6NA 5ITBL 1L9RA 3IPEA 1N0XL 1NFIB 4LHJB 3MV8B 1CGWA 3MLXH 4EIZC 4F8OA 2LTQB 2O5XH 4MNQD 4YZFE 4Q4IA 2BP5M 3ASOB 1IAKB 4P9HL 1CGSH 5D1XB 5BOPA 5C1EA 2CUAA 3AG4B 1RURL 3P0VL 2R2HA 3ZKMC 4NWTL 2Z64C 4D0DB 4PLNC 2GPZA 4Y2DC 3PGFL 4GJTB 3K74B 4JFSA 2AQ3A 1DBOA 4K9EL 1J9SA 2COQA 2HKFL 2V17H 4I0CC 5DEJA 3ES6B 1YQVL 1JZ4A 1XXDC 3L3IB 4FYRA 3QNYB 2YA2A 1KN2L 4JFTA 1EHLH 2BM6A 4AZ8B 4GFTB 3L6FA 2E74C 3B7SA 2BNRB 1QWHA 4QRRA 4HGWB 5T5NF 2F8VA 1TEFA 1NCNA 1DBJH 1DSFL 3B56A 3OWRA 4XPAH 4XAWH 3V0DA 4F7PA 5LVEA 2C9RA 1KCRL 1AJ7H 2OI9B 4HWNA 5EB9A 5K33A 1VACA 4MVBD 5I75B 1K8FA 2EECA 2XKSA 4HJGA 4R4ND 1MWAH 2J43A 2IH1B 5EOCL 4YDIL 4U31A 4OD3L 3TJEL 5HPOA 2VW6A 3VD1A 4HUWA 4NO5A 4HK3N 3CZSA 5TF1H 3VD5A 4XVOA 3U7AA 3B9KB 4L1SA 2VXQA 2VDOB 3IJYB 1WWAX 4ZO9A 4U3XA 4GBXB 2FDBP 5D6CA 2VOTA 3PHOA 1QYGL 2OMTA 4HGMA 4NWUL 3CZLA 4TNEA 1F4XH 2ICWJ 1FA4A 4MJ4A 3OAUL 2J55A 3U4BH 2Z0UA 1CBVH 4YHNA 2V5SA 5D5MF 4WSGA 1E9OA 4ODWB 1ZS8A 3QVAA 4JY6B 4L23A 1W72H 5C7XL 5JQHC 1UD6A 1QEXA 1EZSA 3O8XB 3B2PA 1KCDA 3BO8B 1A14H 4WI7A 1DL7L 5EO1B 2VN6A 1RXLA 4XMYA 4HGKC 2N4IA 4DSYA 1RU9H 1WVZA 3VDBA 2B1AH 3V95A 4AENB 2F7OA 2WXGA 5JIKA 2YAEA 1V7ML 3V5HB 1LEKB 4M8QB 5F9AC 3T0EA 3I02A 1Q9OA 2H2SD 1TO5A 3VXNA 3TESA 2XQ0A 3BO8A 2P80A 4NM4H 3PXLA 5DSCB 2VR5A 3GMRB 4E0RA 5HGHA 5D96B 2BNRA 1U3HB 2A9NH 4FFYH 2HFFB 4XCNA 4B0MM 5LJYH 4PRAB 3KWWB 4JM2A 4DIXA 4X6BA 4PBVC 4DKAA 1MPAH 3BH8A 1IBGH 2VTFA 2Y07L 4IW4C 2ZSWB 1KJ3L 3D3VD 2G3MA 4JO2L 4R0LC 1RUQH 5FUOH 4M3JA 1MFCL 4EKJA 4UAOB 3ZQWA 3U2IA 5IBLC 3D5OF 2XY2A 1XEDA 3H3BC 4NZRH 2VC2L 1CFQB 2BSSB 4B27A 4G2AA 2QKIC 4ZX5A 3T6WA 2WYHA 1XV8A 4F24A 1E3FA 3WEAA 4TULL 1UB6B 1XF2B 3QRFM 2APXA 4WU7B 1DQVA 2HT3C 4J3OG 2FO8A 4IHOB 5DDHB 4QRRD 1M4KA 4E2OA 1Q72L 3HA0A 1QLEB 3MJGX 1NH6A 2ADIA 3TBTA 5I6XC 3S8GB 1KSRA 1MNNA 2EDRA 1TVHB 3S88L 1PZUB 3QUMA 4GINA 3GLZA 4X4ZA 2LQRA 3BWSA 1A14L 1TFPA 4M61A 1UKTA 4QWWD 3OLDA 1NTDA 4UM9B 1LGVA 1TZIB 3L9RB 4AQ8C 1UA3A 5IG7A 1H6UA 1BFVL 4J3TA 3FB7B 3TNNB 4ZFGL 4Y19E 1H8NA 5CEYB 4CJ0A 2WSDA 1A3RL 5E0QA 4CNIA 1DQMH 5MEQA 4FGMA 4AVIA 1WYJA 4OZGB 3RBGA 3G5YA 3UJTL 1G7QA 1ASPA 2XFXB 5I75C 4JUTA 4YGVB 5AKVA 1VBLA 1NIAA 4P46B 3OG6B 1P9MA 4TM9A 4GI9A 1OAKL 2CD0A 1YEJH 2A83B 2BY2A 4AGOA 1HWWA 1SXZA 2FUQA 1MCQA 4LLVA 3GZPA 1MREH 1FZMB 4LO9A 4HCGA 4KHTH 3QORD 3R7QA 5JW5B 3MBEB 5L0QC 1DBJL 4XPAL 4KJQC 1MNUL 3DBSA 4D0CA 3TZVD 4Z95H 1NCDH 1QJVA 4LOVA 3SCMD 1NBYA 4LF3A 3VU2A 3WI9A 4JGMA 3VGFA 4QOKD 4CW1B 1A9BA 1WV7T 4HZAA 2GVYA 2CWRA 4HWEH 1JGLH 4BD4A 4OD3H 5AKRA 3TJEH 4ESKA 1BBJA 5FAAA 1N70A 2DWSA 4A2GA 4YDTA 5IB2B 3OKMB 1AG6A 1KBVA 2CNZA 1IGCL 2VXVL 3K5SA 2NMSA 1MW0A 4PP1D 4ALAL 4JFPB 4BFIB 5LBSA 4H20L 4LHQB 4ZOCA 3ZT5A 4KDTA 3B5TA 3RPIB 1DSFH 1OGPA 1OT1A 4LPUA 5E99L 3L2LA 4NGHH 4DKEH 2F6AA 4FYTA 4G7YL 3IDGB 3MRQB 5EF0A 5GS2H 1I1CA 4DN3H 2VITB 4N87A 2X6MA 4ETQB 1HL9A 1QX1A 3CFCH 1GA2A 2P5EE 4RFOL 3OJ2C 3AITA 4EPSA 5C86A 1IBDA 3K0YA 4NO2B 3FRUA 3UZEC 1T83A 4AVHA 2QVFB 1O8JA 3QDME 4OR1A 1IB5A 5LUMA 1EJOH 1T7ZA 5AVVB 4Y19B 4F8LA 2WUBL 2LGNA 5HYSG 4WTZA 3US1A 2X0VA 4Y4FB 5JO5A 3UTZB 5JW4M 1YEFH 4K3JH 6PAZA 4ZMLA 1KXHA 1RUPH 4L9LB 1C8PA 2R1XB 1FNGA 3TBVA 2G9HB 5C0AB 5C0ND 3ZT7A 5HYQA 4N2FA 3FOMB 4PJDE 4K94L 5D71H 5MI0B 3N50A 1TYEB 2F7RA 3QZPA 3MA7B 1JUFA 4FHJA 4UYPA 4Q52A 4OTXH 4LHUA 2WO2B 3IFPA 4TPRL 1NCIA 4TTDC 5IB5B 5CAYB 4KKLD 5B39A 1NMCB 3I9IA 4AM0Q 1U8NB 4QYAA 8FABB 3HS9A 3GJEA 1BFVH 4OLVL 1Z9LA 1ZA3A 3U6XA 1C5DA 3KMDA 3MNZB 2A0LC 3QJFA 4TLUA 3T1FB 3CLWA 3VWJB 3EXJA 5B7FA 5A40E 4H1LG 4ZSOA 5B4MD 3TGXA 1YPZB 1DVQA 1R19A 5DRXB 1HDMA 4K07A 2ZP8A 5C0JA 1N0LA 3QPKA 5E9DD 1AP2A 1Y18B 3G5WA 4FNRA 5DHEA 4PYGA 1Q1PA 4JUSA 2BZCA 4W9EC 1O8GA 2VERA 4KROD 2XLLA 4K3GA 2R7EA 4NQVA 1WZLA 1QFWM 4HJJL 3WIIL 4ETQA 3CSBA 3DHPA 1NFDE 3QJFB 4LCWD 1OEZW 3H9SB 4ZUUA 5KAQF 1F3DJ 1X5XA 2WTRA 12E8H 3C5ZB 5EIQA 3ZDXE 5GISH 5GJTL 3IXAA 2YKLL 1CZ8L 2C3VB 4G8GD 4D9RE 4DGVL 4MA3B 1EO5A 5GS0L 1FG9C 4QJ3B 3A4DA 2VDKH 3DOHA 4P2RB 1Q9WA 3QEQD 4ONHB 1FCCA 5T1KA 1ZWIA 4N0FB 1UH3A 2OP4L 3NPSB 4F58H 5AYUL 5LG6A 4R96A 4X2UA 5IHBA 1GTNA 5IEKA 3DIVA 3CBJB 2PYED 1XGZA 2LTQC 4CVZB 4M7JL 3S4SG 3RY5A 4XBMA 3FH7A 3EGSB 3QQNA 4XC1H 2QX3A 2XT2A 5KS9F 4TUKL 1OGSA 3HJEA 3MRKA 3NTCL 2Z31A 4XNXH 5HDBE 1RSYA 5BV7B 2PO6B 4JLRB 5EPMA 3ZJAA 3ZMRA 2BIMA 1AY1L 2Y2TA 2CBPA 2EYRA 3GBLA 2LABA 1RMGA 1IM3B 5C0FB 3J27A 3WKNA 1SXBA 3QWRD 3GI9H 3IVKA 5A6MA 2FBRA 1S5IL 4NAJA 3RNQA 4F5CA 3QZOA 1JPST 3HVNA 5E4OA 2DM3A 3KL3A 1ND0B 5DK2B 2E6QA 2DI9A 3GB7A 3V4PA 4I89A 1QBLL 1CFNB 3DDFA 3ZR5A 4KPHL 2NZIA 4HUXA 2WQUA 1DLHA 5LO7A 4XLCA 2Z91A 2VT0A 3O41A 1WEJH 4XNZB 4DPCX 1OKEA 3PNWB 5I18H 5BUAA 1OPGL 2OBGA 1G1OA 3QWQB 5IEKB 4PJ8A 1J8HA 4X98A 4F27A 2X2JA 2V5IA 5DYFA 1G87A 1TXKA 4M6ML 2GSGA 2WWMC 2N1TE 3DBXA 4HJUA 3ARFB 3HB3B 2WJ7A 1DUYB 1SVBA 1B9ZA 3EOAB 3H9SE 1SGKA 3VVVA 3GUTB 5IJKC 1MQ8A 3PL6D 3CZFA 5IMMB 1BX2B 2AEQH 1I1FB 1A1OB 3D08A 3UTPD 5IHWA 1I31A 3N2JA 2WVSA 4IRZL 1Q9WB 1OGAE 5T1KB 5IOPA 1WGOA 3UJJH 4KO5A 5J1TC 4RMBA 3RHWK 5HY9B 1UB6A 4JPWH 5FEBA 1QFHA 3DV4B 3EJCA 3L3HB 4YS4A 1FYTA 3TYFA 4X4YB 1GXEA 3VMNA 1TJXA 1BG1A 4JFHD 5EZLA 1LP9B 1LL1A 1SF3A 1ZLWH 1MFVA 5MERA 2GJ6A 2VYRE 4RBPK 3GO1L 3OLIA 1F0LA 1PLAA 3KL5A 3ROOA 4PTUA 4K9EH 4LP4A 5EZJA 3G04B 5FYKU 1XTMA 4R97B 4MRCA 5HGHB 1GH7A 2W5PA 3H42L 3INOA 2AK4E 1JCKA 2VDMH 4HDIB 1NGYB 4ZUTA 4Y7OC 4HUVA 1BVNP 4FL4B 3EGDA 3WDHA 5HXMA 3NIDB 5AWNH 3ECWA 3BCFA 4EN3D 4BK4A 4Z7AA 2H32H 3VYOA 4XHJC 5FW8A 1JGEA 1XZ0B 1CICA 3GBNH 1G9ML 3HZYA 1WT5A 3R7RA 1ROCA 2VXUL 3MCLH 2WC7A 2OTWA 1G5AA 1NLBL 4GKSA 4S1DC 1EZLA 1Z9SA 5EC1B 4MLIA 3QUGA 5AOIA 2FWUA 4N2DA 4J1UA 4M7JH 3QE5A 3FQTB 3PHQA 1IBFA 3WNJA 1AGBB 2W59A 4J3OD 4PS7A 4CSSA 4TRPL 4ENEC 2IANA 3BD3A 5I76B 5JYMA 3MJ6A 1NCWH 1ZK9A 1OF0A 4JO4H 3DUHA 3ZTNH 3BOVA 4WUUB 5I6XB 1FO0H 4U3CA 4U6HA 2AV1B 3N44B 2HVBA 4XX1E 5T1JA 4KI5E 1IKNC 1KBKA 3DSNA 5EA0L 5C08D 1WF5A 5TPWL 4XMTA 1ETB1 5F1IB 4UV7L 1ILSA 4C2LA 1SEQH 4N1HB 1F11B 1ITBB 4OIIL 1T1WA 2H26A 4HJJH 4QAMB 2X2IA 3NH7L 5EO9A 3LDBC 3EOBA 2FB4L 3SKNA 4N68A 2DD8L 5ISZA 4DTGH 4XCEA 4QTHA 3ZZ1A 2P24A 4NNYB 5F97E 1L7IH 1CFMA 4NSKB 4XN9A 4LEXH 5DWPA 4QCIA 3T3MB 3QS3A 1FNHA 5GRWA 1WUNT 4AITA 1O8HA 4CJ1A 1EXGA 5I0XA 4M5ZH 3Q2VA 3ILPB 3MRLA 4NQDA 3FQYA 5DD0L 4UT7L 5IESL 3O6KH 3HC0A 1Z1WA 5JOFA 1AQHA 1N4XL 3LRMA 4I2XE 4UNTA 5C1MB 1FL5B 3EFFA 3H1ZA 5E6ZA 1IRAY 5KTEL 1NUGA 3CFBB 4OUUB 1F90L 4FNTA 5EIVA 1G7IA 2CHNA 3ME0B 1FDLL 4ZXBC 2YPVA 3GIVA 4PJEA 4ZG1A 4M7LH 4Y4KA 1U41A 3UTOA 2CO4A 4JFDB 1QPKA 4GYBA 2NY1B 1TVDA 2CBMA 4EUPG 2CPUA 3US0A 3WWGA 5T1LB 2B59A 3QORA 1G9HA 2IAAC 3OMAB 4E9SA 3FU9A 5BOZG 5KBKA 2QSCL 4HSQA 4YNYB 1OTUD 3WXWH 2VFQA 3EJZC 2NY0B 2BNQE 4PJEB 2BRRH 3L5XL 3G5YB 3DSNB 3S8FB 1FJ1B 1X7QA 1X9UA 4UT6A 5C71A 3M8OH 2JCCE 3CFTA 4ZUVB 4ZAKB 1LNUB 1CC3A 5I24A 2ITDB 1EE6A 5FOJA 4EZMA 5JOFB 3V8OA 1GJUA 4FFZL 1NANI 1XGPB 4P5TB 1J8HE 4GEIA 5DVPA 3OAYK 3HIZA 3L1OL 3IU4L 2F7PA 2NNFA 3T3PF 4B9GA 1ZGLP 1E4WH 4WENB 5I6OA 3CZGA 3FN0L 1KCSL 1PZSA 1QABA 4Y4HB 2E86A 4C83B 1YRKA 4DN4H 5IIEA 1ZIAA 4AVKA 3HG1A 4AI7A 1Z0NA 4OZZA 5BMFL 1NGWB 3PWNA 5FYJE 3MA7A 5FDYA 1OB0A 3D2UD 2QQNL 2MKWA 3Q9QA 1AGCA 4OM1L 1BEXA 1ZWIB 3II3A 4N0FA 4NXSA 3IWVA 5BVJB 2F2HA 3LSOA 3MCKB 4P8QA 2JSFA 3S35X 3I75B 1KCCA 3P4GA 1KNOA 3I9AA 3T3PE 5HYJD 1YMME 3HHSA 3I74A 4TMPA 2J4WH 1AD0A 4U33A 3NESA 4Q6IA 3BZEA 1U8CA 4YXKL 3SZ6A 1HHIA 2FQFA 4JM2B 3T65B 3FB5B 1JZ3A 1FZJB 2OMZA 1FAKT 1TZHA 2EEBA 1D5MB 2QZQA 2Q3ZA 3IBEA 2EDJA 2BM7A 4EI5C 1L0YA 3MFGB 3IPFA 1Y1UA 2BIHA 3FXIC 3K2UH 4TSAH 1YCSA 5LBSL 5A7BA 1L7TH 2AEPL 3RNQB 4GO8A 4M7ZB 1QOKA 4QHPA 2C9SA 3PWUA 3ZKXC 5F9OL 1ROWA 3VWKC 4BQCA 3ZKQD 3QXDA 1GZPB 4L3EA 3VD0A 2BNQB 2M2DA 1FNLA 2ZOUA 4N2MA 3H53A 4PJEE 3FSWA 1S9VB 2YFOA 4Z7IA 1I9RL 4EEEA 3P3YA 4J39A 3R8QA 1MHCA 3MLUL 3N43F 3BKJH 3MBEC 4YN3A 5L0QB 3FU7B 4A6YB 3QC6X 1UWGL 4RMTA 5F9JB 3UFIA 4MJ5A 1QUPA 5J89A 2F0CA 9CGTA 5ETUB 1E67A 1VLXA 5MENA 4NRXB 4N2IA 2VDRL 4KAQH 5AL0A 4BFIA 5IB3B 1J8HB 4X98B 3MDJA 2WP3T 1BM3L 2WXKA 2YD0A 1ORQB 3MUY1 4XC1L 2Q7YB 3UOAB 3EZ8A 3L9BA 3SDXA 3EYOB 3WKYA 4QNPE 5KJRL 1FO0B 4I48B 1G7JA 4Q9CA 9PCYA 4Y2DA 2A73A 3ETBF 2XN2A 4BM7A 4S1SH 2J7LA 4NPKA 4PGBB 5AUMA 4NERA 2HKAA 1YLBB 1PZ3A 1Y1DA 2OP4H 2YZ1A 5B21A 4F58L 4YMPA 1GHFL 1MFCH 4KK6D 5DJ0A 5EBLA 5EU5A 1CG9A 5B8CB 2NW2A 2H32A 1U3YA 4MZIA 3SQBB 1HZHH 3UTTA 5FGBA 4FTDA 1UXLA 4BGLA 5D93C 1IBBA 2IWGA 3HG5A 4XPFH 2R7EB 3QPXL 4NQVB 5DTFB 2EIZB 2CLRA 3F6LA 5HGGS 4PWKA 2O61A 3IJHB 5IHUL 1ZHLB 3VA6A 1FHGA 5KSBE 5KS9E 4XMXA 2FLMA 1AC6A 2NNAB 2KZWA 3TVMA 1PG7W 5B3NA 3TH4T 4M43L 4P5TD 1NL0L 3MREA 2CE6A 1AZVA 3B83A 4HS8H 4PRID 4XNZC 3FT9A 1A4KB 1IIIA 1KXVC 3IJ9A 2W81C 1RJZA 4ONHA 1WZKA 2BSTA 1RUAL 3IB4A 4MRBA 2X2YA 4BZ2L 3FTVA 2ZWZA 3PSZA 3WIFB 1FFNA 1MIMH 1FFQA 2F08A 4UTBH 4TSCL 5IVXA 3L4VA 5KVEE 3SPHA 2DQJH 4ZS6C 1Z3GH 4GP4B 4S1QL 4ZK8A 4Z76B 5IQOA 1SXNA 4U49A 2OYKA 1B2YA 1T2QL 2NRDA 4BRVA 4JY5L 1KENH 1E65A 2GITB 3BKCH 3LNEA 3IDJA 4I9XA 3RZWA 5L9DH 3Q1EA 4HUKB 1BA9A 2VW7A 1YN6A 1BOGB 1CPUA 2Q3AA 4TSBL 2PO6A 1F4HA 2PR9A 4I0PB 1LHZA 4ODSL 3LZRA 3VXSB 1OP3H 5FX3A 5J1AB 4ZDHB 3NN8B 5J1SC 4OFYD 2NY0C 3CGTA 3AXLA 2DLGA 3GSUB 4IMLB 2BJMH 1EFXD 1QLFA 1RAMA 1G6RB 4OW6A 3SDCB 1KCRH 3MNWA 1UOVA 3GS4A 1XR9A 4EI6B 2NY3D 4ELDA 5KZCB 3VFTA 3IBOA 4FG6D 4XBGB 4PGCA 1BXUA 3FO2B 3M8OL 5TE7H 5G4OA 3CX5J 5JW4Q 2I26N 3KPRD 4MQSB 1KN2H 4R0LA 4DERA 4YHML 4WK0B 3WTYA 4PG9B 4FRWA 4S0SD 1AO7D 5AVYB 3HMXL 3LKRA 4UBDC 3L9RA 2NY6C 3KS0J 4WDIA 3LKQB 3OQ3B 2V17L 2CXGA 3SPJA 3TV3L 2AFNA 3QFJA 3VGHA 1NIFA 4HAKA 5GGSB 5E4EB 3IU4H 1J10A 3GT6A 1IGMH 5C7ZA 3P0GB 3JTBA 4NZUL 5CD5C 2R0ZH 1U21A 3IFNH 4M56A 3FQWB 3B1UA 4KJPD 5IHZB 3ABKB 4WWKC 4FF9A 4QRTA 2WJ5A 2ORBH 2FX8H 5ANME 4G71B 5ITBH 3RDTD 4TQIA 1S7UA 2JIXB 2BP8A 4X4XB 5AAMA 2PP8A 4M5SA 1S7TB 2GJ6B 3IDMA 2GITA 3NT0A 4Z7OB 5L2KB 4H8PA 2VW4A 1VKXA 1SY6A 4X5QA 5EOQH 5JNYA 1MCDA 4GT7A 3I6LD 3CAFA 3OPZH 3FO0H 5J6SA 3U0PB 2UZYB 4GQZA 3I50H 2NZMA 5I82A 1V3MA 2BOCB 1FJ1A 1BBJB 2VDPH 2FB4H 3BPOB 4LGPB 2Q5BA 3ECVA 2Q76A 1EAQA 4YDJA 1SLVA 2UZPA 2ARJQ 4QNPF 5D7SH 4YSDA 5EDSA 4WY7H 2QV2A 3F12A 2GBTA 3QXUA 4J2QA 5H35B 3H9YA 3ARYA 4A04A 4GG8B 3VXQB 5DD0H 1KEGH 4NZTH 4ODUB 1WFNA 4OCRL 4YEIA 1E9PB 1IE4A 4PJHA 1CI3M 2RQEA 4K7PY 5IMKA 3GKWH 3SO3C 4ZFQA 4HVBA 3GSWB 3KHQA 4JRXB 5JIIA 3SY2A 3QGVA 5JW4R 4JHAH 4MNQB 4OVVA 3KPRE 4QXTB 2E9IA 5H37G 1VJSA 3S88H 1TYXA 4L1TA 3PWPA 1XD0A 2Y5TA 4YZ0A 4ZT1A 4O2EA 1V27A 4GP5B 1QNZH 1X4XA 1HNGA 1FQ9C 1M42A 2JKTM 3X14B 1NFDA 4C59B 3ZN6A 1MHHA 5FA4A 3ALWA 1MF2H 4GI6A 3RU8H 3HRZA 5HSFA 3L45A 4R6UA 5I66B 1ZTXE 4PCSA 4A67A 2LVCA 1JHLL 4JJ5B 4L4TA 4OAWA 4R97C 1DBKL 2DJUA 3HZ3A 2IGLA 5DFWH 5F0JB 3SGJA 3SDXE 5CJ8A 3B6SA 3FONB 3HHSB 3FTSA 3KCPA 4X5XB 1KNOB 4I3GA 3KG5A 2DI7A 3X14A 1N67A 4WRLA 2CBQA 5LNGA 5ISZB 4ORGB 1ZV2A 4AQOA 4P07A 3H42H 4RRPA 3L4UA 3OGOE 3MOBL 2GJJA 5ALCH 4Z7UF 2YPLB 5HI3D 4JQVA 2BOCA 4K23L 2YOAA 3ZKSD 5F71A 2WB1A 1KELL 5ABDE 4P46C 1QBBA 5E0FA 4J2XA 3VWJD 3MXVH 1DJZA 4AV4A 1BQKA 1XR8A 5IFHL 3C09B 1FZKA 1H8OA 3TIDB 5HJDA 1RV6X 5GGRY 1OTSC 3T0WA 2X0UA 2ZQKA 2WO4A 4Q56A 5ID1A 2YAFA 2VBEA 5EU3B 2A77L 3CSFA 4JN1L 4ZRGA 4WFGD 2BCKA 3IJEA 3F58L 3NEXA 2K4AA 1XMWA 2HVKB 4NBYB 3QQDA 4M3HA 1KPRA 5JHDA 4XR6A 1OARH 5CLZA 5DK0A 3NFPA 1HHJB 4Z5RA 1OSZB 2HLFD 3ROLB 3M1BA 3WFDH 4GRLC 4X0KB 3POHA 2D3LA 5C6TL 2X4TB 1SN5A 2X70A 4HKBA 1VADA 3QO1A 4KXDA 3UERA 3O2VL 1AE6H 3I6KA 3ZGHA 2C7UB 2LU3A 2ZSVA 3T9GA 3ULUF 5DA4A 5D70L 4BWWA 5C6WH 3IFOB 2DQDL 2PPFA 3Q8BA 3VFGL 5DC9B 4CVUA 3HI1A 4YXHH 3HG4A 1IBYA 5BZDB 5T5FH 3TJHC 5KJ4A 4KVNH 2YS4A 3EYQC 3SDCC 1L9PA 1BYPA 3ZRFC 3PAUA 1KIRA 1RVFH 3QCTH 3AROA 3LEXA 4NDMB 4V11A 1ML0A 2ZPKL 4Y2LA 5CCHE 3ZIMA 4G6AD 2WGXA 3CQQA 3OC8A 3RIKA 3T04D 2R0WL 2F8IA 4I1RA 5C07A 2WN2A 4QO1B 1J9QA 3ZDYE 5DWUL 1R47A 4H5SB 4YE4L 3IGLA 1E5ZA 1T4KA 4NQEA 4O4YL 3FHAA 4GSRA 5AQ0A 3ULVC 3O2DA 3VFGH 2J8UE 3GHPA 5DJZA 4J3XA 1SJMA 3NJVA 5E9DE 1YNLL 1N64L 3CDFA 1SMOA 3P0YH 5I8KH 5IT2L 1E4XL 3KDMB 1HILA 1UCBL 5AAPA 2PP7A 4UQ2A 3OR7A 4Z77B 1KLFA 1TQVA 4H25A 1N2RB 3FB6B 1GPOL 3BN3B 3BUIA 2ZAGA 4BSWA 4BZYA 2ZCZA 3E38A 4RGOH 3GJFB 1ZXQA 1U8LA 1SNRA 4NKMA 1HHIB 1AZCA 2NUTB 3S6CA 4YHYB 2P1YA 5F0PB 4GQ9L 4I0PA 3ZE0E 3T6QC 1OP5H 5D72H 4LU5H 5GSVA 3RGVC 2IF7A 2GJ6D 2Z8SA 3K4ZA 4V02C 3LH8A 2QLYA 5D7LB 1H5BA 4IU2A 4I2XA 3TA3C 1OALA 1YYLL 3BMVA 5FF6B 5A2KH 4A39A 3UH8A 5GGTL 1I9JL 1AS7A 2B4CH 3MBWA 4OIBA 6FABH 1P5VB 5GJSL 4Z7NE 3KDMA 5C0AE 1E7VA 5C07D 2VABB 4P9HC 3PGCA 4G8EA 3ME0A 1PZBA 3DUUB 3QO0B 1NPNA 4OJCA 2X9ZA 4OLVH 2EEFA 1MLCA 3EDJA 3MLYH 2UXTA 1D7BA 3CXHK 5GISL 2ZUTA 3MUHL 1F4YL 2Y3NA 2BSEA 1GGBL 4K9EC 1OAUH 4EDWL 2I9LB 1GGUA 5I8OH 4K5MA 4OD1L 2IWEA 2VFMA 1KGIA 2X4OA 4OV5B 1DSWA 5HHQB 1WMRA 1WZ1L 2EDXA 4L4TD 4PGBA 5AUMB 2NDGA 3NK4A 3P30H 4UOW0 1M9WA 2OMZB 3DJTA 1RI8A 3LNDA 2O17A 1FI8C 1KBPA 1TNMA 1VDGA 2V5RA 2GY5A 4GAJH 4H88H 2IGTA 3T2PA 1I1AC 3ZZSA 1YEFL 3EO1B 3GIZL 2NR6C 1IEAA 1GZHC 2R2BA 2VXSL 2FH8A 5KG9B 4X80H 1XSJA 2DICA 3MRMB 2DKMA 3R06A 1O8KA 2DEYX 5MEND 1G7PA 1A6WL 3MCG1 4DKFL 1DJGA 2Z93B 4I18C 2QVTA 1OOWA 1AQDA 2XV0A 4Y5XB 4IK6A 2FWOB 5CO1A 4IRSD 3BC9A 4ODHH 5TDOA 1AKPA 3D0VB 3FSZA 5CJOL 3RPBA 3AUVA 1GMEA 5ELIA 2J8HA 1JMZA 1I9EA 5E7FA 4W8SA 3K2MC 4NI3A 3LHPL 1PD0A 7FABL 3KRGA 4K3JL 1MZZA 5D6DA 2LR4A 5AW1B 3K72B 4Y4HD 2OS7A 4ALAH 4HKZB 7CGTA 1XT5A 4AG4L 4WU5B 4HETA 5IQNA 3HR5A 3WD5L 3VFWA 4S11A 1A8JH 2NTFB 5HDBB 4WW1A 1VF5C 4APXA 3O6FB 1MRCH 3PV6A 5IQLA 1NUFA 4ELMA 3X1GA 1A4JA 1UZ8A 5C0BE 4LHUB 4HAFA 1M56B 4WO0A 1EZGA 1UKQA 4QTFA 5F1OB 4HFWB 1FYTE 3BWAB 4HIJA 5E2WH 4FFWC 5D2LB 1JCVA 1GCYA 4QRRB 1F58L 3MFFB 2F53D 4M9OA 5DUPH 2JCCA 2V3EA 2VLRB 2H0JA 4QHMA 5CN1A 4TSBH 1O8LA 1QSZA 4N1EA 4MMXA 5E6IC 2AEOA 2XVKA 2ZUUA 4DUVA 5DEFB 2BWQA 2WLHA 3O2DH 4O51B 5FWRA 3GUTA 2C26A 1XSOA 3HC3L 3INUH 2FT8A 1MXGA 2QDWA 5TJWK 4ICWA 3O0RL 4RGMC 2GUOA 3SDAA 4PFEA 3QIUD 4HWBL 3HUJB 1N5YH 5HDQH 5DRNA 5I1IH 2DQJL 3BPOC 4NENB 1EA9C 5HY9A 4TYUA 5E70A 4TSCH 3U1SL 3BI9X 4MMXB 4O5LL 5KYNA 4ZMPA 4QRUB 4J6RH 5F21B 3V8CA 1IC4L 2XTXA 3FYEB 2HP4A 4X8JB 5AW9B 4Z7WF 1C08B 5GZNA 1I8IB 1MJUH 3L7EA 1BQHB 1KJ2H 4JM4L 1CLVA 1QQ1A 3SOTA 3SE3A 1U8OA 3D7PA 2Q7NA 3KPSD 3QHFL 4RDBA 5DJ0B 2X88A 2ZWSA 1P5UC 3C60C 3Q44A 4ORZC 4CVZA 2EVHA 2P42B 2EDKA 4NQDE 3SDDB 2AZAA 3V0WL 3NCJL 2WN3A 4ZFFA 2QZ5A 3AXIA 2P52A 1XSKA 1KLGA 1BQHG 2BX6A 4JQIL 3F7VB 4ALAC 3UZQB 5CIPH 1A5FL 1UA6H 3KR3L 1BZDA 3RKDD 2AXFA 3L81A 1HHHB 4PJCF 2OZ4A 1PMYA 2ZCKL 3W9EA 3UC0L 4EBQL 3SCMB 3BW9B 2E7HA 4XZUB 3BHBA 4NCC2 1CT8A 1BREA 3FRPA 1GIGH 5D7JC 3RIAF 2HFEB 3SDYH 4HUCA 1PLGL 5E56A 4Y5XC 3KVQA 2ROXA 3ARSA 1O7VA 4B0MB 2XZZA 4PJFA 4MQ7A 1X9LA 5HVGB 1CS6A 1JV5A 2QHRH 2NY6B 4FKHA 4O51A 2OSYA 2CA3A 4CKQA 2ZUYA 4G9DB 2E8ZA 2DQ6A 2KC0A 4WHYG 1DVFB 2WLZA 4M8RA 4M48H 2Z35A 1I9IH 3CSTA 1REIA 5HHME 5GZOC 5D5MA 1JL8A 2X09A 3K91A 3IJ7A 2AJ3B 1V3LA 2VLKA 4L3CB 3LKOB 4RGMB 1IJNA 4A38A 4H5SA 4MWFA 2C4FT 2WK2A 2BVOA 5DC4B 4FQHB 4QO1A 1QRNB 1MH5B 1OWWA 4R84A 1UWEH 1KJ3H 4H44C 5GZND 3DHUA 2XT1B 2HN7B 4MJIB 2WZ5A 3PP4L 2A9NL 2E4FA 3SZEA 1PX3A 4F7CA 4DGYL 3KYKL 1N64H 3M45A 4JPQA 3IMTA 1CU4L 3TBBA 3BRDA 4NLHA 3P4OB 3FCBA 3WUWB 1SJHB 3Q8FA 5I9QB 1CGTA 3AT8A 3KGSA 4M5YH 1M7DB 2P8PA 3W5MA 1BLNA 2COVD 4G6MH 4OCLC 4QOKE 3HG3A 2VE6A 4KOCA 3EGXB 3H56A 1MJ8H 4JFFD 1R5IB 1KTCA 5LGKA 2DQCH 2WV3A 1UB5B 3VNZA 1PDKB 5KYUA 1WG3A 3SKMB 5LGHL 4R4FH 4LQ1A 2J5LB 5B1BB 4NZ8A 1QFUH 5SX5H 1O8DA 3D34A 2OCFD 1LYQA 2EE2A 2O5YL 3KPSA 1KV7A 4GUOA 2LU4A 3EGDB 1NMAL 4YXHL 2R23B 2VGLM 3VFVB 2GHWB 4GKOA 4I2XB 1HH9A 1SOSA 1A02N 3MBEA 1UA7A 2BM5A 4MZRA 1PCSA 2VJ8A 3QEQE 3JTSA 3L4XA 3RPIA 5E8NB 4Y2OB 2DLFL 1X3DA 2JFCA 3O2VH 5T1LA 2YPLD 2HT2C 3CLEL 3DECA 4BK5C 2WBJA 1F13A 2DQUH 5C6TH 4DEWA 3V0VB 3N1QC 3NPSC 3V5HA 5A3ID 2IAMA 1SY6H 3L1OH 2FZ3B 2WQ8A 1OQXA 3GSOB 2QV4A 3TV8A 3CPLA 2EINB 3AABA 3BT2H 3OLGA 4LSVH 5HHPA 1OV8A 1A2YA 4WLCA 5EFIA 4JHBA 1XQ4A 5C3LD 1N5AA 2CRIA 3SPIA 4MJ2A 5E8OB 4FQIL 2JKJA 4Y19A 4YVUA 3ROLA 4E9RA 4ZUWB 3E2HB 1T89C 4JK0D 4XVJH 3ULVH 5KEZA 4J3OF 1PNCA 5BS0E 2YEZA 5DJ2B 3T0ED 4KMQA 1VPOL 1OK8A 4U0QB 2PNDA 1KZQA 3SDXF 2F1AA 5FLUA 2A6DB 1XMEB 3MRJA 1I7RA 3IVKB 2FL5B 5TQ0H 1RUKL 2PETA 5D8JH 3UDWA 5DXWA 1AZZC 5LCVH 3TONA 3F01A 5CP7A 5DLLA 5FM5M 5KVDE 2NPLX 4QCIB 4Q0XL 3ECQA 2BS8A 4YX2H 2OJEA 5DZPA 3VTTA 5JXAH 2Q10A 5C2UB 3US9A 1JRHL 5E6SB 3ZPDA 3S35H 5KVEH 5C2BL 3HB3C 2O0WA 2WBWB 4MJID 4QHNA 4EQ2A 4P2RD 3WLBA 5E1AB 4G72B 4R5XA 3PREA 2IQ9L 5JDJA 2X70B 3BP5A 2BNRE 4PJXA 3LPFA 1HKLH 1HXYA 1R4XA 3H85A 3JV4A 4QMEA 3UTSD 5FYLL 1N2RA 4AXWA 4F7KA 1LXMA 4HWZB 3MBXH 2W91A 1SZNA 5KJ7E 4AYBA 1DVFD 1S5HB 1ULVA 2P44B 3GJFA 2RH0A 2F53E 3UYRL 3DXAA 2J71A 4BE6A 2YC1B 3NH7H 2E27L 3O4LE 4QTIH 1UZ8B 1ZPLA 1KTLB 3T09A 2Z4QB 3VRJA 4HOZA 1HSBB 3TPUA 4F5CE 4HFWA 2EYRB 3LD8B 3CDCA 4OZ4B 1EMTH 4XCFH 4IBQA 1AXSB 3DRTA 4OV6F 1U8MA 1LO0H 4KH3A 1WSST 2WXHA 1MCSA 1WICA 2WKLA 1X5LA 4IGBB 2NX5B 5HJGA 3ULSB 3WN6A 4MDJA 1HEZB 2EICA 4CW1A 4D3CL 3G5VB 4IBVA 2KLSA 4WAFA 5AKTA 4OZHE 3NRFA 4P49A 2AXGA 4PJ9D 3RL1A 1WE5A 4JRWA 4DP2X 3A5VA 1OT2A 1QI3A 3V4LA 4PYHA 5EN2B 3OPUA 1S7RA 3KM1A 1GL4B 3LTVA 3QYMA 1I7ZA 1TQSA 3ARFD 3A4EA 3P69A 4XT1C 2V2WA 1Z9OA 3L3KB 3MC0A 3OB0H 2EE9A 3HS0A 2Y9RT 4EJ1C 1KF9B 3KPPB 5T3ZL 4Q0XH 1FO0L 2GHZA 3GMNA 4P2YA 1Q4NX 1UOKA 1BCIA 3TBWB 3VDCA 3ARBD 2KH2B 2PR4L 2PW2A 3TT1L 2EDNA 5LAPA 2NNAA 4OQTA 5AVSB 4ZYKA 1JTPA 1LTXA 1NMBH 1KUMA 2AEIT 2KZBA 5KUKA 4NC1C 1OAJA 3MSPA 4TV3A 5IKCA 1PY4A 3DVFA 4LAQL 4PJHB 5IMKB 5JORA 1F6AA 1A22B 1YHPA 2R4SL 4Z23A 4AQZA 1RJZB 3ULVF 5ECJE 2ZG1A 2KL6A 4ZSOE 2F53B 3NVQA 4PTTA 4U1KB 2QR0B 2XA8L 4NUJB 4TUJB 2IDUA 3HG1E 2AJSH 2A1WL 4QF1B 3QG6B 4BFBD 3VMVA 3L54A 2YUZA 1FP5A 1FUNA 4JY4A 5GHWH 3NCBB 1N18A 4F3FB 5C0EB 3QJTB 2BJML 4LOUC 4RA0C 1UJ3A 4X5WA 4OQTL 2MKLC 2B2XL 4HPYL 2Q8BH 2FWLB 1F1GA 3AT0A 3MHZA 1TLMA 2J8OA 4OCXH 4H0LC 5HDOA 1PQZB 3Q3GA 3FJTA 2JCWA 1KB9K 3D4CA 4I88A 2NYYC 2WXPA 3CPUA 1MCNA 4XBEH 5F88B 3FZUD 3LXBA 4QXGL 2P45B 5BZWB 2OMBA 4CU8A 3SYPA 1QPPA 3V7AE 2VO8A 3AFLA 4GBXA 5K9QG 1PX8A 2DZEA 3ARQA 5EU6D 4XMWA 1XL4A 1E6OH 2TSAA 4MHHI 1QSFA 5DVLA 4UT9A 1T7WA 4QKXB 4KPHH 4E42A 5ADPL 2YXWA 2F7IA 4K4KA 4GSQA 3MRNB 2GUYA 1PLUA 4GO6B 3NGBC 3AMLA 4MBOA 3F7LA 4JPKL 2LLLA 2Y7OA 4HXAH 4YFLF 2OR8A 1OFMA 3BFQG 3HRZC 5CINL 4TTDD 3DPBA 5SX5K 4R90H 2LW3A 1CG9B 4LHUG 1WBZA 1A6PA 4IOIA 4MNGA 3B7YA 3FSVA 5JIMA 2K1MA 3BGFB 4UMSA 1X7SA 1CFTB 1KCBA 5F7HA 2WXQA 2QEJA 5F7LB 4FXGB 2J5WA 2UYLB 4NYLA 7TAAA 5IB2A 4F15C 5K1JA 1EERB 2AV7A 1CU4H 3HR6A 1DDHA 1E5UI 1SEBB 4MYPA 5G5DA 2AS5M 1XB6A 4GB9A 5CJQH 5HHNB 1U91B 4AUJA 3HUJA 3D2UA 3U0PA 3S5YA 2IV9A 3AY4A 3HFFA 4X0NA 5AW0B 3KPSB 1G9NL 3LRLA 2K7QA 1YEHH 4B97A 4ES9A 1QVOB 1UWEL 2FECI 3K5RA 4LNVA 3S5LA 5F7EL 3VXME 3BH8B 3ZKND 3BN9C 1JNHA 4UT6H 2DQHH 1PG7H 2YWZA 2ZWLT 2ATAA 5HVFB 3EIFA 3OWEA 3T77A 2FJSA 3L4ZA 4PWJA 5ANMB 4H26A 2MCAA 5B3JE 4J23A 4FQQB 2Y24A 3H2WA 2MCPH 3NZUA 5AZ2L 4P4KC 3WUWG 3VRLE 1RZPA 3QIWA 4I3RL 5CZXC 3C8DA 1FVCA 3DWTA 3NCEB 4AGMA 3ZHFA 4YR6B 2CKBB 1CVRA 3APDA 3QDMB 2TSBA 4XXWC 5I73C 5F1IA 1OOCA 1VZIA 3RVXC 1S8DB 1ZHKA 1VFBA 1JZJA 2GTQA 2YA0A 2YPVH 1XH3B 4HC1A 1K6QH 4LMQE 1Y0LA 5AYUH 2H3KA 3QR0A 1F41A 4L37B 1UM5L 4LL1A 5E4AA 4HOXA 4OZHF 1MUJA 3A3YB 3E8UL 3MGTB 4N3TA 4GIPD 1V55B 2QVMA 3KPNB 3D2UB 1U93B 2J6EL 3P9MB 5DVOA 4Y9FA 1MCRA 4E41E 4I3SL 3MVSA 4Z7WB 1JDCA 1TTGA 2DQFA 1R3LB 2X4SB 4HALA 1XIWA 1NBVL 4XAKD 1J05A 3RTQC 2BW4A 4IU3A 3BUBA 3S3PA 1EJ8A 2CJUH 3GSXB 3H7BA 2HFFA 1Z66A 3D0LB 1GZPA 3VSTA 8CGTA 1IBZA 3CHOA 5IBUB 3WDIA 1PSKL 4MXQD 4A63A 2PYFA 2DB8A 3L4CA 1CICC 1UADC 5AYQA 5SV4A 4V1DB 4KTGA 3EFOB 4C57C 1E8WA 4YBLB 2P5WE 1CF8H 1OTTD 2N3JA 5D7LA 1YPZE 4PHXA 5B1JC 1QBMH 2X28A 5DO2D 4XH2B 4YL4A 1D3CA 3BVDB 1HNFA 4KITB 2XIIA 5C97A 5EO1A 5I1IL 1P6WA 2AW2A 3F5WB 1USQA 4G8GB 1YEGL 1GSMA 2XKNA 4D0CB 1FO0A 1XX9C 4I48A 4PJIE 2A7BA 1NFDB 4XVTH 4RAVA 3SYQA 3QI9B 2VR9A 4X5RA 3ETSA 3G6JA 4YLCA 3QUXA 3GXTA 2EDTA 4E5XG 5AOMA 4YIQA 4N5EC 5I2IB 1VB9A 3RGVA 2Z4QA 3VRJB 1KDIA 4G5ZL 5F7FA 3RFZA 1I4FA 4OZIF 1DQQB 3T8VA 1GGCH 2KZ1B 1ZT4B 4LLDB 1AXIB 2EDOA 4P2QD 3RQ3A 3JX8A 4K3HA 4OZIA 4YDJB 2ZYIA 3BSZA 5DMJB 5EU6A 2WXJA 3GM8A 5I1AB 4TNGA 3TF7C 5D4HA 1CXEA 4R7NB 4DN3L 3VXQA 4PU2A 3WCYA 3F5WA 1H19A 4NQXB 4U0RC 4WNJA 2CNYA 2R2EB 7FABH 1UENA 4NP4L 3DX7B 3G5XA 1MAMH 1INEL 3DK2A 5DA0B 4ODSH 4P5KB 1IGCH 2ZOOA 3I75A 2VR8A 3CH1A 4KTDL 5DHVB 2HPTA 5HHOA 2A9MH 3DLQR 2XQYA 3EF4A 3MLVH 2AZUA 1KTJA 4V1DE 4UDUA 1JGDA 5F3BA 5I6NA 1YEGH 3QZWB 2W9LA 2YD6A 3MNMA 4PWEA 1MFUA 1HILB 5ESQB 1W6LA 2DDQH 2H8PB 3EF7A 4HKXA 4LBEB 4MCMA 2A6DA 3WS3B 2O5YH 4L8DA 5FKPA 2EUZA 3DURB 3UTSA 4CSTA 1NQBA 3QUYB 1NGPH 4ZTPL 2Q6WA 3T2LA 1BPLB 3UPRA 4X4MA 5IB3A 4FLQA 4XNBA 4GQRA 1TFHA 2IAMD 2DQCL 3HC0B 2ODIA 3IDNA 1BBDH 2MRYA 3W39A 2WMPB 1X5GA 2FHFA 5CFHA 3TFKD 4TQHA 1B4TA 2EKSB 3QEHA 4OLWH 1JGUL 3W56A 3JURA 1NFAA 4UB0H 1ZS2A 5KN5A 3PGDB 1BECA 2EDFA 2VDNH 2XWDA 2Y7LA 4LCCC 2FD6L 3GQAA 1MN4A 5DHYA 4M5TA 4JPVH 3ULVE 5JR1H 5IROA 2E76C 1FFPB 4YDLB 4AMKL 1JERA 4LCIH 1ET7A 1AZBA 3RZCD 1WZAA 4Q74A 4NOBA 1JD9A 3IGUA 1RZGA 5EOTB 3V4PH 3C5ZA 2OPCA 3JUYA 1JXDA 1DJWA 2FEJA 3BZ4A 1I8KA 2H6PA 2O6CA 5F7DA 1D5ZB 3LKPA 5T8IA 1KIUB 5I1KH 4HAGA 3WJMA 1Q0YH 1Q1JH 5DS2A 5E00B 3CFJB 2DTML 4HSAC 3V4VL 1WHOA 4LESA 3G7TA 4OM0L 3QUKA 1GIGL 4PJBE 2ITCB 4ZD3H 2BVEA 4YHPA 1FGVL 1E42A 3GMOA 5IBTL 3LN5B 1I7TB 3LN9A 3NFPB 2FX9L 2I5YL 1E9QB 1FE8L 3UBXI 2PYHA 2OW7A 1NC4D 4XE5B 4JKPH 1UT2A 4NT6B 4NXKA 3EOAA 5DJ6B 4PJ8D 1O9ZA 1BVLA 3FCGA 2VITA 2ZCLH 2IWFA 4ERSH 3IDGA 3MRQA 5IQ7H 4PRPD 3W11D 1VRSA 4X4KA 5DFVD 1FFNB 3LMJL 4Y1AD 3GXNA 4FYSA 1OTUC 2VXTH 4Z7NB 1PYWB 2EXWC 3MROB 3NJFA 4JX0A 5E8NA 3ATDA 1A7BA 4FQ2H 4HFUL 4RMVA 1CDJA 4KROB 3VI4B 2ZXCA 1A4KA 5JPMB 4JZOA 1LO2L 1A6ZA 1VFUA 3MBWB 5HHOE 3M17B 5CZRA 3UTZA 1ZANL 4NC2B 3DGGB 1MRFL 5JPNC 2Q2LA 4N8VB 1HI6B 2NTSP 3DX9A 3NCJH 1QD0A 2A9DA 3HI5H 1R5WB 4X6DE 4HWBH 2NY5H 4YE0A 4RZCB 4WZ9A 4MXNA 4RDQG 4ABWA 2MTAA 3ET9F 1UEMA 5DMGC 1RHFA 4UQCA 4I5BB 3K2KA 1OK0A 3MLVL 3VUAA 4EQ3A 4EI0A 2YAOA 2VSMB 2EEXA 4KY2A 3GMNB 1O88A 3F65A 1FZOA 1RK0A 3MLSH 4R2GB 1W72L 3PYCA 1QASA 3RA7H 5KVDH 4XAWL 4YPJA 4NHUA 3O6FC 4C4UA 1NKOA 3RWEB 3TO4B 5ADPH 3NGBB 2AJXH 2XU9A 3WEMA 4HCIA 1QYGH 2EKJA 4AL8H 4IBTA 4ZTEA 4FHKA 2PMZA 4YUEL 1YEEL 2INVA 3ATBA 5E2UL 1TTFA 5F7NC 3KYNA 2Y1YA 1LWHA 3OMZA 3QG6A 1C5BL 5JQ6H 4NRZB 5FGBC 2HVJB 2JB6A 1BW8A 1DBBH 5KAQG 2JNZA 3CSYB 4OLUH 4PTTB 4YBHA 3NSXA 2CH8A 3KE0A 2J1ZA 4FNLL 3NFNB 4APQD 3E80A 1F56A 2VERN 2FJFB 1BJ8A 3RIFK 1CURA 1YEDB 3L8QA 3V0JA 2B2XH 4HISA 5EZOL 3D25B 1PZDA 4HDIA 4ANVA 4HUVB 2VBKA 3DGDA 3MA9L 2QMKA 3H0TA 1K4CB 2F5AH 3LNIA 4L48A 2AXJA 3VWKD 5GZOA 1PEZA 2JH2A 5DRNB 1UZGA 1FNEA 4PWGA 2BC4A 2ROYA 1IFHL 3QQ3B 1MCEA 5FCSH 4YHOH 2GK0A 3QZWG 1WK0A 3JV6B 4NQCA 4X9YA 3TT3L 5TGBB 3CWGA 3WGUB 3SKMA 4LAQH 4PGZA 3U4AA 4KNQA 1X44A 4XN8A 1TJGH 3ZGIA 4JRXD 4PLJD 2BHFA 3HFML 3U9PL 3IMUA 4WIQA 4NNPH 4PJGF 3S8WA 2MPAL 2IO5A 5IOPB 1PD6A 4WV1B 4NJAH 1BGXH 5C9KA 3L48A 1CF8L 4WWOA 4YSCA 1Y0LB 2WWKT 1DUZB 2Y3AA 4XHQA 4AJYV 2XYCA 4F2MB 3ZE1E 3GHBL 4G9FD 3MJ7A 4JN2B 3TTSA 4M6NL 2PO6C 2NY1D 3EDKA 1CLYH 1OXYA 2W07A 2JKLA 1EUTA 3CZNA 2X6CA 1N4XH 4LP8A 4IDJH 4U1SB 3WV0A 3WSQL 1MWOA 3VRLF 2ADIB 5IROD 4AGLA 1M53A 2CJUL 2X4UA 2ZAIA 4WGWB 3T8MA 1QI5A 4P05A 1FSKB 2DH2A 4ODVH 5KWYC 1CXFA 3PY9A 1QR4A 3GMLB 3RFZB 1F4WH 1OY3B 1QSED 3RGVB 3MXWH 4NENA 4BDVB 4LVNC 4MS8D 3TA3B 4DEUA 4J12A 4ZMQA 2GAZA 1JWSB 1AZUA 4R8WL 5AG8A 2FJHB 4JREB 4P5TC 4DGWC 2V2TA 1NSNL 3LPWA 4NKIL 2BOLA 4K15A 1N9PA 3GF8A 3K72A 4KHXL 4OUOA 43C9A 3BUQA 4ZMWA 3N9GH 4X5XA 1LWRA 1EMTL 4XCFL 1NC4A 2W94A 3KWWA 2O5ZL 5CSZB 5L6YL 3CVHA 2WO3B 4BSJA 5C9JB 3IU3A 3QQ9D 1MHEA 4KKCD 4MWFB 4OTXL 4ZFZA 5KYYA 3ULUC 1TQTA 3LKOA 1J1OL 1BMGA 2LV4A 2ZIDA 3LH2H 1CWVA 4R8WH 4M02A 4R9HA 4AQ1B 3BKML 3D4YA 4FQ1L 4XC3L 1NEZA 4Y4KB 5SV3A 4RGND 3HE6D 4FEMA 5MP6L 4OZGA 5D1XE 3LJYA 3IKKA 3MV7E 1WAPA 4KRPC 1G9NH 2DWDA 1PPIA 3FTGB 5E5UB 1TYVA 4KJWD 2BX5A 1KG0B 1ZHBA 2CK2A 3M46A 3LQZA 3V52L 3M07A 1XG2A 4HQQH 1LO3L 1KTWA 1IL1B 1XTLA 4NKOA 3UPCA 3UO8B 1EDQA 3B9VA 3OX8A 4JO8A 4RFOH 2O6EA 4FN0A 2ZP9A 4GEJA 3GHBH 3ILEA 1ZSHA 3IFLL 1QRNE 3QUZB 3NIFB 4NGHL 3G6AB 1FC2D 4ZX4A 5CKGA 3QDGA 2WLMA 1IGML 1AH1A 2JE8A 2IADA 3BGAA 3DROB 1NKGA 5C09A 5LDUA 5CGYC 3N43B 4ELME 1O9WA 1XCQA 4XNUL 1JWSA 2VXVH 2AJVL 2NY4C 3LCYA 4J8QA 2MOGA 2EO9A 4P23C 2WVUA 5HDLA 3MV8E 4QRQA 4YL9A 4YHMH 3UCRA 3U0WH 3QDGE 4RWYH 3VQLA 3IEAA 3L3OB 3DVIA 4HW6A 4L3FA 2QKIB 3SDAD 3TM6A 5I28A 5IFAL 1A25A 1J8HD 2ZX5A 3DUSA 4NJ9H 3RDTA 4I77L 2DQDH 4AYID 5T3XE 1RZ8B 1PZ5B 3LB6D 4C56B 2WOBA 1ZHBB 1UWYA 4G6KH 5IJBC 1KIPB 1EGJA 4KJPC 3B2DC 2ZKWA 2C1PA 4OFDA 1COBA 4X7TA 3TP4A 4Q9QH 3MCKA 2R23A 1D7DA 4YLBA 3O11B 1IA5A 2M8XA 4KOBA 5D1ZD 3D3VA 4AEIH 3FW6A 2PCFB 4WI0B 2FJUB 1JS4A 4MXWL 4ABVA 3E9UA 3PJSB 3OHXB 2FIRT 2BFVL 3SYJA 3LX9A 5IOKA 1EANA 2VXQH 5E6UB 1F02I 4G6KL 2BK8A 5KOVC 1E4HA 1KTDB 3VFRB 4FE9A 2NCEA 3Q48A 2OMYA 2XA8H 4Q4EA 1G9MC 4Z18A 4DPBX 4J4PA 2Z3FA 3B2UC 1B0RB 3G6JE 2CKBL 2VDMB 2X1PA 5C0JB 4KMTL 4JQVC 4JDTL 3WFCH 4AQEB 3CXHJ 3F58H 3G9VA 4PJCE 5FA3B 3AU1B 3NAWA 3Q8AA 1U3HD 3CVDA 2R2EA 5C0CB 4R26L 1S8DA 1ZHKB 2DWXA 3HR5B 3UJIL 1Z2KA 1NWOA 1H15A 1U92A 4N9GB 4XN1A 4A66A 5K9QI 5KYWB 2DY2A 1D5BA 3ETTA 3QZMA 3U36A 1QA3A 5BV7H 4LSSL 3T1FA 5BS0B 2XIBA 1TTAA 3KYOB 3QQ4B 2OAAA 4RIRB 3LOWA 4ZO7A 1G4MA 2I25N 3K0WA 4BSWB 1GSKA 3I84A 4AMXA 1PY9A 4YOKA 2XYBA 1BFSA 2K3TA 3WG7B 4LF3B 4R83A 1CE6B 3ESOA 4U6XB 4NN7B 1LJMA 2JB5H 3KPLA 4GRLA 4LASL 4BH7A 3QPXH 4NZRL 2DN7A 5AVXB 3WS3A 2GFBB