3VSTA

The complex structure of xylc with tris
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
molecule keywords Xylosidase
total genus 238
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vstA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vstA01
4C2LA 4UQBA 4U49A 1OGSA 3A4AA 3EJUA 1UKSA 4JCLA 1IB4A 3WNMA 2IQ7A 2PWGA 3ZOAA 3BUIA 4CGTA 2PWEA 4UOZA 1UD6A 4UQDA 4EW9A 3VSVA 1AVAA 2YA1A 1IZKA 3A47A 5E0FA 4UQ9A 1XD0A 6TAAA 3SUCA 3OLDA 1KTWA 3BC9A 5E70A 3LPOA 5C1CA 3IJ8A 1KBBA 3BSGA 4ATWA 3BAKA 1WE5A 4OKDA 3AMKA 1RPKA 3S2CA 1IA5A 1T0OA 1M53A 3CV5A 3WY2A 2CXGA 1TQUA 2PWHA 1MXDA 1UD5A 5I5RA 4XOPA 4YELA 3LPPA 3TONA 2F7RA 4AEFA 2NTBA 2Z1KA 2O17A 4I84A 3VMVA 1CGYA 1PS3A 3AXIA 1M7XA 2V3FA 2F7QA 3CC1A 3HJEA 1H3GA 3GXFA 2NT1A 2X6XA 5I23A 1R34A 2WVVB 5AMVA 3ZSTA 2PYHA 2NSTA 2WNWA 3DDGA 4Z03A 3D51A 1K5CA 2J25A 3IGUA 1PE9A 4XKVA 4FLQA 3IK2A 3VGHA 2F7PA 3EJTA 3FAXA 4NX0A 4CKQA 5A6MA 3VGDA 3ZSSA 4HP5A 1JF6A 1MW0A 1TCMA 4WLCA 3TOPA 4J28A 2FH8A 1GCYA 5CLTA 1U30A 2PECA 2ALWA 2F1AA 4OJOA 3VGEA 1H80A 4JFVA 4GQQA 1KBKA 2E4TA 1MFUA 4J3XA 1E3XA 2D2OA 3JURA 2E9BA 4UQEA 1NOFA 3BUQA 1O8LA 3B4NA 1ODUA 4H8HA 2AAAA 4HPHA 3WN6A 3GQ7A 2VR5A 1XV8A 3AJ7A 5E6ZA 2UVFA 1TMQA 1XH2A 2WSPA 1OT1A 4JFUA 4YEJA 1QCXA 2Y5EA 4YZXA 2WANA 2ZIDA 4H7VA 3BSHA 3BMVA 4LPCA 3HG5A 4XLCA 1EH9A 1PIFA 1GJWA 2F2HA 2FH6A 2WCGA 3S5YA 3VGFA 3B90A 3DX3A 1HTYA 3VO0A 3EDKA 1EO7A 1UH3A 2EJ1A 1XG2A 1QHPA 3K8KA 1O8EA 2WVSA 3EDJA 3VGGA 2V3EA 3W37A 2ZUWA 2D3NA 3D50A 4UCFA 2DH2A 3BAIA 4UNIA 3BVUA 1G9HA 1HWWA 2BSPA 4XOTA 1JGIA 1VJSA 4YZ0A 2XWDA 3DC0A 1R33A 2D0FA 3S5ZA 3KL5A 2C7FA 2E8ZA 1R46A 2Y24A 3TTSA 4AIOA 3FY3A 2ZX9A 1R47A 1JF5A 1EHAA 1SZNA 1QW8A 3BLPX 3VMWA 3BAYA 2F18A 2QLYA 4U4BA 3KRGA 3HZ3A 1KXTA 5BRQA 1MXGA 2CPUA 1UH4A 2GJRA 2ZWZA 3GXTA 1KWGA 4H2CA 1UD4A 1UA7A 1MWOA 2XN2A 2WCSA 1KXQA 3BAWA 2F61A 3K8MA 3L4VA 1IDJA 4NXKA 4OJLA 3CZLA 4JCMA 3VMOA 2V3DA 3L4WA 4XL9A 1J0IA 5KEZA 2ZXQA 3RILA 1I75A 3D4YA 1JDCA 4FLSA 1CGVA 1OSEA 2BY1A 1O7DC 3EDFA 3H54A 4UQAA 3VNYA 1PJ9A 3LXBA 4PSPA 2PWFA 1RU4A 1D7FA 2EQDA 2VT0A 1WO2A 1BN8A 3H53A 3EJQA 2FHCA 3BAJA 1QI4A 3AMLA 3WNOA 2VUYA 1RMGA 3BCDA 1ZJAA 1EE6A 1O8KA 3GRHA 1JXJA 3DX2A 2OW6A 3WDHA 4J3TA 4J27A 2QX3A 3ZT6A 4WSKA 2ZX8A 3GTNA 2INVA 4GI6A 4NXSA 5CGMA 1UH2A 3H55A 5E9AA 2WKLA 2O0VA 3GQ9A 5A2BA 2FGZA 4H8VA 1DTUA 8CGTA 4W8RA 2D3LA 3EQNA 5A2CA 1KGWA 2GUYA 3ZPPA 2WVVA 4FNPA 1XSJA 3K8LA 3BVVA 1O8FA 1JDDA 1MFVA 3KWXA 1MVYA 2ZX6A 3CTTA 4JL2A 3GQAA 1V3KA 4B9ZA 2FHBA 5DFAA 3FAWA 3DX1A 1EA9C 4JFSA 3WNPA 3HG2A 1PPIA 1UD8A 1UKQA 2BHZA 3OLGA 4NK8A 1O8JA 1WPCA 3BVXA 4U31A 1U2YA 3UW0A 5I0DA 1E3ZA 1JD7A 3BUPA 3K1DA 1V3JA 1XH1A 1NM9A 3LXAA 3ZT5A 4PMHA 2XIIA 2NTQA 1LWHA 4LXFA 2XIBA 2O0WA 2VJIA 2YA0A 2ZUVA 1G5AA 2NT6A 2ZUUA 3GBEA 3BAXA 3BVTA 1HX0A 1DHKA 4GI9A 2ZWYA 2Y4SA 3OLIA 4AEEA 2YA2A 3GXPA 1Q4NX 4FNTA 1MW1A 1X0CA 3KEHA 1RWRA 1G94A 1L0PA 3VNZA 1VFOA 4XLEA 1VBLA 2QPUA 2WC7A 4FNUA 2WSKA 3DX0A 4UZSA 3ZO9A 3TTYA 1JRGA 3KL3A 4GQRA 1QX1A 5HPOA 3VMNA 1OB0A 4HOWA 3UG4A 1CYGA 7TAAA 2EWEA 4XORA 4J3VA 2EO7A 1CXLA 3BMWA 3A6OA 2EABA 2ZX5A 2X3HA 1KCDA 4UOQA 3WFZA 4CN4A 4AYGA 1KGXA 1UD3A 1WZMA 4MXNA 5C1EA 2EEXA 2ZX7A 1O8HA 2C8NA 2WVTA 3A24A 4W93A 2DH3A 1QW9A 3CZSA 3GXDA 4XQFA 1V3MA 1BF2A 4HA1A 4J7RA 4OIFA 1PZ2A 4W8SA 3WELA 1QPKA 4MR0A 2WVUA 3A22A 1TQTA 1R75A 3KL0A 3EJRA 3CPUA 1JL8A 3GXNA 3WMSA 1PZ3A 1SMDA 1JIBA 1QI3A 3BLBA 4PCTA 1OGMX 3L4UA 4HOXA 2ODLA 2F7OA 1E43A 3CZNA 3EQOA 1HNYA 3UG3A 2VNCA 1XGZA 3LRMA 3L4YA 4B9YA 2VRQA 2QXZA 3UERA 1ZS2A 2QY1A 3WWGA 4GI8A 3VM7A 3BH4A 4TVUA 3DHPA 1B0IA 1CLVA 1QWNA 1VAHA 3HG3A 3VX1A 3ZR6A 4XONA 3WEOA 1KCKA 4FNSA 4URRA 4PEEA 1KGUA 1VFUA 1CXFA 2E0PA 2D0GA 3D4ZA 1AIRA 3WY4A 1WZKA 2X2HA 4AIEA 4M8UA 3L2LA 1IDKA 1RP9A 4U33A 2VBEA 3T9GA 1CGXA 2EAEA 1JG9A 1BLIA 4JFTA 3WDIA 1PIGA 1CXEA 1AMYA 4LQ1A 3WEMA 2TAAA 1CZFA 4MB1A 2NT0A 5F7UA 4OJ6A 1BPLB 1O8DA 4AW7A 4FNQA 5A2AA 2X2JA 2XN1A 1VB9A 1BVZA 4X0NA 3WENA 4XB3A 4NZFA 1OGOX 2ZUTA 1SMAA 3CLWA 1W9XA 1IZJA 2XVGA 4FMVA 2NT9A 4OJPA 2ZXBA 2XN0A 4XMYA 2IGTA 2PWDA 2BHYA 3KLLA 4FNRA 3W38A 1DEDA 1XD1A 5E1QA 4MAZA 1CGUA 1BAGA 6CGTA 3WY3A 4OGZA 1PAMA 3VMPA 1HT6A 4GIAA 5EMYA 2ZICA 1CXKA 2BXZA 2X6YA 1MW2A 2YFOA 3LXCA 4UQCA 3VU2A 1MW3A 4JFWA 4YZAA 2NSPA 3L2MA 4KWUA 5HDRA 4XLAA 1KCLA 1AQHA 2F1BA 2YFNA 3EJSA 3WY1A 4CN1A 1OFMA 1KB3A 4AMWA 5CGTA 4HOZA 1WMRA 1P6WA 2YJQA 4J3UA 1U33A 2D73A 1HL8A 4WSJA 1JTAA 2GVYA 1GJUA 3D52A 1CGTA 5BRPA 3IJ9A 1DBOA 4UZUA 1JFHA 2OSXA 2OW7A 4J3WA 1B2YA 3UEQA 4NK6A 1RP8A 2OYLA 9CGTA 1KXHA 2UVEA 1Z32X 5TD4A 2ZXAA 4FLOA 1KTCA 3CZEA 3VSUA 1WZAA 1CXHA 5DO8A 2WKGA 2OYKA 3TV8A 3AXHA 4WF7A 4H8UA 1CGWA 2QPSA 3CZKA 4DO4A 3GXIA 2OYMA 5E6YA 3L4TA 3VGBA 3M07A 1HL9A 1J0HA 1UD2A 1OFLA 4W8QA 3OLEA 2VBMA 4GO8A 2YKKA 1CDGA 1S46A 4E2OA 2NZMA 4AVZA 2EADA 3GQ8A 2XVKA 2QMKA 1D3CA 3DHUA 4NZJA 1JXKA 2FYVA 4YZQA 1HXKA 1OOCA 3LRKA 1XSIA 2FHFA 3WNNA 2VJJA 4DO5A 2INUA 2O04A 4OZZA 2CHNA 3RIKA 3ZQ9A 2PYGA 2BY3A 4J3SA 4DO6A 4OJ5A 1QWUA 5CLWA 4W8TA 3WDJA 4CN6A 1KXVA 3IJ7A 1JI1A 7CGTA 2E8YA 1O8MA 4XKWA 4Z05A 4U2YA 1WP6A 3LX9A 4M56A 3ZR5A 4XLHA 1GVIA 4BZYA 1NHCA 1XCWA 1LWJA 1QI5A 5CXPA 1TQWA 3EDDA 2NTPA 3L4ZA 2VRKA 1G1YA 4XN3A 3B8YA 1A47A 1OT2A 1VIWA 2AMGA 1E40A 2QMJA 3GXMA 2OSWA 1HG8A 4XLFA 2D0HA 4BA0A 2ZXDA 1KTBA 3BUDA 3DX4A 2OSYA 1J0KA 2EACA 3VSTA 4U3CA 4FLRA 3BCFA 1JI2A 3BVWA 3VX0A 2Y2WA 1XH0A 2FE0A 3LMWA 1IV8A 3EJPA 3A23A 4JL1A 3MI6A 4AMXA 2G3NA 2X85A 1UA3A 2BXYA 2X2IA 4KMQA 3EDEA 1QJVA 2BHUA 1HVXA 4PSRA 2BY0A 1PLUA 3GBDA 3A21A 3WNKA 1BG9A 2BY2A 2X6WA 1PXZA 3LRLA 1VFMA 1CPUA 3A5VA 2ZUSA 1UASA 1O8GA 1QHOA 3QGVA 3DDFA 3CGTA 4X9YA 1PEZA 1UOKA 1AQMA 1CXIA 4OZYA 4AYSA 1BVNP 1Y7VA 2QV4A 2Z8GA 2NSXA 1TQVA 5I24A 1XCXA 2YIHA 3BLKA 3ECQA 4GINA 3WNLA 3ZT7A 1DBGA 1KCCA 5A6LA 2DIJA 2G3MA 1BSIA 4GO9A 4XM3A 1JAEA 2O1DA 4Z06A 4GKLA 1O88A 1CIUA 3HG4A 1KWKA 3L4XA 2GJPA 2ZE0A 3UCQA 1J0JA 4HWVA 4XR6A 2XWEA 3UG5A 1EO5A 2YOCA 5HXMA 4NI3A 3VM5A 4XNFA 3ZSCA 3BUBA 1WZLA 3CZGA 1V3LA 2WPGA 4PCSA 1GQ8A 1JD9A 1ZJBA 2XVLA 4XN0A 1XSKA 2VBKA 1TQSA 3FW6A 3II1A 4CVWA 1BHEA 4OJYA 1JDAA 2DIEA 1C8QA 1UKTA 1O8IA 4U2ZA 3KE0A 3KLKA 4QAWA
chains in the Genus database with same CATH superfamily
5JMCB 4Y5YC 1DQVA 4CUCA 1QFWH 3ZTCC 5A3IC 3U0PB 5I0ZA 3S37H 1OAUH 1LQBC 3KWWA 4IJTA 3AXLA 3MCYA 3Q3GB 3T6QC 5KYYB 5B1BB 1KPUA 3EHBD 4H20H 4LASL 2I60H 4FFVD 5CP3H 5EZIL 2YA1A 4PQXA 4TQPA 3I9IA 1JGUL 1JK8B 1XB6A 1SVZA 1L3WA 4HZ1A 3WO4B 3QFJB 3MV7E 3AMKA 5T3ZL 3BRDA 2CBMA 4XO3A 3ARGD 4KKBC 3BKML 2O6EA 3B2PA 4OZ4B 4JFEB 4LHUA 1AHWC 1TVHA 3GSXB 2YO3A 3RKDD 35C8H 4L8SA 5DHYA 5IB5A 4DTGH 5BMFL 3HZKA 3VI3B 5L0QB 3TO2B 2WZ6A 2K3HA 5JMRA 1A3LH 4QRRA 1XB3A 3PIQA 1JP5A 4ZZKA 1BMWA 1ZCRA 1IU1A 3DO3A 4KJYA 4WV1B 2X4RA 3PAVA 1B0RA 2EXYD 5C6PB 4LFHG 5I71C 5BZXA 2VDMB 5DHVB 5F0LB 3MJ8A 2E27L 2HH0H 3VRIA 4YMPA 3M8OH 4TRPH 4CKQA 2BVEA 3WXWH 2ED7A 1PZSA 1AE6H 2A0LC 5JIMA 3CLFH 4EUPB 4WWPA 2FO4B 3F84A 3KYOA 2ZKHL 3O3EA 2X87A 3FUMA 3QIBB 1T22A 1BVKA 1XHHA 5F3BB 1Z7JA 2O5NA 4UM9A 4TVPH 4MS8D 2XWZA 2JIXB 3ZKXB 2PKDA 5D2LA 5EBWA 4OQ1A 2VR5A 1ORSB 4AEIH 3F6JA 5I6MA 5IOKA 1LP9B 3V5DA 4UBDC 1AZNA 4Q8BA 4ODSH 1EVUA 5IEHA 5D9SB 3T0EE 2Y2YA 3QUYC 5F6HI 5KSAA 1KGIA 1PIFA 4P2QD 1DUYA 2FJFA 3ILEA 3FUKA 1JZGA 2A7BA 1FL3A 1Z5LB 5HHOE 5HYFA 3SGDH 1MCKA 4PCYA 4R96A 2WTPA 3AU1A 4NC1C 2V3EA 5F9DC 1S9VB 4E9SA 1DP0A 2VLKA 3J8F7 4WGWB 5AW5B 3BVUA 3HI1A 1A8JH 3EYSL 3ZHNA 4JE4B 1A2YA 2BRRL 2HX7A 2APBA 3RTQA 4WO4B 5JHDD 3SPHA 4YJZL 1WA1X 4OGXH 1OAKH 2DLGA 4EXKA 3A3YB 4KKCC 3HVNA 4RZKA 2MSPA 2XJKA 2NR6C 3O2DH 2IBBA 1ITBB 2L4OA 5F7LB 1CURA 2AI0L 1TYRA 2X28A 2Y7SA 2GY7B 2M1KA 4GYBA 3L3IB 5LBSA 3QT2A 2PR9A 4NQDD 3AY2A 3B56A 2QVKA 1KWGA 4P5TC 3ELQA 2PN5A 3L4VA 1IDJA 1KNOA 5K9OB 2QQKL 2XV6B 4Y5VA 1KEGH 3V95A 2EDEA 1FO0H 3HLAB 2AV7A 3KPOB 1HILB 4PJBF 2ATKA 3VFRA 3VDBA 4HS3A 5F9WC 1XGTA 3SDDA 4KAQH 3QRFM 4MMZA 3IBOA 1I8KB 1E90A 1MPAH 3OJ2C 4M6OH 4F7CA 4IYKA 43C9A 1BN8A 4QKTA 4FX5A 4OD3L 4LGSB 5T5NG 2OMYA 1G7LA 2YAHA 4OZHA 3UP6A 4AVIA 1XGUB 2XTXA 5HHMB 5CZVL 1NC4D 4X4YA 1MG3C 2CE6A 2AXJA 5JW3H 3G04A 3DX2A 3IJYA 5BRZE 2NY3D 1BZ8A 1TO5A 2Z0BA 2ZX8A 3RWEA 1EHLH 5CGMA 3A4DA 3HZVA 2UZYB 3FQ1A 3N06B 5E9AA 2VXQA 4EKXA 3FO1A 4JPIA 4YL4A 3NRFA 2C1PA 1YQVH 4P48A 3RWJB 2X2YA 3OZLA 4KVNH 4X7CC 2HRGA 8CGTA 1YY8B 4X7SL 1ESOA 4R8WL 4DK6A 3TVMD 5IMMA 1Y1UA 3ENEA 2XDHA 1AO7B 3O4LE 4Z7NE 1R5IB 2ZX6A 5LQBH 3UJTL 3B7UX 3TWYA 2HJKA 1DJHA 3W1ZA 4F7TA 1HL4A 1MIML 2WM0A 1PZ5A 2GBTA 3P40A 3WJMB 4JFSA 4JB9L 4L0YA 4NKDB 2ORBH 4NK8A 5C0AA 3LH8A 3OXSB 4FQXB 4Y4HB 1YEIL 5DJ0B 4NNXA 1L0YA 4HHGA 3ET9F 4OZGA 4QTIL 4IU3B 2QADB 3HI5H 3KS0H 3VXSD 4TNVF 4E0RB 2LE9A 3BVDB 3ETSA 1TYVA 2P8LA 4HJ0D 2QELA 2WQWA 1WGVA 1I31A 2ZUVA 2XG4A 2NXZB 1TQBB 4XVUD 1YVLA 3BJ91 3B2VL 4EVNB 3B9AA 2WLIA 2YA2A 2C4FT 2Q0ZX 3NSFA 4IMKA 4QXUL 5F9JB 2GAZB 4IBYA 3SDXF 4IS6B 4R3SB 1CFVH 4PRHD 3OKOB 1UB5A 4FC3E 2HTKD 2QVMA 5IW6A 5EBGA 2GJ6B 3SE9L 5EEVA 1OSPL 2VIRB 4EAEA 1X4YA 2Y06L 5DJ8A 5EWIL 3P11L 3WUZA 1XMWA 2OK0L 4J3VA 1VESA 1CDHA 3PWUA 4QY8B 5AUMB 3FPYA 4R97C 5C08E 3UZVB 2X4QB 1QNZL 3WIFB 2ZKXA 5GGSY 2UWEA 3TBBA 3ILPB 4AYGA 2X0UA 4K9EC 1AC6A 2FD6L 3LDBB 4PWKA 1SXZA 1OCZB 5IZ7A 3PL6C 1GY1A 1PZ2A 2BP8A 5DMYA 1RSYA 4DW2L 5I15H 3P4GA 4O02B 3B9KB 1P7HL 1TQTA 3T0DA 4BFBD 2AEIT 4OY9A 2R2EA 3WAKA 4DZ8B 2ZOOA 4Z8FH 4HOXA 1UXWB 1BQ5A 2DV6A 1G6RA 1IBHA 2B39A 2JCCA 4LNRA 4BCZA 2VDKB 3K91A 2DKSA 3K80A 4GS7B 2GIYA 5KVFE 1NCWL 3LIZH 3ARBC 1NDMA 5F88B 3PPEA 3VAEA 3WCYA 3BFOA 5BMFH 4S11A 4PJXA 4QMEA 1MQ8A 3K5RA 3VM7A 1K8IB 5I1GL 3T09A 3S5LG 2HT3C 3ARVA 1YEHL 4W9KC 4DGIL 2EYRA 1VAHA 3TBSB 4LSQH 3SYPA 1NUGA 1CT8B 1ZSDA 3DTXA 4IOIA 5D7KE 3C60D 3IDJA 3NJKA 4M43H 4J8QA 4GEJA 1NOLA 3HRZA 3W0WB 5JIDA 1GIGH 1LDPH 2F5BL 1DLHB 2J21A 4Y19B 2HKFL 1HIMH 4U4IA 2FBOJ 1OP5K 4TUUA 1AYRA 1O8DA 2BOCA 4XVOA 1PY9A 2WK2A 1VB9A 1GZPB 1RV6X 1SY6A 2CLZA 3W2DL 1LK3L 1V8HA 3KPPB 4J3OF 5AKSA 4Z9KB 1HL5A 1A4BA 1QATA 4LPYA 5F7MC 4YSSA 2R39A 2ZXBA 4HFUL 1A1MA 2IGTA 1X9RA 4FNRA 5E1QA 2OCFD 2R4RH 3MYZA 2VXVL 4U0QB 6CGTA 2F54A 2WXIA 3WY3A 3PFQA 4HDIB 3VTMA 2CO7B 1WBYA 3CAFA 2ZICA 2ZOUA 4DAGH 1UWFA 3QDGB 4RMUA 4UQCA 1YPZE 4NSKB 2XFXA 4XGZB 3S3DB 3D69B 3GMQA 2G0YA 4HEME 2NSPA 1JNNH 5E2VL 4N26A 3HC3H 4N3TA 3TT1L 3BDBA 4FFZH 3MV8A 1BYNA 4GQPH 2V5TA 2D73A 3SGEH 4L3EA 4BIKA 2X1WL 4JM2D 4Y9GA 5HDBF 5J9PA 5GHWH 5GJSL 3RUGB 4KDVA 1T0NA 2ADGA 3KG5A 2P8MB 4S2SB 3WS3A 3G5VB 5ISZA 2Y7MA 3N40F 4GRWB 4FGMA 2WZAA 2ZWKA 3K6NA 3Q48A 3CZEA 1NEUA 3B1UA 3HZMA 4G43A 5JA9A 3IXTA 3VJ6B 1RK1B 2DJUA 2E47A 2QQKH 2X1PA 1RZGB 2P8PB 2V5RA 4XPAH 5FYKE 4F7EA 1BJ1H 4R2GC 1TTUA 1RUMH 1NCCL 4PRIE 5EZLB 3TWCL 2FDBP 1ITCA 2BSCA 3MJ9H 5A16A 4AVZA 4R5TA 2ZXWB 5B3JE 3TT1H 4N2IA 3MOQA 3WXVH 4P2QE 1MCSA 3O6MH 5TDNA 2DQUL 4DO5A 2Y6SD 5LLIC 2ZJSL 1PG7X 2FATH 1E6JH 3I6KA 4QCIA 5EU4B 3AG4B 3RIAK 3TEUA 1YPZF 2IFGA 1QRNE 3G08B 1N12A 4D0CB 4IRJD 1CDCA 5CLWA 4W8TA 4N0CC 4JFZH 4Y1AA 1TZHA 5JHLH 4FXTA 3QQ3A 1RZ7L 4S1SL 4URTB 2IH9A 3O11B 2GB2A 5JZ7D 3LX9A 3TBWA 12E8L 3TYGH 1Z6JT 4YDJA 3STLA 3T4AA 4F8QA 1GC1C 3HG1A 2VUKA 5F7NC 1TJMA 5E8NB 4YDTA 4F33B 3E7JA 5FLUA 4XN3A 1SXBA 4UNTA 4PWFA 2IADA 3AROA 2EC9U 1KC5H 4R7NA 1MHEB 5EG6C 1ZHLB 5C0JB 1ID2A 2I24N 2WBJB 1U36A 4HKJB 2EDOA 2PO6B 1YAIA 1KYOJ 3DK2A 4FFVC 4ZMQA 4RMWA 3NEEA 4XPFL 3WUWA 4JFPA 2DN7A 3QDMD 5T8IA 1BIHA 5I30H 4TS6A 1UA3A 3OV6A 4H13C 1KJVA 3RU8L 3VXOA 5KVFL 4M02A 5JHLL 2WLLA 2ZP0T 1BG9A 3EKCA 3GZPA 3HNVL 2ZUSA 3T3MF 5CJ5A 3EHBB 1A64A 1MNUH 2X9YA 3ETBJ 3P4LA 3CGTA 3QEQE 2VDML 1CFSB 3QGVA 1M7DA 2VJ0A 4NQXA 4V02C 5J1AB 2OMXB 4LEXL 3BQUC 1X5XA 2AJXH 2XFGB 4R96B 4WHYH 5H94B 1TQVA 4LCYA 3F7RA 3ZT7A 4RQQA 5I0VA 4PVMA 4WUUE 3G5WA 5ITFB 4FYTA 5ADOH 2VB5A 2HKHH 4APQB 2IH3B 2J8OA 4XM3A 4Z06A 1FFPB 3RY6A 3HG4A 3UCQA 4MQSB 1VGKA 2CRYA 3T2LA 3JT0A 4OD2A 4B50A 2YD6A 4IU2A 4E9QA 4KXAA 4QT5A 4KI5C 2PABA 2CO6A 12E8H 3LSOB 2LOEA 1AR1B 3L1OL 3T3PE 2DQCH 1ZA3B 3O9WB 5BRZD 3I50L 4JRYD 4JM2B 1MVFA 1ACYH 2Z35B 1XGQB 1B4RA 4ZXBB 4ZMLA 4UUJB 2DQEH 1KULA 5BV7L 4F7KA 1F3RB 1A3RH 4AYFB 4WW1B 3KPOA 1PNCA 1AP2A 1MCNA 1NKOA 2D7OA 3MRKB 4P46C 2WLKA 1RZ8A 1UKSA 1NMCB 2IIJA 4HW6A 2ZCLL 4KNUA 2PWGA 1LO4L 5I1KL 1LLAA 4I0CC 1UB6B 1EZVY 3MC0A 5CN2A 3ARDD 2VQ1B 4UQDA 3SDXE 3SPCA 1EXGA 3WTYA 4ZUWA 4OLZH 1CG9A 3BIKA 3MCLL 4OR1A 4EZKA 3WBDA 2XBDA 2RQ8A 1CU4L 2H2PD 1NCNA 3VRLF 1G0YR 5C1CA 3WN5A 3NSYA 1LJMA 1FLTX 3LQMA 3G6DL 3GIZL 4U1LA 5D71H 1S7UA 2A6JA 2DF3A 3K6FA 4GUCA 3QXWA 1MI5A 2OTPA 3O2DL 4WEMB 1T5XB 4NO0A 1I7RB 5AVRB 2VH5L 4EO5A 2MQ0A 1FO0A 3KPMA 4QXUH 3RY5A 4EUPG 4BK8A 1IBGH 1LD9B 2FT7A 3SBQA 3HVDA 4EQ2A 1A7PH 3AW5A 2QQLH 4PFEA 5CGYC 3LD8C 4MBOA 4A2EA 1T66C 4XXCA 5F6IC 1P7KA 5FK9A 4JS7A 4ZFOL 4PCKA 1VF5C 4CMHB 5HDQL 4XBMA 2C3VB 4X8XA 5A6MA 2QDVA 4NM4L 4Z7WA 4NKDA 4ELMB 5CLTA 3AREB 1UACH 3BQUB 4NB7A 2ZSVA 5DJ0A 3B5HA 3ULUF 3ZL1A 3HRZC 4WEBH 5EEXA 4GQQA 1JHKH 1EFXD 3VFSB 3ZQWA 4YQXL 5CZKA 4E0RA 4WFGE 1UZ8B 4J3XA 2D2OA 3FB6B 3IDGB 1FZJB 4XNXH 5C6TL 1O8LA 1ODUA 1CFNA 3IMUA 3V0FA 4HPHA 1Q9WA 4NT6B 3VYOA 2Y7NA 3MUGB 3RNQB 2EE2A 3Q8CA 3FTVA 3OX8B 2DMBA 2EDNA 5E2UL 1BM7A 3HAEH 2IOOA 2UWEE 2XQYK 3GC3A 5C70A 1QCXA 1BVLB 3ZDZF 3GUTB 1LK2B 4JHWL 1UVQB 1KLFB 2D4DA 2BRQA 1HTYA 3O8XC 1GGTA 1QLEB 1FFOA 1KUMA 2EJ1A 1M56B 4P3DB 4IHBA 4FJYA 1I1CA 5FF6A 1MCHA 2OX5B 4YVUA 3ATAA 1FSKB 3F7YA 2DAVA 4GMSH 3EHBC 2Q6WB 2D0FA 4JRXE 1P4BH 4LPWA 4X5RA 5HDOA 1VPOH 1MIMH 5D6DC 4A6YA 5IJBC 3WIFA 4NOFA 2WQSA 5D96C 3B2MA 1ZTXH 3QDJA 2A5UA 4R83A 1S5IH 3VVWA 4P0DA 1FGVH 1YNLH 1WA2X 3BLPX 1FV1A 4HC1L 1E50A 3DVFA 4X6DA 3OGCB 5JUEL 4YE4H 3BT2L 2XZQH 1OFEA 2PCPB 4PJIF 1LEIA 2ZWZA 1X7QA 3TVMB 1EEZA 1UA7A 4FG0A 2IALA 5IESH 3TWCH 2F61A 2UX6A 4PJ9B 2FYYA 4UIMA 2JKWA 5IMLA 2IO5A 3W9EB 1VPOL 4GSDH 4HKBA 2GABA 4H4NA 3TYFA 4D0DB 4DK5A 2APTA 3AK5A 1LO0L 3D2UB 3QCTH 4QF1A 2OLDA 4FQQA 3VA2C 5FUZH 1Q1JH 2R23B 2ITCB 1PSKH 3QUYB 2VSMB 2CR3A 3MLUL 2FL5B 1I9IH 1GMEA 4PJXB 5A1AA 3C75A 3LXBA 1KXQE 4PSPA 1GYVA 5DYOA 1H6FA 2B3RA 4N3UA 3GSNB 4JY6B 1XAKA 2XT1B 3D4GA 1QI4A 3T6WA 1FJ1B 2Y06H 3GIVA 1FC1A 2WKOA 5CSZA 2FK9A 3B5GA 2VN3A 2GFBA 3HPJB 4OLWH 4PB0H 3FFCD 2BO0A 4H1LH 1CS6A 3LZNA 4A7UA 2QX3A 2AC0A 5CUSL 5DDHB 1RLBA 1V55B 4GAJL 2X4NA 4YHIA 4NPJA 4AGMA 3FRPG 4YHLH 3L5XH 4L8SB 5IB5B 3RWGB 3QIWD 3DSFL 3TO4D 2AV1A 5JYLA 1ETJA 4NQVB 3JX8A 3U9UB 1YEEL 5IQOA 1XSJA 4KQ4L 1A1MB 2LW3A 3AS2A 2MQCA 3Q1SH 4I2XB 4Q14A 1ZT4B 5T3XD 3RGVD 3ARGA 3TJPA 3TF4A 1MFVA 4NFDA 1JS4A 2H41A 3CTTA 2XBZA 5DJZA 3TA3B 4FFZA 4FP8H 5FV1L 5ADPL 4CMMB 1TDQA 2ICES 3S96A 2Y22A 1CWVA 2D7TL 5I1CH 1U4EA 4XP9L 3ROLB 3NG5A 1U2YA 1SEBB 4D9RE 4RESB 2YQ3A 4JY4A 4AKQA 4D9QE 2I9LB 4XNUL 1MY7A 4YE0A 5J13B 4C4BA 5LGJA 3K1DA 3V4VH 4PTTA 4ZFZB 3WIIH 2XWJA 5JIKA 3V52H 2JIXA 4XMKL 1Q38A 1OGAE 3WFEL 4LXFA 2XIBA 1Z3GH 2VJIA 2PTTA 3QAZC 4FQ1H 2ZOKA 4H26B 1CDIA 3QC6X 4M43L 3MV8B 1OAXH 3GBEA 1GYAA 4KMTL 2ICWB 3MUUA 4IK7A 1OCWH 1T7YA 1X5MA 2ZOWA 4HX1B 2X4PB 2K9UA 3X1NA 2V5IA 2BVOA 3Q8FA 4PB9H 4TUOA 3IFPB 1QTPA 4A7GA 4XNUH 1JZDC 2KS0A 1DQQA 1Z5LA 5ISZB 4XLEA 3VFWA 4KKQA 1IARB 1KC5L 3HUJF 2F9BT 2O6PA 4HS6B 5LNGA 3FQUA 1IM9D 1U95A 3CQQA 3TP4A 4YHPA 2H3NB 1UM4H 1SHWA 4KI5F 4XORA 1OM3H 4P3CL 3DV4B 1GAFH 1H5BB 1KTLB 3POHA 4ORGA 2WY3B 4JFHD 1RMFL 4FTDA 5D2LE 2V17L 1BQKA 4LDOB 5EZLA 4ZUTB 4AG4H 5BCAA 2J73A 3NPSB 1XGRA 2X4TA 4W9HC 4MXNA 5C1EA 4PGCB 3V0EA 1JK9A 4XQFA 3FSZA 1CE1H 4J7RA 2A9DA 3IGFA 1QLEL 2AXGA 2UZPA 2CNYA 2IQAA 5DHVH 4I2XE 1HQRB 3NCMA 3S37X 1WYJA 5IJVB 4GT7A 5CINL 2CKBH 2Q9OA 3ABKB 3VFTB 2RCSH 3FYEB 4R9HA 1X9LA 1QI3A 5C07B 1XBDA 4M7JL 5D2NA 1U41A 3EOYG 4WQOA 4AM0B 1NCOA 2WGNB 1E5AA 1X5KA 2OFQA 2WXGA 3DYPA 1CYWA 5J3HC 2CDEA 3BJLA 4MMZB 4M1CD 3VRLE 4JUTA 4OAWA 4XOAA 5I9QC 3PJSA 4MJID 2H7WA 2J72A 1A7RH 2IADB 3UGXA 2VE6B 5FFGA 1RSFA 3DMMA 1EK3A 2VZ3A 4FNSA 1FNGB 1KGUA 4HSAC 1KENL 1L7IL 1MCWM 1MLBB 4K94L 3SGEI 3DUUB 4LVHC 3NIGB 2FBRA 2VFMA 5DMJB 1C5BL 4EDXA 3NABL 4KRPD 1UGKA 5JLVC 4NHUA 2Z8SA 5C09D 1F6AB 3DTDA 4BQ6A 1A9EB 1Q0XH 3RWJA 1BVZA 3WENA 3WHXB 4NZFA 1EXUB 4JRFA 5DVNA 4M00A 2OMZB 3D25B 1GGCH 4MAYB 1OF0A 3BHBB 5J1AA 3H0TB 5GIRB 2JJWA 2XWRA 2X10A 1LO3H 1QRCA 2RR3A 3K0YA 1ZLSL 4K5OA 5IW1B 1X5IA 3RJOA 4L48A 4OLXL 3VRJA 3ZUNC 4F7TB 4NQDB 5IFAH 1C16A 2EIKB 1MCRA 5DD3L 1CXKA 3DBXA 1SM3L 2IPKA 2QEJA 2RTTA 3KMDA 4CNIA 4NNXB 1KJMB 4JR9H 3BDYL 3Q13A 1T89A 4OGQC 1CQYA 1Q0YH 4LSUL 1OP4A 2E7BA 2X2UA 3D0LB 5DD6A 4C56E 1DANT 4IRJB 4GMSL 4M4RA 1XBRA 4QRSB 2IANA 4RAHA 3UYPA 1H5BC 5CCGE 3V0GA 8FABB 3P3RA 1HXYA 5LNDA 2OTWB 1CICC 1IE4A 3FTWA 3ERXA 2FX8L 4AYFA 5KYNA 3UEQA 2G3XA 2EICA 2BVPB 4NK6A 2UWEF 5I18L 1XO8A 3CFTA 4HF5H 2O6WA 3C6LD 1TCRA 3BZDA 3BVNA 3OKOA 1GYWA 1WZAA 3QFGA 2Y5QA 2DWEA 3G6AB 5D6DA 4NNPL 2OYMA 4NQCA 4L0ZA 1DVQA 1MKFA 3L4TA 3NN8A 5D1ZC 4PY7B 2XUWA 4N2NA 5G4MA 2ZUQC 2VBMA 4J2XA 2YKKA 4OLUH 3GQ8A 3RFZA 4ZPVA 1ED3A 1NANI 3UADA 2WBXA 4ZFOA 1XSIA 2FHFA 3RPBA 3PP4L 4JFEA 4LHUB 4LSRL 4AV5A 1LD9A 5A7BA 32C2B 1F90H 1HOCA 3AB0B 5DD3H 3GSQA 3QS3A 3QZWG 4QOKE 3UO1H 4NPYB 3OKKA 3PIQB 2R2EB 4DZ8A 3I2CL 3FO2B 3L1EA 5E7FA 4K73A 4E9LA 4XX1G 2BM5A 3PWLA 3WFDL 4FL4C 2JCCB 4NQSB 5IQMA 3VTAA 4KO9A 4YHZL 5LG6A 1O7DE 2V9TA 1GGIH 3DIFB 4XLHA 1ZK9A 4OIBA 1PTZA 1F4WH 4IRZH 4LSRH 1OB1B 2J6EL 4XCCH 5J6SA 5EA0L 4BCXA 3IFLL 3GJFB 4F7PA 3EZJB 1OCOB 3ECWA 3EYSH 5HSFA 3TBSA 1HG8A 5C0AD 2Y3NA 1KTBA 3DX4A 3QFDB 2OSYA 4IKLA 1ZAGA 4E9YA 5E6SB 4BKLB 2ED6A 3B9EA 4YHOH 1YNTA 1RZIB 1F90L 4F2MA 1SRDA 2B7DT 2OBGA 3ROOB 1QJVA 3EDEA 3M45A 1KZYA 4HMCA 1GZPA 3U2JA 3ILQD 3O4OC 4PBDA 1AR1C 4MAYD 4CC1A 4M48H 1XF5A 1NC4B 3JVGC 5AZUA 1HHKA 1QHOA 1SYVB 3B34A 3LHPH 1H8NA 3F04A 4K4KA 4A38A 4Y4FC 3FCBA 2HT4D 2F7IA 2BNQD 5FF6B 4YHMH 5C0CB 1AXTL 1NL0L 2QSVA 3VD7A 1IJNA 1IKNC 1DN0A 1A2YB 2QKIC 4X7DC 2YEQA 3R7RA 3GSUB 3LQAH 3NJIA 3BUYB 3QCVL 4NSKA 3QDJB 3L3OB 3RZCB 3LHPL 5FO8B 3LKNB 3LY6A 4NI3A 4PYHA 3OGCA 1S7WB 1WZLA 3CZGA 4X5WB 2WPGA 3FF8A 4WDIA 5SWZD 4I77H 1MCIA 5C86A 4Y4HD 2EEBA 3FT2A 5FOBA 5LAXB 4JFDD 3HC4L 3KE0A 1WAAF 4HWBL 4ODBD 2F3LA 2XN9B 4UQBA 4E5XB 1X3DA 2FBJL 2FWLB 3CCHB 4JHWH 2ITCA 4MQ7A 2G0LA 3CVHL 4XPTH 2IQ7A 4V33A 2JTYA 4HS3B 2FL5A 1NAMH 5K33A 3LKSA 3ZYIA 5DYOB 4EI5C 1I7TB 1NLDH 1RIHH 1Y18A 2CIKB 2NNCA 2VLRB 3GHEH 4PN6A 2CWRA 3JBG7 3UTSA 2ENYA 1BZ7B 4QXTA 4FFWC 3B7RL 3LPOA 5DJCA 4G7YH 2B1AL 4I4WA 5C0BD 1LL1A 4BJLA 4U6HA 1FH5L 4BFKA 4QRPA 4JKLA 4P9MH 3CSPA 4LLDB 4PS4L 5ELIA 5HI3D 3RAJL 4NYLA 5FCUH 5CN1A 2G30A 5HI5C 3HC4H 5I6PA 6PCYA 3QPXL 4G2AA 2DBJA 3PWVA 5C9KA 3UC0L 3ZGIA 4D0CA 1TU2B 4NKIL 3DHJA 4MNQA 4K94H 1U92B 1C5DB 2R8SH 3RL2B 3ARGB 2DEWX 3DDGA 4UF7C 5EC1B 2D7MA 1USZA 2P5EE 1IB5A 2OTUB 3BPLB 4YAQB 3S3JA 1QSFD 3FO0L 2PYFA 2AQPA 4HV8B 2W0LA 1TJXA 1WAAE 3MNWB 4KX9A 3P73A 5AEAA 3LB6C 4J28A 4TYUA 2FH8A 4R4NC 5J89A 4PLOB 2XA8L 4GSQA 4LCUB 4OFIA 4NIYE 1GY2A 4GG6E 1F2QA 3U1SL 4MMYB 1IEHA 1DDTA 4FE9A 1GGBL 1B88A 5L9DH 3KW7A 1DVXA 3M46A 2CKBL 1XR9A 2VDNL 4PJ9D 5LHDA 1RZPA 2MQ3A 5AOKA 5DD1L 2ZOKB 3SDAA 4LLVB 3H56A 3RGVC 5ADOL 2NY1D 3P4OB 3T4AC 4DOHE 4TQHA 1BAFH 2ZIDA 1EHNA 3BYTA 2BVOB 2WD0A 3DGGB 2XOTA 5F2FA 2PCXA 1NSNL 3FU5A 3QDHA 3FRUA 2FH6A 4AGOA 3VO0A 5AYTA 2XZCL 5E8EA 1MFEL 3M7FB 4IS6A 4R3SA 2OMXA 2DQHL 4X6EB 3LD8B 2DQJH 1OM3L 1NCHA 3JV4B 4PGBB 4Y1AD 1TYUA 1A22B 4OD1L 3UTSD 2DZEA 5IW6B 4PJDF 4YZWA 5F7EL 2ZUWA 5KBNC 2NSMA 4Z7WF 3UPAA 3QQNA 2IH3A 3QUXC 1MWAA 4X6CE 4HJSA 4MLSA 1N64L 3VDAA 4WGKA 5AKRA 2EUVA 2B08A 5JHMA 3NIGE 3UROR 5CJBA 5DJYB 4IIQA 4F3FA 1MFMA 4JE0A 5EU7C 5SWZB 4J4PD 4YSCA 4HT1L 4L4VE 4Q56A 5F97E 4P9HH 1MXGA 1Y1DA 1MZZA 3ISYA 5E4OA 4MDJB 2WCPA 3STZA 1FAKT 5IJVA 1JUFB 3P4NB 4WO4D 2WZPA 1KYDA 3S3SA 3N0PB 4BE6A 5CBEA 4BA8A 2XQBH 2VXUH 3E6FA 4LL4A 3FTZA 3KDMB 4WW1A 4LVNB 2Q3AA 2VDOL 4X5XA 5B8CC 2W9LA 5F89B 1RZ8B 3D87B 1BV8A 1OE2A 2V7NA 2D7TH 1I3RB 4B53A 4QRAA 3EDFA 3ETTA 3O3UN 1UB6A 3APNA 1KT2B 4PJ7E 2X9WA 1M7UA 1WO2A 3OC5A 4JREC 2JMRA 4OGAD 1NBYA 4FNLL 3MRNB 1MUJA 1N4XH 4PV9B 3UACA 1DABA 2JKSA 1CD8A 2H6UA 1MLBA 4IJ3C 3LCYA 5BO1L 3U48A 3BD4A 3MA7B 4KZEH 1S3KL 1XZ0B 4TUKH 4UTCA 4AEIL 4HCRH 1WJ3A 1BBDH 2WWKT 1MRDH 2ZXEB 3GTNA 2FX8H 1CFMA 4KJWC 4KUZH 4N2AA 2INVA 4NXSA 4P46A 1UM5L 4JFDE 4JPSA 4WUUD 3VH8G 2YD1A 3HZKB 3KHOA 2CLZB 4Z7IA 1A6TA 1T2XA 4HXAL 1HHGA 2IV9A 3ZDXF 5A2CA 2O5YH 2A9NH 4LLAA 4P49A 5I28A 4LL9A 4V1DA 3TJEH 2FX7L 4ABUA 4UTBH 1BLNA 4R7DA 4P3CH 5E2WH 4Z7OB 3CE1A 3Q9QA 4MAYC 5KOMC 2YOAA 5BS0A 5J6HB 4ZMZA 3NCEB 2CO7A 3ULAB 1N5YH 3WNPA 4Z7WB 4B60A 3PUCA 4L4TA 1UKQA 3RL1A 4UQ3A 1EMTH 3KWVA 7FABH 4J4PA 4ZMOA 1MFBH 1LMKA 4FCAA 4AK1A 2HVKA 2G60L 4WTQA 4JKMA 2GJ6E 3LXAA 4GAAA 1EZGA 3KAAA 4QI3A 4EIUA 4Z7UE 1WCBB 1I7ZB 3UTZB 1CZ8L 2E7LA 2IANB 1FH2A 2ZUUA 4QRTB 4OV5A 1LO4H 5I1KH 2AQ3A 4HCGA 3BVTA 2OYPA 3JVGA 3RIFK 5BOZG 2WMPA 2AI0H 3UYRL 3TF7C 4YDNA 1IVLA 2QVTA 5GGQL 4IEFA 3NZ8B 2ADGB 4MBRA 3LEYL 4PLJC 5JOPD 5DEGA 4ES8A 2ZAHA 3MREA 1Z5YD 1RUAH 1DE4A 3ZIMA 3D3VD 5BW7A 3BPOB 2Y23A 5L2KA 4QHNA 5A2LH 1FZOA 4I8DA 5I8CA 3LMJL 2J3SA 4R90L 2Y1ZA 3VJ6A 1RK1A 1Q1PA 3VVVA 4FMFA 4WWKA 5HPOA 3NN8B 4HOWA 4C4UA 4RRPM 5IVNA 3VD3A 7TAAA 3GRGA 1P6AB 2J5LB 4UT6L 1PYWB 3CLEL 4P59H 3ZE1E 1F5WA 2FUTA 3T77B 1ZIAA 3WFZA 2YGNA 5TE6H 3FSWA 1OGPA 1U8MB 1V3MA 5LBVA 2BIPA 5KBLA 5EB9A 1OGAB 4ANWA 2XPGB 2CH8A 5JOFA 1YHPA 2ZYHA 1D2PA 5IB1B 2YXFA 1BGXL 1VGEH 3SCMC 4JQVA 4URKA 2DIBA 2QZAA 2OMWB 1A1OB 1R5VA 3NJLA 4HKBB 4KK9D 4JRLA 3SKNA 2YPLD 4Y2DA 2GTQA 3FCTA 1QASA 1I9JH 2MQGA 2MCMA 1E43A 2PXYB 2ZXCA 4KX7A 2H2PC 3V0VB 5K9KA 3SE3A 5BRZB 1MPAL 1FYTE 2WB1A 4K7PY 1OB1A 3BN3B 4GI8A 3GMLB 1JPSH 5GGRB 5EOCH 1B0IA 5HHME 5A43C 3FFDB 2JQMA 4ZOBA 4R0LA 5HGAB 3NMEA 5F0JB 3ZE0E 3LIZA 2D0GA 1S4IA 4JZOA 4HPOL 4JANA 5CSZB 1DFXA 1RP9A 4PR5A 4X4YB 2PCYA 4WZ9A 2XTLA 3PGDB 5MEPA 1QUNB 3FQTA 2MKLC 4WUUB 2KL6A 2UUDK 4P99A 3ROOA 3BP4B 4AYDC 4S10A 2NT0A 5B38B 2BVQB 1SEQH 3KXFD 3VXOB 1Q0EA 2V2TA 5IQNA 1CLOH 1QTSA 4X0NA 3F7KA 4FG6D 4LOVA 3CLWA 3GS7A 3U9UA 4OZHF 1J0YA 5DEFB 3WSQL 2FO8A 2XN0A 3IJHB 4K71C 3MV01 2FQFA 4ZDHA 5HGHB 3Q5OA 3C8KA 4BH7B 4WK0B 3KLDA 3EYFA 1R4XA 3LVEA 4MYPA 1HT6A 2GI0A 1PZ5B 1FFPA 2BMKA 1YEIH 2NY4B 3AQYA 2A9AA 3GK8H 2BXZA 3G5XB 4RNRA 1TQCB 2HN7A 3HFFA 5B21A 3C5SB 2FIKB 2KZKA 4IU3A 4U1JA 1MW3A 2ZXGA 1FHNA 2OMBA 4GPVA 4JFOA 4FJ6A 4F9LA 4CN1A 2AQRA 2QADC 3KM1A 1KB3A 4AMWA 2X3BA 4HOZA 4G8FB 3MXWL 2FR4B 3RE0A 1U33A 4N8PA 2BSSA 3CFJB 2FECL 2ZYSA 3FT2B 5FOBB 2GVYA 1ZVSB 4GLRH 3VFMA 4ZOAA 5EF1A 2W7ZA 2AZAA 1YMME 3MOAH 4TUOB 1XIWD 1YEGL 2EDHA 2ZPKL 3WIHL 1GAFL 1TZGH 4ALAC 4M48L 4NJAL 1WUNT 5IEKB 5D5ME 4FLOA 5K9JH 4XO5A 4W6YB 1TUPA 5EC2A 4KKLC 3BP6B 3I6LD 4KH9A 3TV8A 4ERSL 2JSFA 2FEEL 2QL1A 2X38A 2ED8A 2VIRA 4ZPTA 1CG9B 2HRHA 3VGBA 3O3BB 3PWUB 5AUMA 1HL9A 3ALPA 3SIKA 1HHHB 4MQXC 3J7HA 4J6RH 4ZMNA 3IT8D 1A6UL 5HHPA 4FI8A 1L9RA 1V7ML 2CGRL 4HUCA 4N0CD 3ESMA 1V7NL 1CO1A 3P3SA 5EBMA 1FO0B 2N1KA 3RIKA 4NO3A 5PAZA 1K2DA 2ERJC 2PYGA 1SHXA 3TA3D 3MOAL 1HH9A 3DX7B 5FW7A 3TT3L 1YO4A 2VYRE 2YXWA 3WDJA 4KJWD 2AEPH 1NKGA 1RL1A 2BCKB 4H0LC 2VLKD 1A3LL 5HHNB 1B0GB 4NQDE 1SNRA 3UTTB 2G5BB 1TKWB 4OCYH 4MJ4A 3NJFA 4NZUH 1DCLA 2YMTA 2COVD 2ATPA 1PZBA 2EEDA 3RWHA 1NDMB 1KB5H 2BERA 3L5WB 1RAMA 1BDYA 4HV8A 4X6CA 1SPDA 2VLRE 4ILDA 2C3WA 2VRKA 4M1CC 5HI4D 2X9XA 4JFYB 5HVHB 4F20A 1JGVH 3T1WA 3QR2A 4L1BA 4NUJA 3BAEH 5AD0A 3RWIA 1FGNH 4P2QA 4IOIB 3VFSA 1Z9OA 1N6QH 3QIBD 4BK5A 1WAPA 2WWNA 3MRMA 4O02L 3KLHD 3LH2L 4XPAL 4IOSD 2A6IB 2Z7ZA 3QI9A 3TL5A 1DLHA 3MUGA 4AEHL 4PD4K 2A4ZA 3SDAB 4ERSH 1IM9B 1D5ZA 1N0LB 3V5KA 5KYXB 4XVTH 5CLYA 3WXVL 1IC4L 2B2XH 2NW2B 3RTQD 5JHDA 5D7JB 5FFOA 3NA9H 4YDZA 4Z7NB 1JXFA 3TX4A 4WEEA 3MX0B 4L8SC 1SDDB 1UOKA 4MAYA 1URIA 4XNQA 3JTTA 5C0NC 5EU6A 5I2IB 4B6ZA 4J4PC 1CD1A 3QSKB 1YEKL 3LN9A 1EXHA 3NSDA 4B7LA 1ID5I 5FM5O 1QA3A 4CVXB 4K9EL 4GW1B 1YY9D 4A6YB 5FM4A 5CINH 2VABA 4O5LH 2VWEC 4YXHH 4O2FB 1BX2A 5J5EA 2H6PB 2X6VA 3CVDA 3X3FH 1ZVYA 5HYJB 3CZFB 3FU8A 4YHKH 4APQD 3STZB 3QHZH 3Q8AA 4YBLB 4AMKL 4NZRL 3H85A 4XN8A 1JGVL 3VXSE 3T8XA 1OAQL 2CGYA 3TYFB 3LZLA 3KDMA 4KK5D 1QSFB 4PJ9C 3MBEA 1ZLDA 4LBAA 4X4ME 5MP6H 4YSQA 2ZSWB 1KN2H 1TIUA 5LB1A 1OV8A 5GS0L 1RU9H 3QUYA 4ZJ9A 3ZOAA 3O9WD 3RFRA 4AL8L 2WWKO 3D30A 4RIRB 3VSVA 1D5XA 2NX5E 3HMWL 4L3CA 4TOYH 4LZKA 1MFCL 4XCYB 3CK0L 2DWDB 3F5WB 3JWDC 4F7EB 2A74C 4I1PA 2VSCA 5ISZD 2VN6A 2E9WA 3MODH 3T8VA 3VFNB 2XYCA 3VFPA 3ZL2A 2NY1B 4Q9QH 1KCRL 1OFDA 1M1SA 1QSED 2VDKL 4DT2A 4HBQA 3QJXA 3DSNB 5I5IA 1I8MB 43CAA 3FU0A 4N8VG 3KPSE 3HJEA 3MLTA 3ECVA 5BO0D 4XTRC 3GGWB 3L5IA 2Z6FA 4JG9A 1FAIL 2NZ9C 4M5YH 4Y1AB 3W11D 5BUAA 4M7LH 1FYTA 4TSAH 1SOQA 1DBJL 5JW4Q 2WVVB 4JRWA 3O11A 2JK5A 3NTCL 2R29H 1FDLH 4JW3A 2H32B 3QCUH 4KXZI 3TBWB 1PE9A 3MNMA 4X4ZA 4F5CE 2HX8A 1X7SA 4W4OA 4HJGA 1RVFL 5DJXA 4HJ0C 4YX2H 1ZS8B 4AVJA 1TCMA 3TGXA 2PR4L 2HPTA 1U30A 3BKJL 3MFGB 5IV2A 4R7NB 3SSGA 6FABL 5AVXB 2P24B 4P2OC 3MZGB 4FQXD 4HKJA 5LGJB 2BDNL 1KBKA 1BECA 1N5AA 3PQYB 2MNJB 4MDRA 4N2MA 5KWYC 3SDAD 1I7ZA 3UTZA 4HCIA 3P02A 3QO1B 1NOAA 2GIMA 3TNNB 4JFUA 3MBXH 4ETQB 2Q76A 5JXAL 4B0MB 1AGBB 2HAZA 2O61B 1M2OA 3S98A 1GJWA 2KPWA 4QAMB 4RCAA 3SKMB 1BXAA 1KN4H 1G9EA 5JDSB 4GKSA 2CO1A 4LLYB 4XPBL 2LT9A 3CFDB 4WCYH 1ADQL 4AY0A 1XF2B 1EWHA 4B9FA 4KC3B 2F53B 3BI9X 3GSNH 5C09B 5L2KB 3SJVD 5ITFA 2H3NA 4YDIH 5CP3A 3H4HA 1JNJA 1XWVA 3EGSA 1WCQA 5CAYB 4KTDL 4OF0A 1OCRB 2APXA 2C7FA 1JTTA 4XNMA 3BUYA 2WAQA 2I27N 4P23A 5IK3B 1QW8A 1XGRB 2JI3A 1CTMA 1OSYA 3NIDB 2CO6B 1ETZB 3C5ZB 3NRQA 4GG8B 3D2TA 2P45B 2IQAB 1ET5A 2K78A 1KCUH 2IDUA 3CHXA 2AJYL 4Z5RA 1XGQA 3SYQA 4NXKA 4D2NA 2OMWA 5KBDA 4YGVB 4G9FA 1ZA6B 2NQ3A 3HJ0A 3L4WA 5DJAB 1IKNA 5HD8D 4ZXBC 3NAWA 1I75A 3CCHA 5TE7L 4AE0A 3O3DA 4NKMB 5H2BA 1A1NB 1BHGA 3P30L 4LPUA 5EEYA 5KSBA 4Z95H 5IMKA 2ED9A 2OQJB 2C5DC 1EHLL 1TNNA 1LVEA 3QJOA 4HJTA 4ODTH 4QTHA 4XHJD 2P46B 5F9AC 3TH4T 1CFQA 2VT0A 1RU4A 3BIKB 3I3BA 4JFDA 4JG5A 4ODSL 2BSBA 2J7LA 3RUGF 5ALCH 4UT7H 1OGTA 2OI9C 3MRRB 4M8RA 4JZOB 3FQXB 2P43B 3OB0H 1GPOH 1J5OH 4U1LB 3UAFA 5MHSE 4NP4L 2OL3B 3WDHA 4Q9CA 5T3XH 4WU5A 4WUUA 4BV1A 4NHUB 4EE2A 2LFEA 3PNWB 1RUQH 1AYOA 1KTKE 4JBSA 3GBMH 3MNDA 2WUBL 3OMNB 4PGEA 3S4SG 1N6QL 3I75B 3QWOA 5K1JA 2OMZA 3D25A 3HB3C 2QQNL 4JQIL 2H0FA 4QYOB 3OTTA 4EZMA 1RCYA 4DVBB 2YS4A 2MRYA 1QSEA 5FO9A 2DL2A 3OR7A 1JDDA 1U3JA 1ZWIA 4JRYE 1MVYA 3PGFH 1QABA 1S9KC 2ZKYA 4LRNH 1UQSA 4AJWA 5HYEA 5AG8A 4PLJD 5H37H 5B8CB 2NPLX 1LEKA 4ELMA 3DBXB 5D7SL 3E3QC 3HNSL 2IFFH 1KJMA 1NIAA 3OB0K 3G5YA 3V0JA 4BQ8A 5I0DA 5K1NA 4FEIA 4DGWC 2XN9D 1V27A 4ODVL 2VKWA 3ZU8A 5DQDL 4U1HB 1DR9A 4IRJA 1NBZB 4JZJB 4K15A 4QXGL 1JE6A 5BV7B 4LLQB 2HWZL 3BSZH 4OGYH 3LNFA 1DQKA 1BZ9A 2BSSB 3RWFA 3WNIA 3FBKA 1FVCB 1RZFH 3APFA 3RA7L 4HH9B 4L1TA 2VLRD 2Q7NA 2OR9L 4WWKC 1ILSA 1MW1A 3X14A 3KEHA 2F53D 4ZTOH 4EI6B 2F74B 3AQDA 3MROB 1T04B 1NGPL 1MCEA 2WC7A 1IBYA 2CXKA 2K7PA 3QZNA 4PBXA 2W81C 3QJSB 1UWYA 3QXTA 4JFQA 3R06A 3BMWA 3QO0B 1HF2A 1TXKA 1T5KA 3O2VH 3U1SH 2EDKA 5ICYB 3U9WA 4IKKA 1S7VA 2C8NA 4W93A 2NZ9D 1CLOL 5AVTB 1H8SA 2XKUA 4YBLC 4C58B 1UACL 2EVFA 2IBZX 1KB5A 2AW2A 3HNTH 3L45A 3OG4B 4R2GD 3UO8B 3RKDC 3MUY1 4IDLA 1QPKA 4XX1E 5DK0B 1PKOA 4PI2A 4LHQB 5BNXD 3MAWA 7PCYA 1D9KC 4PJ9A 1QHQA 3QXUA 3WMSA 4O02H 1KMGA 1JIBA 3VH8A 3FO2A 5DVOA 5DZVA 3DVGB 2WNGA 1SXCA 1UATA 1F3JA 5F89A 3FULA 2O93L 2G5BA 1GL4B 2HTLC 4PJIA 2VRQA 1N6UA 4NO5B 4BRJA 1PL3A 3NBNA 5A40E 5E4IA 1UCTA 4G6FB 3WFCH 4HS8H 2GSIB 3ZR6A 3FT3B 3KVQA 1KGCD 1MHPH 4U1SA 1I8UA 5JLZB 1DQMH 3OB8A 1UM4L 1RIUL 3HUJE 3ULSB 1P4LA 3VXRE 2H3KA 2JCCE 2BCMA 1CFVL 2ESVA 3JWDL 3LRGA 2PO6D 3FU7B 3TBTB 1CXEA 1IAOB 2F54E 4QHPA 4BUGA 5J6GA 4HIHB 4LQ1A 4WFED 4KVCL 1XIWB 3UBXA 2J8UF 2WZ0A 3QDMB 4HLZH 4F8OA 4GUOA 3UYOD 1ZE3C 1IC5L 4OJAA 4XOEA 1A6TB 2H47C 4QO1A 5EU5A 1TYWA 4MXQC 5DT1L 4EN3B 2KMWA 3MX0A 5KSAD 5D7IB 2VMFA 5JIQA 1EJFA 2RHEA 2WXMA 3KLLA 3MA9H 5BQDA 4HAGA 3BWUC 4CJ1A 1XH3B 2KZWA 2DQJL 3BGAA 1BAGA 4F2FA 3DJZA 1DDHA 4U1KA 3UIYA 3FRPB 3NACH 5FUCC 3QYMA 5LCVA 1MRCH 4Y7MA 3AS1A 3GSUA 4H0GA 1HCZA 4XB8A 5GGTL 1D6VL 2BX5A 1QKZH 3AS0A 4JEGB 4O2FA 5HDBE 4YZAA 5GGQH 1KLUB 4WTZG 4X7TB 5GRVK 4XLAA 2EE0A 3FB7A 1MRDL 2YFNA 5D96B 3WY1A 2B1HL 4Q9RH 5IR1A 2O5ZL 3MCG1 5BQ7B 2C9QA 2YJQA 1OIOA 4J3UA 4N5EC 1UC6A 1H15B 1UENA 1NGWB 1YC7A 2HG5A 3IJ9A 3SYOA 1NBCA 4MJIA 4PRPB 4AJYV 2FNBA 2CJTA 5IFHH 4WFGD 2AK4E 4FS0A 2DQ6A 4RH4A 3MBEB 4X42A 4PW9A 4BWWA 1QEWB 3MN8A 3V4VA 5SWQA 3AXLB 3Q3GA 4GRLD 4G5ZL 4XVJH 2ZXAA 1ET7A 3VSUA 1UYWL 5DO8A 3LS4L 4WF7A 3NQKA 3KLSA 2NY5C 1FNEA 2OJZH 1KTDA 1P2CB 4I89A 4R4BA 1WFMA 3U4EB 4I3SH 4MXVE 2ROXA 3PAYA 2IPTH 5I1LB 4JN1H 4XCEB 2CKNA 4KX8A 4XXDA 1JPFA 1H3UA 1NFIB 2O5YL 2CHZA 2XVKA 4ZTEA 2X4TB 5G2NA 4PLNC 2VM4A 1H9DA 1FL6B 2W07B 3AU0A 5DWPA 1FZMA 5DRZB 1OOCA 3RVUC 3D06A 4NYLB 1UJ3A 4F58H 2WTRB 43CAB 5DXWA 1IAMA 2XTJE 2WUCL 4RZCB 3EG9A 1J9TA 5IB1A 4FG4A 4YXKL 3IKCA 1U3HA 3KEDA 4RFEB 3TPUA 3IPEA 1TU2A 3VG9C 3HA0A 3CN1A 1R5VB 4P2RE 5ETUA 4CSSA 4IM8A 5C07A 5JW4N 2JK5B 4S0TD 4YZFF 1PFOA 1C7SA 3MHZA 5T3ZE 1A66A 1E28B 4HJGB 4G9DA 4JRXA 3VB9A 4MAUH 4UV7H 3T2NL 3OPZL 3B8YA 3HI6L 3QXAB 3AM8A 1OE1A 1HSAB 1RIVL 1OT2A 4BYHA 5AVSB 1G4RA 2J2ZB 4G6KH 3QQDA 5JHDE 4OLXH 5D1ZI 1X44A 1EHXA 4JANB 4L2YA 2K6WA 1W91A 3IS0X 3M1OA 1RUKH 3NAAL 2PYEB 2VQ4A 2GC4C 3OQRA 4KKAD 5HYSG 5A2KH 3L7EA 5M95B 2YQGA 4GUPA 3I9GL 1P5UB 5E9DE 5LWYL 4LLVA 3IGLA 2C9XA 1W72H 2V2TB 3QEHB 3V4UL 1DCEA 5TFSH 2X6WA 4RSYA 5I18H 5KSAB 1ONQA 1BQLH 2C9RA 5HP5A 1O8GA 3P77A 1FL3B 3DDFA 3NFSH 2ADIA 1F4YH 3AG2B 3ZRFC 2B0RA 4X6EA 4OF6A 5D4IA 1XCXA 3BLKA 2YSSB 5LBSL 4XNDA 5A6LA 1D5RA 4MJIE 3FQ2A 3DROA 5I6KA 1F11B 4NQDA 2BMKB 4G6KL 3RDTA 5HHQA 1TEGA 4JM0A 5JQ6H 3B37A 2IPKB 2Z91B 2GJPA 3CXFA 3L4XA 5FHAL 4MQXD 1M6OA 1YN7B 5DJYA 4JFED 5HXMA 2YPLB 5I75B 2R2BB 2XT4A 1X5YA 2W9DL 1J8SA 5DS8A 4JDZA 2J1ZA 1ROCA 3TA4D 3BPCA 4DPRA 3II1A 2AJZA 1UM5H 4P2RD 4TXVB 2WN2A 1AACA 1UKTA 3LYCA 1AGCB 1P6FA 3LKQA 1JTOA 2CO2A 3ESVF 4MNHB 3U25A 3KLKA 1A7PL 1ZA6A 4AQ1A 3VXMD 3WKNA 4TSBL 1T3FA 3VXTA 1BQHA 1GS7A 3LAFA 3F05A 1OK0A 2NX5B 4Z77B 1KQ5A 3EJUA 5HHVH 1AZVA 4FYSA 1IB4A 3E80A 1SN5A 3S34L 4FQJL 4HWUA 1LE9A 2G9HB 3BP6A 4OIIH 1Y0LB 4L4VA 1YNLL 4NQCB 2TSBA 4F9LC 43C9B 5CKAA 4JFDB 1XD0A 4QNPE 3RWDA 1TTBA 1NBYB 4YC5A 4W4NA 3NH7L 1JGLH 1OGTB 3BSZL 1RURH 4OGYL 1AS8A 5LN4A 2X6BA 1RPKA 2NXYD 4CL7A 3IJYB 4RETB 2NY0C 4QHUA 3CV5A 2WP3T 4K23H 4YELA 2DS4A 2N01B 5C0IB 5KSBF 1W8EA 1NBVL 4S1RL 2NTBA 2O17A 3VMVA 5J12C 1HH9B 3DX7A 1OP3H 3DI3B 4HVBA 3GSQB 2WAHA 3TO4B 3N5AA 3SZKC 4PS7A 4ZFFB 3F85A 3SJVB 3IAPA 1IX2A 4PMEA 2JQAA 5FO9B 2HMID 1XGPA 3EBHA 1AXTH 1TENA 2EE6A 3ES6A 4LCWE 3DKHA 3EOAB 1TKWA 1LWRA 1KJ2L 4DNLA 1O6SB 5C6TH 4DGYL 3E1F1 4JN2B 4M7ZB 5D1XA 1IO4C 1T1XB 2B8OT 4JO3L 3GS0A 4NX0A 4ONHB 3T1FB 3ZSSA 5B4MD 5T1JA 3GJFA 4JHZA 3SZ6A 3TFKD 4R8WH 1GCYA 1WDAA 1A4JB 1MY5A 5I16B 5C7XH 4NRXA 1DBKL 1IEBB 1YMMD 1YY9C 1QYGH 2JQZA 2HPOA 4PIBA 3OMZA 5F70A 2A6IA 1KIRA 2V7HA 4MX7B 5E1HB 3SYCA 4E5XG 2UVFA 4OLEA 4W6WB 4ORZC 5DK2B 1XF1A 3MRCB 3SPVA 5KYXA 2P80A 5L6YH 5DYFA 3P3YA 2C9SA 1GOHA 1MCJA 5FOJA 5BS0E 4KMTH 3N6ZA 3PXJA 3BN9C 4CU7A 2H5UA 3DX3A 2ZPKH 1HHKB 5AZ2L 3EDKA 1ZANL 3KPNB 4NDMB 1KOAA 2IGLA 2R4SL 4FFWD 2JE8A 4HU8A 1JVOA 4XNQB 3APMA 2JB5L 3EO1A 4GBXC 3KNBB 2GEEA 2ENQA 1OTTC 1LHZA 4QHNB 1E42A 3T65A 1CD1B 4Y5VC 4TNWF 5LBGA 2DMCA 1QFHA 1PNDA 2MOGA 4JFQB 2NZ1A 2ZX9A 1G1CA 4YBQD 5FO7A 3TBYB 1O5DT 2Y9RT 3L3OA 3I02A 1SZNA 3FQWB 4UIKL 1UOLA 1S7WA 3QPKA 3V6BR 3EJCA 3IFNH 2BNRE 1IEAB 1JV5A 3NK4A 2IOIA 1YYMH 4NQED 5EU3B 4QXGH 1T5WA 2ZF8A 1E4XH 1AO7D 3ABMB 3EH4B 3SKNB 4HJJH 4AIZA 3JWOC 4KITB 4LNRB 4E9XA 5L7XL 3GMPA 5G4OA 3DIVA 4MA1C 4MQ7B 4FLSA 5D7SH 3V0VA 5K9KB 2B3IA 4OGAC 1J88A 1OAZL 4NQCD 1RIHL 2JV6A 3GHEL 3FCSB 4GQ9L 4R0LB 3IDNB 2EYRB 2WQVA 3FT3A 3VCLA 3Q2NA 1IGTA 3RX9A 3KD4A 1FGNL 3DURA 5D7JD 3E9UA 1PY4A 4RFOH 2DQIL 3DX6B 3ZYOA 2J4WL 1I3GL 1U3HC 4A7TA 3K6DA 1KIPA 3BP4A 3H3PL 3NCJL 2KH2B 1E4WH 1G7IA 3QHFH 2XACC 3MLTB 4H8VA 5DMIL 1OXYA 3B9VA 4B96A 4FABL 3PWPB 2L7QA 3KPPA 4PREA 3WIHH 4UT9L 1W16A 3D39A 3NGBB 5DEJA 5ECGA 5F7YC 2TRYA 3C8KB 4GAFB 4GRMA 1U93B 4BH7A 4FA7B 4ODWB 3BIBX 4ZS7H 2VFNA 1FORL 3GSVA 3VFGH 3INOA 4JHAH 5DFAA 4X5LA 2H1XA 3MNWA 3W2DH 1PPIA 1RJZA 2BHZA 4X4XB 3OLGA 1TVBB 2VMJA 4EQ3A 2XWTA 3BVXA 2VZUA 5EIIA 3KZ8A 2VJ8A 5GS0C 1PZDA 4TQ8A 5D72L 3DOSA 2R1YA 4NAQA 4YFDB 1R3LB 4MMYA 4G7VL 3TVMC 5KSUB 5KS9E 2X4OA 3W39B 3ARPA 3T8MA 3C6LA 3L16A 2FEEI 4JPVH 2A4CA 4XC1H 5E6IB 1BQHG 5GS3A 4BZ1H 3G6JE 4Z7VF 3TNNA 2EYTB 2B4CL 2W38A 1SMOA 2WLMA 5F8RC 4L3EB 2HG5B 2ZTBA 4XBGA 4RMRA 3Q2VA 1EDYA 2KLRA 4W4OC 2AGJH 4AQOA 5HPMB 4JDVB 1L0PA 5JDSA 3VNZA 3V4VB 1A8ZA 1U42A 2F53A 4R4ND 4CBPA 3CX5K 4YGAB 5D55A 2LU5A 3IXTB 4DP7X 3WTWA 3MJ9L 1HH6A 1S5HB 4OZFB 3MOBL 1UWGH 4LU5H 4X5PA 4D8PB 2VISB 4PJCF 2VR8A 1ASPA 4GSRA 4XNMB 2IGFL 1A4AA 1AHMA 1D9KA 1N59A 2JFCA 3MGTA 4IIQB 4Y19D 1UD3A 4F3FB 2RBLA 2YD2A 3MRFA 2LGNA 4W9EC 1INEH 5EBMB 3C6SB 5EFIA 4JREB 3V7AG 3U4AA 1FIEA 2YK1H 5IP4A 1C5BH 1M42A 4FLHA 3CSTA 4TRPL 1O5PA 3L5JA 3ESPA 4NCC2 1A3QA 3BKCL 1OTUC 1IRAY 1ACXA 2NY7L 4Z3IA 4OLYH 1KENH 3TH0A 1K4CB 2Q7AA 1XFPA 3Q1EA 2NY2C 3HUJA 3VXRA 3I9AA 1A9BA 1XGZA 4N0UA 4OTXL 3CFEB 3PYCA 1YECL 5EZOL 1NGYA 3L9YA 3NPSC 1KLGB 2VUOA 4QTHB 2OI9B 4GG6F 1F4WL 5K39B 2B9BA 1BQLL 3MCLH 4Z3FA 1MHCA 2E86A 4I18A 3CSGA 4OF5A 3G6DH 1AIRA 1A0QH 2O5ZH 2H2SD 2AQ2A 3THML 3C09C 3CH8A 3KPQB 2DWTA 3LKRA 1RHHB 3MLYL 2Q87A 3VXME 3WUWB 1AMYA 3L7EB 3MDJA 3T0EB 4FXLA 3MLWL 5JORB 1UCBH 2EVIA 3ZW3A 2EUZA 1MCLA 5EUOB 4ELMF 3R8QA 3MO1A 3PWPD 5KW9H 4QD2E 4AX3A 3D5OF 2WLLB 3MNZA 3O6LH 2EO1A 1V54B 3I9PA 4JB9H 2ZUTA 2XVGA 3P77B 2V17H 4ODXB 5DURD 4N90E 5D1XC 2DEXX 1QSEB 2BHYA 4XP5H 1DEDA 1JGEB 2NNAA 2MJWA 1KGJA 2VRAA 5D7EA 1YYCA 4XN5A 1ACYL 4RQQB 2YSSA 4BSVA 3ZXAC 3VMPA 3KXFB 3ASWA 4RBPH 1SBSL 3V4PL 3VE0A 4MSWA 3BKYH 2V6HA 2XTWA 2ICCA 3RJQB 2D3VA 4MB3A 3CK0H 4KQ3H 5L8KB 5E51A 4BZ2H 4M3KB 3SO3C 5KYUA 2HVKB 3DPDA 5HDRA 1NCIA 2X6UA 2W60A 3CXHJ 1HE8A 1DBMH 1AG0A 2H2SC 1OFMA 4LVOB 3ZN6A 5EOQL 4JZJA 1I4FA 5KZCB 1DQLH 1KBGL 1O0VA 2XICA 3QWQB 4O2CA 1JTAA 1QLFB 1OSZB 1GJUA 3D52A 4FJZA 3GM8A 1DBOA 4M6OL 1PDKB 4P5MA 3BO8A 3MLRL 4GBXA 3CVIL 5DEGB 3W82A 1WFJA 2VH5H 2CK0H 4XVUC 5I26A 9CGTA 1KSRA 3VWKA 1WBZB 3LN5A 4WUKL 3S36H 1DE4B 4HXAH 3OMAB 4U1IB 1LE9B 1N68A 4DN3H 4RIRA 1HAWA 2ENSA 3OR6A 4ZUWB 3TEXA 4WW2F 5MERB 2MHAA 4N8CL 4HLJA 1AS6A 1EDQA 5IF0A 5E08L 5D93C 1EBPA 2HFTA 7FABL 2W0FA 1U8MA 3BT2H 3MRPB 1HWHB 3LRKA 5DA4A 4Q7DA 3QJQB 5F7HA 5DK0A 5EA0H 1ZPUA 4L1LA 5EORL 4ABQA 3RA7H 1ZHNB 1K72A 3TO4A 4J39A 3VD1A 4RA3A 2VZOA 1N67A 4DPAX 3DVNB 3FB8A 1B0RB 3C5ZD 4A2HA 4M56A 1MJUH 4U7KA 3EYOB 3JUYA 3MJ8B 4JQIA 1E9PA 4NO5A 5CEYB 4XBPB 2R2HB 1YCSA 3WSQH 1MN4A 3OZKA 3CC5A 2GQHA 3P0YH 4FQJH 3W9DA 1A6AA 4DCQA 1VIWA 5B1CA 2I7OA 3BQUA 1GZHC 3CDFA 3IFNL 4OUUA 1ANUA 5I16A 3JYCA 2FLMA 2ZXDA 4Q89A 5HYQA 3BVWA 2V37A 2FE0A 3FB6A 3IDGA 4OLVH 4ZXBD 5GGUB 1T2JA 5D2LB 4PRIA 5KTEH 3Q06A 2C7UA 4QNPF 4LCCA 4WVRA 5FYKU 5ICXB 3VXNB 1DL7H 1LP9A 1NC2D 2DD8H 2CCLA 3PG2A 3OX8A 1FFQA 4YZFE 3S8WA 5INDB 3UJJL 1V7NH 1AGBA 4F57H 4EMZA 3GUTA 5DD0H 2ZQKA 3CH1A 5DURB 4Y4FB 1A6WH 2EH8H 1UASA 5IQ7H 5I19H 1CXIA 1MI5D 5LVEA 4LLYA 1FFOB 4P3DA 2P28B 1K4DA 2ZOLB 4TUJB 3RVTD 1KCCA 2OX5A 3LN4B 1IFHH 3VYPA 5C08B 3GD1C 2QVIA 1TPXC 3EYFB 1JYXA 5KJRL 2R1WB 1OO2A 1P53A 4WJ5B 4N2EA 2NXYB 2G2PA 2ZE0A 4RRPG 3NP3A 1IQDB 5D4HA 4BWUA 2ZP9A 3WLBB 3I02B 4AYBA 4GW5B 4BSWA 2EXWD 1ULVA 4PCSA 5BJTB 1L0XA 4QRUB 2OL3L 2PCPA 1LEIB 3AWEA 3FFOA 3P9WB 3GF8A 2AEPL 1T5WB 1OOWA 3CMOH 2HZHA 1ZVSA 2LU4A 4QYAA 5F9OL 5H37G 5FO2A 1KJ2H 3VU1A 4WHTA 4AW4A 3DO4A 2P4AB 4HXBL 1IM3B 3SDAC 4FHKA 5E8PA 1GGYA 4FQQB 5FWQA 4CA4A 5KVDE 1QFWI 2WKOF 1F4XL 1HILA 4Z3GA 3RPIA 5BZWA 4ADGA 3GJEB 5E56A 5J56B 3MRQB 5MEOA 3LJYA 3Q6GH 1W0YT 3NYKA 4KKRA 1LDPL 2F5BH 4R4BB 3C6EA 5CJXC 1E9OB 1YEHH 4UQ9A 3SE6A 2R83A 4HQQH 3BEWA 6TAAA 1WTGT 4NNYA 1IL1B 1AKJA 2Y1VA 4UTBA 2N0KA 3FQXA 1DJSA 4ATWA 3BAKA 4Z0XA 2DQTL 3QH3A 1JYWA 4HUNB 4CILA 4GRLA 1FL6A 2W07A 3DX6A 2CXGA 5I5RA 3AT8A 2WLHA 1KIPB 2WTRA 4RMVA 4MZ3A 4LIQH 4XT1C 5FGSA 2ITDB 3REVB 4BXSV 3RWGA 4EIZC 1OQOA 1RZQA 1CLWA 4XAKD 4L4TD 1F1DA 4DP4X 2X6XA 4Q6IC 4IDJH 4JY5L 4G6AC 3M88A 4FTVA 2YRBA 1PKQB 4H5SA 4PLKD 1FLRH 4GRMB 2IWFA 1T7VA 1U91A 3IGUA 4N28A 3P0VL 4PU2A 2XX0A 3ZTJH 2XV3A 4B5EA 4DUWA 3TA3A 3BH7B 1H3WM 5B22A 4X6CB 5B8CA 2OZ4L 3QIUA 4JG1H 2I9TB 2VLJE 2AQNA 1INDH 2ATAA 4PHZA 3L3HA 4M7JH 1F8TL 3QVAA 5SX5K 4JFVA 5AD0B 3G5YB 4YSPA 3X1BA 2WJ7A 3KPRB 5JNYB 5A3ID 5E94A 3QWRD 2X53A 1NDGB 2I69A 2X1QA 1JRHH 3LNGA 1F4YL 2IWEA 3MOBH 4LIQL 3TBVB 3R0MA 4H26A 2Z1PA 3RI5F 5IB3B 4BZ2L 2IAND 2N4IA 4RISH 5FWRA 4Y4FD 4YWGH 4EVNA 1Z66A 3X14B 2HKAA 1DQQB 3AFLA 4JDVA 4UI2A 1SGKA 5AAPA 2AK1H 4XO8A 2NYYC 1OTSD 2F74A 3MROA 1O8EA 3ZKMC 4ZYKB 5TDOB 1HFUA 4DKEL 2D3NA 3D3VB 3BAIA 1LYQA 2YSTA 2FQDA 4XOTA 2XWDA 3DC0A 1H19A 2KQMA 3QPXH 3KL5A 3U1PA 1NMBH 3FFCB 1OKEA 4AIOA 4ZNCD 3FUDA 1KB5L 2UWEB 3PE9A 4AL8H 4WNJA 2CHDA 2RIKA 5SWSE 4YIQB 3HNVH 3BAYA 2F18A 4D9RD 3D6GA 3RYMA 2VKXA 3FOLA 3O6LL 4H25A 4PVLA 3FTSA 2ENPA 3J27A 2AXGB 4ZG1A 2MH4A 4KVCH 4KNQA 2P5WE 1OGAD 4R7LA 1OAQH 3L3GB 4A67A 4DFIA 1FPTL 2JELH 2YMOA 1BGXH 1VGEL 3BWAB 3CZLA 5F7BA 3VWKC 3UGUA 1F42A 3ARBB 1KB9J 3DVGA 5ALBL 1FWXA 3EFFA 4X8JB 3V0WH 3WL9A 5I8KH 2ZSWA 2YJLA 2A6DB 2K6YA 1WSST 2OR8A 2PXYD 1FNHA 2VLME 2UZXB 3MRBA 4PJFF 5F88A 3VQLA 1OFLA 1NGYB 1PJ9A 2DQDL 1NIDA 3WD5L 3EUUA 5JW4R 2P5WA 4OGXL 4A68A 4XCYA 1M4KA 5CP7A 3E8VA 1FNGA 5JPMC 3GTTA 3H42L 2JCCF 2VUYA 4OCRH 4U7SA 5E6ID 3CN2A 4X6BA 5SV4A 2HSIA 3UAJA 5DQ9A 1ZTMA 2ESVB 4JFHE 5DZ9A 3VD0A 1B2WL 4AQ1C 4OZ4A 1MFNA 4RBPK 5J6GB 5ERWB 1CE6B 3VW3H 3AITA 1TVHB 3EFOA 1JERA 4HHAA 4DGYH 3BH6B 2V2XB 3GZQA 3QRLA 4AJVA 1JPGA 1G84A 3VI3A 3Q05A 4QO1B 1B9ZA 5TF0A 2GUYA 4Y88A 2NY5H 4WENB 2JB6A 3IGKA 4JFEE 2DLIA 3O2DA 3FCUB 1IMHC 1RULH 4Y2DC 4ADJA 4NQQA 4U1KB 4A2DA 1T1XA 3NZHL 5AALA 3GQAA 2J56A 2WBKA 2Q2EB 3FHAA 1WBYB 1I7UA 2AERT 1GTFA 1FYTD 2XWCA 2ZWNA 4LBEA 3QDGA 5C0CE 2NY4D 2QZ5A 3KPRD 4MKTA 4L4VD 1BVKB 2P24A 1E3ZA 4MMXC 4F91B 4YHOL 3PDOB 4H8QA 4KKLD 2NX5D 4G3YH 4UV4L 3WJJC 4LIQE 4Y4HC 4PJAE 1EA0A 4CRPA 3MRCA 2Y72A 1OSZA 3KS0J 4GI9A 4OM1L 3SPVB 5IEHB 4BFGA 4E41E 1U2HA 2JJVA 3JZYA 1PDKA 2QADD 2BNUA 2CDFA 3VXSB 1QOKA 2Y1AA 1EZSA 4XMPH 1RULL 1A25A 1W0WB 1VFOA 3UJTH 2WOYA 1WRFA 1BBDL 2AEWA 1KCSH 3P0GB 4FQIH 3T65B 5GGRY 3EGSB 1HI6B 5IBTL 3BGFC 1NJ9B 2GY5A 4P2CG 2NY2B 1AJ7H 2EH7H 2YD9A 3MLVL 4KH3A 2Q8BL 4W1TA 3D18B 5JXEC 3FQWA 1IBFA 1BFOB 5EUKB 4F57L 1FZMB 2I26N 2XC8A 4JM2C 2CSPA 2Z7UA 3HC0B 1FIGL 1EIBA 3OSVA 5I73B 3FZUD 1WFNA 1WAAA 5B1JA 4OJCA 1HU8A 4G6MH 1TF4A 5LDSA 4YCQA 2YKLL 3QUHA 1JBJA 1SMDA 4PCTA 4XN2A 1R3JA 3IN2A 4JPWH 5HVHC 5FIEA 1YMHB 3PWLB 4QLWA 2HT4C 4L4JA 1HNYA 4CVZA 2ATKB 3O3DB 3UCRA 3JTSA 3OKMB 4XMLH 3RUGE 3OAUH 4P2RB 3HG1B 4MHHI 5IMKB 1E28A 2CO4A 4NQEA 3FCSA 4PJFB 2D8KA 2FLRT 2IOMA 3BH4A 4L29A 5KSVA 3R8BB 3QXAA 1S7RB 1SJXA 2NCMA 2J2ZA 1IGTB 5DVLA 1RPQA 5HYQB 3MPCA 2FLBT 2OMYB 3JWOL 1P4IL 4OFQA 4TVSa 1T7ZA 2R1XB 5IWLC 4HIXL 2Y7QA 5F3HB 1NIFA 2EDQA 3GSWA 2AQSA 1RZIA 5EO9B 5EZPA 4PRIB 4OCNC 5HJGA 4GUPB 3UTSE 4HALA 3T0WA 1C8PA 3MLUH 3QEHA 4F9PC 3LJ3A 4NKIH 5FA3A 5HD8C 4PGEB 2H8PB 4PV8A 3DOHA 4C56B 3OKNB 2NXZC 1XEDA 5DD1H 4GKNA 3DSFH 1UG9A 5F6IB 3QIUC 1K4DB 1FFNB 2ZOLA 4TUJA 5F6HJ 1PLGH 2QBWA 3L3JA 1O9ZA 5AVZB 3CMOL 5F9OH 4YDKL 5TTRA 3MV11 5FGBA 1I1RA 3EXLA 2A83A 1RJZB 2OZNA 2F08A 3QULA 1USQA 3X12B 2I85A 2FRGP 3M17A 2XTSA 3OJVC 3ZYZA 1ZTXL 4U05A 1DQIA 4IU2B 3L2MA 1ZT7B 4P5TA 2Y69B 3IEAA 5DUPH 5C0BE 4U1HA 4EDWL 3IWVA 1KJ2B 1NCAH 3QJRB 1V7MH 2V9UA 4JO1H 1T21B 5CFHA 2WWMD 5ACLA 4XBEH 4WY7L 2P5ED 4N5UA 2Z35A 2FD6H 4FQ2H 2E6JA 4OZFG 5LAXA 4P4KC 3HG1E 4Z7NF 5I74C 2DI8A 1YMMB 2A0LD 2XN9A 1IM3A 4HCFA 3ZTJG 2DM2A 2PP8A 4JVPA 1GA2A 2RMNA 4RAUB 4QHKI 3SDDC 3ZDYF 4CW1A 5KOVC 3MRQA 1RZJH 5GZOA 2X09A 2OYKA 5EF2A 1Y0LA 3GRWH 4H8UA 1CGWA 3LKSB 4DO4A 2HJFA 4KNSA 5G5DB 1VADB 3VI4F 4FZ8L 3O2VL 3BEWB 4PRPD 2CBQA 5GRJH 1EGJL 1BFTA 1J0HA 5IT2L 2V0AA 1HINL 3OLEA 3WFHB 4AE1A 4DSYA 1HC1A 3O4LD 1S46A 5BZDA 4HBCL 4A2MA 1GMIA 5E6UB 1TOXA 5I1EH 1E67A 4V1DE 5K9QI 1U8QA 3T3PF 4IBSA 4MXWL 5IGXL 4LLDA 4Y4KC 3C6SA 1DVFC 3EOBA 4NGHL 5EFIB 2VL5A 1RMFH 3BZFA 3HMXA 5TE4H 3KPMB 3TH2T 5C0IA 2O04A 1QFWL 2BSTA 3OPUA 3WIHA 4PJ8C 2VAAA 3DX9B 4LAJH 3PWVB 4O4YH 3GSOB 3MBWB 4CN6A 3S35H 5DTFA 5C0CD 3OHXC 1WWBX 3RL2A 2X44D 4H5SB 4U2YA 5HJ3B 4I1RA 3GWJA 1JTPA 1VZHA 4N0UB 3OPZH 4AGPA 4Z7UA 2C3VA 4ONHA 3K4AA 4NHCH 4F8LA 1EGJH 3B6SB 5C0EB 5IB4A 3PP3K 3DXAD 3GHBH 5CCHE 2WQ8A 2YARA 1MHCB 1E40A 2QMJA 3C5JB 4LCCC 3TFBA 4BA0A 1BYPA 4F8NA 2OXGA 3V0IA 1JI2A 2H0JA 1C1EH 1XH0A 3QNFA 3NZHH 5I6OA 2CLRB 3EJPA 1TMCB 4P04A 3MXVL 5SX5H 1KBVA 3PQYD 3SDCA 4TVPL 4HIHA 3RNQA 3ATEA 4N9OB 1MFBL 3N9GL 1F4AA 2BOCB 4N2OA 4G11A 1IIIA 3U2SA 1YN6A 5DRNA 5CCKL