3VSTA

The complex structure of xylc with tris
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
molecule keywords Xylosidase
total genus 238
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vstA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vstA01
1TQUA 2YIHA 4PSRA 4OIFA 2GVYA 1PAMA 4H2CA 3L4YA 3KL3A 3EQOA 1BG9A 2PWDA 3DX1A 1UH4A 4JFVA 4HOWA 1O7DC 1CXFA 2XIIA 3WY1A 4B9ZA 1S46A 2UVFA 3GBEA 2OYMA 5I23A 1VFUA 5CGTA 1PEZA 4W8TA 1Z32X 3H55A 1OOCA 1MVYA 3ZSCA 4OJOA 2E8ZA 4UQ9A 2WPGA 2ZWYA 4XQFA 5E0FA 6CGTA 1WZAA 1TMQA 2Y24A 1UKSA 4J3UA 1DBGA 3M07A 3VGFA 4YZXA 1H3GA 7TAAA 3VGHA 3HG2A 2QPSA 1B0IA 3CZLA 2NT1A 3D52A 3HG4A 2ZX8A 2VT0A 4J3VA 1IA5A 1IB4A 3UERA 1MXGA 4XM3A 3BLBA 3DX2A 1OGMX 1XH2A 3LXAA 4XOPA 5E70A 3KE0A 1XGZA 2ZUWA 1HL8A 3VGDA 4GINA 4JCLA 1BSIA 1R47A 5CLWA 4FNRA 4OZYA 3B8YA 2YA0A 2EWEA 2X6WA 1XSKA 3LMWA 1KCLA 2WKLA 1AIRA 1KWKA 3VGGA 2DH3A 1UH2A 3D4YA 1ZJBA 1CLVA 3GRHA 1XD0A 1HX0A 4XN0A 4Z06A 3VNYA 4DO6A 3BUPA 4YZAA 1OFMA 1CPUA 2WVVB 3EDKA 2F61A 1SZNA 1I75A 3GQ9A 2ZICA 3WMSA 2BY3A 4QAWA 1CGWA 3BAYA 3BC9A 4AYGA 4E2OA 3BSHA 2QY1A 1EHAA 1NOFA 1PJ9A 5A2AA 4NK8A 2V3DA 3EJRA 1KCCA 2X2IA 4OZZA 1VIWA 4H8HA 4AYSA 1JF5A 2BXYA 3CGTA 1QHOA 1G5AA 2ZIDA 1PZ3A 1AQMA 4AIEA 4M56A 3WDJA 3VMNA 3AXIA 2ZUTA 4FLQA 3RILA 1PXZA 3BAWA 3AXHA 4PCTA 3EJTA 5I24A 4LQ1A 3VU2A 2OSXA 4FLRA 1V3MA 2BXZA 4FLSA 4UQDA 3UCQA 1OGOX 1KXVA 1BVNP 3BUIA 2WVVA 1EO7A 2EABA 2D3LA 1VFOA 1IZJA 2OYKA 4UZSA 2WVSA 3A4AA 4XONA 1HWWA 4U33A 4HA1A 1HTYA 1Q4NX 3UG3A 1EE6A 3ZPPA 1KBKA 1X0CA 5C1EA 3BVUA 1O8FA 2E8YA 1BHEA 3S2CA 2BSPA 1O88A 1SMDA 3CV5A 4LXFA 3VSUA 4X0NA 1T0OA 2CHNA 2F7OA 4GO9A 3CZKA 3H53A 3K8LA 3L4WA 4UZUA 4HOZA 3T9GA 3FAXA 2EO7A 4GIAA 3WNMA 4W8SA 4KMQA 4W8QA 3OLGA 3ZR6A 5EMYA 1M53A 1QX1A 1KXHA 3TONA 1JL8A 2F7PA 3A47A 3EDJA 1KTWA 2VRKA 4WF7A 1ZS2A 1RWRA 5AMVA 3GTNA 2CXGA 4AVZA 3IJ7A 2FHFA 1MWOA 4MAZA 1TCMA 1OGSA 1UKTA 3OLEA 4CN6A 1BVZA 2WANA 2OSYA 1CXLA 1QW9A 1JDDA 2X6XA 1UKQA 4GI9A 3WNOA 2QPUA 3UEQA 2FHCA 3A22A 4PCSA 4TVUA 2O0VA 1JDCA 2XVLA 1EA9C 2OW6A 2YOCA 3BVXA 2NT9A 3D4ZA 2XWEA 5CXPA 4WSJA 1MW1A 2C7FA 1JD9A 2Y2WA 3L4XA 1Y7VA 3TTSA 3ZO9A 4M8UA 3KLLA 2V3EA 1O8MA 1U30A 3L2MA 5C1CA 1LWHA 1QI5A 3S5ZA 2E0PA 1MXDA 2FH6A 3L2LA 4XORA 4U2ZA 2VNCA 1D7FA 1PZ2A 4W93A 2BY2A 4OJPA 1AMYA 1UD4A 1CGYA 1KXTA 1IV8A 3GXFA 3VMPA 1M7XA 3DDFA 3KWXA 1R75A 3VX1A 1CXIA 2ZXBA 3AMKA 3BUDA 1TQTA 1E3XA 3BAIA 4WSKA 1HVXA 3K8MA 1B2YA 1TQSA 1O8DA 2F7QA 3BVVA 4UCFA 1VBLA 3IJ9A 1PS3A 3EDFA 4KWUA 5F7UA 1UD6A 2XIBA 3LPOA 3KL5A 1IDJA 2VJIA 5CGMA 3TV8A 2GUYA 1UOKA 3BCDA 1PE9A 1DTUA 3EQNA 2ZUVA 4UQBA 4UNIA 2X2HA 3MI6A 3WEMA 4FNSA 3L4ZA 2PYGA 4CKQA 1LWJA 3LXBA 1BAGA 1QWUA 1KGXA 1JAEA 4OJ6A 3EJPA 4GO8A 4XN3A 1CXKA 1R34A 3WY2A 2VUYA 3FAWA 2YA1A 1JTAA 2IQ7A 1R46A 5E9AA 2OYLA 4I84A 9CGTA 3GQ8A 1DEDA 1SMAA 1UH3A 2WSPA 2VJJA 4LPCA 1KBBA 5KEZA 2BY0A 5DO8A 1OFLA 1CGUA 3EDEA 4DO4A 1UD3A 4OJLA 4MB1A 2WVTA 4NX0A 3B90A 2GJRA 2YA2A 1MW3A 1KB3A 1JF6A 1NM9A 2YFNA 3A24A 1XCXA 3IK2A 8CGTA 1KGWA 1JGIA 3IGUA 1O8HA 1UD2A 2NSPA 1DBOA 4DO5A 4AMWA 1GQ8A 2O04A 3LRLA 3SUCA 3HZ3A 3GXTA 1XSIA 3WN6A 4AW7A 2X2JA 4U4BA 4XOTA 1JG9A 2PWFA 2E4TA 1CXEA 1DHKA 3H54A 1JRGA 2D3NA 1JDAA 2Y5EA 1WO2A 2WC7A 1XG2A 1A47A 1L0PA 1CXHA 2WKGA 1WE5A 3VGEA 3FW6A 1E43A 4U3CA 1BLIA 4HWVA 3GXMA 3RIKA 4ATWA 2ALWA 3UG4A 4YZ0A 2NZMA 2XVKA 3EJUA 3EJQA 4JFUA 4J3XA 3ZR5A 1R33A 3BMWA 2ZUUA 5BRPA 3VSTA 4XNFA 4OJ5A 2D0HA 5HDRA 1OB0A 3IJ8A 2D0GA 1TQWA 4CN1A 5E6YA 3LX9A 4YELA 1J0JA 2PWGA 3BAJA 2F18A 3GXDA 1V3JA 2OSWA 2ZX6A 4NZFA 3B4NA 1NHCA 1D3CA 1KGUA 3WNKA 1GJUA 1PIFA 2DIEA 4FMVA 4J7RA 1QJVA 3II1A 4AEEA 1XH0A 2DIJA 4MR0A 3D50A 3ZOAA 2G3NA 2EACA 2PWEA 4U31A 2D2OA 3CTTA 4XLHA 3GXPA 2QV4A 1MW0A 4PSPA 2VBEA 3L4TA 3GXIA 2QMKA 2PWHA 4NI3A 3WEOA 5BRQA 3VM5A 1ODUA 1K5CA 3DDGA 1O8GA 3WENA 1XSJA 4H8UA 4UQAA 4GQRA 3DHPA 3CLWA 4XB3A 3DC0A 1OT1A 4U49A 3EDDA 2WVUA 1JIBA 2XWDA 4GQQA 1E3ZA 1EH9A 1XD1A 1RP8A 1O8JA 5TD4A 2XN2A 1IZKA 1WZLA 3KL0A 1G94A 1AQHA 2OW7A 3BCFA 1JI1A 3WNNA 4Z03A 1G1YA 4FNUA 3CC1A 1IDKA 1CGTA 1UD8A 1UA3A 1RMGA 2VBMA 3BUQA 2YJQA 1H80A 3VGBA 5A6MA 2O1DA 1GCYA 4HPHA 1XCWA 3ZT6A 2QLYA 1ZJAA 3HJEA 3DX3A 4JL2A 3EJSA 4B9YA 4XKVA 2D0FA 3ZT5A 4OJYA 1U2YA 2NTBA 3WWGA 1WZKA 3ECQA 4X9YA 4Z05A 2X6YA 1HG8A 1QW8A 4J27A 3OLIA 3CZSA 2DH2A 3GQAA 7CGTA 2ZX5A 1JI2A 2INVA 1HNYA 2Z8GA 4FNPA 2F7RA 2XN0A 3DX0A 4JFSA 2GJPA 4WLCA 2PYHA 3LPPA 1O8EA 1BPLB 2BHYA 2ZXDA 3LXCA 1RPKA 1GVIA 2WCGA 4UQCA 3VMWA 5E1QA 3L4UA 3DX4A 3UG5A 1GJWA 3W37A 2QXZA 3ZSSA 1W9XA 3A23A 1QPKA 2ZX7A 1O8KA 1TQVA 2D73A 3VX0A 2O0WA 4PEEA 3VMVA 1UASA 2QX3A 4JL1A 1UD5A 1JXJA 2BHUA 3A5VA 2AMGA 4NXKA 2EJ1A 4FLOA 2YKKA 3BLPX 3BSGA 1RP9A 3TOPA 1PLUA 2NT6A 4XLCA 3CZNA 1CGXA 1XV8A 2XVGA 4JFTA 2NTQA 1U33A 1VB9A 4OKDA 2EADA 3ZSTA 3KLKA 2BY1A 3VM7A 4HOXA 2ZX9A 3ZQ9A 5A6LA 2QMJA 1KWGA 3WNPA 1WMRA 1OSEA 2ODLA 3GXNA 1VFMA 1CZFA 3VNZA 1OT2A 3BVWA 6TAAA 1C8QA 1WP6A 1PIGA 5I0DA 3K8KA 4XLEA 2ZXAA 3KRGA 4EW9A 4MXNA 2G3MA 5HPOA 2VBKA 4XR6A 2WSKA 1MFUA 1CYGA 1O8LA 1O8IA 2NSTA 4J3TA 4FNQA 4J3WA 3ZT7A 4HP5A 3HG5A 2UVEA 1V3KA 4FNTA 2EAEA 3JURA 2NTPA 3L4VA 3TTYA 4JCMA 1JD7A 1JFHA 4CGTA 2FGZA 4U2YA 3VSVA 1KTBA 5HXMA 3VO0A 2FE0A 2X85A 1CGVA 1BF2A 3FY3A 4J3SA 3WNLA 4BA0A 1BN8A 4AMXA 3WY4A 4PMHA 1KCDA 4YZQA 4J28A 3CZGA 2EEXA 3BMVA 3DHUA 1PPIA 1KXQA 2PECA 1J0IA 2FHBA 2J25A 3A21A 1G9HA 1HL9A 2Z1KA 2Y4SA 3LRMA 2WCSA 2NSXA 4YEJA 1CIUA 1JXKA 1WPCA 2ZXQA 4AIOA 2E9BA 1XH1A 1HXKA 1VJSA 1QWNA 2BHZA 4H8VA 3VMOA 4NZJA 3HG3A 2F2HA 3BH4A 4XL9A 3AJ7A 2O17A 3BAXA 2F1AA 5A2BA 5I5RA 3LRKA 1EO5A 3BVTA 3KEHA 2TAAA 1E40A 4C2LA 1AVAA 4H7VA 1MW2A 4GKLA 4XKWA 4XLFA 1UA7A 3WELA 3CZEA 5E6ZA 3BAKA 4CVWA 5A2CA 4AEFA 4NXSA 3UW0A 4CN4A 1J0HA 1J0KA 1KCKA 3BLKA 3CPUA 4W8RA 2YFOA 3GBDA 1RU4A 2XN1A 1VAHA 1QI3A 3BUBA 4XMYA 3WFZA 5DFAA 2CPUA 3S5YA 4JFWA 3GQ7A 3QGVA 2X3HA 2C8NA 2ZE0A 2F1BA 3AMLA 1QI4A 4GI6A 3OLDA 2NT0A 1QCXA 4OGZA 2FH8A 2IGTA 2WNWA 1HT6A 1QHPA 5CLTA 1CDGA 1MFVA 4UOZA 2VR5A 4BZYA 1KTCA 4GI8A 3WY3A 4UQEA 4NK6A 2ZWZA 4XLAA 2V3FA 1V3LA 1P6WA 3WDIA 2EQDA 3WDHA 4URRA 2ZUSA 3W38A 1WZMA 3K1DA 2INUA 2AAAA 2FYVA 3D51A 4UOQA 3A6OA 2VRQA
chains in the Genus database with same CATH superfamily
1SN0A 2ID5A 1VSCA 2V5TA 1GGIL 3LAFA 2F3LA 4PB9H 3PIQB 4I18C 2DM7A 3SE8L 1DDHB 1O7DC 1UM4H 4R8WH 2CRZA 1RZKC 4HHAA 4Y4KD 2Y22A 1FPTH 3VQLA 4D3CL 1AC0A 1SYVB 1OV8A 3FN9A 1BVNT 4AQZA 3MJ9A 1BWWA 4XMWA 3RU8H 1U42A 3HE6B 3OGCB 4KY2A 4A7TA 4NHCL 1LO2H 2Z31A 1DSFH 1IRAY 3CK0L 1CICB 3CXDH 3EGDA 1LO5B 3GGWB 2CG9X 4EI0A 1MY5A 4YHNB 5IKCB 2J4WL 4CJ0A 5IFJB 1Y1DA 3L3JA 4HHGA 1N59A 3DVNA 3QQ3B 1U93B 4JVPA 1T66D 4QNPE 1EHXA 3RIFF 3QO0B 2R2EB 4B9IA 3IETB 1YYCA 3MLVL 4YSEA 3VFTB 4QRRA 3C08H 5T5FA 3LZOA 1PZBA 2B59A 1KJ2H 3HR5A 4Y4HB 4HS3A 4RWHA 3QNXA 3UTSB 1GZQA 3Q6FB 4MSWB 1HQ4A 2OTUA 2Z7WA 1DFBH 3DSFL 3UC0H 1ORQA 4RGOH 3VXUE 2K9FB 3NJIA 1SMOA 1H8NA 2FO4B 1TO5A 4HPYH 5IQ9B 3SIKA 3ZYJA 1WHPA 4JVUA 3IAPA 3DVFA 3OJDB 3CD4A 4KGJA 3O4OC 3HNSL 3MREA 4AYGA 3UJIH 3IMBA 2W1NA 5EPMB 3UGUA 1JZ3A 3QEQA 4QOKE 5JA9A 3BPNB 1LQSR 3PWPE 1XH3B 2QL1A 1S7XA 2KHAA 5DEFA 3VMNA 3WDJA 2E47A 4KTDL 2ADGA 3FUJA 3LS4L 4TLKA 4BD4A 1KIPB 5AVZB 2BXZA 3ECBA 3KPRD 5I5IA 4Y5VB 2PMZA 3PHSA 2EABA 2YXMA 2ZF9A 4O02L 4HU8A 3B9EA 1IKOP 4HWEL 2GY7B 4KO9A 4LL9A 2W60A 1V05A 5C0CD 4GMSH 4W9IC 3FCTA 2I07B 4N9GA 2EIZA 4XNAA 5K1JA 2IANE 5CJBA 2L7QA 3BPCA 4TUJA 4ZYKA 2E8YA 5EBLA 4OF0A 1WHOA 3ATBA 3FUIA 3MRKB 1ONQA 1QQ1A 1HQRA 4LCWA 43CAA 5JOPE 3MLXL 4B0MB 4YEFA 1EUUA 4ODBD 4AEHL 1LEGA 4IK6A 4UZUA 2ITDA 1NBCA 5DVOA 5DNSA 3DSNA 1N64H 1TVBB 3H9YA 3ZR6A 4HWEH 4L5FL 4EKJA 3TONA 1JL8A 2IF7A 4X98A 2NUPB 1AYRA 3QUMA 4NS0A 5D7KD 3U1PA 1IGCH 3EOBA 4HXAL 4WWKA 4AVZA 3MLUL 4RZCA 1RUQH 4ELMB 3CFUA 5KSVB 1FO0B 3LKPB 2YQ2A 3D3VA 3OC8A 1HWHB 1NCBL 1YYML 4WJG3 1BZ9B 1NCNA 5ALBH 3H4HA 5FUOH 1F0LA 2NRDA 3IDIB 2X6XA 3O6KL 4WZ9A 3O3UN 2YJLA 3TN0B 3WNOA 4GKNA 1IKFH 2J8HA 2LR4A 4QLWA 4YBQD 4I3RL 1OLZA 5IHHA 1ZLVH 4YO0B 4M4RB 5LDSA 2F54E 3CHXA 1OQXA 4YSDA 2IWFA 2J8UB 3CSTA 4ZXBC 4YX2H 3LKOB 1QLRB 4RFEA 4YHZH 1THAA 1BQKA 5DQ9A 25C8H 5K69A 3KPOB 2EUWA 4Z7WA 3ZE2F 3NGBB 3TX4A 5C0EA 1MJUL 1EBAA 1PZ2A 4XTRC 3ZKXC 4OJPA 3ML8A 4K3DL 2VLKB 1JV5A 5GJTH 3P40A 1NEPA 1WA1X 3EIFA 1G6RL 2MIZA 2Y5TB 3TEUA 3ZHNA 4EUPB 1R5IB 1YQ2A 5ESVB 1OTUC 3ARED 2XTXA 3D85A 5E8NB 2AERT 4DERA 4EPSA 5L0QC 4OZHE 3HRZC 3LPOA 3BDXA 3BDYL 2KL6A 2H1PH 1LYQA 1MLCA 1CZ8L 2GUYA 1PE9A 2VLJB 2DB8A 2I5YL 4XNXH 4M5YH 5I1GH 2NXYD 3FYIB 2GT9A 3IBEA 2OL3H 5D2NA 5E51A 4UMGA 4Y1AB 5JPMB 3GRWA 3F7VA 5K33A 4JG1H 4LOVA 2W07B 5KSUB 4GKSB 4IQHA 5C2UB 3T0EA 3AUVA 4DQOH 4F9LC 3LEVH 3FYEB 3MBEC 4RMUA 1ZLSH 3KYNB 5BXFA 3SKMA 2ICEA 1LLWA 4MD4B 1AKJB 1Z3RA 2VW4A 1A7PH 5IMKA 5FCSH 3U7YH 5IR1B 1D5ZA 2JB6B 4FA7B 4HUVB 1TIUA 1DBML 2BVQB 2NY2C 3AQXA 3AWEA 3TVMA 1ECYA 1ZTXH 4OJLA 2HN7B 4MJIA 3UPCA 1CTOA 3B5TA 4LLQA 4G8GB 3P11H 1V55B 2H6OA 3EYUH 3I6LD 4HGKC 4K94H 5JIQA 1Q1JL 5LNEA 3JTSB 3UGEA 4J23A 3TJHD 3MODL 3CK0H 2NQ3A 4HJSA 3VXQA 3IDJB 3GXTA 3RX9A 2X6AA 3V4VL 5EIVA 1I1AD 4HJIA 4N2NA 5FYLE 3TEZA 1MHCB 4HPOL 5E4IA 3PGFH 1NANI 4IU2A 3BIBX 5D70H 1A25A 1XZ0A 4WEUD 5G5DB 3JWNG 2FD6H 5HVFB 4FQQA 1XGQB 5IBTH 1CF8L 1E9OB 3MV7B 1KJ2L 5JLVC 1CL7L 4UUJA 2W60B 1DN0B 1XIWB 4XH2B 3VRIB 3MRNB 1UFGA 5E8PA 4F57H 3T2LA 1BJMA 4HAKA 3T0EE 4PS3A 5I17A 1AGBB 3LQAC 3UFIA 5EU4A 2OCFD 5CJXA 1NHCA 3B4NA 4GT7A 3QZNA 4N90D 5D6DA 3ROLA 3WU1A 2VMEA 2YUVA 3EW3B 4XMVA 4WGKA 1PKQE 3RVXC 4JM0A 2F6AA 5JOFB 2O93L 5T1LB 4KZDL 2FX9L 4YSPA 4DUVA 4XBGA 4M61B 7FABH 1IGJA 1P4BL 4QF1A 3GXIA 3ZL4L 1YZZA 1RPUA 2VW6A 2CWRA 2A73B 2JELH 1CFTB 4JO3L 1LK2A 1INEH 1NC2A 2Y7LA 1HHKB 1KJ2B 3L16A 3SDDB 3WENA 2XWJB 5KYWA 4Q4EA 3TWYA 5GGSB 5FEBA 4GUPA 1JWUA 5L4MA 1XD1A 2H7WA 4C83A 3OKKB 3NACL 2UZXA 3L5HA 5L9DH 1N4XH 2LHAA 3PE9A 4JFDD 2NY2D 3C60C 2X89D 4ZPVB 1FQ9C 5IMOB 3KR3L 5IUCA 4GAYA 4X8JA 2HKFL 3RIFK 4NM8L 5PAZA 1B0RA 2MNUA 2E9JA 1PW3A 1OGAD 1LDSA 2MRYA 4X5XB 5KYXB 2GI7A 1EAPA 2IDQA 4G9DB 4HPHA 2WQRA 1T89C 1F4XL 2M83A 3HJEA 3ESMA 4DTGL 3GS0A 2D0FA 1XIWD 4YFLI 4U1LA 5GRXG 2NNRA 4HKJA 1TYEB 3OAZK 1JGEB 4LP8A 2NQCA 3S3JA 3L6FB 2BSBA 4PLKD 3QIWD 1UUNA 4RETB 4TV3A 4YHIB 1ID2A 5E6ID 1JSYA 2RR3A 2FBOJ 5AUMB 1U2CA 1N5AB 3ZN6A 5KJRL 2I85A 3SKOA 1PD6A 1ZLWK 1T21A 4KKZA 1BPLB 3MLTA 1QQDB 1FBIH 3DK0A 2NY0D 4JPIB 4MMZB 4RNRB 2O5NA 3OKEB 4WEBL 3UG5A 4EQ3A 5G55A 5F89A 4EOWH 2A5UA 2BP0A 3V8CA 1INDH 4XMTA 1A3RH 2JNZA 5C0CE 2W07A 2X6UA 3VMVA 2ATPB 3L3IA 4XZUB 4FI8A 4BK5C 3FOMB 3O9WA 2GC4C 5ES4B 4MJ5A 4A2GA 4CBZA 4OZIB 2YKKA 4PJ8A 3N41B 3ZKMC 1N7MH 3ZDWA 2DQIL 1O7DE 1JXDA 4G43A 5C7XH 2BWDA 3ZQXA 1EHLL 2XXMB 1CYXA 2ZXCA 3AVEA 3ULVH 1HCFX 4H40A 4YDKH 2JVUA 5FGCE 1DQLL 3MQIA 2ZKXA 1NSNL 3QZWA 3SEPA 1MIEH 1OT2A 3BVWA 3GS4A 1WP6A 3RY5A 4Z0BH 4UANA 4JM2C 2W9DH 5GIRB 1ZHLB 4EXPX 1GC1C 3PQYD 1U8LB 4LCCC 1I9IL 4XCEA 2H45A 1Q72H 4R4FL 1GSMA 5TQ0L 4XMLL 3VXNB 4F33B 4IMKA 5IW1B 5HJGA 1OF2B 4Y16C 5HHVH 5DC2A 2A4ZA 2DQGH 4EZLA 5F3HA 5DHXB 4FQJH 3GSWA 4DUXA 3POCA 2D03L 1TOXA 3U1SH 2EEXA 3STZA 4W6WB 3UBXB 3GHPA 2EEBA 4KVNH 2PECA 4YGVB 2J8KA 3WL9B 1S3RA 2KZBA 3C6LB 1WQVT 3EFFA 2ADIB 2Q8AH 4J3OH 2NSXA 1JXKA 2ZXQA 1P5UA 1OQOA 2UZPA 2QJDA 1HH9B 1QLEL 5CFHA 3AZUA 3QAZB 1EFQA 2F2HA 4OCXH 1G84A 1UOLA 1YY8B 2F1AA 3UH8A 3IMSA 5FOJA 4ENEC 1MQ8A 5I8EB 4PRIE 5KZCB 4HG4J 1KLGB 1DLFH 4O02B 4PBDA 2EXWD 2LTQB 4WK0B 4D0DA 1XL4A 2APTA 5CWSB 4H8WC 5F3BB 1LDPL 3MBED 4YHLL 4CVWA 5A2CA 4A39A 3BLKA 3DOHA 5FC9A 5BZDB 4HJ0C 1MUJA 1OARH 3ULVE 3PQYE 2UX6A 3VQMA 4ELDA 3MFFB 4YQXH 2WWMD 4AV5A 2XV6B 3PQYB 4KDTA 2VTFA 4ELMA 4D9QD 3FSWA 5I9QB 3DOIA 4F9LA 3T0EC 1I9JH 4L9DA 3BH9A 3K80A 4L2YA 2AI0H 3CFIC 2NY4D 3IXTA 1KN4H 2ZCZA 1MCOH 2YGVA 1GGBL 4OCRH 4LQFL 4BZYA 3AS3A 4I89A 3T77A 4KQ3H 1AIFA 5FPIA 1GZQB 1R3IH 5F7EH 2EQDA 1KC5H 4QRRE 4LVHC 1J87A 2Z7UA 3VXTB 4LBEA 2BSSA 4JM2D 4M6MH 4TVPD 3O6ML 1LO5A 5B1JA 2V7NB 2Q7AA 1IO4C 3BSZH 4WEEA 4JFVA 4E36A 3L3JB 4B9ZA 3QZWG 2AEPH 3VDAA 3X3FL 1RMFH 2CDGB 3O3BA 4Q56A 2KKQA 4HIIB 1KENL 4MX7A 3RKPA 4A6YH 1EK3A 2HKFH 2GBVA 2J88L 3RJQB 1RZ7H 4PJDE 4JZNB 3AUWB 4MMYB 1AXIB 3FRPG 4LGSB 4LAQL 4MMZA 4L2LA 3ZL4H 6CGTA 4J3UA 4NQEA 4UIMA 2QPEB 3VGFA 3CFTA 4MB3A 3QDJD 2VKWA 1QVOA 3HG2A 4LSRH 4MS8C 4JBSA 1XF4A 4FD0A 4WU7B 5I30H 3NCFB 2NT1A 4WTZA 4ODXB 4GRLC 4F15C 5I2IA 4I0PA 4OCYL 5KS9A 4PW9A 4AXWA 1IB4A 3U2IA 2PETA 2O5YL 5IMMA 5IB4B 4BDVA 1ZLWH 1CR9H 2WZ6A 3H7LA 3RVTD 4QGTA 4GAGH 4ZT1A 5DCCA 5C0BD 1M56B 3THMH 2NY4B 1HWGB 1FLRH 1I1AB 2XY2A 4GOSA 1CQKA 4OJFL 4PY7A 3P69A 3IWVA 3C5JA 5GHWL 1INEL 5KVEH 2Z93A 2P8PB 3HI1B 3TA4D 1PNCA 5E08H 1AIRA 2DD8L 3X3GL 1T04B 4LVOC 1BM3H 2VMDA 3QIBB 2H0FA 1ADQA 5K39A 1IFHH 2ED8A 2GSMB 4AGPA 2NUPA 4HUXA 1OFMA 3IF1B 2DI8A 1KY6A 4NUPA 1EJOH 3BRFA 1I3GH 3HC2A 4MGXA 4FQ2H 1LHZA 5B1BB 3WS3B 4P2RD 2YAMA 4A55A 5IHWA 4FKHA 2APBA 2CIKA 2K3HA 2H3KA 2FX7H 3DV4B 3G6AA 2AAVA 1LP9F 1NPNA 3X2QB 4BWUA 1DJGA 2AK4E 2EIEA 2J4WH 1ZIAA 1P7QB 2PPAA 1R5WA 4PCTA 5B8CC 5EC1A 4XXWC 1M7UA 2P5WA 2Y7OA 2MH4A 1JK8A 2E7DA 4L3EE 2WVVA 3IF1A 4PFEA 2D3LA 4N6RA 1E4XH 1E6OL 3OPZH 4QXGL 3RTQB 4PJ8C 5JIMA 1EZLA 3KH3A 5HHXL 1LEIA 4AQ8A 4PG2A 1JVOA 2F58H 4LSVL 3RA7L 4DVRL 2KUTA 4FFWC 1EAOA 3HS0A 2NZ9C 1NC4B 1FFTB 3ARBB 4P2RA 4HKBB 1PMYA 1T0OA 2F8OA 4LPTA 4Q4IA 4GKNB 4Y89A 3GJFB 5LGHH 2NX5E 4ZAKC 5ICXA 3T9GA 3B6SA 1QMUA 1A22B 1W15A 4HPYL 3MROA 4ELMF 5IVNA 3QDHA 1HCVA 2NY2B 3X1GA 4HWBA 5D7LE 1UOWA 2F7PA 3NABL 3QUXC 4LK4A 4RIRB 5HHXH 1LO4L 4HKXB 4KXDA 1I4FB 1RU9H 2JH2A 5HYQA 2ZXWB 1DQQA 4FFZA 4MAZA 4XPFL 1HNGA 3IXTB 1M7DA 2AFNA 3L3GB 3OR6B 1HHHB 1U2HA 2CDEB 3MV9A 1HAWA 2FX8H 2BZDA 2D4DA 5DWUH 4X5QA 5GGQL 3T0EB 5C9KA 1F8TL 4Y9FA 3RTLA 1AZBA 4M8VA 2FR4B 1Y6NR 3ZZ1A 3SDCA 4I1RA 2OW6A 3WIIL 1YNKH 3D4ZA 3VFGL 2X7LA 3WUWB 2A9MH 3CFJB 3C9NB 4ODWB 1BECA 3CMOH 4HUCA 3L3KB 2BP8B 2PW1A 1D2OA 3S5ZA 2E0PA 1WK0A 4PGDA 4N0UE 2MJWA 1S9XA 3HAEG 3MLSL 4LGRB 4K5OA 2AK4D 3LNGA 4ODHH 2YC1B 2R56H 4JFPB 4NKQB 4LCWD 1UD4A 4FFTA 3MKGA 2APWA 4M4PA 4Z3GA 2HVBA 3MBWA 3KWXA 5DUBA 2QKIB 3QEUB 2VQ1A 4NSKA 5FUOL 4AM0B 1YMMA 2RCSL 2YWYA 1QYGH 3FOLA 4TLSA 1BMWA 1JN6B 4UTAH 3CSYA 1I1FB 4IK7A 3NRPA 2F7QA 1IIIA 5HYSA 5EO9A 3RZCA 2XIBA 1AQDA 2Z8WC 35C8L 4RX4A 4A2LA 3UJJL 5HPMB 5K5YA 1AR1B 2PW1B 4Y4FD 3JTTA 2EEDA 5D9SA 1YO4A 3JWNH 3BHBA 4YX2L 5F93C 4P2QB 4IBUA 5CD3B 2PYEB 4W70A 3VFMA 3DRTB 1I8MA 3QEQD 4KKLC 1WFJA 3HBQA 2OMZB 1ROWA 4GKZA 2H0EA 4MJ5B 4Q97A 1KLFB 5E2TH 4GO6B 2IQ7A 2CDFB 2F0CA 1PCXA 4PJCA 3NP3A 5ETUB 3V52L 3BQUB 2W9LA 3BSZA 4G3YL 1NFDE 3W2DL 2YGOA 3V9FA 3F7LA 5EEYA 4K3EL 4Y5XA 4NX0A 4ZW5A 4ETQA 2WLYA 3I3EA 4N2BA 3DETC 4PJEF 1YY9D 5K39B 4C57C 3CVHB 1AE6L 2O61A 5T3ZH 1KGWA 4DZ8A 5CD3A 2VLJE 1UD2A 3POHA 4NC2B 1PY4A 3TA3A 1E8XA 4AMWA 1TVHB 3RPKA 3D05A 1GQ8A 4ZUUA 3BD4A 4P4KD 3F6JA 4W6YB 3G5XA 3K46A 4KI5E 3W2DH 4P06A 1DFBL 2JJUA 1HXMA 3DIFB 1DHKA 3DSFH 2WC7A 4NPJA 1I8IA 4FFYL 2FWOB 4ZD3L 1QSZA 3WLWC 5DQJB 1ETA1 5D93B 5JOPD 1WE5A 1CD8A 4LDCA 1I1YB 4U3CA 4YDIH 3W9EB 2DPKA 1VCAA 2C7UA 3RNKB 4GEJA 4PJFB 5J11C 2C3XA 1U8NA 2EDKA 4QRUB 1MG3C 4P2QD 4WNJA 3F3HA 5JOEA 3GBLA 2D0GA 4G8FA 3ARXA 2A4CA 4OZFG 1D3CA 2RFXB 5CZXC 1LO3L 1E5YA 2ZZUT 4HV8A 5HBBA 5A7BA 3N0AA 4AVIA 3BQUD 4XAWH 3SKUD 4EDWH 3A4EA 2FEDD 4WAFA 2PWEA 4NHUB 2FT6A 5C3TA 4Y2DA 5DD0H 4N0RA 5DT1H 4G72B 1IC4L 5J6GB 1MEXH 4QXVA 1A9BA 4ZPTB 3TNNA 4LIQH 4LCYA 2OTUB 5AALA 1AP2B 1G4RA 2Y6SD 3ME0A 4XN2A 5DURB 3GZQA 3ZDZE 2JIXB 2PKDA 1L7TH 1F00I 1M3JA 4L4TD 4N3UA 2B59B 4AKOA 1ZXKA 3VWKD 2IPTL 3CLWA 4OGXL 4HIHB 1P1VA 3KYKH 3NOIA 2YS4A 1RK1A 3I3BA 2A77H 1CFSA 5C0RL 4OCLC 1XFPA 2K3TA 3DVGA 3LEYL 5AUMA 4DP4X 3IFNH 1UOVA 3IPBA 4LIQL 3MAWA 4FNUA 3T0DA 2FQDA 1SEBA 1E6OH 3OPZL 1D7CA 4DOHB 3NDYE 3LHPH 5F0MB 4JL2A 4ZX4A 4JFYB 1S6NA 1QHQA 3PDDA 4GW1A 4K73A 1AS6A 1PL3A 3SGEI 1V7NL 5EC2B 3D9AL 3ULUF 1OAYL 2X6BA 3BPNC 1TJGL 3LQZA 5EU6B 3RVTC 3P4GA 2OL3B 4M3HA 3AB0C 3GS7A 4Z7AA 4L8CA 3TEXA 3SDYL 1KUMA 2F74A 1FL6B 5EBLB 1KCWA 2YAPA 1PNDA 3MRGB 5DUML 3S37L 4JRYD 2OMUB 4O5LH 5BS0E 3S8WA 4JO2H 2LOEA 1BX2A 2JCCE 1TETL 1DBBH 1NDMA 1QPKA 3MRBB 3PDGA 4X9BA 3WL9A 4PRBA 2KQMA 2AK4A 1F6FB 1FC2D 4N8UA 3J2PA 2W65B 2ATKA 2XZAL 2YXWA 2L7JA 2VO5A 3BZDA 2AMGA 2ARJQ 2Y07H 3UBGA 2EJ1A 3LIZL 4M02A 4ENZA 3K3QA 4ISVB 3P9LB 5E5UB 1N4XL 4ZFFB 2UUDH 3QHFL 2GJ6D 3FQRA 2NTQA 3QXDB 1LILA 4P4KA 1AOZA 3X11A 3B37A 1JGDA 1WLHA 1SXZA 3OV6A 1AKPA 2OZ4L 4JO4L 5C9JA 2GBTA 3MRCB 4MNHA 5IF0A 4XP6L 3KRGA 4JPVH 3IDYC 3H9SB 4DCQB 3QIWC 4H8WH 5EOCJ 3K6SB 4JREB 4XCYA 1VLXA 1J88A 2CA4A 3P73B 3T71A 1MCFA 4BFOA 2P3YA 1X44A 1J18A 1R17A 1N18A 4ZXBA 4DWHA 3TF4A 1S7WA 4MAUH 4AQAA 5GS3A 1XBRA 2CJ3A 3FL7A 4NYLB 2DWYA 4KU1A 5TE4L 4OZGA 1BD2B 1GH7A 1BGXL 1I1YA 2BIPA 1KPUA 3EYQD 4TSAH 4V1DB 4YZQA 2Y5TA 2MCMA 2H2PD 3LN4A 2DQDH 2JK5A 4N2MA 2EDJA 4KZEH 1P7QA 4JN2A 2CJSA 3L54A 1WTLA 5E8NA 3ABKB 3FT4A 1G87A 2GCYA 4HIXH 1FYHB 4P5SA 3MFFA 4K0OA 3BAXA 1I7TB 5ERWA 1MELA 5LBSA 1BZ8A 5FHBH 5E8OB 4MXQC 1WD9A 4JQVC 2PYEE 3LRKA 2EYSB 3CFEB 3BE1H 3GMNB 3QZLA 5KANI 1GIGH 1B0GB 1NEZG 5AKRA 1RHHB 3RL2A 5F1NA 1DQJB 1ZT4A 4JFZL 4AV0A 2Z31C 3D09A 5AOKA 5BXFB 4H7VA 3GLZA 1J9CT 1OAQL 4Z23A 4WI8A 4FEMA 1C16B 4PJBA 5KSUA 4ZTPL 3CPUA 1RU4A 5GGVH 1F3DH 1TUPA 3ESVF 1FZJB 1GTFA 3EUUA 4X6CF 3VWJB 5HGBB 4NLHA 4MD4A 4YUEH 4MQTB 3NQKA 5BV7L 5DJAB 4RVBA 4PB0L 3QGVA 2YEZB 4S1SH 4RGNC 1XB3A 3VD0A 3SYOA 4OCXL 4Q7DA 5IB4A 4WFEE 5D2NE 1FYTD 2W38A 4UOZA 1BVLB 4FQCH 1M2VA 4CJ1A 2DQJL 1KSRA 1KTCA 3WY3A 4NOBA 1CU4L 5JTWA 1FGNH 3K4AA 4HH8A 4NLAA 4OLXL 4WI0A 2G30A 4HX1A 1HYRC 1WSST 2VZVA 1H0DA 1V5JA 1A7NH 3A6OA 3OJVC 2VRQA 1J1XL 3E6HB 4I4WA 1KYOJ 2IPTH 4OGXH 1AY1H 1T66C 3ARDB 3CHPA 5SWSD 2YRLA 3GBEA 2DJ4A 4JFPA 5E2JA 4GBXB 3TBYA 2PCXA 1IBBA 1ZA3A 3Q3GA 4RGMB 3LKNA 1FL6A 2YGNA 2XTJC 1JMZA 1YN6B 2ZWYA 2E27H 4PY7B 5I1CH 3EJJX 5E99L 1AZRA 1S8DA 2PW2B 3MRLB 1PZDA 4KXBA 1EXHA 3LHPL 4YZXA 5C6TL 2FATL 2IALA 7TAAA 3VGHA 3B9KA 1TEYA 2G0YA 3TEWA 5C07E 2OMBA 5AW9B 2NQDA 5IROA 4E9VA 1HN1A 2VXQA 1W0WB 3PWLB 4HUXB 4J3VA 3OXRB 3P77A 4ZUWA 5EEXA 3MJ8B 2LLNA 3ROLB 1YJDL 1VF5C 3BP6B 5JYMA 5C0RH 4KRPC 1XH2A 1YDPA 5E70A 3OHXA 4RA0C 5ISZA 1MEXL 5JIDA 1MCWM 3WIFA 4PG9A 3VU1A 4HCRH 2WINB 4NNYA 4P4KB 2GTWB 2VDPB 2XWJA 3G6AB 1UGNA 3CIAA 1CL7I 2C9VA 1L7TL 3MZGB 1F3DJ 1JRHI 3SJVE 2XKSA 1XSKA 4OV5B 1KCRL 3BKYL 3LMWA 1PLAA 2B1OA 2DD8H 2R69H 2BNRA 1XD0A 4PJXE 3IGAB 1RJZB 1DANU 1QA1A 1EJFA 3APNA 5ISZB 2C26A 1LEIB 3HBPA 4DKTA 2Z0BA 4NK8A 5JMOC 2R1YB 5EUOE 4ZZFA 3D3VE 3ABZA 3I02A 1VIWA 3MCLL 3QNYB 2ADJA 3GD1C 4BEIA 1VEPA 2OXGA 4UU9B 3IPFA 3R4DA 1QHOA 1G5AA 2DQHL 2Y2YA 4R4BA 5CIPA 4FYQA 3ARSA 1PXZA 1NCTA 3RILA 4DW2H 4LSRL 1AZZC 3VU2A 3M46A 2AQTA 3QHFH 5ICZA 5E5RB 1D9KB 4Z7NE 1KTLB 1UWGH 2IOOA 1L0YA 3E1ZA 7PAZA 1QA9A 3VI3B 4LPUA 1H9DA 1FL5B 2DMHA 3UTPD 1WBYB 2X12A 5I0VA 3WTVA 5HYQB 4MAYC 4JG5A 5DD1L 1X9LA 2AV1B 5DXWA 1BW8A 5TFSL 3VSQA 2CK0L 4WUKL 3K4DA 3RI5K 3MLXH 3OZ9L 2JTDA 3CFNA 3SGJA 2D7QA 2EDQA 3O6FA 1KT2A 4AWJC 4DN4L 5I1DA 3AITA 2CMRL 5IT2L 1F56A 1NGPH 3G9AB 3DUSA 3O3DB 5I1HL 1PLCA 3G6DH 5D72H 1PYWA 4IBQA 2OTPA 4PJ8B 5DJ6B 3V0AC 1X5HA 4X4ME 3NZUA 4G1MA 3WMQA 3K81A 2E9IA 4EVNA 4B9GA 1RU9L 3D18A 3IRZA 3SDXF 1J86A 2QFPA 2JCCA 3ARWA 3VVWA 3BH6B 2O6CA 3QAQA 3PL6B 4J4PC 5CN3A 3EOYG 5EHFA 2DQHH 1E8YA 2NW3B 3LZFL 5AG8A 2EVFA 3AU0A 4OFYA 5BO1L 1IC7L 2WQVA 4CMMA 1QABA 1JBJA 2FBRA 2BNQA 1ZLUK 3WLBB 2WBXA 1MW1A 1SJXA 2YRZA 1JD9A 5LGHL 3NCEB 4P5RA 3RL1B 3VD1A 2QKSA 4FABL 1ZT7B 3MLPA 3QARA 1G4MA 1E9PB 1K3ZA 3FQNB 4PGZA 3GFUA 1CFMA 4LSVH 4QYAA 3S88L 5DJYA 1FSKC 1AD9B 3G9VA 2QSTA 4KFMA 1NCAL 4Z7QB 4P2QA 1HU8A 3H6AA 4ODHL 4FYSA 2FYYB 4R7LA 4D7PA 4YL4A 4XNMA 3L48A 4K94C 2AJSH 3FTUA 4HDIA 3VXSE 4E5XB 1II4E 4ZS7L 4AC4A 1QSEA 5T8IA 3NIFB 1PBYA 3C8DA 1TQTA 4GW5A 4ZMXA 4L5FE 3V4VH 1BJ1H 2P5PA 3RBSA 2CZNA 4OFKA 5FS5A 1DJXA 2H8PA 2ESVD 3DTDA 3MLSH 2ZSVB 1E9PA 5B3JE 2GEEA 4XCCL 2ILLA 2VJIA 3TV8A 4QY8A 3MRRB 5F88A 2IFGA 3FUKA 4XXCA 4ZFGH 2A0LD 4U4IA 4Y19B 3F7YB 2OKMA 1T3FB 3U6XS 1Y0LA 2G0KA 3OB0H 4HF5H 5TDPB 1ETJA 5HGAA 4OZFA 3MA7B 3GO1H 4GXUN 1OXYA 2CO4A 3Q1EA 5CU5A 2P7TB 4G2AA 5DVNA 3U4KA 2Z92A 4AW4A 2SODB 4PGEA 4HETA 5C0GB 5IIEA 3RWDA 1T80A 3RNQB 2I25N 2VR3A 4PB0H 2GYSA 5E56A 1OFLA 1J12A 2IADA 1ZTXE 4EDXB 2WXIA 1MW3A 2AQ1A 3A24A 3VFOA 2YZ1A 3CQPA 8CGTA 4L3CB 5DJDB 4P2YA 5JNYA 5C0EB 3V6ZA 3BGFC 4HISA 4C4UA 2VDKH 3V0DA 1T2XA 2A73A 1GYVA 3C6SB 4UTAA 1XSIA 3O4OB 3ZKMD 5D55A 2NLJB 2MKWA 4MDJA 3C5ZD 3RVUD 32C2B 4ZFZA 4GW4B 4K3EH 2XT4A 3VXTA 2YUZA 4I2XE 4Z95H 1H3UA 1CXHA 4PV8A 3QISA 4G3YH 3ZW3A 3CCHA 1BAFL 1URLA 1D9KA 3ARBD 3FU6A 4ZUTA 4AH2B 5ANMB 3LRSA 4MA3A 3TYFB 4HUKB 3N42F 1SVBA 3ZR5A 4DZBB 1QFOA 1QAWA 3GB7A 3S35H 3KNBB 1IBYA 4IDLA 1TPXC 1ES0B 2D0HA 2BM3A 8FABB 1ADQL 1NEZB 2Z91A 4HFWA 4F27A 3M1OA 1I3VA 3LKRB 1A4JA 1J0JA 1GGTA 3DMMB 4NENB 2ZX6A 2NW2B 4X9FA 4YDIL 4APQA 1X4XA 4PUBL 4NZUL 3II1A 1RIHL 4P46A 4IHOA 3WJLC 3DOSB 4G5ZH 5TJWK 2FWSA 2OK0H 3D0LA 2WXFA 4JY6A 3CTTA 1I1AA 3UTSD 1X4ZA 4O4YH 3PV7A 3GXPA 5B39A 1MW0A 2HKAA 4LIQE 3EGSB 4WDIB 1XCTB 4JE0A 4XN7A 1TCRA 5LWYH 4BDVB 5ABAA 1KMGA 3O4LD 5J13C 4KQ0A 1FL3A 2X89A 3LNIA 3QIBA 5DJXA 5C0JB 4LOEA 1M05A 4XODA 2X28A 3MRDB 1L9QA 1MLBB 1MCRA 5LDUA 2JKRM 1N2RA 1BG1A 1WZLA 4I8DA 1BEYH 3W0WB 2FLMA 2BIIA 3DXAA 3EYOA 3H9HA 1JZIA 4OM0L 1ACCA 5DYOA 3RHWF 5GS1A 1ED3A 1IDKA 5B1AB 2WQAA 5IJKC 5ICYA 1VFAB 2BOBB 1EPFA 4PTUA 2O1DA 1MWAB 3TO4A 2VLME 1SLUA 4LCWE 4FCHA 4NFBA 3AGVA 2HTLD 3AT0A 5E8PB 4N90E 4XNMB 3DV4A 2NTBA 3IE9A 3UTZB 5AAPA 5F7DB 4PBWD 3V0WL 5C3LD 4X9YA 2G75A 5D4IA 5I8CB 1MCIA 4HJEA 2AJZA 5CZVL 1S7XB 1BA9A 3DMMD 4NWUL 3QHZH 2INVA 1JI2A 3MRIA 3JYBA 4BQ8A 3NJJA 3UADA 3NP4A 2DTML 1F42A 2VJ0A 3FQ1A 1QFPA 2PCYA 1JF1A 3WFHA 5E2VH 3DX4A 2H32B 1SLVA 5IG7B 4ZFOA 4JN2B 4P59H 3FQYA 5MEND 5D1ZB 1O8KA 1H3VA 4JQXC 4TNFA 1NC4A 1UASA 2VERN 4FXKB 3NPSC 3DX6B 3TFKC 3UZVB 1VZGA 4NKDB 4M9OA 4FG2A 5BPPA 5KSVA 3ILPA 3CZNA 4N2AA 5HHOA 1CGXA 1WF5A 3QG6B 4RMWA 2WZ0A 4QXTA 3DGCR 3D33A 3EO1B 1W2KT 1AACA 5FK9A 3VNZA 1NEUA 3HCVA 1OE2A 4DGWC 1B6DA 2YMOA 1E2WA 3P4LA 5ILTL 2V17L 3WJLA 4AI7A 3MXVH 1UXLA 4QAMB 3ML9A 1AGEB 2G60H 3HE7B 4FEIA 4YIQB 1LDPH 4KMTL 1K6QL 4KUZL 3EG9A 4XT1C 4QT5B 1U3JA 2WAQA 4WW2F 4WO4B 1A2YB 1QRND 4DF9A 3Q06A 1E4XL 3ECUA 3QEGL 3SPIA 4WHYH 3HR6A 5TGBB 2X0VA 4ORGA 1CGVA 3DUUB 3FF7A 3NSCA 3FQTB 4K15A 4J3SA 3S36H 5JIPA 3WTUA 3ALWA 4KZEL 2P8MA 1JZGA 4WFED 5GGSY 2Q8AL 1T03L 4RISH 1NIAA 3C12A 4QCIA 5CLXA 1I9IH 2NZIA 4FL4C 4NSKB 4XL9A 1KV3A 2NXYB 1TZIB 2BP5M 5KSAC 1SJHB 1ZSDA 5F96H 2RBLA 4K7FB 1U58A 5C08A 4IRSC 5DK3A 1L6PA 4DPAX 4QRSA 1G5GA 5LNGA 1F11B 2XJLA 3WFDL 2A38A 2JIXD 1ZIBA 2YPLA 3EXLA 1PG7X 1F2QA 1NGZB 4JRAC 4PJDF 4K07A 5EIIA 2UY6B 3UPRB 1VKXA 4XLFA 3DIVA 3BT0A 2AW2A 2FLBT 4FFYA 1FN4B 2JB6A 1X5IA 1RD6A 3UTQB 1CLZH 2H6UA 5D4QA 4W8RA 1PYWB 2FJGB 4HT1H 3NJKA 1FNSH 3L3OC 4XMYA 4G8GD 2X5PA 3MPCA 4JHUA 2JE8A 4CDGC 1DLHA 2A83B 1U58B 5LBVA 4KNUA 5JPNA 1GL4B 2FTAA 2QHRL 4D8OA 4OUOA 3RWJB 4X7CC 1NBYB 4MDIA 4R7XA 3V5KB 4DGVL 1D5MA 1HT6A 5F21B 4MAYA 3BO8B 4UYPA 1YPZA 2AXWA 5DYOB 6PCYA 5FW6A 3IJHB 4MNGB 4MA8L 1V3LA 1FV1B 4U1NA 3JVGC 4H26B 4YGVA 3ZZLA 2FJHA 2EUZA 3QH3A 1TVHA 3ARGA 4YSSA 4UOQA 3HS8A 5B1KA 4OF6A 4U1IA 4L37A 5EDXA 5HDWA 2CGZA 5IV2B 3ATDA 2YD7A 5FO2A 1ADQH 4RBPK 1VGKB 2RA1A 2BDNL 1QASA 3RX7A 4NZRH 5HHPA 4HALA 4KRLB 4NIKB 4YXKH 5BVJB 1J5IA 3GSUB 5C2BL 2IH8A 5IREA 5F9OH 2CUMA 3RDTD 3HBZA 2B9BA 1SBSH 3G08B 1I1CA 3KG5A 4L1TA 3HPLB 4XQFA 5ITFA 5L4IA 4JB9H 2GJ6B 1MREL 5KVGE 2NX5B 3LS4H 4LVNB 2BVTA 2YD9A 4YSCA 4UDTB 2E7MA 4XO9A 3GZOA 5GRJH 1YEDA 3CZLA 4PI0A 3QWRA 4MJ6A 4X7SL 1DDHA 3OJMB 5CP3H 1T1WB 2WIIB 4NQSB 4YR6A 1NLDL 3TYGL 4IJ3C 5J8OA 2I9LA 2IIJA 2Y69B 2BM5A 3H2QA 5FYJD 4M7KH 1RUPH 5T33H 1R19A 3U4EA 3GNMH 3SDDD 2PO6D 3HN3A 1P69B 4P57B 2EUVA 2BJMH 4Y2OA 4N2OA 4EI5A 3FO2A 3D25B 2J8UE 3PGFL 5F70A 1RCYA 5KVEE 5C0GA 1FZKA 5IIEB 2AQPA 2HRGA 3GMPA 2NX5A 2DWSA 5AOLA 3PS6A 4XXDA 1EZSA 5DK0B 4HUUB 4TUOA 4XO4A 1NMAH 4N86A 3SDAA 2W91A 3HEIB 2X4RA 5F7HA 2Z65C 3VI3A 2HP4A 4JDZB 3QDGE 4QMEA 3DX9A 3QJTB 3HW7A 1CL7H 4P99A 1I3UA 1KF9B 3RX5A 2NPLX 1YEEH 3D6GA 3KW8A 4JFEA 2E56A 4HKJB 4OZZA 3S3SA 2VE6A 4FQ1H 2DM4A 3FO2B 2VWEC 1ZANL 3NCXA 5HI5C 2D7NA 3GMQB 1A6ZA 5D8JL 5A40E 2FQFA 3HLAA 4JRXA 3KVDD 5A43C 4DGIL 4PLNC 2WOYA 4JLRB 3D0VB 4HH9A 4RX4D 3GHBH 1ZT7A 1CMOA 3FXIC 4EUPG 4LLMA 4F8OA 4OLYL 2BNQE 2AEOA 2BS8A 3MLRH 1EFXA 4HA1A 1UT9A 3DYPA 3WMPA 5FKPA 3TJEL 3SE6A 1T22B 2G60L 2ATPA 3L3IB 4EOWL 1K8DB 4XE5B 1ZGLP 3ZKND 5EUKA 2EO9A 5F1IB 3FQUA 1ZHNA 2P47B 3CZKA 3BP5A 3OWEA 1EFXD 2V6HA 3Q8CA 4W8SA 3P3YA 4GQZA 3FNKA 4I2XB 5FW8A 4JLRA 1IKFL 1URIA 4AUUA 4NZTH 5KJRH 4W8QA 1DVQA 1QX1A 3W0WD 2HVJB 4UT7L 2VW7A 2OA9A 2WTOA 3RFZC 4JCWA 2KH2B 4MLSA 4O2EB 3E80A 4OFPA 1N5YH 2CUHA 1XCTA 4PJ5A 3VI3E 3I6GB 5C9JB 3ZHKA 5BZZA 3MJGX 4HIJB 1OGSA 5C09D 1CVRA 3MOAH 2WLZA 2WN3A 4JHVA 1WCBA 1T03H 1IM3D 2BVUA 5EF1A 1KGIA 2W0FA 2BIMA 4ABVA 3LMJL 4QHLA 3UDWA 2F53D 4NZTL 5C08E 4BRVA 3VG0L 5LJYH 2ADGB 3P0VH 4IRZA 4WSJA 5JMCB 4EUPH 3H9HB 4DIXA 2VDLL 1G1KA 3IDMA 4K3GA 4JG0H 1N7ML 4ZJ9A 1MXDA 1XF1A 5F71A 4CADB 3ZYZA 3VFOB 3ESPA 2Y25A 1F6AB 4X9HA 4MJ2A 1TYJA 5SX5K 4PGJA 4HIJA 3C6LD 4TUKL 1W72H 1OTTC 1CD9B 1TXKA 1JGLH 4NYLA 4QKXB 2HRPH 3DDFA 4LMQE 4KHXL 1IU1A 1GGCL 2HG5A 2ZXBA 5I18L 32C2A 1UTDA 4G7YL 5FYKL 5IQ7H 4OLVH 2G4EA 2DN7A 3T0VA 4C58B 3AC0A 2M26A 1UENA 2AV7B 1S9VA 3NA9H 3OKOB 1CK0H 3BH8B 4GSUA 4KK6C 2VN3A 2A2QT 4KRPD 1DSYA 1FVCA 2CH8A 4X6CA 5HDBE 4XVSL 1M7IA 4PREA 1SHWA 2PR4H 5DFVC 2IDSA 3WEMA 5FLUA 5L88H 1R1CA 2XZCL 4RWYL 5B22A 5I18H 1Y1UA 1GYUA 5DRWA 4OJ6A 2X4QB 5IOPA 1QLFB 1ES0A 3D87B 4XPGH 5HJBA 4S1DC 4G6AD 4DUWA 3N85H 4JDEB 4NKDA 4YHOH 4M4RA 1AQ8A 4LPCA 4X50A 1MFDL 3EO0A 3H3PH 1CLYL 1F3JA 3VFRB 1SOSA 1KTKE 1TJHH 5BRZA 2R56L 4J5VA 1B9KA 3RWCA 3B90A 4JO2L 2WY3B 2WLLB 3F62A 1UQSB 2HKHL 4AY0A 2HAZA 3FULA 2QQLH 1H3WM 4AENA 3MNMA 2XWCA 1CI5A 1NUNB 4Y19E 2X4QA 3AXLA 2VDKL 3QYCA 4MTMA 1KC5L 3Q1SL 4K5PA 2DQEH 4Q74A 2VE6B 2E4TA 3FUHA 1JRGA 1E0OB 2FO1A 2Y5EA 1R5IA 3GMQA 4H1LA 1DEEB 2QQKH 3HFFA 4IIQA 3H0TA 1YEKH 1G6VK 4I7ZC 1USQA 1KN4L 4GAAA 2DKUA 3UTOA 4MJIB 2R7EB 2H4EA 3VGEA 3ULSA 3TV3L 2DI9A 3FBKA 2ALWA 1D5IL 1E27A 4GY4A 3UG4A 3NSXA 3FU5A 3PFUA 3NN8B 4PTUB 1YNLH 2R4RH 4JFUA 5FKAA 3BZEA 3CFDB 1HOCB 3R0NA 1BBDH 1J8HB 4TQIA 4UF7C 1G9MH 2IDFA 5F7YC 1BQUA 3MV8B 4RMTA 1R3LB 4X7FC 4CN1A 1ETZB 3M1CA 5INDB 4XP1L 3B2PA 4CVXA 4RMRA 3BAJA 4WW2C 4Q0XH 5C08D 5JQIB 1FZMB 4GLRH 1KGUA 1N3NA 1XTMA 1T1XB 4OT1L 3G6JA 4PRPE 3FH5A 3FT0A 3OMNB 2HVJA 4XP5L 4YDVB 3BYYA 2QSQA 3P2BA 1IC4H 1AI1H 2VC2B 2OMVB 2VISB 5DT1L 4PSPA 4BUHA 3NRQA 4P2OD 2PABA 2BJML 4X6BA 2IGLA 5FA3B 5G4OA 2KERA 2PPEA 4XX1G 4BIKA 4JZJB 3RU8L 3QJRB 4H8UA 4R9HA 2B0SH 3W81A 4ZMAT 2IC2A 3BI9X 5JHLH 4LB8A 5B7FA 4I18B 4OCYH 1IE4A 1EH9A 5B4MC 3QA3A 3ARBC 4XNXL 2XN2A 3P9LA 1KYDA 4NO2A 5JDJA 5FWRA 2VR4A 3L7FA 3H42L 3Q48A 1FFNA 1JVKA 2XWTA 5F44A 1A6UH 4JRWA 3MRPA 3UIYA 3V4PA 2HCZX 5HSFA 2A6JA 2AVGA 4S1DD 4JVWA 3ZTCC 4JRYA 2WAHA 5FFOA 5AW7B 5FGBC 1N12A 5BV7H 4NP4L 1WZKA 3GF8A 1TLMA 2J57A 1LE5B 1MDTA 1CICD 4FADA 2XQBH 4J27A 2OP4L 1ID5I 4F7EA 3AG3B 1HNYA 3E6FB 1TJMA 5EZLA 4F7TA 3DX0A 4KQ4H 2GJPA 2PYHA 3WNJA 2FX7L 1CR9L 2QEJA 43C9A 3LPPA 5C7XL 3IMRA 4OZGB 5KYYB 2AXFB 3WEBA 4D94A 5AG9A 4MAUL 4JPKH 2B3IA 2EE9A 5ESQA 1OW0C 1CVSC 4H25A 3V4UL 4E9XA 4Z7VE 3W37A 3TBBA 1AXTH 4DP6X 1IGYB 3O2WH 1PZUB 1IT9L 1T2QH 2NXZD 3SDAD 5TDOA 3EG9B 5FECB 3B7RL 1B6UA 4FQXC 3A0OA 4JUSA 5HI3C 1AKJA 1BQLL 2VDQL 3FB6A 2V5MA 1N5AA 2BIQA 3E6FA 1XV8A 4WFHE 1J48A 4OJEH 1E7VA 4M43L 3I9IA 5CCHE 4OKDA 4C4BA 2JI1A 3GJEB 5EDSA 1KJ3L 1ZS8B 1TG8A 2PO6A 1I4FA 4ZX6A 2I7OA 3LZLA 1UA6H 3PG2A 1A6PA 3Q2VA 4LBAA 4XWGL 4MXNA 2IMNA 4Q6YA 3O9WB 1RIUH 3FU9A 2NSTA 2VABB 4WHDA 3F2LA 2UVEA 4TLTA 5KTEL 3WD5L 1V3KA 1A1NB 2VL4A 1S9XB 4IM8A 1SPDA 4K7FA 2IO5A 1I8KA 5HDBF 2PPFA 1UFUA 4O5LL 4R5XA 4CGTA 4Q9RL 3B7TA 3MMEB 4QDGA 1MCOL 1D5BA 1V54B 3O4LA 5EO1A 5F1SA 3SD2A 2BNUB 3DTXA 5DMYA 3WY4A 1IAIH 4J28A 5DJYB 3ZVVA 2AXHA 4AVHA 5D7JD 2VZUA 2J25A 3E2HC 2Z1KA 1A6VH 3NJHA 4NNPL 1HE8A 1EVUA 1OCRB 4XVTH 1NAML 2E9BA 3QO1B 4PJEB 3Q2LA 5BRZE 1M57B 3O2DH 1VJSA 3U6RA 4G43B 5DZPA 3VB8A 3Q8EA 3PXJA 2WTPA 4QHNA 3ARGD 3PHOB 2UWEB 3M1BB 3X1NA 1LD9B 1FNAA 1KZYA 4ONGH 2R2BA 3RWFA 3ZE1B 4EKXA 3W39B 3GBNL 2V17H 3I6SA 1NMCB 2HKHH 1FUNA 1KPRB 3NJNA 2FGWL 4G6AC 4GUOA 3DJSA 1P5VA 1L9SA 4MS6A 2ICWB 1J0HA 1J0KA 2QT6A 3DRTA 2Z35B 2EC9T 2Q2LA 2DM3A 2XN1A 3PV6A 1LK2B 1NC2B 4NRZA 5T1KB 1O7SA 2K6WA 3QNZB 3ENEA 5ID1B 2J8UF 2F1BA 4TSCL 4GAJH 5F2FA 2VXSH 3Q8AA 4PWFA 3UP1A 1QHPA 4PV1C 2GK0B 3ZKXB 1MVUB 5IB2B 5E24E 3NGBC 2LLLA 3QXVA 2OJEA 5FOBB 4OCWH 4PJXF 3WUZA 1CU4H 4XZ4A 5BUGA 3WDIA 2LAGB 3HLKA 3QUXB 3TC9A 4KC3B 2CKNA 2R1XB 2X1WL 3GI8L 5EBWA 4G9FE 5MERB 4E42B 2PTTB 3BKJH 1EEYB 5GGVL 3T8XA 2ED6A 4XPHL 4X83A 3VXMA 2X4RB 4N2IA 4E9YA 2YUHA 1MJ8H 2FWOA 4PR5B 2C1PB 5I23A 4ODUA 5MENB 1NTDA 4GUQA 2RB8A 3BP4A 5HVGB 3W9EA 3UZQB 2W9DL 3NZSA 3IJYA 3DVIA 2R29H 5I73B 2J71A 5E5MB 2IQAB 3QDME 3R4RA 4OAWA 5TQ0H 1H3GA 1A7QH 5DMJB 4KX8A 3T3MB 3VXPA 5LVEA 3ILQD 1IEAA 3KXFD 3V0VB 3IAQA 1SQ2N 3BN9D 5GGTH 1FPTL 2YLKA 2ZX8A 5DWPA 4LLVB 1K5NB 3UERA 1XF2B 4WDIA 4L4TE 4MZ2A 4PB9L 4OD1H 2WLJA 5DDHA 5LCVA 5IJVB 2ENPA 2GQHA 4M7KL 3D0LB 1GAFH 1W0VA 4CU7A 4LCIH 3V4VA 2UZYA 2ZF8A 2HPTA 3HTLX 4OZYA 2CKBB 2XQ0A 3LH2H 5I1CL 1F90L 2HT2C 2NYKA 4HGMA 3H7BA 4HZLB 4LOFA 3BWUF 2AQ2A 4YXHH 3Q0HA 2AHIA 3QRGL 4P0DA 1NMBH 1UWYA 2WLLA 1JNNL 3HZMB 4QRQB 5IVZB 4DO6A 4G6MH 2GBUA 3GWJA 1GYWA 3HC0B 4UNTA 1I75A 2MCPH 3L4CA 4K3JH 4RAVA 3S0PA 3WMSA 4JFHD 2VQUA 5TH2A 1KJMA 1B2WL 1Y6KR 3IETA 4OZFH 4GMTL 2DBJA 1LTXA 5BOZG 1RI8A 2V3DA 3RX8A 1BD2E 4WI7A 2XICA 2OAAA 1XIWC 3HKFA 2L3BA 2YQ3A 4NWTH 2JELL 2IH1A 1WWBX 3TO4B 3PHQA 3N91A 1CLOL 4OM1L 2ADFH 1T1ZA 5FB8B 1XXDC 3EJTA 3U4BL 2FO4A 4AQ1C 3VW3H 3O3EB 4PYHA 2X1XR 2EIMB 5KSBB 5AAMA 4X98B 4C4KO 2YUXA 2OYKA 2R2HB 5IP4A 2E7BA 3TBTB 5J1TC 5C6PB 2WJ5A 3IGKA 2X4OB 3ZPPA 4HSCX 3QDGB 5TQ2L 2ZYHA 2BO0A 1XWVA 3BVUA 1UJ3B 4GJTB 4W9FC 1AXSA 4NM8H 1ZLUH 5BQ7A 1AD0B 4GRMB 4JJOA 2H6PB 4LXFA 4WKZA 5FGSA 3L4WA 5E8EB 4X8XA 1N3NB 3NACH 3NZ8B 4PCKA 4Z7WF 1H8LA 2VMCA 3CDYA 5K9KB 4IHBA 4JR9H 3ZDZB 4E9RA 5IVOA 1SFDA 3AADB 5M7QA 1ZWIA 5EU7C 4MCYB 3MJ9L 3B7UX 3IDMB 3MRRA 3QIBD 3QZPA 3R1GL 3WEXB 4NT6B 1UZ8A 1ZVNA 3K6IA 4FXKC 1TCMA 5EB9A 1UKTA 3H9SD 3REWB 3ARUA 4JAMB 3QRBA 2ODHA 5DRXA 3IDNB 4P2RB 2QYUA 1C7TA 1JV5B 2FIKB 4AM0Q 2WXPA 4JR9L 5GZNA 1JPSL 4UZGA 3WIHA 2ZOLA 4RCAA 1DBAL 3D5OF 2NSQA 1AGEA 3L4XA 1S9YA 1T0NA 1WCQA 4Z3HA 2O5YH 2HJFB 1U8QA 3FQWB 2Q6WA 1P6AB 4G6KL 2R2CA 5CBAB 3L2MA 3PF2A 4K71C 3Q7JA 2R9HC 1AO7D 1D7DA 2DYRB 2HX9A 4B9CA 2A6JB 1ET5A 4UINL 5FFLA 1I7UA 2ZXGA 4GXUM 4NFDA 5E1AA 4X9IA 1LVEA 1MZZA 5E4EC 1A65A 3U46B 4AQAB 1PJWA 3L1OH 4BUQA 1UM5L 3ZHFA 1QLFA 1U3YA 3EKCA 4G42A 4WI5A 5D1QD 2VSCA 2VMFA 5C07B 1JZEA 1C5DB 1QSVA 1CBVL 3F58H 1NJ9A 3IE4A 4J3OG 1B2YA 5FM4A 4Z76A 4HIQA 1RZIB 4JG0L 3D34A 3Q9PA 4RGND 5IFAL 5ANHA 5B3JF 2R27A 1QLRA 4JM2A 5AVVB 3SE4C 5DJ6A 4WFFD 1LXMA 1OHZA 2E59A 1DTUA 4LP4A 4AX3A 3Q2WA 2ZKYA 4R7DB 3SCMA 3U0WL 2WXMA 5EUOF 4J4PD 3F05A 3MR9A 3OX8A 3OKDA 1FN4A 3GMNA 5FO7B 4N8VB 5AZ2H 4XN3A 3WY2A 5C07A 1MPAH 1IM9D 1WFOA 1J9QA 1B4LA 2XQYK 4OTXL 3T3PF 3W5MA 3FOLB 5CP7A 1A4JB 4EN3D 2M2DA 3WE1A 3K2KA 3L3OA 3Q6FA 2VJJA 5ECJE 3S88H 2E75C 1SJMA 2IWEA 3LN5B 1MCHA 4LU5L 4YHZL 5SWSE 4XAWL 4EDWL 4ZD3H 4IIQC 4ANVA 2GJRA 2YAQA 5DLMH 1BVKB 2LFGA 4Y9CA 5AOIA 4ABQA 1E27B 1OZTG 2Q9OA 5D7JB 3U36B 2QSCL 3HRZB 3VI4F 1NFAA 1UWXK 3GM0A 4HDIB 4IRSA 1MNUH 2GFBA 4UM8B 2X2JA 3IJHA 3ZUCA 1JG9A 1O6SA 4YSRA 4E0RA 3TZVA 5BRZD 2JKWA 2H2SC 3ARDD 3H54A 2OJ1A 4JMXA 3BUYB 5F0JB 5GGRB 5D7IB 4NO2B 5MENE 2EE6A 1QEXA 4IMLA 4KAQH 3DTUB 3VRLF 3AS0A 3ECBB 3B7YA 1U3HD 1IAOB 1WC7A 4RGNB 1RVFH 4H88H 4HWVA 2C9SA 2V9RA 3HG1E 3L2NA 4IS6A 4LFHD 3D0AA 3RTQA 2E86A 1S7QA 3BMWA 3TBYB 3PAZA 3HI5L 4DP8X 1IMHC 3UYRL 4OJ5A 4IEFA 2EE3A 1QLEB 4NJAH 3KPSD 1WDAA 4U1SB 2QR0A 1A7BA 1AD0A 3VXOA 4ODVH 4J8RA 4RDQG 2FWUA 5C8JA 1MJJA 1RUMH 3D7PA 4QXWA 5GGTL 4KROB 3GKWL 4AYDC 5FYJU 5J1AB 4PJ7A 3BAEL 5BV7C 1OTUD 4PBXA 3OPUA 1XH0A 2CNYA 3ULUH 4OLYH 4Y5YA 3GLEA 4K4KA 4U31A 3KEDA 3BOVA 3K2UL 1W0WA 3ILEA 2ZKMX 4L3CA 1BIIB 3FTXA 4PW3A 2Q7YB 4YVUA 5J0BA 3L4TA 2ALAA 5IWLC 2J6EL 1RMFL 3WEOA 4A7UA 1RURL 1LWRA 4QXUH 5IVXF 2WW8A 3L9RB 4K5MA 5CJOH 4OGYL 2WBJB 4MHHI 3VFGH 4PS4L 3REVA 1CE6B 3VQ2C 2XWDA 3C6EA 4YDNA 4NNXA 3TV3H 5IMLB 3CMOL 1LM8V 4MRCA 5B3SB 1N10A 1G7LB 1R3KB 3BN9C 1E5BA 3PUUA 2N4IA 1IL1A 4DAGL 1GKOA 1OE1A 1KFGA 4RRPM 4OF7A 4LVHB 1U8QB 1G1YA 2VDPH 3KJ4B 5J12C 1LM1A 3WFCL 2VBMA 1X6NA 3KPOA 4W9JC 1KB5A 5CIPB 3ZT6A 3HC3H 3CVHH 4Z9KB 3AS2A 1JZJA 3DBXB 4LASH 4AJ0A 1KCUH 2VLKA 3ARVA 4OJYA 1U2YA 4ALAH 4PMEA 1N6QH 3BJ91 5KSBE 1DUZA 1KLUA 1FSKB 3Q5OA 4KOBA 2ZG2A 1HDMA 4X4XB 4F7CA 1A6ZB 4MXVF 4YSUA 4QHPA 2HFEB 3KYMA 4QYOB 3CIQA 5F8QC 2X70B 2HLAA 1T83A 5ICZB 5J13B 2D31B 3QWNA 2VXTH 5DO2C 3UZQA 1CQYA 5JXEA 1FVEB 3X1BA 1L7IL 2BNRE 3FT3B 1GVIA 2Y1AA 5GRUL 3FFCD 1S4IA 5TPWH 1J9RA 2F54A 4L4VA 1IBHA 4V33A 1TFHA 2CE6A 4A6YB 1WBXB 3NCMA 4U1LB 4ZS6D 5T5NF 4WU7A 1NA8A 2GAZB 4QHUA 1F02I 3I84A 5JW5B 1FAIL 1JXJA 4JFDA 1GJIA 2QPDB 3EADA 3V7AG 4C4KT 1KT2B 3J8F7 4AUJA 3BP5B 1RP9A 3FUNA 1ZD6A 1PLUA 5E2WH 2AEWA 4L9LC 5AZEH 1ZVSA 4PRDA 3R06A 2XVGA 2VDOB 3TJHC 4ODTH 5C86A 3V4UH 2AQSA 5B8CA 4NN6B 3FT3A 1OP5H 3TM6A 1HJBC 1D5BB 2C9PA 5HD8C 3FUFA 1OSEA 5SV4A 3F7QA 5CJ8A 2XETA 1IBZA 2O6EA 5I0DA 3OC5A 2ITCB 4K55A 4P49A 4Q14A 4NKOA 3X12B 2OBGA 1O5DT 5DR5L 2G75B 4J3WA 2GITB 3HG5A 4L0YA 4RMSA 4FNTA 4IRZL 4A2EA 2Y23A 3INUL 1XAUA 2NX5D 1TZHA 1SVZA 2YWZA 3C60D 4KJQC 1FG2B 3BO8A 3V9CA 1VA9A 3U7WH 1BXXA 2R23A 1XH3A 5F97E 1GXEA 1OK0A 4M3KB 2ESVE 1L5GB 2FHBA 2R4SH 4XP4H 1JNLH 3MACL 1NL0H 1CFNA 1M71A 3IMTA 4XP9H 5SWSA 3K6SA 1MUJB 2QSVA 4WHTB 3T8XB 1QBAA 1K9TA 4YLQT 3SGKC 2CJUL 3HNTH 1FVCB 3QUGA 5BO1H 4BSWB 3SOTA 1N19A 4GRLA 3U9PL 5HTSA 1XCQA 4UQ3B 1A21A 4BZ2H 4P5MB 1U8MB 2AV7A 2NDFA 1QRNE 2BFVH 2GABA 3PWUB 5DHVA 2CBOA 3KPSA 5DI8B 3MNVA 2TAAA 1JNHA 4C2LA 2VZTA 4NHUA 1M7IB 4XP9L 4EQ2A 4TOYL 4FHJA 3ZY7A 1YC7A 3ZGHA 2RIKA 3BAKA 3UW0A 4QF1B 4I13B 3FU0A 3S7GA 1KCKA 3L5XH 2W95A 2YFOA 4U1GC 1JTTA 3QK0A 1VAHA 1OAKL 4NUGH 1OGAE 3TNMB 3W0WE 5J11B 4N8VG 5EOQL 1LP9E 2CPUA 2DLFL 4PLJD 5DA0B 5KBDA 2CK2A 3M45A 1M4KA 1C5CH 1U8MA 2Q86B 3K7UA 4EZKA 2QQKL 4N2CA 4ELKA 5K9OB 3AMLA 1JPST 2A9AA 1QCXA 2OZ4A 3F12A 4LVOB 5CLTA 1JJUA 1MFVA 3Q6GL 4MX7B 3TP4A 5E9NA 2ADYA 1DVSA 1NOLA 1JWSB 4PGBB 2ZWZA 4XXCC 3V0JA 1BD2D 4ANXA 1DEEA 1WZMA 1DVTA 5DRZA 5KVDH 3LDBB 3E0GA 4KK5C 5F8RC 2PLTA 3QIUD 4PSRA 5FYJH 1I9JL 2I69A 2CO3A 3ZPDA 1IJNA 1T20A 5I71B 5ERWB 5ANMA 3QUZB 4XAKE 3KPPA 1JGUL 4FFVD 4O58L 3WY1A 4EBQH 1S46A 4LLVA 2QADC 3PL6C 1KB5L 5JORA 1NMAL 1KZQA 1QFWI 1VFUA 2OYMA 2W5PA 3D4CA 3QUHA 4N87A 4OZIF 4LVNC 1Z32X 4F5CA 3QEQB 5JUEH 3SKOB 3ZKQD 2VDPL 2LV4A 2EDEA 2KPNA 4EUPA 2JCCF 3EJYD 3MLYH 4M8RA 4QOKA 2Z6FA 4FA6A 1EA0A 3HI6L 4FQHB 3SCMD 4AQEA 4Z76B 2WGNB 5LN8A 4IGBD 1U4EA 4KQ3L 3LS5H 1I1RA 2C5DC 3HC3L 3K5RA 1AQDB 1NGQL 1T0MA 1ULVA 2FJGA 5F7BA 3FQ2A 4W9GC 2BOCA 2UYLA 5KVGH 4BYHA 1ETZA 5INDA 5CJOL 5AB2A 1DJWA 2X53A 2YMXH 3ABLB 3QORB 1JTOA 3IMWA 4LSSL 1SYSB 2EXSA 4HKZA 4KI5D 3U30C 3MR9B 3GZPA 2NYYD 4UAHA 1RVFL 4H88L 4NRXA 3CDGB 4U05A 3B3BA 4MYWB 1QFWL 4KHXH 1MHPH 4PVLA 1HI6B 3IFPA 4B0MM 4MA1B 5DJXB 3K71A 1RURH 4WWKC 4G6FB 1FRGH 4RBPH 1EXUB 2QKIC 4RESB 2J88H 3QA3B 3G5ZA 4R84A 1KCLA 5T5NG 3IJSA 3KWUA 2IDCA 4YXHL 4O2FB 2V2XB 2C4FT 2F1EA 1OM3H 1ZDQA 3UCRA 3DXAB 3EYOB 4ANWA 5FF6A 4POZC 4QRFA 1OWWA 3BUPA 3UTPE 1JZ2A 4DAGH 3LEYH 3SGJC 3MRDA 4LHUA 4Q6IA 4PVBA 4E2OA 4ZMTA 2X4OA 2QY1A 4WW1A 1DQIA 4GG8A 2VLLA 5ACZB 1K8FA 1AQKL 2EDNA 2VR7A 2XYBA 4X0KB 4BKTC 4HG4K 5GS0C 2WYHA 3UMTA 4PJDB 4A2MA 4NQCA 4I48B 4PTTB 2CXKA 4JE4B 4LRIC 3QRGH 1EV2E 4FMKA 1MFDH 2CRYA 3O2VH 2XWRA 5FYKD 5KZCD 4TYUA 3ARRA 2Y1ZA 3CUPB 3SPJA 1FFRA 1URZA 1ZHKA 3A67L 3N2JA 1GC1H 5GISH 1NCHA 3BUIA 3GMRB 3UCQA 2X6VA 4O02H 5GXBB 3ZO0A 3MBEB 3PWNA 4U33A 1M6OA 3D69B 1D6VH 3FTZA 2J6EA 1KY7A 1DZBA 1F4AA 2AXGB 3FO9B 3VXSA 2P48B 1OY3B 3D07A 1DQMH 2ZUXA 3DO4A 1C1EH 3VSUA 2F7OA 5M95B 4NN7B 3QYMA 2BVPA 1AIZA 5D2LA 1Z5LB 1F58L 1KACB 2X7LB 1UJ3C 5L0QB 3FB7A 5D1QE 3RGVD 4AK2A 1D6VL 1BHGA 2GUOA 3N9GH 1WBZA 2P80D 5CBAA 5AMVA 5FECA 3WSQL 4TF4A 1UT1A 2WZPA 2R8SL 4HCIA 3FB6B 1EO8H 2FHFA 2K45A 2AV1A 2D2CC 4F2MB 5MEOB 2J1XA 4CAGA 1K2DA 3L9RA 1HK6A 3BP7A 2AJ3A 4HEMA 3UEQA 3TO4C 3A22A 4L48A 1XGRB 1GS7A 2FBJL 3T6WA 3BUTA 3TBVB 4NQCE 2LE9A 4WO4D 1W8NA 5IMLA 5IJKA 2LFEA 1S5HB 2EYTB 4JFFA 4PJHF 3NVQA 5IMOA 3CXHJ 3SBWC 5IQLA 2AJVL 5L2KB 5AZEL 2YGPA 3FQTA 1FL5A 2VAJA 2OMTB 2PCFB 2H47C 2QQQA 3RHWK 2W7ZA 3L2LA 4U2ZA 3WG7B 5D2NB 2NY6D 1GZPA 5H8DA 4KKBD 4W93A 5A2LH 4GBXA 4ZO7A 4PP1C 5K1VA 5T1LD 4HWZB 2C9QA 3VXQB 4LKXA 1FFPB 5C0BA 4IRSB 2FR4A 5E8DL 3APFA 5I5JA 1PZAA 5J06A 3BUDA 4JEGB 1P9MA 1E3XA 4N0CD 3KYMB 4QYOA 2XKUA 4LHQB 2X41A 3P30L 3EDFA 1HESA 4OJDH 1KIQB 2WYTA 3EFDL 1FJ1A 5JR1L 4HWUA 3BEWA 4Z7IA 3BCDA 4FZEL 1ZAGA 2OZ4H 4G6KH 3MI6A 5C0ND 1GIGL 3I9AA 1LWJA 5KVMC 4P5TA 1FNEA 3V0GA 4JQXA 5IMMB 1NPUA 2VC2L 4UOJA 1M3IA 4UMSA 4N2HA 1CXKA 4JKNA 4I1PA 1OGAB 3SE9L 5I73C 2UY6A 2JB5H 3FAWA 3L08A 4C8XA 4RFNC 4WGVB 4OCSL 1DEDA 3HBGA 2ICWA 2EKSB 4JREC 4PLJC 5GZOD 3MTRA 3AFLA 4FZEH 2KZKA 4I3SL 4UINH 5D7LA 1KOAA 2J5LB 2XPGA 3I9GL 4NUMA 1OPOA 1SUHA 4IMLB 3C5ZA 4S2SB 4XGZB 4TSAL 1KB3A 4F93B 3Q2CA 1NGXA 2PR4L 4R3SB 1CFVH 1UACH 1AFVH 4P4RB 3AQYA 3WJJA 3M88A 3PABA 1BF8A 4LF3A 5I75C 2J5WA 4TOYH 5GGQH 5BZWA 4P2OC 4NCC1 4YK4B 1ZHBB 1E6JL 2PWFA 1UWFA 3REVB 1UB6B 4ZMVA 1NBQA 4X5LA 1L0PA 3DRQB 3T0BA 3VA6A 5E9DA 1JK8B 1PF3A 1MFMA 4DZ8B 4HXBL 5DJDA 4YZ0A 3S4SA 4DQOL 1T3FA 3MBEA 5E5MA 1HKLH 1Q8MA 1AGCA 4P5TD 5E2UH 4V11A 1YEGL 3JWDL 3V6BR 1ZGLB 4OVVA 2ZQKA 4MA8H 4U6YA 5C0AE 1HDMB 2IEPA 4F7CB 3OKLB 4AGOA 3PNWB 1K5NA 4L3ED 5CM1A 5JDSB 4WJKB 3MRMB 3GMMA 3VWJD 2DIJA 4I5BB 2QHRH 1CGSL 1FC1A 4LEEA 3WLWD 5I8OL 1IAKB 2C7UB 3S4SB 3GEWB 1J9TA 4FI6A 4A6YL 1PD0A 5IY5B 3U2SB 2GJZA 2PWHA 4P4KC 2V9TA 1U3ZA 3QWQB 3MLZL 5E6SB 3MN8A 3ESNA 2BZCA 2OMXA 3DK2A 2HLEB 2VO8A 3HZVB 2C1OB 1AG6A 2ED7A 2JFCA 2OI9C 4NZRL 1U6AH 3DC0A 4JN1L 3WHXA 3QUZD 4M6OH 4M5TA 4MSWA 4GQQA 4X4XA 3NBNA 1CF8H 5SWZD 4P46B 3OMZA 3LQZB 3QPXH 2BNQD 5HYJB 5EPMA 1KCBA 3CC1A 3BRDA 3N90A 5C07D 4KPHH 1AI1L 3RUGB 1UXWA 3OJDA 3F01A 1MJ7H 4HCRA 1GCYA 6PAZA 3PHQB 3QWOB 5KOMC 4AG4H 3PXHA 2FZ3A 3EJSA 1SBBA 1WITA 2DRUA 3KPRB 1AG0A 3ZT5A 2XBTA 3WWGA 3KHOA 4XCEB 5A2IH 2JXMB 2Q8BH 3JBG7 5DEZA 5C0CB 3SQVA 2Y6TE 2UX7A 3T3PB 1OANA 2DIAA 1ZVSB 4PRDB 1IQWL 4POZD 2G5BB 1NZRA 2EH8L 5I6XB 1IJ9A 3BWZA 3O0RL 4L3FA 3S96A 4AYID 1SEBB 4UQCA 1U8OA 4FQXB 1JK9A 5KSAD 3H09A 4HC1L 1ZMYA 3A23A 4OD2B 3GO1L 1UM5H 3OG6B 1Y0LB 4PAZA 3VFMB 2H0PA 3K5SA 1UD5A 4WHTA 1AO7A 1TQBC 4W4NA 4ZMLA 4IOIB 4R96A 2P44B 3H4FA 4XLCA 4YHYB 3T0AA 1X4YA 3T6ZA 4HULB 4ERSL 1MIMH 3WIAA 5SWZB 3BPOB 1IM3B 5TPWL 2MTAA 4O02A 4TSBH 4H20L 3UJIL 3VM7A 3ZQ9A 3WNPA 1BMZA 1NFDF 3CZFA 1PKQB 4HZAA 2VXTL 4JFQA 4P9MH 3E7JA 1C8QA 2X4TA 1P7KB 2BC4A 1KCUL 1PDKB 2AK4B 4YEEA 2VCOA 4YDJB 1GOFA 3V6ZB 3MUGA 1S9YB 1T0NB 1A02N 2E6PA 4R26L 2FGWH 1MFUA 3LNHA 1P5UB 3EOTH 3GKZA 1JHKH 2F5AL 1DL7L 1F1GA 1P9MC 5EZIH 4LPYA 3MUY1 5FO8B 4PQXA 3FQRB 4NO5A 5C1MB 1PGRB 2CIKB 4H2AA 4X0KA 2G9HA 4UV7L 1ZSHA 2IGFH 1WUNT 2GK0A 2FE0A 3KPSB 3NJGA 5DI8A 4JDTL 3JUYA 2Q20A 3CFMA 4AMXA 1IBFA 4PMHA 3GT6A 4OR1A 2WM0A 1HINH 1G9NC 2VSKB 3ULVL 4DHLA 4K3HA 2CCWA 4TN9A 5F3BA 5ADOH 1Z0MA 3C08L 4LEOA 4NNPH 1QPPA 4A66A 2ZWKA 1PQZB 4BH8B 4PGCB 1YNKL 2AQNA 5FYKH 5IQ7L 1FZJA 2VLJD 2ARJA 4WU5B 1R3HA 2VLJA 3PWNB 1EMTL 5E4AA 1M1XA 3GRWL 2L8AA 1X3DA 4P23D 5IROC 4FQPA 4P5KA 4DP1X 2CGRH 5JDSA 4PJ9B 3VXSB 5ANME 3TA3C 5KAQG 4L4TB 3GUTA 3BP4B 1E40A 4JY6B 1XEDA 3U9WA 1BBJB 4FYRA 3GJFA 2GT9B 3TU6A 4R7DA 3QNFA 1G7QB 1AIFB 2C3VB 3HA0A 4PY8I 4XKWA 1HHIA 1NGWB 4DKFH 5I6XC 2CJUH 1MF2L 3HNTL 3GSQB 4N20A 2IWKA 4LSPH 1AP2A 1ODAA 1QBML 3LQAL 1GZHC 1JWMA 1S7TA 3QI9B 1H5BC 3RGBA 1QI3A 1OAKH 3MACH 2L04A 3E6HA 1ASPA 5EV7A 4YPJA 4JFWA 4ACTA 4X7DC 5AENA 3LQMA 3QUZA 4KV5E 2AVFA 2ZE0A 1ZT1B 3HHSB 3ULUL 4ONHB 4JS7A 2LU3A 2Q76A 4TUKH 5HY9B 1B0GA 2CDGA 4LESA 2Z4QA 4NQXA 3ARFA 4GP4B 4K2UH 4GI8A 4ANKA 5GS1B 1NL0L 5C0AA 2DICA 3E9TA 3FUDA 2E74C 3OAUL 1WAAA 4L1LA 4JZNA 5CHNA 4AL8C 5EF2A 4XP6H 1TYVA 3ARFC 5EU7E 3HI5H 5EOQH 2YK1H 1CK0L 2QVMA 4MJID 5HDLA 4QCIB 1QVOB 1TQUA 2YIHA 3VWJA 4H2CA 4GG6F 1HS6A 2GTZB 1H3PL 2PCFA 3D4GA 4RZKA 5I82A 5HP5A 4BK4A 4NBXB 1ZVYA 1FDLL 4C56E 5DJ0B 1G0YR 5EOTB 3H55A 2JKLA 3T65A 4QJ5B 2Y5QA 4A7QA 2QZAA 3ISWA 1J05A 3UO1H 3G5YA 3P4MB 4MXWH 1MPAL 5FX3A 2YKLH 1GHFL 1CN4A 1NLBH 4POUB 1DCEA 2GIMA 4GPVA 4RMBA 1J5OH 3UAAA 5DMKA 4Y5YB 4D0BB 1OB1B 5I17B 1EHNA 5I9QC 3M86A