3VSTA

The complex structure of xylc with tris
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
638
structure length
638
Chain Sequence
MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
total genus 238
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vstA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vstA01
3BMVA 1VFOA 3GBEA 3WWGA 3HG4A 1OFLA 4YELA 1R47A 3HZ3A 1QX1A 1VIWA 4NK8A 1XGZA 2C8NA 3WNMA 4XLHA 3DHUA 1MW2A 1H3GA 2V3DA 1G5AA 4HA1A 1KWKA 1OGMX 3EJQA 1MFUA 3GQ7A 2VBMA 1RP8A 2F2HA 1KWGA 3DX4A 3S5ZA 1QI5A 3L4UA 3BVXA 3D50A 3BAIA 4FNTA 4GI8A 4PSPA 3UERA 1D7FA 3A4AA 5A6LA 2QMKA 2BXYA 2DIEA 4H8VA 4W8SA 3KL0A 2NTPA 4QAWA 5E6ZA 2NSPA 1WZKA 2TAAA 2O1DA 1EA9C 4WSKA 2QPSA 3L4VA 3A22A 5CGTA 3OLEA 4BA0A 1DTUA 1BF2A 1IDKA 4OZYA 4UQEA 3M07A 4UQDA 2AMGA 3KEHA 3CZEA 3L4ZA 3ZSSA 5A6MA 4EW9A 4JFUA 3ZR5A 2WVTA 4E2OA 3D52A 2OSWA 3B8YA 3BAWA 3VM5A 2OYLA 4UOZA 4GIAA 3WDJA 2FYVA 4MXNA 1KXTA 2WCSA 3GXMA 4GO9A 4AEFA 4UQAA 4J3TA 2VBKA 1W9XA 1RP9A 3EDEA 2F1BA 2X6XA 2WNWA 3K8KA 1J0IA 4OGZA 1XV8A 3AMKA 4JFWA 3QGVA 1E43A 4FNQA 1MFVA 2OYKA 3VMPA 3ZPPA 1TQUA 2VT0A 1NM9A 4NXSA 3WY2A 5TD4A 1OOCA 2YFNA 3L2LA 1RU4A 1EHAA 2WVSA 1CXFA 4OJOA 3BAYA 1DBGA 4MR0A 3K8MA 1T0OA 3TTSA 4UQ9A 1G9HA 3H55A 3H53A 4YZXA 3UEQA 1JD9A 2D3NA 2F7PA 4OIFA 1BN8A 1B0IA 1CXKA 2FHFA 3BUPA 2J25A 1QJVA 1MW0A 1PEZA 2E4TA 2O04A 3AMLA 1CIUA 3DDGA 2ZUSA 3VO0A 4CKQA 3LXCA 4J3SA 4XN3A 4NI3A 3IGUA 3GQAA 2WPGA 3K8LA 1JAEA 2E9BA 4FLSA 2ZWYA 4H8UA 2D73A 3ECQA 4JCMA 1ZS2A 2WCGA 3HG5A 4UZSA 4I84A 4XMYA 2VR5A 1O7DC 4GKLA 1C8QA 3D4YA 4YZ0A 2XIBA 3II1A 4OKDA 4LXFA 5C1EA 1MWOA 1P6WA 3UCQA 2GUYA 2ZICA 4WSJA 4JFSA 1GVIA 1JXKA 2X6YA 1MVYA 1AMYA 4YEJA 1PAMA 4J28A 1JRGA 2O0VA 3ZR6A 1G1YA 4AIEA 1KXVA 3W37A 4TVUA 3GXNA 3OLGA 2UVFA 3L4WA 3TTYA 2XIIA 2XVLA 3LPPA 3GXTA 5AMVA 5I23A 3EJUA 3EQOA 1JGIA 3BUBA 3KE0A 2XWEA 2F61A 1JL8A 4U4BA 2PWEA 3A6OA 4GQRA 1M53A 2D0GA 2G3NA 3WEOA 3ZT7A 1E3XA 1H80A 4UZUA 4W8QA 2YFOA 1QW9A 3WDIA 3IJ7A 1OB0A 2X85A 2EJ1A 1DHKA 2BY3A 4YZQA 1TQWA 5CLTA 1O8HA 3DHPA 2NT0A 1CXLA 1JI2A 1CXIA 1UA7A 4UCFA 3TOPA 1JTAA 4XM3A 1PIFA 4XOTA 1RWRA 1JG9A 4J7RA 4B9YA 4XONA 2E8ZA 3UG3A 3GXIA 1OGSA 1JD7A 2GVYA 3S5YA 2F7QA 4AYGA 4J3VA 4CN6A 1VBLA 2OSXA 2PECA 1PJ9A 2VBEA 2E8YA 3VGEA 1KB3A 1KBKA 1XCXA 2FGZA 1CZFA 2NTBA 3CC1A 1J0KA 4GO8A 2ZX6A 2IGTA 4J3XA 4DO4A 3WEMA 2ZX9A 3CZSA 1XSIA 5BRPA 3ZO9A 4XKVA 1D3CA 2X6WA 1O8FA 1QHOA 4YZAA 2D3LA 5HXMA 1CPUA 3EDDA 3KL5A 2VRQA 1CGWA 1WZMA 3CZNA 2XWDA 1UKQA 2UVEA 2FE0A 1WPCA 2OSYA 4Z05A 3EJPA 1HG8A 4GI6A 4FNRA 1UD6A 1TQTA 3VGBA 1JI1A 1CLVA 3CLWA 3VGDA 1HTYA 1RPKA 2EEXA 4OJYA 1PLUA 4NK6A 4DO5A 1L0PA 3LRMA 3FY3A 3LXBA 3TONA 2NSXA 4KWUA 3BSGA 3D4ZA 5A2BA 3ZQ9A 3WY4A 3H54A 3HJEA 1RMGA 2BHZA 4XB3A 4UOQA 3ZT6A 2G3MA 3WNKA 1KTWA 2WSPA 1B2YA 2PWFA 7CGTA 1KXHA 2IQ7A 4ATWA 1HT6A 1AIRA 1HL9A 2NT6A 1OSEA 1PZ3A 3BVTA 1PPIA 3GXFA 1OFMA 3A5VA 1MW3A 2WC7A 3UW0A 3VSVA 1WE5A 2PWHA 6TAAA 1XSJA 1G94A 4URRA 1J0JA 3DDFA 1V3MA 4WF7A 2F1AA 3FAWA 2Y4SA 4J3UA 1O8JA 4KMQA 4AIOA 1PS3A 2D0HA 2VNCA 1CGYA 1BSIA 1R46A 1UD8A 3FW6A 9CGTA 2C7FA 1ZJAA 5BRQA 1UD5A 2PYGA 4C2LA 1M7XA 2QPUA 1HXKA 4XORA 1R75A 1VJSA 3IJ8A 1UASA 4CVWA 1NOFA 1HL8A 2BXZA 2OYMA 5E0FA 2ZX8A 1QCXA 2YA2A 4OJ6A 1XG2A 4FLRA 4XLEA 2EQDA 4J27A 4AW7A 1UD3A 3GXPA 3GQ9A 4H7VA 2XN1A 3IK2A 1JF5A 2X2IA 3KLKA 2ZX7A 3LRKA 1O8EA 5A2CA 1JDCA 4FNSA 4JFTA 5HDRA 2VUYA 4PCSA 2YA0A 1ZJBA 3LRLA 1XD0A 1VFMA 4HP5A 1CGVA 4PCTA 5CXPA 4FLQA 2F7OA 1KCDA 1TQSA 2QMJA 1WMRA 4HWVA 3LXAA 3BMWA 5E1QA 4XOPA 5E6YA 4OJLA 4M56A 2Y2WA 4PEEA 3UG5A 5I0DA 4W93A 1VB9A 5EMYA 4U3CA 1I75A 3GXDA 3KLLA 2QV4A 2Y5EA 4W8RA 1WP6A 3VMNA 4U2YA 1EO7A 3VMWA 2ZUWA 1CYGA 2XVGA 1WZAA 3D51A 1UKTA 1V3KA 4U2ZA 1O8DA 1S46A 4AYSA 1DBOA 3GRHA 3WN6A 5CLWA 4JL1A 2ZX5A 2QXZA 3KRGA 1GJUA 1KXQA 3ZT5A 2WKGA 4JL2A 1XH1A 2EABA 2ZWZA 3CZLA 4XLCA 4GINA 2VJIA 4HOZA 1XH0A 1U2YA 2ZXQA 3WNLA 4HPHA 2X2HA 2NZMA 4WLCA 1V3JA 2OW7A 4X9YA 3S2CA 4NX0A 4UNIA 2WVVA 2DH2A 2Z8GA 1R33A 1LWHA 4Z06A 2WVUA 2ZUVA 3BVWA 1CDGA 2EADA 2X3HA 2ZXDA 3EDFA 3VX1A 4PSRA 2BY0A 1EH9A 1ODUA 2WSKA 3EDJA 5F7UA 1UH2A 1JXJA 2O17A 4XNFA 3L4YA 1E40A 3ZOAA 3WY3A 2EO7A 2ZXAA 2YOCA 1PZ2A 1BAGA 1LWJA 3TV8A 3KWXA 1UOKA 2CPUA 3BLKA 4XLAA 4UQBA 4AEEA 1UD4A 1QPKA 2CXGA 1KGUA 4FMVA 5E70A 2OW6A 3BCFA 1GJWA 1IDJA 1AVAA 1GCYA 2QY1A 2GJPA 1TMQA 2XVKA 2ALWA 1NHCA 3BSHA 4MB1A 1PXZA 3VX0A 2BHYA 4AMWA 2D0FA 4GI9A 3CZKA 2INVA 5DO8A 4AMXA 4CN1A 5A2AA 4CN4A 4HOWA 1JFHA 1QWUA 3DX2A 3BVVA 1CXHA 4X0NA 3VMOA 4XN0A 1SMDA 1J0HA 1KGXA 2EWEA 2FH6A 2BHUA 1U33A 3BUIA 4U33A 4GQQA 3BLPX 1O88A 3WNPA 1CGXA 1KCLA 2INUA 1Z32X 1JDDA 1SMAA 3ZSTA 1IZKA 4XKWA 1TCMA 3OLIA 6CGTA 2VJJA 3L2MA 3DX3A 3BUQA 3EJSA 1BVZA 1PIGA 4LPCA 3K1DA 3EQNA 3VSTA 1EO5A 1VAHA 1MW1A 2FH8A 3HG3A 1XD1A 1Q4NX 3WFZA 4XL9A 3AXHA 2AAAA 1QI3A 4FLOA 1MXGA 3BCDA 1JDAA 3L4TA 5KEZA 3EJTA 3WENA 3BAJA 1CGUA 1Y7VA 5CGMA 2WKLA 5C1CA 1KTBA 1AQMA 1O8GA 1KCKA 3T9GA 1IV8A 1UA3A 1V3LA 2ZUUA 1HX0A 3MI6A 3B4NA 3A24A 1R34A 2NT1A 2GJRA 2V3FA 5HPOA 4OJPA 1VFUA 2ZE0A 1BLIA 1QI4A 2YJQA 3L4XA 1IB4A 1O8IA 2ODLA 2ZUTA 2CHNA 1UH3A 4OZZA 3WMSA 2WANA 2Z1KA 4W8TA 1KTCA 3VSUA 3AXIA 3LX9A 2FHCA 3A23A 3BVUA 3GQ8A 1O8LA 4BZYA 3AJ7A 3JURA 3HG2A 4H2CA 1O8KA 1JIBA 3BC9A 2YIHA 3A21A 3VU2A 1QW8A 3VGHA 2NTQA 4NZFA 1K5CA 3BAXA 4MAZA 1CXEA 1A47A 1UKSA 1MXDA 2YKKA 2DH3A 4NXKA 1TQVA 1UD2A 1E3ZA 1EE6A 4FNUA 3VGFA 2XN2A 3EDKA 2PWDA 4LQ1A 2BSPA 2F18A 1HNYA 3DC0A 1X0CA 1OT1A 3B90A 4NZJA 2WVVB 3EJRA 4JCLA 1IZJA 4CGTA 3VNYA 3CTTA 1HWWA 3KL3A 1WO2A 3UG4A 3DX0A 1BHEA 2V3EA 2ZXBA 2YA1A 4XR6A 3DX1A 1U30A 2O0WA 3WELA 3GTNA 1BPLB 2DIJA 3OLDA 1DEDA 4UQCA 1GQ8A 1KBBA 2F7RA 1IA5A 2NT9A 3ZSCA 3CZGA 3VM7A 4FNPA 3BAKA 4H8HA 5I24A 1QWNA 4DO6A 8CGTA 5DFAA 1UH4A 2X2JA 1AQHA 3CGTA 5I5RA 4JFVA 3VGGA 4B9ZA 3RIKA 2D2OA 3VMVA 3WNOA 3FAXA 4OJ5A 3BLBA 3GBDA 4U49A 1WZLA 1OGOX 4M8UA 4Z03A 1HVXA 2PWGA 2NSTA 1KCCA 2EAEA 2QX3A 4HOXA 1JF6A 3LPOA 3WDHA 1KGWA 1BVNP 4XLFA 3BH4A 3IJ9A 5E9AA 2E0PA 1XCWA 3A47A 1O8MA 1OT2A 2ZIDA 4AVZA 3W38A 4PMHA 3CPUA 3CV5A 1XH2A 2FHBA 4J3WA 1BG9A 1XSKA 1CGTA 2XN0A 1PE9A 1QHPA 3LMWA 3VNZA 7TAAA 2BY2A 2BY1A 4XQFA 1SZNA 3RILA 3SUCA 3WY1A 3WNNA 2EACA 4U31A 2QLYA 2PYHA 3BUDA 2VRKA 2Y24A
chains in the Genus database with same CATH superfamily
4HPOH 4PJEF 4GBXC 1AR1B 4JO8A 4OLXL 3Q13A 4PJ7B 2WUBH 1XGZA 2C8NA 4D2NA 5IB1A 3M45A 1OTUC 1DP0A 2ZOKB 1OGMX 1HSAA 1MF2H 4A7TA 4ZUVB 5DJ6A 3GEFA 1XZ0A 3LNHA 2GABA 3L4UA 5L2KE 4KHXH 1C16A 1XH3B 4WW1A 4GRLC 3HS0A 2CBPA 1OPOA 3REWB 1SDDB 4W9JC 5EZIL 4H2AA 5I19H 5HYJE 5AVRB 1DLHA 3RY4A 2CR0A 5AZUA 5FYLH 4PLJC 4JY4B 3AM8C 4I3SH 2ZKWA 1RSYA 5T1JA 4QTFA 3C9NB 4HJJH 3KYMB 2VDNL 4JUSA 1QOKA 1JZGA 4K3EH 3Q5TA 2NDFA 1B3JA 2VOTA 3ZIYA 1S8DB 2ADJB 1NL0H 1MH5B 2F53E 4KJQC 3MR9A 4RVBA 3LKSB 3QZNA 5F1IB 5GGSB 2B4CH 5LWYH 1DANT 3D2UD 1BQRA 3V0HA 2RQ8A 2VDKH 4HCIA 1U91A 5L4JA 5ICZB 2MQCA 1FZKB 4G1MB 2LHAA 2VR4A 3THMH 1SEBB 4O58L 3RE0A 2FWOA 4Y8DC 1GGBL 4FERA 2EIJB 4D9RE 2X0VA 5GJTL 3EOAA 2VKXA 1MFVA 4A7VA 1F90H 1GCFA 1BQLL 3QO1B 1BQHB 2OXHA 4IOFC 1EDQA 2ENYA 2H1XA 1OAXH 2F74B 2YEZA 5AVVB 1QA1A 3H53A 3MUY1 4ZOEA 4U05A 4YZXA 2D8KA 4KHTH 4WO4D 3OWEA 4JFFA 3WS3B 3ESOA 3IETA 3W11C 4B5ZA 3CK0L 1D2PA 4FJ6A 4YDZA 5MEQA 1AY1H 4K23L 4UUJA 1FN4B 2G30A 1W72H 1SJVA 4LHUA 3DGCR 3MRPA 4UDTB 2E4FA 2AABL 2AFNA 1F41A 4P2QD 1TYEB 2OM5A 2V6HA 1W8NA 4Z0BH 3BSZH 4GW1B 1QRNB 2VXUH 1HDMA 3FU7A 5SV4A 5I1KH 1XR8B 1I9JH 4DN3L 1AMYA 4ZFZA 1I8KA 2VLKA 4UV4L 2R29A 4N0CD 4JFDD 2XXMB 3NIFB 1ZSHA 2MCMA 5MEND 3TFKD 3EQOA 2XWEA 1H6EA 1FP5A 3PWJB 4UTBA 4ABQA 3MREB 4HG4J 4LL4A 2EYSA 1JS4A 4ZQKA 1AXSA 4PS3A 3HZKB 4AM0B 5EOTB 4NO2B 1FFOB 1NIFA 1DHKA 5T1KB 4Z0XB 5GGVH 1VEMA 1DJXA 2OMXA 3C12A 1MRCH 5CEZL 3KYKL 1UA7A 4B3EA 2A77L 4CSPA 4XONA 1OD7A 3Q2CA 4W68A 4DVRH 3ENEA 1OD9A 1AI1H 1BZ7B 2GKIA 3S5YA 1NAKH 3U30C 1CDUA 4IDLA 5KJRH 2VBEA 2OP4H 2X42A 4Y4HC 1HSBA 2FDBP 4OCRH 3UBXA 5KVMC 5D55A 1ID2A 5F21B 4OJDH 1B4RA 4NZRH 5BRPA 1A65A 1E4JA 5F0LB 4KVPA 4OV6F 3WU1A 3FTSA 4PP2B 1BEYH 1ZA6A 3OAZH 4GMSL 2NSMA 4KI5E 2I7SA 4K3GA 5DRNB 4AGLA 4Z05A 1U92B 2XG4A 3F84A 5I16A 3JV0A 1MFMA 3CLFL 1NLDL 4JG1L 3KGSA 4J4PC 4P5KA 4ANWA 4G8GA 1BFSA 4E5XB 4WTQA 5A2BA 2OTUA 2XV0A 3I9IA 2Z0UA 3WY4A 4ZX4A 4I89A 1RMGA 2NY5H 3SY2A 2HXAA 2ITDA 4ZUTB 1P84J 1AMXA 1E2WA 3F00A 5CN2A 4M1DL 5KJ4A 5FYJU 1WITA 4ATWA 1HT6A 4X4ME 4TM9A 1JGLL 2MJWA 4A2FA 4PJBF 5AOZA 2DWXA 1NC2B 4PJ7A 4TULH 5F1NA 4FI6A 3ARED 5LG1A 4UM8B 4ZD3H 2BSTB 3MLYH 1TITA 2YGVA 3CQQA 5BVJA 3NK3A 4FQ2L 3UBXI 5CZXC 3P11L 4TXVB 2BSRA 1NFIA 3BP5B 4WF7A 4FHJA 4DZBA 5IHHA 1O8JA 4J8RA 4KVNH 3P4NA 4WHYG 4QHKI 4PJHA 1CGYA 3RTQC 3V4UH 2G2PA 2DQHL 4BSJA 4NC1E 4AC2A 3DXAE 1E5ZA 3DIVA 4FF9A 4ORGA 1HEHC 1YEFL 4E9LA 3QFGA 4P05A 1NOFA 1INDH 3VD5A 2ZX8A 2OMWB 3B34A 4M93B 4J27A 3RDTC 1TTCA 1OGTB 2WXQA 4Z5RA 2BZCA 1UZ6E 2ZX7A 3LRKA 3K91A 3K7UA 3R0MA 4U0QB 4R26H 4BFIA 1V5JA 4XNDA 2ZCHH 1BVKA 1A7QH 4LLUB 1VFMA 3UC2A 3FTWA 5E56A 3K2UH 3WFBH 2QKIA 2QMJA 3C6SA 1R3JB 4ZTOH 4WI8A 1AO7D 2ZKMX 1YYML 1OFDA 1FFNA 1M6UA 3BE1L 3FB8A 4I4WB 5AKTA 4DUVA 1DSYA 2AJUH 1BVLA 3FK3A 4NIYE 5HYFA 1OAQL 2UZPA 3D39D 4TLTA 4WHCA 1OE2A 2F74A 4Z8FH 2CCWA 1LQBC 1CYGA 2MH4A 2YBRB 4WNQA 2K4AA 2ZWNA 3O9WC 4YDLC 3SE6A 3QUZA 3ZHDA 3ETBJ 1FFRA 1N2RA 3Q01A 5F7NC 1X5KA 2XQYG 1MJ7H 3QNXA 2BVTA 1GA2A 1FN4A 3BQVA 3CZLA 1Q94A 3B6SA 3CDZB 3OHXB 4L29B 4APQB 2NX5A 1P4IL 4HOZA 3ZRCC 4Z3FA 4RFEB 1XH0A 1RUAH 3MYZA 1N12A 1FHNA 3NH7H 2YC1A 1I8IA 2CLRB 2L8AA 4OJEH 5J6SA 3SY6A 2R56L 4GW1A 3K6FA 1DYZA 4JDEA 5BV7C 5F6IB 5GRVK 4M7LH 4KTDL 4L3EA 5CBEA 5ITBH 2EADA 3B1TA 2OBGA 3Q48A 2X4OA 3GPSA 4IGBA 3DTDA 1N8OE 1ODUA 5F7UA 4X9HA 1FV1B 1WFIA 3F5WA 1U8QA 3B2VH 3PGCA 2LVCA 2VH5L 1T5WA 1F1DA 2UWEB 1IGCH 2WXFA 2A83B 3QJQB 1UADC 3G9AB 1ULVA 2XN9B 2XTJC 3KPSA 1PZ2A 1Z5YD 5L4MA 1LD9B 2NY2C 4OZHA 1WFTA 4YSCA 3KWXA 1BAFL 4OLUH 3UTPE 1CLOL 3CX5K 5AVXB 5JW3L 4KDTC 3BXNA 4YDVA 1A5FH 2CZNA 3HBPA 3HE6A 3O3DB 4I87A 5LDSA 3BT2L 2VQ4A 4KVCH 2GJPA 4OQTA 5KSBE 4ODUA 1JPGA 2ZXCA 5CSZA 1KPVA 1NGWB 1JWMB 3HAEA 5I75B 2GY7B 3K81A 1IQWL 1K5NA 3H2WA 3QUXA 2I32A 3CIAA 3QZBA 1UC6A 4NCC1 2L7UA 4WWID 4IDJL 4AMXA 5ILTH 2GAZB 4M6NL 4KKLC 4X83A 2AJ3B 3LSOA 3MLRL 3P4MB 4KROD 3SQBA 5KVEH 4XPBL 4Y4KA 3GSRA 2Y36L 4GS7B 4AEIH 2YR3A 5DJXA 1GHFH 5GS0H 3GDBA 4PJCB 4PRAB 3WIHA 4XO3A 4IRSD 3RUGF 2K9FB 2BHUA 1NJ9B 1AGFA 1CO1A 4GQQA 4YFDB 4OCSH 3TN0A 3PSSA 3MCKB 1R24A 3B2XA 1O88A 3WNPA 5HGAB 2MNUA 1A3RL 3IT8D 5E9DA 4NZTL 5TK2A 3A6BH 4EN3C 2F8XC 3VCLA 3FO9A 3FQWB 5SX4I 3HRZB 3KPNA 4GKZA 4DERA 3QIBC 2HJLB 3HEIB 3FRPA 3D25B 4PB9H 4XNUL 8FABB 4RCAA 5HDBB 1UCBL 1QFWH 2NSQA 3MJ6A 3HR5B 2MNWA 5DUJA 5IVOA 3RB5A 1KG0A 3TZVD 3BPOC 1ZGLA 3QUGA 4G6AC 3KYNB 2EE0A 4FNLH 1T0PB 4WWNA 1A9VA 5CGMA 4YHPA 3M7FB 2PCPB 2JCCF 2VLRA 3AS1A 2B20A 3FSVA 4HHGA 4E41E 1HX0A 5BS0A 3T1FA 1HFUA 5C09D 4JKLA 4ZSOA 4F8TA 5E8NB 3ARGC 2GUOB 2ZE0A 2DEXX 4HH9A 5FV2A 4BUGA 4GNKB 1USQA 3GKWH 4PRHA 2VAAA 5CO1A 3RWJB 4MHHI 5LDUA 1MHEB 2XV6B 4Q9RH 4Q6IA 4WEBH 3H9HA 7FABH 5DNSA 4LGRB 1DSWA 2YXWA 1O8KA 4IMKC 1I7TA 3VU2A 3AK5A 4FX5A 2ICWA 1A47A 2X1WL 3PAYA 3LPFA 2HLAA 3GIZH 4M8VA 2Z6FA 3SDAC 5KSVA 1XF5B 4PS4H 4NWTL 5B38B 1RCYA 3VI4B 2PO6D 5AW2B 4TQEH 1X7TA 5AWNH 1OM9A 5I82A 2F18A 3DC0A 4TPRH 4WY7L 1RVFH 2P8MA 3CXDH 2DJUA 3DMMA 5D1QD 2QPDB 3T0BA 2OMZB 3EJRA 5EORH 3T8VA 4J6IA 3TVMA 4G83A 2XWRA 4F58H 4BH7A 1IE4A 1TNNA 5C08E 3D4CA 5KUMA 3SKUD 1JNJA 3S5LB 4XR6A 2A6DB 1IBDA 1FZMA 4XP5H 3GQFA 4B9IA 5BVPL 4PWHA 5ADOL 4HPYL 1CLYH 5I26A 4GAJH 3Q0HA 5E1GA 1H6FA 1QMUA 1N68A 1AKJB 3GNMH 3I9PA 4RBPK 4HMCA 2EDJA 4U1GB 1WS7A 3N85H 1B2WH 1OP4A 4PJAF 3L7EB 5EF0A 3CN1A 2LQRA 5GPRA 2BC4A 2AEQL 1SBSH 2MHAB 2VC2L 5EC1A 1L4IA 4NQUA 3GBDA 3WNOA 1IMHC 1E4HA 4H40A 4XMZA 3KM2A 4QHPA 4GO6B 1NDGB 3H3PH 3BQUA 4XP4L 1KY6A 5IK3A 1T66C 2V5TA 3CUPB 3QFJB 2OR9H 1KJ3L 2LTQB 3QG7H 3QIWA 4C55A 3IXTB 1PVHA 4PREB 3NZHH 4NNPL 1DEEA 5DVLA 4W81A 5J8OA 5HGHB 1Z7JA 3BEWA 1RJCA 4YLBA 5IEKA 35C8H 4QTHA 1VIWA 5F71A 1IC7L 3A4DA 3FMGH 3MX0B 1IAMA 2EDQA 2Z92A 1E67A 4XMLL 3C60C 1H3GA 1YO4A 2H9GA 2ZG2A 3V9FA 1KWKA 3QXUA 1KGCE 5C0DA 4G80B 2XZCL 3UPRA 4Y5VA 3ULVE 2UWEA 4JRXE 3NMEA 1REIA 3L3HA 5JPMA 1GL4B 1I3UA 1FGNL 4CADB 4PB0H 4X5LA 3EFFB 1T03H 4HFUH 2PCFA 2JKTM 3H3BC 2ESVB 2RMNA 1RJLB 5AD0B 4JZOB 2ICWJ 5E6RB 3TASA 4E9WA 2W0FA 2YGNA 4GKSA 3KHOA 5F93C 5TH2B 3L4VA 4FTVB 1QO3A 4H1LB 4N6RB 1U8PB 3U0TA 4ADIA 4F9PA 4AIZA 1SFDA 2FJHB 5HGGS 5DMIL 3QULA 1N5YH 2X4NA 3ZR5A 5BXFB 2EYTA 5DD6A 4JZJC 4M1GL 4PJ6A 2XC1A 1VZGA 1J1PH 4GP8B 1NLBL 1SLVA 2OCCB 3O41B 5EUKA 2FYVA 3ARBA 2XN9E 1UXWA 4FQCL 4J3TA 5ACLA 1I85A 6FABL 3U7YH 1NGXA 3CVIL 4TNVF 3O6LL 4AYDC 4FHKA 5CBAB 2J73A 1HQ4B 3I2CH 3VD1A 1NCCH 4KJYA 4ZW8A 3P4GA 3FHQA 2PXYD 3DVFA 4DPCX 4NN6B 5DD5L 1EHAA 5KSAB 1ACYH 1NC4D 1ECYA 2Q7YA 2ZXEB 4QRFA 3B5TA 1NEZB 1SYSB 1YPZE 3RI5K 4BE5A 1OFEA 3GHPA 3BUTA 2F7PA 4WDIB 1BN8A 2HJLA 1DBMH 2XWJB 4XO4A 5A2JH 3BUPA 1YEIH 3RIFK 2E9WA 1UOWA 1QACA 2UUDH 4X9BA 1MEXH 4JO1H 1CIUA 3LXCA 5IBUB 1WIUA 5EEWA 3GQAA 5D70H 5F70A 1D5BB 3SY0B 3QCUL 1RZIB 5C0BA 1KBGH 3GPEA 2FSDA 4DVBA 2WQAA 3CFDB 4Q74A 4YDMA 1O7DC 4PY7B 1F4WH 2CH8A 4FZ8L 1ZIBA 2A6JB 5DJDB 1XIWB 1O5DT 2HVBA 4IU3B 1H3PL 4HXBH 3N04A 5EO0B 1D9KD 3BJLA 4RA0C 3OG6B 3DPBA 4ZTPL 1MHEA 2PPCA 4PJDF 5FFLA 1KXVA 4N0RA 3OLGA 4HHAA 1X5YA 3C5ZD 5HDBE 5LNGA 3O4LE 2XVLA 3PPEA 3BHBA 4U0RC 3ASWA 3DIFA 5HJ3A 3H2PA 1VPOH 2Y1VA 3KE0A 2H26B 3TNMA 1PSKH 3RWDB 3UTTD 4F57L 3FT3B 2D7QA 5FUZL 2Z0BA 4MBRA 1JHKH 2WWMD 3FQ4A 4KJPD 1A22B 5A16A 2Z4QB 3D0VB 1DQMH 4PJIA 2NT0A 2BM3A 5I1EL 1F8TH 4P3WA 2EYRB 1L3NA 1WSST 3QYCA 2PW2A 4PTUB 5ACMA 3MLSL 2GC7C 1MIMH 4RAHA 2DAVA 4DHLA 5JDJA 3T2OA 1XGPA 3D85A 1MCHA 5F44A 3S96B 3MOAH 5F89A 4BKLB 4JMNA 5IROC 1MDTA 4HJUA 3Q8FA 5LAPA 2JNZA 1UQSB 2DBJA 3DKHA 4Y2DC 2G3ZA 4D0CA 4P07A 3CZSA 4EN2A 1A1OA 3HHRB 4DQOH 4PQXA 1TYVA 2L7QA 1T89A 4KPHL 4WI2A 1BFTA 4BQ9A 2VRQA 1JCKA 1MFEH 4ZOAA 3VFRB 5KYWB 5TE7L 4N26A 2K7QA 2AJXL 1KPRB 4XT1C 4OSUL 3EFDL 3GRWL 1OV8A 3JWDL 4XN5A 3N1PC 4JM0A 1JI1A 2PTUA 3OKMB 3QFDB 1TUPA 2P8PB 1EZLA 4DO5A 1MQKL 3NCCB 1RY7B 2ZOLB 3KDMB 4JDVB 1OCCB 4MASA 1FIGH 4HIEA 3RVTC 3O45B 3ZHKA 4LQFL 1LVEA 5F7EH 4P9HL 4JMXA 1WFUA 4N22A 4N6QA 3QZWG 3SE4C 1C9SA 43C9B 1KXHA 2YPKA 5DC4B 4LNRB 1HH9B 3AQYA 1IM3D 1PZ3A 5HGDA 5DURD 2NY4B 4P06A 4Y2NA 3HI5H 3P40A 1BXVA 3DETC 5BV7H 5IMKB 2G2RB 4GXVL 3FDWA 3GM0A 3GMOA 3GRWA 2UZIL 3VTAA 4Z7QF 1M6OB 4XBGA 4FQLH 4HEME 5L6YL 2P5EA 1MAMH 4GT0A 3KLDA 3QFJE 3TCLB 2D0HA 2FT6A 3ZTJG 1B0RA 4YGVA 1IRAY 2KPWA 4HZAA 4X9FA 5FCUH 3RGVD 3SO5A 3WFDH 9CGTA 3MRIB 2HA1A 4PV9B 1MRFH 5KBLA 1CF8L 1MCEA 4GLRI 3IJ8A 2PMZA 1J10A 3NZUA 1BECA 1P2CB 2XJLA 3TH4T 2X2UA 4PJHF 1MWAH 3HG1D 2P5WA 2E9GA 2Q2LA 4LK4A 5AOLA 3TBCA 1G7IA 1IGYB 1MLCB 1SUJA 2GFBB 5I18H 3FTGA 4BEIA 3MC0A 1EZSA 5A3IC 1SXCA 4YFOA 1M71A 3O0RL 4PCTA 4Z7VB 2ITCB 3O6FA 2K1MA 3KCWA 1TQSA 2GK0A 4QRRE 1RL1A 2YGQA 2JTYA 1OARL 4IGBC 2A5UA 4U1MA 1RJZB 4OF6A 2ESVE 2ATKA 1A64A 1EUTA 1OPGL 4AKOA 5IW6A 2VDMH 3BD3A 5GRXG 1W0WB 4HJGB 5HSFA 3TU6A 4M1CC 2H1PH 2AV1B 3VMNA 1IEAA 4AE1A 4OZIA 1H5BA 2R69L 3C87A 3D05A 1EO7A 1XB3A 2P7TA 1BXXA 1R6VA 4MMXB 2XWJA 4LLWA 3CH1A 3VXMD 1NMCB 1UYWH 3KXFA 1K4DB 2QQKH 5DUMH 3VXRB 1LM8V 1Q38A 3RJOA 1KSRA 1KQ5A 1TVHA 1TLKA 4MXVE 2QLVB 4GINA 2H0JA 4AENA 3QUXC 1KTDA 4R2GC 3NVQA 4FFWD 4PJXB 5L8LB 1NMBL 2OK0H 2X2HA 3L6FA 2BSBA 1PNCA 4UNIA 4DK5A 3IJEA 4Y4KC 5EU6A 2Z8GA 4MSWA 4DGYL 5D7SL 1E27B 5HHXL 2R69A 1RJYA 3FCTB 4OGXH 5EO0A 3IVKA 4K7PL 5D7JA 3DUSB 4LCWA 2BFVL 4KI1A 3U2JA 3MO1B 4NRXA 6PCYA 1E40A 2YMXL 3TN0C 4LASL 3EBGA 1QRKA 5JNYB 5D7KD 4BGDA 3N06B 5DS8A 5HTSA 3QUYC 4UU9B 1ROCA 1F4YH 1YC8A 5D4IA 4BHUA 3CMGA 2V7NA 4NM8H 5BQ7B 1E5CA 4AEEA 1L9NA 3ERXA 4FMVA 4UTCA 3ZBMA 5L7XH 3FFCA 3QS3A 3V0AC 4M4RA 2QQLL 4IBVA 3ZE2F 4PJ5A 3LEVH 1RZPA 3M46A 4OZHF 5D2NA 4U6VL 4Z95H 4TNGA 2APSA 4R90L 2G60L 5JOPD 1E6JL 2O5XH 2VZTA 4NP4H 3ISYA 4WV1B 4HOWA 4AZ8B 4OV5A 2VDOL 3FHEA 3AC0A 3LKNB 3SDDA 4LPXA 4G8AC 4UILH 2VJ8A 4PJGF 3VGAC 4M6AA 1OE1A 3OMIB 4ODWB 3QCVH 2XWBA 2KERA 2EE2A 4P2CG 1ETA1 4AK1A 3DYOA 4NENB 3VWJC 4YDJB 1MCNA 3DURB 3V6ZA 2BS8A 4ZO9A 4ICWA 3Q8AA 3MBED 3DHJA 3LQMA 4MAYA 1SM3H 3TA3A 3SIKA 3V4VH 1Z6JT 4OGAD 3ZSTA 2FO1A 5FDWA 1TSPA 1N0LB 1S9XA 4A1RA 1P7KB 2IWEA 5B22A 1HZLA 1VAHA 3CD4A 4DSYA 3FT1A 5AVSB 5T3ZH 1I8LA 3BIBX 4XL9A 1ZHLA 1QI3A 4LKCB 1KJ2B 4K7FB 2ZQKA 2CA4A 1S7VB 3DMMC 5K39B 3VDBA 4IIZA 1HQRB 3UOAB 2Y7NA 2XQYA 5E7FA 1KTBA 5FA4B 5LAXA 1NGPH 3QAQA 2J6WA 2NT1A 3MV7A 1MREL 2YJQA 1O8IA 6PAZA 2QYUA 4XNXL 4B95C 4BCXA 1KELL 3GO1L 3B9VA 1T1YA 3V9CA 5EZIH 3SEPA 1S9YB 1I4FB 4IYKA 5D2LB 5J56B 2PPDA 4NHUA 1O8LA 5GZOD 4YSSA 4LIQE 5EN2A 1IAIM 3U2SA 2WNXA 3BP6B 1G84A 3QWOA 1K5CA 3LQZB 2OL3L 1ZLSL 2HPTA 1XXDC 2VDNH 2JV6A 2ROXA 1B4LA 4WNJA 2ZNWA 1MY5A 3SKNA 3HE7A 4G9FB 2I85A 3NT0A 4AVJA 1DQJB 4EEEA 5TDOB 1EE6A 3W9EB 3EDKA 4LQ1A 5IB5B 2NNAB 5C1MB 2JIXD 3QIWC 5F0MB 1H15B 4W1TA 2VDQL 4P46D 1OT1A 4WZ9A 4LHJB 4XNZC 3GSXA 3FS9A 4JCLA 3H1ZA 4POZD 4CGTA 3DJZA 1N10A 4L4VE 2P1YA 3I3BA 1VA9A 4O58H 4ZMOA 5FA3A 1GGBH 3LN4A 3UP1A 5FW8A 3P4OB 3T6VA 4CNIA 3P30L 1BQLH 1YEGL 3CSTA 5AW7B 4I2XA 3GI9L 2YRBA 1NFDA 4OUUA 3VB9A 3R06B 3VJ6A 2WP3T 5ETUB 5BO1L 4R7DA 2AQ3A 2XQBL 5CZKA 2IPUG 1EA0A 1ADQL 3UYRL 1V10A 4GG6A 1FL5B 5ID1B 4JE0A 3RPBA 3OB0H 3TO4B 5DO2D 4HKJB 2DTML 3BLBA 2XA8H 5D1ZB 4M8UA 1RUPL 5I1AB 4Z03A 4U1HA 3HUJF 1RH8A 4KJWD 3WEAA 3F6JA 4L1DA 2DM4A 4OF3A 4F9PC 1AC6A 2DQGL 5I5MA 1XCWA 2AABH 2BNQA 3S36X 3BN3B 3X13B 3DRTB 3PL6C 1OWRM 4J3WA 2IBBA 5JIIA 3V95A 1CR9L 4FLHA 4MXQC 2DQMA 3MBXL 2K6YA 2BY2A 3MRHB 3IFNL 2QVMA 4P2YA 4OFKA 4DN3H 3L17A 4IJ3B 2PYHA 4HIQA 1Q72L 4KKNA 1ADQA 1E27A 4RFOL 4UV4H 1DJIA 32C2B 4ETYA 3WWGA 1I85C 4EO5A 4JRLA 1RMFL 1S9WB 3OKOA 4AXWA 3CN0A 1K2DB 1J05A 1OL0A 4XCNB 4N2NA 4WTXA 4EMZA 1WWBX 3D0AA 1CICA 1MFUA 1PZ5A 2GSGA 2A38A 3EJQA 4FQIL 4NZDA 5DQJB 3ZMNA 4C56D 3VXRE 4FNTA 3QBTB 3PJSA 5CCKL 2RTTA 3SZEA 1D7FA 3KJ4B 2R0LL 3KM1A 4FXLA 4PJXE 5FWRA 3L9YA 4JCWA 5CEZH 3KYKH 5K9OA 1HEJC 2CK0L 5JPNA 2A77H 5C07A 2LLLA 1GOHA 4A2DA 1PD6A 1IDKA 4P23D 1E6OH 1A2YA 2VLJE 3VQ1C 3H8NA 4MA8H 1G9ML 2GIXA 4MQXD 3AXLA 4HK3N 4A2EA 2I07B 3A0OA 5EF2A 1BVOA 3GTVA 1QEXA 3QDGA 5LKNA 3WDJA 1ZTXL 4MA1C 1OAYL 4AQEB 5E8EA 4PLKD 1KXTA 1YEHL 3QJXA 1YNLL 4QHLB 4GO9A 5ICYA 1PLCA 1TJHL 5CILL 5MEPB 3AB0B 2X6XA 3L5WA 1YNTB 2P44B 4CU6A 1HHKB 1KXVC 4IRJA 2MCPL 1SJMA 3D07A 5TDPA 1O9WA 5JHDA 5LBVA 3CLFH 2C7UA 1NLDH 4JG1H 3NZSA 1KYDA 3MLXL 4N9GA 1CXFA 2DKUA 3BAYA 1B0WA 2V2WB 3AACA 4FYTA 4UI2A 3GS7A 2VRAA 2X9XA 3GS4A 3QEQA 2FX7L 1KTLB 1K85A 5TQ2H 1PEZA 2VUKA 4KKCC 1URZA 4M1DH 2O04A 3DDGA 4E5XG 3O2DL 1SNRA 2VABA 4I0KA 1JGLH 4NUPA 4R0LB 4X99A 5JXEC 1IVTA 4N2EA 2W9EL 5D1XD 4H8UA 2D73A 5KWYC 2J43A 4BFBD 4ORZC 4MCNA 2D31B 5GSRB 4CMHB 2NY0B 1X5MA 4FQ2H 4KRNA 1ZXQA 3B3BA 3GJFA 3P11H 4P5TA 5D7IA 5F0JB 5F97E 4MRCA 2AK4E 1EZVX 4M62L 5CJXC 5FB8A 4WSJA 4P2RE 2CUHA 3UO1L 2XBTA 4HAGA 3RVXD 1EHNA 5C0GB 1PAMA 2DQHH 2ZAGA 4OBSA 5F9WC 1UGKA 1NFAA 4W9KC 2HT3D 1FG2A 3L4WA 4P4KD 3PDDA 1YEFH 4WEUD 1U3HD 1U3NA 4N9OB 1DCEA 4YGAB 2ATPA 3LQZA 4M7ZC 4XVOA 1VFBB 5CZVL 3TO2A 4V1DE 2ENPA 4KK9C 2D0GA 3ZT7A 2MPAL 5IM7A 4Y8AA 4W6YB 4X8JA 4EDXB 1QW9A 5TE6L 3JV6A 1LL1A 2X85A 2DQUL 3GB7B 4YCQA 1JZ8A 1O8HA 5DJZA 2DJMA 5JQHC 4X7TB 1CXLA 4HDIA 4N20A 2HZHA 3MFFA 1VFAA 4CBZA 5FKAB 2F19L 3O8XC 4MJ5B 4XOTA 3VD3A 5JQ6L 5DEZA 4HZLB 2JI2A 1RWRA 4GUOA 2A4EA 4ZRGA 2O6WA 2ADGA 5D2LE 2P46B 2R39A 3LOWA 4NB7A 4LOVA 5GS0D 1YYMH 5JMCB 3PWLB 1AHWB 5KVGH 2FSEB 5J3HD 3BE1H 4NT6A 1S3KL 5JUEL 1VBLA 2PECA 4RESB 1OAQH 2DS4A 5CNHA 3FCSB 3JWDC 4JVUA 4LMQE 5J9PA 3B9KB 1ILUA 5JXAL 4EVNA 3EKCA 5DJ0B 1TZGL 5IJVB 1MG2C 2XKNA 1JGEB 3O2WH 1Q1PA 5D8JL 4YC5A 4HKJA 1NINA 2Y6SC 3IDYC 1EPFA 2KDYA 5E5MB 43CAA 2WZAA 3WMQA 3FQ1A 3JBG7 4X6EB 5SX4H 5FO7B 3HBZA 4P9HC 3S48A 3U6RB 3NB2A 1RAMA 5EU3B 3SBPA 1YY8A 4F7PB 3CLWA 1JPEA 3S34L 1LILA 2EEXA 5FCSH 3T2QA 3T0EB 1EXGA 3F62A 2XT1B 3APCA 3T04D 3X13A 2ADIA 2DIAA 2R56H 4A39A 3BSGA 2ADYA 3HJEA 3K6DA 1P4LB 4KTDH 4NO0D 1GTFA 4ZUWB 1B4JL 2DWYA 2EE6A 1B2YA 4K94L 3HAEH 2H2PD 3O6FC 4N3UA 4G9DB 1L3WA 4F8OA 2P42B 4GBXD 4N86A 1OSEA 4MD4A 1WBYA 3G08A 2WC7A 3M8OH 1OTUD 1JRHI 4NQDD 3ASNB 3WEXA 4BH8B 1BX2A 4Z6AT 6TAAA 3G04A 1DVSA 3NCEB 1OSZB 1QSEB 4URRA 2DPKA 5FYJE 5G5DA 5CWSA 1BAFH 1LTXA 1YDPB 3S36H 1CLOH 3U36B 5JW3H 4A7GA 4GRLD 3S88L 1CFTB 3WE1A 3P2TA 1IUZA 3BT2H 5T1LA 3IDUA 5D5MF 2KUTA 1UD5A 2OMYB 1F3JA 1IAKB 2JB5L 2E27H 3OTTA 2J5LB 4JJHA 4QGTA 3AUVA 2VFQA 1UUSA 1M3JA 2IOOA 1IQWH 1D5XA 3DTUB 1QD0A 4JKKA 5FYLE 1GMIA 1J5HA 3MLRH 1A7RL 3VD2A 2W0KA 4XPBH 3FQRB 3UDWA 2Y36H 4OI8A 4IEFB 3MRMB 2X2YA 3OAZK 4H0IA 2BOBA 4QWWC 5DHDA 3LYCA 3IU4L 4WO0A 4P2OC 3K4DA 2J3SA 4FLQA 1M1SA 5C2UB 4XXWC 3UAEA 3NAAL 5KBDA 2EXYC 5D7JC 3UC0L 3FTVA 5EU4A 2KBGA 2C9PA 1QFUL 2G9HB 3GMQB 3OKEB 1FL6A 4Z7NB 3UPRB 4HLZG 4NZTH 1QQ1A 4JQVA 2X0WA 1WIOA 1WBXA 2CM6A 2NMSA 4IOFD 2VXTL 4S11A 3CPLB 2DQTL 2C9QA 3AZUA 4XNUH 4MTMA 1RZQA 1UCBH 2CLZB 4WKZA 1V3KA 4PYGA 4ZS7L 3I02B 4NWUL 2LFGA 3W11D 4MMZC 5TQ0L 3WN6A 4YE4L 3EW3B 4RMBA 4GKNA 4F93B 3QIUB 2Y7QA 3WSQL 4OZIF 1HL5A 5D2NC 1L5GB 1QLEL 4Y5XA 3AROA 4FXGC 3CSGA 5B1BB 2C3HA 4K8RL 3VACA 2X05A 2FBOJ 3T6QC 4ZXBA 2WVVA 3ZE1F 4MZ3A 3SDDC 1MHHA 3QJHB 2HMIC 2JJSA 5MHSE 4X9GA 1CDGA 1HH6B 2GI7A 4HKXB 3VX1A 2G5UA 3KCPB 1MAKA 2Q76A 3C6LA 5HYJA 4ONHA 2VISB 4UBDD 3T4AA 1KN4H 1SDAB 3BH8A 3OXSA 3QZWA 1VRSA 1WBZB 3V4PB 5A7BA 2YO3A 3BGMB 5B8CA 4H8WL 4NWTH 5IMMB 3TA3C 4DKTA 2B8OT 2YOCA 4F7KA 3PHAA 4EZJA 1S7QA 5IFHL 5DJYA 3GK8L 2F53A 2VKWA 3MRCA 4Z3IA 4WY7H 1HCZA 1KGUA 1OSPL 1H0DB 3BCFA 5B38G 4MJIB 5E95B 2AK1L 3MNMA 5EO1B 5I28A 3N0PB 1M1XB 1KPUA 2BSED 2KS0A 2D7PA 1PCSA 3ZW3A 4WAFA 5BVPH 4JE4B 4NCC2 4HPYH 2ZCZA 5ADOH 1AYOA 4ENZA 2BM6A 4YHLL 1UWFA 5ALBH 1A3QA 4Y9BA 4CN4A 4Y2OA 2HTKC 3S5LG 4Y4HD 2A1WL 4NBXB 1QP1A 2EDWA 3ZDYB 5LJYH 2AEQH 3GMPA 3CCHB 1RPUA 3FUIA 2ZSWA 5EBLA 3RX8A 3WHXB 2VR3A 3DOHA 3KWTA 1LE9B 2FQGA 2A4CA 3QJFA 5T3XD 4KH2A 4KK6C 2ISDA 3LNDA 5TDNA 2YRLA 3DVNA 1HHGA 3VFVB 4N28A 4Z7IA 3STLB 4RAUA 3DO7A 2CO2A 3HE7C 1KJ3H 2FZ3A 3PWVB 3ARFA 4OUOA 5F96L 1U8MB 1XD1A 3OXRA 4NNPH 3RPIB 5CU5A 4W9GC 2K0RA 3BPLB 4FLOA 3BT0A 1ET8A 2R0ZL 3APNA 4BQ6A 4BKTC 1MI5A 3TBYA 3NPZB 5KOVC 1IC7H 3KBEA 4XMLH 2IQAA 2HJFA 2XZCH 4XOBA 2XX1A 3OJDA 5HPOA 2OJEA 2AQQA 2ODLA 5HHPB 1FGNH 3BEVA 4OZZA 2NZ9C 5CZXD 1JBJA 2MCAA 4Y1SA 3X12A 3VXOB 3T0EE 3FSOA 1MNUL 1QG3A 3LRSA 3I3EA 1K8IB 4H2CA 4IRZA 1LNUB 3IRZA 3DX7A 1TT6A 2Y5TA 2R0KH 3AS2A 2BNRE 3S4SA 2XFXB 3OR6A 5BUGA 3BH6B 3LB6C 4KFZC 1UD2A 4H1LG 4M1GH 4Y19B 3RDTD 1IGFL 2BJML 2APFA 1I1FB 2PWDA 3BN9C 1F6FB 3LNFA 4GFXA 4MVBC 5B4MC 4HIJA 2OA9A 1FH5L 1BZDA 1FFPB 1L6PA 1L0QA 4GXFA 2WO2B 6FABH 2ILLA 1IZJA 1QSEE 4N8UA 3GSOB 3CVIH 3O6LH 1DBKL 2IADA 4JFOA 1PG7L 4YBHA 4Z7WF 4QJ4B 1EAPA 3LIZH 1WC7A 3EGSB 4A37A 4KXBA 4Y88A 5BUAA 4XXCA 1JUFA 5DD5H 2P9RA 1IAOA 3U9WA 1II4E 1A4JA 1GH7A 3FZUC 4LGSB 4JFXA 4OJAA 1AD0A 4HSCX 4K7PX 4UT9L 5FUOL 4FQXB 1IT9L 1X6LA 4WFGD 3DV6B 4ELME 1G6VK 1KIRB 4QRSA 3MNWA 1O9ZA 5KAQG 5J6HA 5BZDA 2E7MA 4Q8BA 3O9WD 2ZXWB 4WWKB 3SO3B 5JPNC 1KCCA 3V0EA 3CVBA 4HKZB 4PWIA 2Q10A 1TCRB 3QCUH 4Z7UB 4FC3E 3UTSB 2Y07H 4IS6B 4PWJA 4LKXA 5IBUG 3E38A 1MCCA 2IIJA 2FHBA 4FZ8H 4L4TB 3TIEA 4QYOA 4Z7NE 1H3PH 1NMAL 2YPVA 3DBXB 3NEXA 4IK7A 4JN2B 2YN5A 3RILA 4BQ8A 2CRIA 3OAYH 5FOBB 5FO8A 3SUCA 4PV8B 4UT9A 2QLYA 1FCGA 2N4IA 1TKWA 4ZTPH 3OAWA 1KXQE 2PYED 4M3HA 3OSVA 3QJUB 1QLRA 4W9ZA 3E6FB 3CFTA 1OXYA 1PY9A 3DXAA 4UNUA 5I17A 3RFZA 1UT9A 4R84A 4NQQA 4OZFB 4NQEE 3FQXA 3STBA 3M17B 4L0ZA 4XNQA 4F57H 4LGPB 3K72A 5D96C 1SVCP 3RKPA 1QI5A 5FUZH 5ISZD 1HS6A 2XTJD 2IALB 5IWLA 2Y6TE 4AQ1B 1FVDB 2NY2D 3FOMA 1G9MC 1DO5A 2HKFL 4YIQB 1P5UA 2W91A 3LRHA 4GLRH 4N1HB 4XBPB 3KL0A 1PY0A 4MQTB 5I1EH 4K2UH 2NTPA 5HVFB 1TQCC 3MLSH 1A6TA 4LCCA 3A22A 2YWZA 4BA0A 2EIKB 2YD0A 1S9KC 5C7XL 3PQYD 1CS6A 3KLHC 4GRWB 5DHXB 3B83A 1UB6B 2CHXA 2P47B 3HMWH 3QEUA 5F9OL 5FYKU 5IF0A 2H6PA 1JNHA 2FWUA 4KKLD 3D2UB 2A9CA 1NPJA 1V54B 1HK6A 2L0DA 1U8NB 4JQXA 15C8L 1UZGA 1C5DB 4KPHH 1E5BA 3QDJD 3DRQA 3KAAA 2IAND 1NBZA 1SOQA 5EU7E 5TE7H 1CE6B 1J8HE 2HG5B 2F54D 2AJXH 3D69B 3LMJL 4OSUH 1M9SA 2HKHH 4MJIE 1IBHA 3JWDH 4GEIA 1R3HB 3V0DA 3SDXB 4AYMC 1TTRA 3F6IA 1CIDA 4I3RL 4EN3D 2NW2B 4NUJB 1JD9A 4WO4B 4X4YA 4MWFB 1K4CA 3EJCA 3QIBD 4F7CA 1U8MA 5EU5A 2Q8AL 4LQFH 4EI6B 4KZCA 4MS6A 1O9VA 4MYWB 2Z31A 4J3SA 3IGUA 5MERB 2WPGA 2Z8SA 4G6AD 1AKPA 1J8SA 1T4WA 3Q44A 4PGCA 5C9KA 1C7SA 3E2HB 4QCIB 4AYFB 2VSDA 5I1LA 4GXVH 4OAWA 3WTVA 4GEJA 3PWNB 3GTTA 2BVEA 4OKDA 1OE3A 4MCYA 3ARGD 4GAFB 3FO2B 3UFIA 2BIIA 2GITA 2J8UB 2ICEC 5L6YH 4I0PA 3OKLB 1CD9B 2OJ1A 4X6BA 3FT4B 4F20A 1JZHA 2Q2EB 3MTRA 3QNYA 1IEBA 2AJSL 3EGXB 4Z3EA 1DABA 4XMUA 1T6BX 4JFDB 1Q9WA 2WXHA 1CF8H 5MENB 3LPPA 2WMPA 5F8QC 5KSBA 2FRGP 1IFGA 4Y1AB 1P7QD 1R3LA 3BUBA 3LZLA 2F61A 5IJKA 1ZD6A 3SDAD 2DQIL 3VFPA 2Z91B 1E3XA 3CFBA 3L45A 2EJ1A 5I6XC 4JRYD 3ET9F 3O0RH 4FXKA 5DQ9A 1JI2A 4LOFA 1JTAA 1JK9B 2X4QB 3MU3A 2P45B 3QRBA 3DUHA 4PJ8B 2GVYA 3V0VB 4HS8L 4LVHB 2C3WA 5E0QA 4ODHL 2FGZA 2R69H 4DN4L 1CFVL 4Q52A 2EIMB 4RGNE 3GXUB 4YSPA 4V11A 4Y19E 1KIRA 5K59E 1MCJA 2BNUA 3HZVB 2AXWA 1JHLL 1TFHA 3R19A 1JZ4A 5T3ZD 3ZO0A 3FT9A 1I9IH 2GT9B 3G5YB 1ONQA 4K94C 1TMCB 3UGXA 1IKNA 4M4PA 5FUCE 3QORC 1CLVA 3U7AA 4NDMB 1RZ7L 4KO7A 5GRVL 1NMBH 2YD2A 4QY8A 1RZFL 1I3RB 4ODVH 5EEYA 4L37B 5F7KC 1G7MA 1CD0A 4WHYH 3TONA 4KWUA 3ABLB 5I5IA 3DO4A 5D7SH 5HHXH 2A7BA 3J2PA 4K71B 2WSPA 4K7PH 5DEFA 1FGVH 4PM1A 4HF5L 2VR7A 1C12A 1JZ2A 4Z7OE 2HUEA 4HJIA 2BFVH 2AJZB 5E8DL 2YMXH 1PDKA 2EIEA 1FC1A 3HMXA 3AREB 1T22A 4LASH 2NZ1A 3A5VA 4FQHB 4PLOB 3B9EA 2M8XA 3C60D 4RZKA 3NJLA 1PZUB 5IKCB 4JQVC 3QR2A 4ZMQA 3EYFB 4NSKA 2CGYA 4Z7UE 1Q9OB 2P3YA 4HJTA 2EKSA 2LOEA 1FVDA 3NOIA 2I25N 5KG9B 3ZKMD 4YIQA 2XTLA 2QQLH 5E7BA 4AGPA 4KO9A 4DP8X 2OI9C 4NNYA 2VQ1A 4DGIL 5BRQA 4JFFD 1QLFA 3G5XB 3P9LB 1HZHL 1MDAA 1UJ3C 2N1TE 1KJVB 2NDGA 3H7BB 4QKXB 4U6VH 3V5KA 5C08A 1XCQB 4AW4A 4BFNA 1A7OL 3KBPA 3N50A 4NFCA 4XGZA 2WYIA 3O0LA 4BFOA 3P54A 4R90H 4OJ6A 2G60H 2Q20A 4FLRA 4LNVA 4A7GF 1XG2A 4LHUD 1IFHL 4NAMA 1ZV2A 2X2IA 2VDOH 3F7LA 3VE0B 3UAFA 4NKOA 1F4HA 1ND0A 4PWFA 2JJSC 4FULA 1WD8A 1BFOB 4S0HA 2C4FU 4ZNCD 3LXAA 2XBDA 1KNOA 3BMWA 4W4NA 3C6LC 4NRZA 5ESVB 3ZKXC 2VLKD 3T4AC 1AO7B 5SWZB 5I0DA 3ULVL 2H0EA 5CMAB 4JFYA 5B8CC 1IC5L 4U3CA 1YUHB 4B9CA 2DMBA 3LKOA 1MG3C 1Z9PA 1WP6A 3D39B 3NCFB 4QDGA 2BDNL 5TF0A 1Y6KR 2EUXA 2NCMA 2NW2A 1EHLL 3MMEA 1DQDH 1ADWA 4K8RC 5C0EA 2JJTC 4U3SB 3K0WA 4UAOB 4G43B 2ZCKL 3U1PA 5CCHE 1G9NL 1OEZW 3D0LB 1ZT4B 5E1IA 4MA3B 1WGOA 3L1FA 4JL2A 4WI3A 2EABA 4NKIL 1S7XA 3AWFA 3HCVA 5CIPH 1T5XA 1MREH 3WKPA 4QEGA 4P2QA 2Z35A 2G4EA 2XA3A 4JRXA 5IT2H 2CBOA 2NZMA 2B59B 4XNXH 4H8WC 5EPMA 5CD3B 2PPAA 3AU1B 3GO1H 3SDXE 1LWHA 4R7NA 1MIEL 4Z06A 1P1ZB 3X3FL 5J57B 2FX8L 1A7BA 3BP7B 4XNFA 2FJUB 5AVZB 3RNKA 2OL3H 5C2BH 1ZLSH 4M48L 5DEJA 4PP1C 1OT4A 2J2ZA 5F8RC 4X4XA 1VZIA 5CEZD 4HWZB 1SOXA 3WY3A 3AQDA 3ZYZA 4J5VA 4PTTB 1MUJA 3HA0A 1E0OB 2ICES 4BK5A 4HKBA 2AKRB 3ARFC 2WIMA 3SYOA 2Z3FA 4LFHG 2VDQH 3W5NA 4LSTL 4G8GD 2WY3B 2BWDA 2FLBT 3WJMA 4J1UA 2J8UE 1NHCA 2EIZA 4YSAA 2H3NA 3EH5B 5DZ9A 2CO3A 2CO6A 1NKOA 3ZTDC 5IFAL 2YAMA 4QJ3B 3P30H 4OGYH 2NTFA 1YEGH 5IB4B 3GI9H 1DUYB 3CX5J 5DO8A 3RURA 4QRBA 4GQPH 1VGKB 5CEXA 4JQIH 3HW7A 3T65A 2I9LB 1G7HB 2ZSVB 4Y1AE 5BO1H 5IROD 3EYQC 4LSUL 1ADQH 3UYRH 1YPZA 4X0NA 4XB8A 4CRPA 2HT2C 1DANU 1KGXA 3BUYB 4IRSB 1RUPH 3HFML 2FLMA 1QR4A 4NQCE 2HFFB 3RNQB 3IKCA 5F6HJ 1CYWA 4H8PA 1CFNB 2BIMA 1YAZA 2K45A 2DQGH 3OV6A 4ZPVA 3IF1A 1U93B 1OSYA 2UY7B 1R19A 5K9QG 1JGVL 1CR9H 4RAVA 3MBXH 5KYUB 5BJTB 2DW5A 2VXQA 3WFZA 4OD2A 1EVTC 3IFNH 4L3CB 4GJTB 3SYJA 3HTLX 2EDRA 2AQ1A 2IFGA 1Q72H 4RFOH 4HBQA 3RVTD 3TZVB 2JVUA 1RMFH 3BAJA 1QR1A 3FRUA 1Y7VA 3BD4A 2VFMA 2UY6A 4EI5A 1U58A 1RQ5A 3O4LA 5FX3A 4G2AA 5C09B 4KI5C 1HILA 4MJ6B 1JPFB 1HHHB 4NHCL 3ESNA 4D0DB 5C9JB 4XXCC 5IV2B 2HRLA 3DETD 1QI4A 2PTTB 2CGZA 1F45A 4D8PB 3RUGE 2W8CA 5CCKH 2CHNA 1SOSA 4R9HA 1AHMA 1G4MA 4KKBC 2IWKA 2R0LH 2GB2A 1D6VL 3D4GA 3M7OA 2FQDA 4PBWD 3BVUA 1MHCB 2CK0H 1S5HA 2B3RA 3HG2A 1CD1A 4F9LC 2Z7WA 1H6TA 4F2MA 1TYRA 1I53A 3BC9A 4X50A 5IBTL 3QJVB 4XZUA 3QUZD 2FVNA 2HP4A 5IUSA 2WLJA 3LDBB 5ITFA 2J8OA 3IJHB 3LAFA 1L7TL 1G9MH 5GXBB 1G43A 1RERA 2V4LA 4R3SA 1NCOA 3EYSL 1KZQA 1E3ZA 4WTZG 2NX5D 2PCYA 2ZF8A 5CGYD 2BIQA 5JOEA 1K8FA 1LMIA 1ZTXH 2LE9A 1LEKA 3VFMA 1YEHH 2QGDA 1Q9LB 1YNLH 2XJKA 3RGHA 5D1QB 1HF2A 4ZAKC 2WXJA 5CILH 5A3ID 4HS3B 3BZEB 2VN4A 4YEEA 3UEZA 1CQYA 3GBNL 4L3ED 2MCPH 4V33A 2YAPA 4NC1C 4IGBD 4WSGA 3DX1A 1FYTE 1U30A 1EEQA 2H6OA 3DTXA 4JFPB 4AGQA 3LVTA 3MLXH 2GJ6A 1MCBA 4D3CL 1S2EA 5HVHC 4ZUSB 2QVFB 4F7MB 1AR1C 4M1CD 3KPSD 3EH4B 5GGTL 3CGTA 1CDCA 1V8HA 3GMMA 3PV6A 4MQSB 4PRDA 4KI5F 5DHEA 4TNVK 2N56A 2YS4A 1NH6A 1XDTT 2NUTA 4OJ5A 1THCA 5DEGA 4RISL 3O2DH 2J1WA 5CHNB 5SWSD 3QXDB 4F7EA 3HE6D 3M1CA 5M95B 4N2BA 4FA7B 5EDSA 2JLLA 2W9EH 4OF0A 4P4RB 5AUMB 2W60B 1XGRA 3IJ9A 4ANVA 5B1AB 5I6OA 3TEYA 4N2LA 2X6BA 1NIDA 1E4KA 3AWGA 3CV5A 2Q7AA 4Z9KB 3TC9A 2M83A 4RQQB 3QUXD 4QMEA 3UBHA 4DJMA 1AO7E 4OKVB 5SWZE 5J4MA 3N3EA 3LMWA 1N64H 1KGJA 2F5AL 4HEMA 2EDBA 4M5ZL 3UO1H 3J07A 3BWAA 3MRLB 4Y4KD 4WEMB 1MPAL 3DK2A 4JQXC 2VRKA 3MRJB 4PJ9B 3EO1A 3QEHA 3T2PA 4YELA 4QIRA 2XT2A 1JRHH 4XCYB 4EIBA 2QSCL 1F2XK 5T1MA 3Q5YA 2G0LA 4ZMAT 1JGUH 4O2EA 1LEGA 3TN0D 5KYNA 5J1TC 4KMLB 4HWBA 2NOYA 2MPAH 5KN5B 2O61B 1NQBA 3U4AA 1DVUA 5TE6H 3W0WE 2R1XA 3QUYD 5E94B 3UERA 2DQUH 3HVNA 1UWEL 2MOGA 3NTCH 3M6DA 4ZODA 4A6YB 5EEZA 4ETQA 1WA1X 5J1AA 5INDA 4H8VA 2MFNA 3C09C 3CFEA 3FB6A 1M7IB 3S37L 1E2VA 2F19H 3IDJA 4WW2B 5E4IA 1R0AL 5JQ6H 1BD2A 4QRRA 1EV2E 2ZYSA 5I76B 3BGFC 1J7VR 2Z31C 3EYOB 3H09A 4EBQL 1U2HA 1MFCH 1UZ6F 3LD8B 3QQ4A 2OJZL 4OZYA 3FC8A 5CEYA 5D9SA 1XR9A 3RA7L 2HRPL 2WOBA 1S3KH 2VM3A 4FAAB 2VDRB 3DARA 5JUEH 1FZJB 4ZPTB 4LDEB 5BS0D 1F11A 3OB0K 1FNLA 1Q1JL 1MLBA 2V2XA 2AVGA 3BAWA 3QP3A 2OSWA 1SHWA 2LGNA 2EIDA 5GS2D 5JXAH 5HVWA 4MQ7B 4TSCH 1TZGH 3MV01 5L8KB 4JHUA 4PRHD 3HC0B 2AV7A 2WOYA 4AEFA 2VBKA 1JZEA 3AG1B 5D8JH 2L7EA 3BUYA 2X1QA 1Q0XL 1OLLA 1BGXL 2CRYA 1G0YR 1RURL 4MB5A 4NQVB 1L9RA 4OGZA 4RIRB 1HOCB 3LTVA 3VWJD 5CR1A 1XX9C 2HFGH 1CG9A 1YMMD 2PXYB 4XH2A 2SODB 1NCWH 2YXMA 3R4RA 4BKSC 4XM3A 2WVSA 1NC4B 1QBLL 4Y9EA 3S34H 5IJKC 4OJOA 4J39A 3ILQC 2KC0A 2C1PA 2VO5A 3CDGB 3T0WA 4BGLA 2B7DT 3KLSA 2JQZA 3MROB 5BRZE 1PQZB 4OD3H 3TWCL 1B4JH 4K94H 4FXKC 3KNBB 4XWGH 3H42L 4FTDA 3DMMD 5F7DA 1AOHA 3VAEA 3LKRB 1CFBA 2X70A 3TJPA 4FG6C 4XPHL 2EDHA 1PTZA 2A73B 1WAPA 1FL3A 1YEWA 1XTMA 5C0CD 5CGBA 2CRZA 1NOAA 2DMHA 1AGDB 2J4WL 2J55A 3UCQA 2EUZA 1PG7X 4FFZL 3T3MB 3O3AB 3S88H 1D9KB 3L3GB 3L3IA 3JT2A 4GP5B 3SE8L 2BIOA 3ZDZB 3W37A 4GW4B 3C5ZB 5HDQL 2JB5H 3TTYA 4WJ5A 3Q3GB 1M05A 2LU3A 1QVOA 2AQSA 1YMHA 2FO8A 3ALWA 4U1NA 2NY6D 1NIAA 3OR7B 3O11B 2B1HL 4U1KB 2HJKA 3BQUD 2Q87A 3UZVA 4W8QA 1A6PA 1BXUA 1A7RH 3N40F 5T5FL 1XF2A 2PO6A 1WT5C 4HC1L 5KSBF 2OXGB 4NO5B 3IU4H 3QIWD 3QPXH 2G5BB 2QL1A 1I7ZB 1SJEB 4FFZA 4W9DC 3X2QB 5I6MA 4UINL 2CKBL 3NAAH 4YSDA 4LSSL 1JG9A 4HALA 3NSYA 1PL3A 5I8EB 3SODB 3UC0H 3QA3B 1I9RL 1QFUH 2E8ZA 1J1OL 3ARZA 4Q97A 1OGSA 4YR6B 4FQQB 1KFGA 3ZL2A 5E9NA 1P69B 4K5LA 1A6AB 4FL4B 2OSXA 2R27A 1OCOB 3C2SA 2FQFA 4HV8B 2C9SA 4IKLA 2VXTH 4JY6B 4WEEA 3ZX1A 2DQTH 4JRWA 4L1TA 4JFQB 1KACB 5DFTA 2D2CC 3VFOA 1ZHNA 3CFNA 2HPOA 3MLVL 5T5FA 5IB3B 4ZS7H 4LIQL 4IMLB 4NWUH 5TQ0H 5HXMA 4YE4H 1WFJA 3DNKA 1MHPL 1CTOA 1YEDA 3WSQH 2CKBA 2OSYA 3V0IA 5I9QC 5TE4H 3WIFA 2WQVA 4C4KT 1QLEH 5AUMA 5JOFB 4OCWL 1FNEB 4PRPE 5IBLC 3VG0L 3VGDA 4KX7A 4K8RH 1BLNB 1AJ7L 2K7PA 5H2BA 4PY8J 3VFTB 1KBVA 3ZTJH 5JZ7C 4MXQD 2R4RL 3H0TB 1C08A 4QF1A 3HHSB 3KPOB 3WLBB 3WNKA 4M93C 3KHQA 5GGRB 3LZPA 3BD5A 1GYCA 3BVNA 5EIQA 5TGBA 1IM3B 4S2SB 3TXAA 4IOIA 3I6LE 2D9QB 2ZG3A 1NSNL 3MLTA 5DURB 4H8WH 4I9WE 1IGJA 3FTXA 2PABA 3QPKA 2X7LB 3U46B 5IFHH 3D12B 3UPAA 1FH2A 4Z76A 5BPPA 5DZAA 3GK8H 5I2IA 4NFDA 1G7PB 1QPPA 1XAUA 2JB6A 1YEKL 2NLJB 4Q58C 5JORB 1KLGA 1OSPH 4A6YA 1AS6A 1BEXA 4HX1A 4JANA 2AK1H 5K93A 1Y1DA 3FW6A 2VIRB 3RGVB 3RL1A 3DGDA 1YC7A 2IV8A 3NJGA 3S9DB 1KB5B 2EECA 3GRBA 2DWDA 4L4VA 4MDJA 3BZFA 1KFAL 1PZSA 4QNPE 4C2LA 5TFSH 1OTTC 3FL7A 2YUVA 5EBWA 2Q86B 3WFEL 2ZWSA 2BERA 3DROA 3P77A 4AW7A 2VXVH 1CGSL 2IPTL 3HG1B 2PR4L 3NPSC 3QQ3A 4IW4C 1T20B 2ZP9A 3MODH 2EVIA 1UATA 2A1WH 3ULVC 3F3HA 3DECA 5EB9A 4BK4A 2QVIA 3CZUB 4QHMA 4ZX5A 4Q9CA 5JIDA 2P43B 3GSUB 1X44A 4ECNA 4LEOB 2XHNA 1UWXH 3D06A 5C6WH 1YJDL 5IQ7L 4GG8B 4OJLA 1QSFB 4M56A 3FCGA 4QD2E 3W56A 4BFRA 3TYFA 1G9NC 2ZOUA 2FLRT 3NCYS 2AXGB 4DPBX 4PBDA 1S78C 2V5RA 4WWOA 1EAOA 4UOW1 1CZ8L 2ZPKL 2FWSA 4ZYKB 5F96H 4U2YA 1GZQA 1U8KB 3VMWA 4BK5C 4I18A 1M42A 4TMPA 2PYFB 3LN9A 1TVDA 2R0ZH 4NUGL 3ATBA 2QR0A 3T3PE 1K8DB 4ELKA 1DBOA 3VXMB 4ZNEA 1U8HB 5CLWA 1D5RA 4J3OH 4JVWA 2EDXA 3TH0A 4KKCD 4UIKL 4S0SD 4OZGA 1LLWA 2H6UA 2NY3B 2MCG1 2VZ3A 2ZWZA 3CHOA 5DHYB 5JXED 5DHVA 4UIMA 3D85D 5ENWB 2Q3XA 1LMKA 3CFJA 2V8MA 4L9LA 1T04B 3R4DA 4PBVC 3CFKB 5HHME 1ETZA 4RFNC 3ROOB 4MD0A 1DN0B 4S1DD 5DRZB 5DSCA 5I75C 1BPVA 5HYIA 1P6AB 2EZ0C 3ROLB 2X3HA 5FAAA 3PXJA 2VR8A 3UTQA 2VSMB 1DCLA 3SYPA 3ULVF 2EDNA 5I66A 3MLPA 1QKZL 2OSLA 1F58L 3NIDE 4GS7C 4DCQA 3MNZB 2VLJA 3WUWG 3RWHB 3UTTA 4MAUL 1X9QA 1TNMA 1IGFH 2BJMH 2N01B 5LN8A 4KK9D 3VUAA 4CSSA 1R5WA 4KUZH 3R0NA 1FH5H 4UQBA 4Y9CA 4L8BB 2VMCA 3T2LA 1BAWA 1DBKH 3FXIC 1PG7H 1PZDA 2XVKA 3O8XD 2YZ1A 3QE5A 3HRZC 3WNIA 2OQJB 3T3ME 1PGRB 3VA2C 4EI5C 1U95B 3ZDZE 1BJ1J 4F3FA 4ZFFA 3F7PC 1S7UB 2WQ8A 2FB4L 3UYPB 1IT9H 3STZB 3FJTA 3A3YB 4MKTA 5D7LE 1N70A 3G6JB 2P5ED 2UX6A 1DBBH 1GGUA 1ZRUA 4EIGB 2F5BL 4YDKL 1PLBA 4EF3A 5JTWA 1KJ2L 3MBEB 4QGYA 3BAEH 4QOKE 4POUB 5D72L 3HN5A 5FGSA 1U8JB 2ZKXA 1YNKL 1YPZF 3ORJA 5JHBA 2ZCLL 5DK2A 1CBJA 3CQFA 1DZ0A 1BVZA 3HNSL 4XVTH 4AITA 1LE5A 3ECBA 1INQB 1NMAH 2DWTA 3QXAB 2AAAA 2AK4A 1X5XA 2WAHA 2P5WD 5GS1B 3MV8B 4P2RA 4QT5A 2ED9A 5FK9B 1I8MA 3DYPA 3NGBC 4QLWA 4CW1A 3EZ8A 3TT3L 2O6CA 4OQ1A 1OCWL 4XHJC 2FL5B 3O6FD 3FYEB 4WI4A 1DQQB 5GGUA 2X1PA 5BZWA 1DE4A 1KLUB 3RX7A 4WVRA 3JSSA 4GH7B 4U1LB 1R5IA 2IV9A 1ZS8B 3EYUL 4V1DA 2OTPA 4ZMXA 2ZUTA 1QBAA 3D3VB 3OJ2C 1I1AA 2BINA 2DKSA 3C75A 1KB9K 2YLHA 3P3RA 4FKEA 3WMSA 1TZHB 1G7PA 4ANUA 5HDBF 2DQJH 2NLJA 3IGAB 3AT0A 2GBUA 1X6NA 3AJ7A 5LO7A 2E46A 3MCLH 3K6IA 2I26N 4U1GC 2XT4A 2NTQA 1H3UA 4Z77B 1HZKA 5GRUH 5AENA 1E4XI 3KXFD 2W59A 1MY7A 4AKPA 5C7XH 3CH8A 2QGEA 1AP2A 1ML0A 1JV2B 2BRQA 3WFCL 2ED7A 2KLRA 2RAMA 1E4KC 3KWWB 2B1OA 3N43F 3HZMB 3QAZB 4O2FA 2YHGA 2EP6A 1BIHA 3G5ZA 4P46B 5FV1L 3UJJH 15C8H 4QWWD 4FG4A 2CHDA 1X3DA 3VNYA 5EU6D 3U9UA 4P2OD 2HKAA 3PP4L 3UGUA 2ZG1A 3U0PA 2WBJB 3ZDXB 1VSCA 3DX6A 3SCMB 2LTQC 3TURA 1J9CT 2EXYD 1IM9A 3LMJH 1XTLA 5D7JD 1O0VA 4U6TA 3OLDA 3OVUB 1DEDA 3PNWB 5CM1A 5HP5A 3MRGA 4LCWD 2XYBA 1NCIA 4ENEC 1NEPA 4KZ0A 5FYJL 4I3RH 1JVOA 4ABUA 1TJMA 1UHVA 1UH4A 1AQHA 1MF2L 2I5YH 3WV0A 5I5RA 2KZKA 2WTOA 3VGGA 2Q8BL 2Q8AH 3VXPA 3RIKA 1PCXA 2R1YA 1T0MB 4KHXL 1JZ7A 4U49A 5ANMA 3FFCD 3UZEA 4M7JH 4PJ5D 4GUPA 1SJHB 3LPOA 3VFWB 3L08A 5FYLL 1O8MA 2QSQA 1B9KA 2I24N 3OKDA 4WI0B 4I3SL 1PX3A 3EO0B 4DP9X 3BESR 4JO2L 1XH2A 1AQ8A 4JLRB 3L95B 2Q6WB 4LRNL 1QSFE 4Z78A 4PLNC 2R2HA 3US0A 2AJSH 3SDDD 4QRTA 5IW1B 5IQNA 5FEBA 2HMID 4ACPA 1XSOA 2X41A 2V2TA 4J12A 3BMVA 2B1AH 1AGEA 4OFPA 3TBWA 4LAJH 2VDKL 4D9LL 1T0NB 4YFLI 1KLFB 3FUKA 4AYBA 3CFQA 4A55A 4S10A 4LLYB 4C56B 1N59B 3S5ZA 3FQUB 4KOCA 3JTSB 3TA3D 5DYOB 1Z2KA 2D7OA 4NI6A 5DS1A 1ZSDB 1FBIH 4F27A 2A74B 4XPGL 2Q0ZX 3H9YA 3SE3A 2CO1A 2NR6A 3ARRA 1WWCA 5GZNA 5KSAC 2R1WB 1E5YA 3P1VA 4WSKA 4HUUB 4GQ9L 1DTUA 5INCA 4P23B 4HS8H 1FRGL 2GI0A 5IR1B 3WN5B 3WIIL 3L9BA 3ZE0E 3F7RA 1BQKA 3SOBL 4FDWA 2ZKHL 3MUUA 4ODHH 3MRBB 1W72L 1IEHA 3PPSA 2O72A 2B5IB 5D1ZI 4YWGL 4IIQA 3ZL4L 1CFVH 4DN4H 5K9QI 2HTKD 3MV7D 1F56A 4NQXA 3FU3A 4PHZA 2YARA 4X6CE 4BRJA 1GOGA 4JDZA 5TJWK 3S35X 4X5XA 5CCGE 2NNCA 4Z0BL 4M5YL 4YZFF 2W65B 1N5AA 1JHLH 2DWEA 4XMKL 3K6NA 4JM4L 5FYKE 1I9JL 3T77B 5IOPB 4LLDB 3US9A 3NFPA 4GP4B 1BFVL 3PHOA 4L3FA 3UZQA 4YXKH 3VMPA 4KK6D 5EZJA 3VWKA 1RZ7H 3OAYK 3WGUB 1NIEA 1RZFH 4G8FB 4UQ9A 4P5MB 3NIGB 3HE7D 3M1BB 4N2HA 4O51A 1W72A 2QZAA 1JWUA 3X14A 1OO2A 4NO3B 4JPQA 2FEJA 2E9IA 2XKUA 2BS71 4HF5H 5JW5A 4MXVF 1OZTG 5GGVL 3BSZA 4FFYL 3CVHB 1JAEA 3EUUA 3P73B 2ED8A 5F9DC 1MRCL 3G6JE 3REVA 1HHIA 4Z1PA 3K74B 1OAJA 5ABDE 3IU3A 3QS2A 1WS8A 3DV4B 3JV5A 4I3GA 5KAQF 2EDOA 1AI1L 1FNFA 3EF4A 4MNQB 3C5SB 2VGLM 2W38A 3PGDA 3DUUB 1NCDH 2NZ9D 2UZXA 3MACL 4CMMB 4YEJA 5F3HA 4YHIA 2RFXB 3KPRE 4U1IA 4DGIH 2H8PA 5FXCH 4FEIA 5GZOA 1F4AA 5E2TL 2O30A 2DBLL 4P4KB 4R7XA 3L3JB 2R59A 1V55B 1U3HB 3LKQA 4N2GA 3GIVA 3GXTA 3PDOA 1A7OH 1TO5A 4HK0A 3MV8E 1S3RA 2WLYA 4V2CB 1AC0A 1BEYL 1TVBB 3HI1B 1U8LB 2J8HA 2A6KA 4JJOA 1H80A 2X89D 4WFHE 4YPGA 4ABWA 4ANXA 3LB6D 4PJEB 3TIDA 5FS5A 3BN9D 2FWLB 2IDSA 2JIXA 4MVBD 5B4MD 1T7ZA 1F4XL 3FB5A 3MA7B 1VKXB 3Q6GH 5JDSA 2JI3A 3D3VE 4WU7A 5IMOA 1UACH 1UM4L 4J7RA 4B9YA 4EJ1C 3QQ9D 4YHZL 1GGTA 1YHPA 5KS9E 2X4PA 2NY5L 3PHQB 3TNNA 4X6DE 1CT8B 3RVWC 1BM3L 1J11A 5AYUL 1IC5H 4M8QB 4HUWB 5DUBB 1U3JA 1HI6A 1CICD 3FZUD 3VXNB 2BDNH 1OF2A 2Q5BA 1XSIA 4TTDC 1EHLH 3LN5A 4AYID 4XNAA 2NQ3A 1UGNA 1RV6X 3T5WA 5I30H 4WUKL 1G9NH 3EDDA 4MCZB 3KL5A 3T8XA 1CGWA 2WTRB 4KVNL 2FE0A 4XXDA 5C07D 1HG8A 4JDTL 4NKIH 1EHXA 3LJ3A 3ZDXE 4NK6A 2AS5M 3EG9A 4WI0A 1TO4A 1UEYA 3S37X 1L0PA 4QHNB 2R23A 3LRMA 4FI7A 3L3OB 1NDTA 4NO0B 3P0VL 1MIEH 1YZZA 3AY4C 2WIIA 4Q6YA 4Y5YB 1UCTA 1ZANL 3U83A 3X3FH 2FX8H 1NWOA 3IFPA 4H26B 3OGCB 5T1DL 3Q9PA 2YSSB 4M48H 2YPLB 2IFFH 4HUMB 1QUNA 1LK2A 2PWHA 4NQDB 2BNRA 4WFFE 5F7WC 3ISRA 4FZEL 5JHDD 1XSJA 3L5HA 1G94A 2BCKB 4WGWB 2BSSA 4GRLB 4LSTH 5DCCA 4LCUB 2VNCA 4I18C 3P9MB 5IIEA 3PAZA 3CG8A 3RWFB 1I1YA 2WSDA 4DGVH 3QEQD 4TL4A 5C6PB 4YXHL 1SN2A 1TZIA 3MQIA 4HLZH 2WBKA 1E7VA 5E0FA 2Y06H 1AZNA 4PR5A 1X9LA 3VQ2C 3VXQA 2XWTA 3MLUH 5SWQB 4MMXC 4PG2C 2SEBB 1JHTA 2KKQA 2B15A 1G7JB 1MJ7L 1YJDC 2BP8B 3IBEA 4RZCA 5F3FA 3KLHD 3E80A 4YK4C 5A2CA 2BWQA 2NZIA 4LSUH 3EXJA 5L8JB 4TOYL 1RUAL 1U4FA 4P5TD 1ZCRA 1LP9E 3RY6A 4C56E 2XUWA 2WINA 4LOEA 4ELMA 5CXPA 2D7MA 2IPKA 4OM1L 5DRWB 3U1SL 2QADC 5JQIB 3HKFA 2W07A 3PNRB 4JS7A 1ES0B 3WCYA 4KQ3L 5LUMA 2Y2WA 3JZ7A 4TVPE 1RI8A 2ED6A 3V52H 3D1MC 3RWEB 2XV3A 5EMYA 1JGVH 4BSWB 5I1DB 2APTA 2WLIB 3B2VL 2K8MA 1I31A 2J1XA 4HWNA 4JB9H 2WGXA 4P5MA 1ACXA 4U6HB 3S3JA 3ZYJA 5HHQB 1F6AA 3LJYA 3U6XS 2F8OA 3I6KB 3FQNA 4Z7VF 3KRGA 3BW9A 1FO0B 1KXQA 3B3IA 3VI3A 3S35H 3CU1A 4ILDA 1T2QL 1VF5C 2WKGA 4Q89A 1A5FL 2HN7B 3P3TA 1RK0B 5F3BA 4OLWL 4NQEA 4NHCH 5D1XA 4L18A 1U2YA 3H9SE 1DVFB 2L04A 2VDPB 3V4PL 2APBA 2Q1EA 2E59A 2Y7MA 5ESAB 2ALAA 3AUWB 1K72A 3QJOA 5HGBB 2R83A 5EC2A 3RJDA 4KXDA 3NIGE 2BY0A 5IBTH 1UH2A 3R18A 4DOHB 1WAAE 4IU2A 4YC2B 3CHRA 1E28B 4OF7A 3AS0A 3DSNB 1SPDA 1L7TH 1YY9C 3F65A 5IQ9B 5I0ZA 1AQDA 2YBGA 1O6SB 4JHAH 1NUDA 2JH2A 4PJXF 2XQYK 4KRMB 4L48A 1U8CB 4C57C 1DVTA 1JYNA 3MGTA 2V9UA 1GRWA 1UD4A 3A6BL 2CXGA 2OTWB 4N90D 5E70A 1CCZA 4BXVA 4EKJA 4NPYA 3N41F 3QQDA 3GBNH 2GJZA 5F88B 4G6FD 4LBEB 3ZTNL 4MNQE 4G1EB 1QFWL 4FGMA 4JO3L 2RGSA 5EFIA 5B3SB 4ZUUB 1T1WB 1WEJL 1J8HA 3AADB 1WWAX 4MGXA 1D5ZB 1LGVA 4WU5B 2EXWC 1L0XA 2NY1C 1LEIB 3T08A 2IH3B 1HXYA 4N0UB 2W95A 5EEXA 2VZ1A 1FJ1A 1OB1A 3BZ4B 4Y4HB 3DX2A 3P0GB 3D09A 5GGTH 3MV9E 5AZ2L 1NDMA 2I9TB 5L4FA 1CVRA 1I1AC 3AVEA 2XNAA 4ZOCA 3L3KB 4PRBB 4R96A 4UF7C 5AG9A 2UZYA 2CUAA 4YO0A 4JY5L 1J9QA 2VMFA 3SQRA 3BUIA 3PWPA 2VXSL 5T1LD 3BLPX 2JKNA 4X5RA 1ZXKA 4JEGB 3BIKB 2BOCA 3ZMEA 4NRYB 2EC8A 5HY9B 1S7SB 2ZYHA 3L2MA 1JV5B 3QXVA 3O6KH 1HHJB 3QORD 5LVEA 2EEAA 3MCYA 1EO5A 1RZGA 3KS0H 1FA4A 5I8OL 2F5AH 2X87A 3IMSA 4PS4L 4L8CA 3UX9B 2DM3A 3Q1EA 5FIEA 3IDIA 4XPFH 1MPAH 3PY9A 1UB5A 4F5CE 1A0QL 3MRQB 4MNGB 5AWNL 1F5WA 1W0VB 3PRZA 1TJIL 2YD5A 3QG6B 2WKLA 1ZVSB 1RVFL 1U8IB 3V6OE 1UA3A 1S9VA 4GBXA 1PKQB 4OCXL 4H1LH 2WLLB 2EDLA 4NQDA 1C8PA 5DD3L 5C71A 1FDLL 5DGQA 5I15H 1UWEH 2E6PA 1OVZA 3ASOB 1HCYA 1HINL 3K4ZA 4GRLA 3N85L 4FCHA 1TOXA 5DGRA 3S37H 4CAGA 4F33A 4B5EA 1R0AH 4JKMA 5K5YA 3A21A 5IFJA 5E99H 1AXIB 1QW8A 3MRFB 4EBQH 3SE9L 3UZEC 2OJZH 4WQOA 3ARWA 2R7EB 4Y9FA 4NQTA 1MXDA 3RA7H 2HRPH 1NCBH 2CO7B 4DP1X 2BLFA 4E42A 1DDHA 3WUWA 1TTFA 5D1ZC 1Q9KA 5F0PB 2YPLE 1FNGA 1BZEA 2HVJB 1CTNA 4ZBJA 2DYPA 3AAZB 3TJHC 1GZPB 2LW3A 5L2KD 2OR9L 1X5LA 5D2LF 4ZXBD 3F58H 4TQPA 3KL3A 4XNMB 1Q0XH 1BGXH 3F6LA 2VL5A 1RURH 2LU4A 2WXLA 3GMRB 4GAYA 1E7UA 3TPUB 5HYJD 3C6LD 3CHSA 3IJYA 2L7JA 4N0YH 5EOCH 3RWIB 3RWGB 4FP8H 4IJ3C 1QBLH 1Z9OA 1JTTA 4PJFE 3VM7A 4H8HA 2FX9H 5I24A 4Y1TA 4URKA 4DO6A 2BVPB 2ZT9C 4FMKA 1NTDA 4MLIA 4YFLF 2EUWA 3QI9B 4LDOB 3TWCH 1EXUB 2D2OA 1WF5A 2F53D 4AL8L 3A4FA 4A68A 1WV7T 4K8RD 1IE5A 2NR6C 3O9WB 1U21A 3Q2LA 5GZNC 3B1UA 3U4KA 3ARSA 3FUNA 3PHSA 3OJMB 3T4YA 4XRCA 3TM6A 1BVNP 5H35A 4AGNA 1A6ZA 4FCAA 3TEXA