3VSTA

The complex structure of xylc with tris
Total Genus 238
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
238
sequence length
638
structure length
638
Chain Sequence
b'MEYHVAKTGSDEGKGTLKDPFLTINKAASVAMAGDTIIVHEGVYREWVKPKYKGLSDKRRITYKAAEGEKVVIKGSERIQSWQRVEGNVWRCQLPNSFFGEFNPYKEEVFGDWLLTVNEKKHLGDVYLNGMSFYEVTNYEDLFNPQLRTEVLDHWTQKIVPIKNAEQTKYVWYAEVDREKTTIYANFQGADPNEEFVEINVRRSCFYPVETGIDYITVKGFEMAHAATPWAPPTADQPGLIGPNWSKGWIIEDNIIHDAKCSAISIGKEATTGNNYRSIRKDKPGYQYQLEAVFNAKRNGWSKEKIGSHIIRNNTIYDCGQNAIVGHLGGVFSEIYNNHIYNIALKREFYGHEIAGIKLHAAIDVQIHHNRIHDCSLGLWLDWEAQGTRVSKNLFYNNNRDVFVEVSHGPYLVDHNILSSEYAIDNMSQGGAYINNLIAGKMNQRKVLNRSTQYHLPHSTEVAGFAFVYGGDDRFYNNIFIGKEGLENVGTSHYNNCTTSLEEYIEKVNEVPGDLGEFERVEQPVYINKNAYFNGAEPFEKEKDNLVKKDFDPKLAIIDEGDEVYLSLQLPDEFENIVGDIHSTKTLERVRIVDAEYESPDGKELVLDTDYLDAKKPENSSIGPIALLKKGNNYIKVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Xylosidase
publication title The substrate/product-binding modes of a novel GH120 beta-xylosidase (XylC) from Thermoanaerobacterium saccharolyticum JW/SL-YS485
pubmed doi rcsb
source organism Thermoanaerobacterium
molecule tags Hydrolase
total genus 238
structure length 638
sequence length 638
chains with identical sequence B, C, D
ec nomenclature ec 3.2.1.37: Xylan 1,4-beta-xylosidase.
pdb deposition date 2012-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13229 Beta_helix Right handed beta helix region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3vstA02
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 3vstA01
2CHNA 2QLYA 1O8KA 4XMYA 3DDFA 2WKGA 1HWWA 4XNFA 3WDHA 3GQAA 3CZSA 3EDJA 4UQEA 3CLWA 4NXSA 3ZSTA 1MFUA 1O7DC 3BUPA 4J27A 1OGSA 1CYGA 3LRKA 3GXTA 1R33A 3BMVA 3GXFA 1QHOA 3CC1A 9CGTA 1T0OA 2D0HA 2VBEA 3EDKA 4JL2A 1JDDA 2F2HA 1SZNA 4UNIA 4X0NA 3WEOA 2G3NA 4NK6A 3L4VA 3W38A 1EO7A 2V3FA 1KGXA 4J3XA 4H8HA 5CLWA 7CGTA 4YZAA 3IJ7A 3GXNA 4NXKA 1QW8A 3KWXA 4LQ1A 3A6OA 1KCKA 4U4BA 2XN0A 4JL1A 4UZUA 3RIKA 3A23A 1BSIA 1CGYA 2F61A 3ZT7A 1JTAA 5E6ZA 4XKWA 3BSGA 3EJSA 1U30A 4H7VA 1WZAA 4Z03A 4DO5A 3VNZA 2ZX5A 1OFMA 3FAWA 1OOCA 4OZYA 2YKKA 1KXTA 4MB1A 1E40A 2EJ1A 3A47A 4UQDA 3CZNA 4DO4A 1JXKA 4XR6A 1U2YA 4PEEA 1ODUA 1WE5A 5I0DA 3TONA 2WVSA 2UVFA 3VMOA 1QI4A 2GUYA 3L4XA 2QX3A 3DX1A 3DDGA 3KEHA 2IGTA 4J3VA 1GQ8A 3GTNA 3H53A 4J3TA 3VMWA 3EJUA 3BUDA 1UA3A 1V3MA 2OSYA 2DIEA 3BAWA 1O8IA 2FHFA 4UQ9A 3TTYA 2YFOA 1QWUA 2C8NA 2BY1A 1WP6A 2ZX9A 3AMLA 1KTBA 3DHPA 4JCMA 2O04A 2PYGA 1CIUA 3WNLA 3D4YA 3T9GA 2F7RA 1V3LA 1XD0A 2E8ZA 2VNCA 1OT1A 3TV8A 1S46A 3LXBA 4W93A 4UCFA 1PIGA 8CGTA 3VM5A 2F7PA 1PXZA 1CZFA 1JI1A 2F18A 2FH6A 5F7UA 3VSVA 4OJ6A 1JF6A 4JFUA 2ZICA 1GJUA 3S5YA 3AXHA 5AMVA 2DH2A 2WNWA 2EWEA 3WNKA 1MW1A 2VRKA 1VJSA 3WY3A 5I23A 2ODLA 1CGXA 2X6YA 1JD9A 2WSPA 2ZXDA 1IDJA 4XKVA 2ZWYA 3TOPA 2VJIA 1G9HA 2NTBA 3UW0A 2D0GA 4GINA 4U49A 3WWGA 1UD3A 2QMKA 4YEJA 1IZJA 1WZLA 3EJPA 3CZKA 4AEEA 1X0CA 2YJQA 1VAHA 1V3KA 2WSKA 3BCDA 5BRQA 3BUBA 3BH4A 1UD5A 1O8MA 1R46A 1GVIA 4M8UA 4GO8A 4AW7A 2PWEA 4FLSA 2V3EA 4J28A 3WY1A 4CGTA 1ZJAA 3LX9A 3BC9A 3B8YA 1KCLA 4UOZA 3CV5A 1VB9A 3VMPA 2WC7A 3LXCA 6TAAA 3VMNA 2ZE0A 1UD4A 3D50A 2NT6A 2GJPA 1IDKA 1PS3A 1QWNA 1O8JA 4WLCA 1QJVA 4EW9A 1UD8A 3WY2A 3EJTA 4PSRA 4OIFA 1KTCA 3VSTA 1E3ZA 3FAXA 1GJWA 2NSXA 4CN1A 1RU4A 2BSPA 1JD7A 4XONA 2NZMA 2FGZA 2EACA 3CTTA 2J25A 4FNRA 2XIBA 1QI3A 1R75A 3GRHA 4FNPA 3WNMA 1HT6A 1KGWA 5E6YA 4W8QA 3K8LA 1MWOA 1H80A 5CLTA 3LPPA 3GQ7A 1RP8A 1I75A 2C7FA 2VUYA 1OGMX 2BXZA 1ZS2A 2EADA 4OKDA 4AIEA 1DBGA 1WMRA 4XQFA 5EMYA 4GKLA 4H8UA 4PCTA 1OFLA 2WVVB 4WSKA 3LRLA 1HTYA 2PYHA 1QCXA 4OGZA 4JFTA 2QPSA 4B9ZA 4W8TA 1A47A 3D52A 3BVVA 3GQ8A 4PCSA 3QGVA 3BAIA 4AYSA 1RP9A 2GVYA 1MXGA 3WDJA 2ZIDA 3OLDA 3GBEA 3HG3A 3GXPA 1O88A 1J0JA 1CXKA 2PWFA 2XVLA 4W8RA 1BPLB 1SMAA 3KL3A 3WY4A 1CGVA 1BF2A 3EDEA 1TQSA 1TQVA 2EAEA 3ZR6A 5A2BA 2X2HA 3FY3A 1JG9A 3K1DA 3WNPA 1PZ2A 4OJOA 4Z05A 3LMWA 2QY1A 3ZO9A 5A2AA 4UQBA 1KXHA 4YZXA 1XD1A 2O1DA 2VRQA 4NZFA 3D4ZA 1O8LA 4XM3A 1QI5A 2XN2A 3VGBA 3B90A 2TAAA 3VGFA 2Y5EA 2PWDA 1C8QA 4J3UA 3KL0A 3LPOA 4LXFA 4FNSA 3HG2A 2QMJA 4FLOA 1KB3A 2OW6A 2BXYA 4PMHA 4J3SA 1U33A 2IQ7A 3II1A 1PPIA 1UOKA 2OSWA 1WZKA 4YELA 3A24A 3L4WA 2XN1A 3RILA 1XSJA 4KMQA 3HZ3A 1BHEA 4AYGA 1PJ9A 2F1AA 3BCFA 4TVUA 1D3CA 2OW7A 3ZPPA 3IK2A 3SUCA 4XLHA 4U31A 2X6WA 4ATWA 2O17A 2Y4SA 1MFVA 3L4YA 4FNUA 3BLBA 1QW9A 4H2CA 1NM9A 3EDDA 1PZ3A 3EDFA 3UG5A 1D7FA 1AIRA 3L2LA 1QPKA 4I84A 1QX1A 3HG5A 2INUA 5CGMA 1KXVA 1VFUA 1BN8A 4MXNA 1R34A 4OJPA 1BLIA 1PEZA 3UG4A 1RPKA 1UD6A 4WF7A 2NSPA 1WZMA 4UZSA 2PECA 3B4NA 4NX0A 4OJLA 3ZSSA 2DIJA 3KL5A 1DHKA 1JGIA 1O8HA 2YOCA 3DX3A 1PLUA 2NTPA 2V3DA 4QAWA 2ALWA 4FNTA 3WN6A 4BA0A 2WVUA 1M53A 4XB3A 1KTWA 1XG2A 1ZJBA 3CZGA 4XOPA 3EQNA 1UASA 1UH4A 4E2OA 5A2CA 1R47A 3ZT5A 3A5VA 1KWKA 3WNNA 2BHUA 4C2LA 1HG8A 1JIBA 2E9BA 3M07A 4WSJA 2EQDA 1BVNP 3CPUA 1O8EA 1XSIA 2OYKA 3UG3A 1LWHA 3GQ9A 1Y7VA 2D3NA 2WVTA 4UOQA 1JI2A 1UD2A 6CGTA 2EO7A 2OYMA 2Y2WA 1HNYA 3WDIA 3JURA 1UH3A 3L4TA 1XH0A 5CXPA 2X3HA 2YA2A 2D73A 5CGTA 2CXGA 4W8SA 1B0IA 2Z1KA 1JL8A 3GBDA 3K8MA 4UQAA 5E70A 2O0VA 1XH1A 4FLQA 1HL9A 2PWGA 3DX0A 2ZXAA 5HDRA 3H54A 3WELA 3VX1A 2XVKA 1KGUA 4YZ0A 3CGTA 1KXQA 5TD4A 1L0PA 2DH3A 1TMQA 1UKSA 2AAAA 3AXIA 1JXJA 3TTSA 4XLCA 3BUQA 4JFVA 4JCLA 4OZZA 1DEDA 1VFOA 3OLGA 1HXKA 4PSPA 4NI3A 1DTUA 1MVYA 3WNOA 3VNYA 1JDAA 1XGZA 2WPGA 1TQWA 1LWJA 1HVXA 1O8DA 4FLRA 1EHAA 4CN4A 1JDCA 3ZOAA 3ZT6A 1Q4NX 3BAYA 1G5AA 2XVGA 2D0FA 2CPUA 3H55A 2YIHA 1EA9C 3KLLA 4AMXA 4J7RA 4JFWA 1MXDA 2ZUUA 4CN6A 1IA5A 3VX0A 1CPUA 3A22A 2X2JA 3OLIA 4GI6A 2ZX7A 1OSEA 2X6XA 1AMYA 1EH9A 2BY0A 2D3LA 4FNQA 4XLEA 1J0HA 3VO0A 3BAKA 1OB0A 3CZEA 4GIAA 4XORA 2VR5A 5DO8A 3K8KA 1H3GA 4XLFA 1HX0A 3AMKA 4DO6A 1CGTA 2UVEA 2ZWZA 1XV8A 3EJRA 2G3MA 1XCWA 2PWHA 4MAZA 2NTQA 1MW2A 2OYLA 2GJRA 1KBKA 3ZR5A 3S2CA 3BVWA 3L4UA 3WENA 3LRMA 1EO5A 3VU2A 3KLKA 2BY2A 2ZUVA 3DHUA 1CXIA 5I5RA 1E43A 1BG9A 3BAXA 4HOXA 2VBKA 2FE0A 2FYVA 4XLAA 5C1EA 1NHCA 1UKQA 2BY3A 4AMWA 4U33A 4GQRA 3AJ7A 1VFMA 2E4TA 4KWUA 2E0PA 3W37A 1P6WA 5E0FA 3KRGA 1JF5A 1JAEA 2E8YA 1NOFA 4GQQA 1J0KA 1AQMA 3DC0A 3GXDA 3DX2A 3ZSCA 2XWDA 2ZXBA 4AVZA 1KBBA 1O8GA 3GXMA 1VIWA 1TQUA 3VGHA 3ZQ9A 3UCQA 1MW0A 2INVA 1V3JA 2ZXQA 5A6LA 1WPCA 5I24A 1SMDA 5HXMA 5C1CA 4XN0A 1TCMA 4XOTA 3UERA 2XWEA 2ZX6A 3DX4A 5A6MA 1XH2A 1G94A 2XIIA 1AVAA 2D2OA 7TAAA 2X2IA 4NZJA 1CXHA 4XL9A 4NK8A 2ZX8A 2YA1A 4BZYA 4XN3A 5KEZA 4GI9A 4HA1A 3BLPX 1J0IA 1PE9A 4JFSA 2VT0A 4MR0A 3CZLA 5BRPA 2VJJA 1AQHA 1BAGA 1XCXA 3VGDA 2F1BA 4U2YA 3S5ZA 2NT1A 2NT0A 2ZUWA 5HPOA 1UKTA 2EEXA 1OT2A 4GO9A 1IV8A 2FHCA 2NT9A 2X85A 4YZQA 2YA0A 1KCDA 4J3WA 1G1YA 1TQTA 3BSHA 1JFHA 4CVWA 4H8VA 1Z32X 3A21A 3LXAA 1IB4A 1CXFA 3WMSA 4FMVA 2BHYA 1RWRA 1VBLA 2F7OA 1HL8A 4UQCA 1DBOA 4HOZA 3VMVA 2EABA 2FH8A 1KCCA 3L4ZA 4U3CA 3FW6A 3BMWA 1JRGA 1B2YA 3VSUA 1WO2A 4OJ5A 1BVZA 3OLEA 1PIFA 2OSXA 2WCSA 2BHZA 3A4AA 3HG4A 3HJEA 2WANA 3VM7A 1OGOX 1EE6A 5DFAA 1XSKA 1QHPA 2WVVA 4Z06A 3WFZA 3VGGA 2ZUSA 1RMGA 1MW3A 2QV4A 3BVXA 4HWVA 3IJ8A 1W9XA 1CXEA 2AMGA 4OJYA 1UH2A 1CGWA 3IJ9A 3MI6A 4B9YA 1UA7A 1CLVA 4X9YA 4HOWA 3VGEA 3L2MA 4HPHA 1KWGA 3KE0A 4AIOA 2QXZA 2Y24A 2WCGA 2YFNA 3UEQA 1PAMA 2Z8GA 2F7QA 1GCYA 1O8FA 5E1QA 1E3XA 3BLKA 3D51A 3IGUA 3GXIA 3EQOA 2VBMA 4URRA 1IZKA 1CXLA 4HP5A 4GI8A 3ECQA 1CGUA 2ZUTA 2O0WA 3WEMA 3BAJA 4AEFA 1M7XA 2QPUA 4LPCA 2NSTA 1K5CA 2FHBA 4CKQA 3BVUA 3BVTA 1CDGA 4M56A 2WKLA 3BUIA 5E9AA 4U2ZA 3EJQA
chains in the Genus database with same CATH superfamily
3CLFL 4ONGH 2Y6TE 2QSVA 1AGDA 1WFMA 2AAVA 4QHKI 4QTHB 4F20A 3GBML 1SOQA 1HWWA 1EAJA 1FCGA 2DJ4A 4N9OB 1MELA 4S11A 4G42A 3ZMNA 1H3VA 2B14A 4APQB 4IJ3B 5I71B 1ETB1 3PABA 4IEFA 1D5XB 1YNTA 3TYGH 4IBUA 4YZWA 1J1XH 2NXZC 1D5BA 3KPPB 4ZPTA 4JG1L 3V0GA 4UQ3A 1HE7A 4KZDL 2DQUL 4WHTA 4EKJA 3DU1X 1IAKB 4CVUA 4HG4K 5KSAA 4EOWL 1JV2B 3DROB 1LE5B 4Z7IA 2WV3A 3CNKA 1VEOA 1CLCA 1AY1L 5CLWA 3TH2T 5HVHC 5AB1A 1OL0A 1XMWA 3GSRA 3L3KB 1MCSA 4U4BA 3C6SB 1DBKL 2FYYA 2G60L 2VLLA 4TNWF 1UACH 2IPUG 4TUKH 4PS4H 2WYIA 1CICD 2X4TB 2EIDA 2HVKB 4HZAA 4AGNA 4X9BA 4KH9A 1A5FL 5E2WL 1J87A 2A1WL 2VXTL 3MLWH 3P9MB 3MXWH 5E2UH 5DT1H 1UM5H 3NA9L 3HBGA 5C6PB 3ZGIA 3GDBA 3FQXB 4HLZG 4H0GA 4LGPB 3BDBA 5F1KC 2JKWA 2Q76B 5FM5O 4P57A 5J89A 2L7QA 2AV1B 2GSGB 3BQUC 3GMQB 4JDTL 1A6UL 3BAWA 2DYSB 1JFQH 3NMEA 4GSQA 4IMLB 3RWIB 3S35X 1D7CA 1F1GA 4PIRF 3E80A 5FDYA 3F58H 3X14B 4WWKA 4ZT1A 3WNLA 4LCWA 2VNCA 1FNGB 1NJ9A 2NNAA 3MV11 4NKMB 4PHXA 3U9UA 3V95A 3HR6A 4E9TA 1KJVA 1XGYL 1NEZA 3N1MC 3F05A 4OF0A 2VQ1A 2YBGA 1FLRH 4TQPA 3VSVA 1JZ4A 1TQBC 3ARFD 1Z9MA 4AIXA 3HNTL 1UHVA 3B2PA 1C16B 1ZEAH 3VGAB 1IC1A 5FIEA 5I1DA 2MJWA 3Q9PA 3IU3A 3VYNA 5E2VH 1L7IH 4BYHA 4JFDB 1FE8L 3TOPA 3KJ4B 1SJVA 3WWGA 4TULH 1UZ6F 4PJFF 4M1GL 3BE1L 3GI9L 2D31B 1DBBH 2XFGB 3EJPA 4PVNA 1NMBL 2XOTA 3GHPA 1VZIA 3MKGA 4YDZA 3OB0K 1GOFA 4M8UA 2Q7YB 3RL1B 1LO4H 1OCRB 3D18A 3ILPB 1M56B 1YMHA 5DJ2A 4JMXA 1IQWL 5KSBF 3HE6A 5JIQA 2BS9A 1NBZB 2H6OA 4EO5A 1CLZH 1J5HA 5HVGB 4X8XA 2YARA 5JQ6L 2GFBB 1TYRA 2FT7A 4P9HH 2C3HA 5KS9F 2A9MH 5BO1H 1T20B 5ITBL 2EXSA 3X3FL 2ZZUT 1CK0L 1QBMH 1O5DT 2R2HB 4XC3H 5B1JA 3UZQA 4YAQA 2UY6B 4N2IA 2NSXA 3G6JE 1B4TA 4Z7UE 3GT6A 4FNRA 2XIBA 3OKEB 1KGWA 3K2UH 2AK4A 5E6YA 3IFOA 5IREA 5C07A 2ZCKL 1F11B 1IILE 4NRXA 4XCFL 2G5RA 3VQ2C 1SHMA 5I1LB 2NYKA 4UQIM 1QZNA 4WGKA 2QVKA 2F5BH 2ARJA 3BOVA 4UM8A 3ZE0F 4LPUA 5EWIH 1O0VA 1TJHH 4BFGA 2A9BA 2GY7B 3MMEB 4DKAA 4RWYL 2XV0A 4PRHB 1H0DA 2UXTA 3WJLC 4JFTA 2XG4B 2ZCHL 4XB7A 1SRDA 4WDIB 1K4DA 4AYSA 1X7QA 3L5IA 3QFDB 5C7XL 5E94A 4JFEE 4QHUA 2Z35B 3OLDA 3RVXC 4X6BA 5BV7H 2NXZD 2XFXA 3GXPA 3V4PL 1J0JA 2XVLA 1BDYA 1SMAA 1AD9B 3SOBH 1UC6A 2MQ3A 3BWAB 4LCYB 4WSGA 4R96B 3GHEL 3KGUA 5ID1B 4RFNB 3K1DA 1TO4A 5FCUH 2GSIB 3T8MA 1A7NL 2ZWKA 4PS8A 2QY1A 3LMWA 3ZO9A 4PRNA 3LKSB 3QZMA 2FT8A 4S10A 5DC0A 1O8LA 4JVWA 4ZJ9A 4HDIB 2XLLA 3BUYB 1HJCA 1MCJA 4ZUTB 2VZVA 3QUXA 2UWEA 3T1WA 1XIWC 3KLQA 2KZBA 5HVWA 2QMJA 5AYUL 4RMQA 2VN4A 3ZN6A 2VXQH 1Z9SA 5KJRL 5DDHB 4NWUH 4N5EC 4G8IA 1PTZA 4S1SL 1TR7A 1UOKA 3ZO0A 1CFQA 1A22B 3F7RA 5T3XD 3ZRSA 3FXIC 3L4WA 3V0JA 1LP9E 4KMQA 2XT1B 1OF2B 3DVNB 3HZ3A 4XHJD 5LBVA 3MRHB 5CO1A 3T4AC 3QCVH 3RPIB 1R3IL 4LSQH 2YLHA 5DEFB 4KKRA 4XLHA 2DKSA 3H3PL 3P4LA 4GRLA 5B4MD 3WLBB 1LXMA 1UB5B 2FB4L 4P23B 3VXSE 3VWJB 2WHVA 3BQUD 2Z93A 3SDYH 1E4KC 4DF9A 2APWA 2PTVA 1OP3H 1P5UA 3QVAA 4KAQH 4JM4H 4MMXA 3PGCA 3EKCA 4YXKL 2VQ4A 1FL3B 1XFPA 3SCMA 1HIMH 2VR7A 1LEGA 4QHMA 4WCYL 1RERA 3ZTDC 2AC0A 1MSPA 3OKLB 4A6YB 2IPTL 2I25N 3GS0A 5A16B 5TDNA 1NGQH 2ZF8A 1AQKH 1CG9B 2BVQA 1ZE3H 4JKLA 5D1QC 1UWGL 1ZD6A 5AW3B 4P2OB 4F8PA 1EBAA 1KXVC 1N4XH 1ZJBA 3OAYH 3Q8FA 2CCLA 3EQNA 4P5MA 3WIHL 4PCKA 3HB3B 1GTFA 1PEWA 2IH3B 4AM0B 1M3IA 3CFMA 5ENWB 4PJDF 5LLIC 5IB3A 1XSIA 4YPGA 4ZMYA 4XX1G 4GRMB 3T0EC 2VDMB 2D3NA 4R0LA 2X4SB 3P77A 4IIQA 4W6WB 5IJVB 3BN3B 5EUOB 2VFNA 2EIMB 3LZPA 3AREB 1FBIH 1FFOA 1SEBB 2I07A 3NPZB 2Y06L 5D5MB 1A2YA 3P0YL 5JQHC 4LOUC 4FKKA 3R1GH 1JVLA 1MVUA 2DIAA 4P5TA 5DJDA 4BK5A 5DK3A 3GBLA 3LIZH 5DURB 1DQDL 3SBWA 5FO7A 2E27L 4F7TA 1SJHA 4LVOB 1HDMB 1H3PL 3L95B 4X6DF 3CN3A 4NFDA 3SKUD 3QG7H 3HNVH 4MJ4A 4XBEH 1SM3L 1E4XH 3ZX1A 1JNHA 4OFYD 3BT0A 2IG2H 3US9A 1J05B 1XGQA 4PBWD 4AZ8B 4L8CA 5DR5H 3KPSA 3EFDL 4U1JA 3VI4F 4UU9B 3UL4A 5K9QG 3VNYA 1IBGH 1JDAA 4NJAL 5B7MA 4OD3L 1O8DA 3ULAB 4PRPD 3ZYOA 2OP4H 1CFNA 4M7KL 5TE7H 2NY3C 3U2SB 2CIIA 1KG0B 2Q1EA 2C1OA 2QKIC 2X53A 4A7QA 4OJDH 4MZIA 5C92A 2F58H 4GEJA 1GHFH 4I3RH 5IBUB 1A9EB 1GH7A 1ZSDB 1BQLL 4NPYA 1NIEA 2XC8A 1Z0NA 5I5IA 3IETA 3ZDYB 1A7OH 1BZOA 3PF2A 4L5FL 5CP7B 1BIIB 1HOCA 1RUAH 5JIHA 3RVXD 2HJFB 2VZ1A 1T0PB 3JWNE 4G9FA 4NDMA 1S9VB 3WO4B 2DQIL 3GGWB 4OVVA 5I76B 4DIXA 4E9VA 3NDYE 3TVMA 4GAYA 4FDWA 3X2QB 4RBPK 5C0AE 2DQGH 2Z8SA 3HCVA 4QRQB 5IROC 2ID5A 3MNVA 3LRMA 3WENA 5E99L 1TDQA 4MCMA 1L6ZA 4HKXB 5DQ9A 5EO1A 2TRYA 4AXWB 1PG7W 3TN0C 2PYEA 5ES4B 1JWUA 4M02A 3WTTA 4XLAA 5C0CA 4W9CC 1XR8B 3D0AA 3U4EB 1FP5A 4YDVA 1S9WA 1UJ3C 1JZDC 5DMIL 2CR6A 2Y3AA 1J12A 1HI6B 4JCWA 1XIWD 4ANWA 4JRLA 1MFBH 6PAZA 4HLJA 1HZHL 3MGTA 2JKIS 4PGDA 1BYPA 3L3OA 3VFTB 4NC0B 4M4RA 5E8DH 4Z76B 1NBYB 2DKMA 4N5ED 4G7VH 3VAEA 1FPTL 5EB9A 3DURA 4YZFF 2O1AA 4R90L 2ZXQA 4H0IA 1SEQL 2VDKB 2VSDA 3MFGB 5K39B 4L29B 3GSQB 1A1MB 5CD5C 3ORJA 2NX5E 2UUDH 4GRWB 3DIVA 2P5PA 2Z7YA 1ZXQA 4UANA 3I9IA 3WUWB 2ADJB 5I2IB 1TZHA 4YXLL 4NZRL 5KVEL 1O5PA 1A6ZA 3FH7A 4F58L 1NAMB 3FT3B 1V7MH 3OXRB 3PL6C 1KN4L 3L3IB 4LLUA 5ABDE 2FK9A 4DKEH 2H1PL 1U8HB 2OZ4L 4CVXB 2IAMC 1RUQH 1UA6L 4AQEA 5GS0L 3IDIA 4YC5A 2AJXH 3QDJE 4HIJA 1IJ9A 4ERSH 3SY2A 5MENE 4LDCA 3VRLE 4HEME 1U8LB 2WXQA 5BZDA 3S88H 2APVA 1RZKH 1SXAA 2RFXB 4KVNH 4WKXA 5D1QD 3CFEA 3QWRA 3L3JA 4YSTA 1YN7B 4ZS7H 3F12B 2IOUG 4Y1AB 5JOFB 1XAKA 3FSOA 5LDUA 3MXVL 1IFRA 1MCNA 2OL3B 2G0YA 3O3BB 3T77B 5IZ7A 5JW3L 4LEOA 2Z31B 4GMSH 3X17A 4F2MB 3T0ED 2VE6A 2VC2B 2W9LA 1CLOL 2YAFA 1AGEA 4YIQB 1JPEA 5E5RB 4NP9A 3IXTA 4UMSA 2X88A 3ZZSA 1PIFA 2OSXA 2WCSA 4MNHA 4LU5H 4ZSOE 5K1VA 1JN6B 3N5AA 5MEQA 5CZXC 3E2HC 1U8MA 4LOUD 1ZTXH 3PWPD 2ZUSA 1MW3A 5SV3A 4HKJA 3IJ8A 1W9XA 1CXEA 5DRWB 1S7VB 4GKSB 1XEDA 4XP4H 4GEIA 4HOWA 1DYZA 5EZIL 4BH8B 3S3BB 4WU7A 5D7LE 5E08L 1B4LA 1RUML 2DL9A 2IDQA 2X9YA 4MA1C 4WHDA 5EORL 4OD2B 3WIFB 2X4QA 2Z8GA 4IKIA 4U3HA 1AGBB 4EPSA 4MRBA 5CSZB 4ZFGH 1T3FB 1OSPH 2P24A 3MV9E 4N0FA 3MV01 1I1AA 3GMNB 5C0BB 5HPMB 1M71A 2APSA 2Q3AA 4ZX6A 1QUPA 1XQ4A 3NGBC 2YGPA 3L7FB 1Q0YL 1CLYL 3VG9B 5AKRA 1J86A 1QA9B 2DF3A 4Y1TA 2XQ0A 4I2XE 1B0GA 2P5EB 4D9LL 2CJSA 4EE2A 2WKGA 3S3SA 4F8QA 1ZHNA 2VERA 1J9TA 4JPWH 2ICCA 2JELL 5C86A 4MD0B 1L9OA 3EJYD 4QXGL 2F68X 4J27A 3QB7C 3LRKA 3B5GA 2EE0A 5GGSB 1KPUB 4R7XA 5DD5L 1OE3A 1LWRA 4Y2DA 1WFJA 4MXVF 4L1SA 2OSLA 5IROD 4FYTA 2EICA 2R0WH 1JVKA 5F1NB 4UNIA 3QZBA 5IF0B 5HGBA 3DOSB 1BW8A 1NAKH 1RZ7L 4XVUC 3TN0D 5J7CC 1HEZA 2HRHA 1OB1B 4YZAA 1ETZA 1PX8A 1TEFA 1ZLUH 4OGAC 1H5BA 2HVJA 2VW7A 2XWJB 5E8NB 3PAUA 4Z7VA 4KNSA 5DHVH 4G5ZL 5DUPL 4GUCA 4YEIA 5HD8C 2VDRB 3L1EA 3INUL 1KNOB 3QDHA 5E7FA 3EH5B 4OH2A 5E6ZA 4ODTH 2VMFA 5D9SA 5DA4A 5AYTA 4AEIL 1GGBH 1PZ5B 2YD5A 4F7CB 5JW4N 1S5IH 4L9LA 3IMVA 5DD3H 4BQCA 2BNUA 3ARVA 4QOKA 1BXUA 4XCNA 1LK2A 1RJLA 2QDVA 3L3HB 3O45B 3OQRA 4OZFH 4NENA 3TFKC 2XDHA 3ZE1E 4KDVA 3L4XA 1DUZA 2EIBA 5CD5D 3BRDA 2XWCA 4GXVL 3AQZA 4DPAX 1OARL 3EJUA 3APFA 4YHYB 3AY2A 4NZTL 1HL4A 2R1WB 2WP3T 3PXJA 5TFSH 2HG0A 3OJMB 3DV4B 3FT2B 4JCMA 3NACH 4FTVE 2FQGA 3ARGA 4PJCB 4POYA 1NSNL 5C0JB 3CX5J 2F7RA 4HFUL 2AXFA 4KU1A 4HISA 2NXYD 2IAMD 2QYUA 1JGVH 2DL2A 4YL9A 1KZQA 4AJYV 3FOLA 3FPXA 2BNRD 2WAHA 2R56H 1P1ZA 5CZVH 5MI0C 1W72A 2L7JA 5C6TL 4LHUG 1M6OA 3BVDB 3DGGA 3GMOB 2WSPA 3NEXA 5JHLA 3BIKA 2AVGA 5ID0A 2IBBA 2HT2D 4FG6C 1KYOJ 1AZNA 1KY6A 3VE0A 4C55A 4E5XA 5KYYB 1ED3A 4PJ5E 1OVZA 1J9CT 3VFMA 1KIPA 2X4UA 4L8BA 5BRQA 5IIEA 4FGMA 1I82A 3VFNB 3DO3A 5D96B 5CWSB 4J8QA 1P4LA 2XYCA 2Z7UA 3S98A 3KPRA 4ZNEA 3CFJB 5CZXD 4UAOB 1WA0X 3K80A 1KCLA 3GHBH 3QIBA 1MRDH 1DFBL 1TXKA 4JY5L 4NBYB 4RNRA 4XPHH 4YUEH 3CHOA 5FYKH 5I9QB 2OMWB 1CUOA 3CG8A 4LESA 3SKOB 1X44A 1G7PA 1G6RL 1M1XB 2F53B 2H32B 4LAQL 5DRXA 1VGEL 4HK3J 1SF5A 4PD4K 3ML3A 1UD8A 4GG6E 3BKYL 5LGHH 3L3DA 1BIHA 1L0YA 1CFVH 3ZDZB 3RJOA 1GZQB 1YMME 5BRZD 1M7IB 1E3ZA 3AM8C 4XNZC 4OQTH 3HC2A 2XKNA 5IT2L 3V52L 5DJZB 2AGJL 4L5FE 3WNMA 1WBYB 4HWBA 5I5MA 1QFPA 3MV8D 1XGPB 4RFEA 2ADFH 3TO4D 5JXEC 1TVHB 4PJFA 4RRPA 1BXXA 3W0WD 3GSXB 4X4XA 1NGPL 1T7ZA 1ZS2A 4Y8AA 1NANI 2YUVA 2EE9A 1YEKH 4DPCX 2YPKB 4GKLA 3KPLB 4QXUL 2DQHH 5J1TC 3QCUH 4Z7NB 4LHUA 4W4OA 3CJJA 2ESVD 2X40A 4EI5B 3GQ8A 1URLA 3FTVA 3V4VH 2ZIDA 3BH9B 4CSSA 5EUOF 4WHCA 2CLRB 4O5LH 3WD5H 4DGVL 2XPYA 5AEAA 4YQXH 4DP1X 5D5MF 3QPXH 5A2LH 4M7LH 3VXUD 4P3CL 5FA3A 4LFHG 2EAEA 4LVNC 2K7PA 1PKQB 1TJIH 3UTQA 1FO0L 1T1XA 1BWMA 2G2RB 4KROB 4A7VA 2GK0B 5I1IH 5GRJH 1G7QA 2FZ3B 3FU3A 4U3XA 3KYNA 3TBYA 3VH8G 3VGFA 2Y5EA 3GTTA 5D1XA 2K9UA 5KVEE 4J3UA 2W9DH 1IO4C 4YHKH 1UXWA 2EH7L 5IW3A 5HD8D 3RWGB 1FN4A 2X5PA 4PMHA 3MA9L 4GS7C 3V6ZB 4PV9A 2DN7A 2QHRL 3RA7L 3GNMH 3II1A 3NRPA 4NCC2 4YELA 3DIFB 1H9VA 1J8KA 5FHBH 4LMQI 4QWWC 2Y7QA 4LCCB 4BH7B 5HHNB 4EZKA 4HIXH 1BHEA 1PJ9A 4TSBL 1JZ8A 4AGQA 2Q2LA 3GPSA 3N0PB 4DZ8A 3TFKD 3O6FA 2OR9L 3IK2A 3IRPX 4WU5A 3UAFA 2IDCA 2J8UB 5DJ6A 3P4NA 3H9HB 4KTEL 2AVFA 2YEVB 2XBZA 1H3UA 4QRPA 1JYXA 1M6UA 4ZO9A 2E9GA 3NSJA 2G75A 3VD9A 4CU7A 4H8PA 2IQAB 3ZDYF 3RU8H 1BN8A 2ZD0A 1F4HA 1SYVA 2QVIA 2DI8A 1FIEA 3RVUC 4OJPA 1MNUL 4E9QA 5F72S 3R8QA 3Q6GH 2ZXWB 4P9HC 3WFEH 2CUIA 3ZSSA 3KL5A 3T71A 4CC1A 4MA8L 2P7TA 3PRZA 3WKYA 3I02B 1CN4A 2ALWA 2ZP8A 4X9GA 3KR3H 3ILEA 2F8VA 5CILH 5KG9B 4WTZA 1IGCH 1M42A 1NCWL 4IRSC 4N9GB 4PWFA 5JIIA 2H3NA 4JX0A 2E9BA 5IJKA 1T5WA 5FM4A 4R4BB 1T4WA 4UOQA 2IDTA 1AGCA 5J6GA 4U6HB 3GZOA 3N1QC 3W5NA 5SWZD 4NT6B 3JYCA 3D87B 2XN9E 1MEXH 5E6SB 2IVFC 3MV7D 3UO1H 1W0WA 3JURA 4JM2A 3CC5B 4FQLH 1R17A 2YO3A 3TXAA 5D7IA 1Z2KA 2WWOA 3S34H 2X6BA 4E9RA 2G5UA 4KNUA 4NIYE 4G8AC 5E0QA 3U83A 1IGTB 5KANG 2KL6A 3AZUA 4GRWF 4N2CA 3TFBA 4MDRA 5KVFL 2IV9A 1R5VA 4M7JL 3U0TA 3HE7D 1WT5C 3EYSL 3U7WH 1YEGL 4UTAL 4G9DB 5BV7C 3CGTA 1XH3A 3LD8C 3QJXA 5L8JB 1T89C 4PWKA 1VA9A 4YS4A 4UT7H 4JE4B 4IGBA 3VXMB 4OZZA 3QJUB 5A7BA 2CNYA 3OLGA 1CFBA 4XNUL 5JXED 3UMNA 1U36A 1F8TH 1Q94B 1E27A 2KZKA 4UOW1 3D4GA 3IDNA 1EHAA 3UH8A 4OZGA 2UXGA 3IAPA 1TLKA 1UT2A 2JJSC 1RUPL 3H55A 2HB0A 2LU3A 1BVKB 1FL6A 3P4MA 5ESQA 4QJ5B 5GJTL 2BX5A 1NKOA 2EDXA 5E9DB 1FL5B 3V5DB 1II4E 2WBJB 3VYOA 2GAZB 3LRHA 4PJIA 4AMKL 3RUGE 2O93L 3EGDB 2YEZB 4U7KA 4FNQA 2VR5A 3KLSA 4GQ9L 1VEMA 1RIVL 3SQRA 5ELIA 1KEGH 1HX0A 2VJ8A 4QLWA 1LO3H 1ADQH 2G3MA 1AO7B 2NTQA 4MMYB 1INQB 5ETUA 4E41B 2BIIA 4L37B 4A63A 4F57L 1UT1A 2ADIA 4PAZA 1IKNA 2FNWA 3VI4A 12E8L 2BSED 1P7BA 2B1HL 3Q5TA 4MYPA 2FYVA 3LH2L 2HT3C 4CUCA 5F6IB 2E8YA 4FQXC 1MFNA 4JO3L 4AQ1B 1X5IA 5L2KE 3FT9A 4G3YL 2DWEB 3HR5B 1UWEH 1O75A 1B0WA 4FZ8L 5C0DB 1SY6A 2CJUL 5FYLL 3VD3A 3APMA 3HI1B 4IRZL 4R7DA 3UPCA 5I30L 3GXMA 1ZE3C 1TQUA 3H3BC 1REIA 3TJEL 1WPCA 3H9ZA 5GGRY 4JJOA 1YEDB 4QWWD 1TTBA 5MERB 2M2DA 5HGGS 4RDBA 4O2CB 4XX5A 4MA3B 5DTFB 5H94B 1Z9NA 5ICXB 2V7HB 1F1AA 4PGBB 2BERA 2QL1A 2OX5A 3CK0H 4N1EA 3X1GA 3BLPX 3PG2A 1PZDA 2PR4H 2AV7B 2PTUA 2AEQL 5AVTB 3SDXE 5KYXB 5BRPA 1WITA 2IBGA 4N2GA 1OGPA 3RVUD 3MLUH 1IAIH 1G4MA 4B27A 2QSCL 1XMEB 1UWFA 2B15A 2EEXA 2A83A 3QISA 4BGLA 4WI5A 3QJRB 2YEQA 4YHPA 2FQDA 3NCYS 3ULVF 3TEWA 1L5GB 2C9SA 3EYVB 4H8VA 1UM6L 3JWDL 4HXBL 4XI5C 4FMVA 2KLTA 1CFTA 4MVBC 1QZ1A 3DUUB 3K0WA 3OZ9H 3C6LB 4KTYA 4AH2B 5EOTA 3OR7A 2NQCA 2Q86A 1MQKH 4OFIA 1BQSA 1FNSH 1RURH 2BIOA 3BKJH 3UYPA 3BP7B 4APQA 1CQYA 5DEGA 1SXBA 5HVFB 1EFXA 4QR7A 1U93B 5FUCE 3VGGA 3OX8A 4AQZA 4FQIL 3TJHC 1SUHA 3A6BH 5F21B 3CFCL 4OF6A 5JXAL 2X6VA 3QR1A 4XN8A 1CGWA 4LRNL 3KWVA 3UTPD 5KN5B 4Y4FD 4PG9B 1NWOA 4WTQA 4M5ZH 3VGEA 2P5WD 5IR1A 2X28A 1KWGA 2GJ6A 2P42B 4CADB 1S7TB 1LE5A 3NPSB 4V1DD 4WJKB 7FABL 1OPOA 3L1GA 4MJJA 3ZZQA 2IBZY 1XF5B 4PJCF 1WH0A 2B3IA 2RD0A 5ICYA 1H19A 5KVDL 4MCYA 3B2VH 4D0BB 2GQHA 2EDEA 2XKSA 3FQNB 4HC1H 2NSTA 3WFDH 2P80D 5JHDB 2HVKA 1QNZL 2WKLA 1H3TA 4ZUVB 4YL4A 5AKTA 4JAMA 3IJHA 3VXTB 3SDAB 3FB8B 4B7LA 2CHNA 4EN2A 4NQDB 2BOBA 2R23B 3STBA 4KJYB 4BSWA 3C08H 2WXOA 4UQEA 4N0YL 3CAFA 5ANMA 3SE4C 1WFOA 4KHXL 1D9KB 1CWVA 1GRWA 5EDXA 2K1MA 4P46B 4AJ0A 1DQVA 1MFAL 5C2BH 1G7MA 2ZYSA 1FH2A 1MJ7L 4C4KO 1XXFC 3WV0A 4DVRH 4DP4X 1T0OA 1BEXA 3E3QE 4I1NB 1DBKH 1F3DJ 4IMLA 3HHMA 3RWIA 3UBXG 2VBEA 2WLLB 4E68A 3WEXA 4ZFFA 5ALCL 3E9TA 3SJVB 3Q5OA 3UPRB 5DJXB 2PPAA 2EIJB 4NKMA 1SZNA 1WAAF 2DQEL 2N01B 4I8DA 4OLYH 2CR0A 4OZHB 4DT2A 1S9KC 2A6JB 3VXPB 5GRXG 3ZDZF 2XWRA 5FOBA 3I50L 1QTSA 2ZKYA 3CVHB 5BCAA 1F97A 4FQXD 2XN0A 1C16A 4QNPE 1A1NA 5DK2B 2KH2B 2BMKB 2IH1A 3SO3C 1OP4A 1NMCC 4WAFA 3O4LB 1TKWB 6FABL 5GS1B 4JDTH 2CD0A 1RZKC 4HBQA 2NZ1A 3D34A 4EQ3A 1E40A 2EJ1A 1YN6B 3CZNA 4L23A 5BZWB 2ZWLT 2VDNB 4IRJA 4PEEA 1U58B 4U05A 5C08B 2UVFA 2WVSA 3FO9A 1MI5A 2FSDA 3CQFA 4M1CC 2BOCB 1Z7JA 2Q7YA 3TA3B 2FO4A 5DF0A 4J3VA 2HX9A 3ZKXB 3K81A 2YRLA 4EI6B 4Z7NF 1AR1B 2F54E 1NBZA 4PTTB 1HHKB 1KJMB 1N7MH 3EYQC 4K7PX 2RBLA 5HYIA 1JZ5A 2FHFA 4XMPL 2GABA 2BY1A 2CRZA 2JB6B 5C0CE 3C8DA 2FGWL 4XN9A 5L8LB 1BHGA 2R2HA 1S46A 2A74C 2VZOA 4UCFA 3TT3L 2X89D 4D9QD 2O26U 4I0PA 4X7FC 1EVTC 4M1GH 1SHXA 1TZGH 2XTJC 4KKAC 4GUPB 5F7UA 2CWRA 1MLBA 2CIKA 3BI9X 3G6AA 4JRWA 2EO9A 1R3HA 4X98A 3WNKA 1K6QL 1MW1A 1Y6KR 4U1NA 1DN2A 4XI5D 2X4NA 4L9DA 5KVFE 5DSCA 4UOW0 4LDEB 5ANHA 4MVBD 2R29A 3Q2NA 4R2GD 2NTBA 2D3JA 4ZAKC 3DBXB 3Q2LA 2TSAA 2NTFA 3X3FH 1SLXA 4L8SA 4JS7A 1GZHA 3JWOH 5IMOB 3HC0A 1EMTH 1A6PA 3FFCE 2BM3A 4CGTA 1NGYA 4FA7B 4PM1A 3TA4D 4AE1A 2IADA 4WNJA 2Z35A 3MLRH 3TJHD 1L0XA 4WFEE 4JHVA 1AD9A 2ZCKH 5GXBB 4WW2A 2XRAH 4XCFH 2J8UF 3VA6A 3D8MA 4R96A 1E9QA 3NB2A 2H1XA 5ID1A 3MBWB 4PSRA 1CJYA 2GSIA 3T0DA 4XAWL 2BSPA 4WI2A 1RU4A 5DZLA 1ACXA 3VH8B 3WN5A 1H8OA 2CKBB 3BIAX 5SWSE 1DJYA 5I19L 4FNPA 3GRHA 2KBGA 4N90D 5AW4B 3JTTB 4I0CC 2Y7LA 3KYKL 1DDHB 1RUKH 3BPLB 2YS4A 1UXSA 1OGMX 1P7KA 4C59B 4X4MA 4F8NA 2EADA 4YDMA 1TZAA 5AYQA 3FN0H 4MZRA 5EMYA 1CU4H 4UM9D 1HZKA 2F1EA 1OFLA 2XPGB 3LV3B 1JNLH 5HYJA 3ULUH 4FXKC 3NN8A 3DVNA 3LKRA 4ZFOB 5T1LB 1EHLL 4NNXA 4F15C 3RPIA 1KXQE 5DEFA 5FYLE 1DVYA 1P4BH 1UB5A 2QHLA 4P23A 3V79C 3QFJA 4LOFA 1IFHL 1CGVA 3O9WA 3LN4B 2EEBA 1TQSA 4ZW6A 5EBGA 2N3JA 2Y25A 4LLYB 2VGLM 1WCBB 2WMPB 4JRXE 5AYUH 3EBIA 4Z95H 3JT2A 1H6FA 4X7DC 2UY7B 4KI5C 2YMTA 3AS2A 3T6QC 1KXHA 2YUHA 3SPCA 2EIZA 4FC3E 4JDVB 5GISL 5IOPA 2TAAA 4PJ9B 3REVB 1S7RB 1OAKL 2K70A 4FQHB 1IM3B 3HG2A 2NSMA 3W5MA 1N68A 4LP4A 4Z0BL 2OW6A 4L4VB 4BD4A 3H3PH 1T04A 1X4ZA 1YYLH 1ZS8A 3OHMB 3RYMA 2IH3A 4IBZA 5EFIB 3VSQA 5ENWA 3MLSL 2B1AL 5KVGL 1E7UA 1TFHA 4H5SA 3FQRA 1YNLL 3MLVL 3P4OB 4TXVB 1IIIA 3WXVH 1JK9B 4YHML 5EUOA 1KB5L 4OV6F 1DUYA 4Y19B 1BLNB 2GT9A 4M1CD 4OIIL 4QY8A 1QFHA 5D5MA 2R0LL 1HSAB 2NY7L 2YRPA 4C57C 2IPTH 2LVCA 3FRUB 4BZ1H 4UTBA 1UOLA 1E3FA 3EYQD 3UCRA 4JFFB 4WNSA 3ATDA 2WXFA 3DTDA 4WIQA 2WWKO 4XODA 5CKGA 3D25B 4ABVA 4A2EA 3F6JA 4U1KB 5E8OB 1AKPA 4WF7A 3NBNA 2HFFA 4B5ZA 4XO5A 4J6RL 3NJKA 1DHKA 4ZPVA 2XTJD 4KKAD 4U1GC 5HP5A 1J05A 3MUZ1 4AZ8A 4X4YB 2WQVA 4JFQB 2F0CA 4OT1H 4XOPA 2Y06H 5FGCB 3VW3L 2ZUQC 3AW5A 4JFYA 4QOKE 3P0YH 4XPBL 3ULSA 3FTSA 5TDPB 5F0LB 2X70B 4WSJA 5AOKA 4MJ2A 4Z3JA 3N6ZA 4ZAKD 3U2SA 3GQ9A 5ACZA 1INDH 2Z92B 2ROXA 3CX5K 4H26B 3CBJB 4N0RA 1XF4A 4K5OA 2VZTA 3V10A 1ZSDA 2YQ2A 3VXRB 5KVDE 1F0LA 1EHXA 1TSHA 2EDQA 3UBFA 1EEYA 1SM3H 4YBQC 1ID2A 3ECBA 3RTQB 2OMYA 2BWQA 4FFWC 2WLKA 4LEBA 4FNLL 1JCKA 1BBDH 5I76A 4FLQA 2BK8A 1HINH 2XG5B 1ZRUA 1RSFA 3FO0L 4QRQA 2DLFL 4OD3H 3O8XB 3LEVL 5CIPB 2WINB 3VX1A 5HYQA 3MCLL 1KPRB 1MJJB 4B6ZA 2LLNA 3FUJA 3E9UA 3OAZH 1E28B 3AS1A 3D69A 4JFVA 1XBDA 5ALBL 2XHNA 5DFVD 1YEEH 5E6IB 3M17A 4ZMWA 5JPNB 1DTUA 1F02I 1BQRA 3LS4H 3M8OH 2FRGP 4YSSA 3R7RA 3VFTA 4Z76A 1IAIM 1EX0A 2GBAA 5LCVA 2FECL 1FYTA 3EFFB 4TUUA 2DQIH 2Z4QB 4G7RB 2Z8VC 5FHAH 2DM2A 2W0LA 3VX0A 2EO1A 5JO5A 4TLKA 4L29A 3RG1C 2PTTB 1AMYA 1QFWM 2XXFA 2D7TL 5C09D 2V9UA 4UDTA 4XLEA 1AZCA 4XXDB 3GI8H 4HXAL 5D2LB 5DO8A 1EZVX 1ZA6B 3WUWA 4W9LC 4YGAB 2WKOF 1I8KB 3QEUA 4BQ6A 2ZWZA 1OSZB 2DWTA 3OXRA 4J8RB 4YDLC 2K78A 2B4CL 2HX8A 3JQOB 3NCFB 1MFMA 3LKOB 3KLKA 2BY2A 3I6KA 4LARH 4AOFA 1UZ6E 4PJFE 3GSUB 2ZUVA 4KI5D 4NQCB 4JN1L 1LQSR 5AW8B 3FSZA 2BX6A 1WBZB 1AQDB 4NHUB 2BSSA 1G7JA 1NLBH 4AMWA 4TQHA 3EOAA 4U1IA 3O3DA 4D3CH 5A2KH 3B8SA 1U8LA 4I4WA 3KRGA 4N6RB 2LGNA 2H7WA 1MJ8H 4C56B 3NIFB 5IM7B 4N5UA 3OHXB 1YN7A 5KSBE 3F12A 4PJEA 5AVXB 1E9OA 2VXVL 5JOFA 4M6NL 2OL3A 1K4CA 1P84K 5GGVL 5KS9E 3VD0A 4F58H 4XBPB 4NNYB 4ICXA 1KN4H 2O5YL 4KQ3L 1K8DA 3S6CA 1I8LC 2VQTA 4X4ZA 4X6FA 3HC4H 4WHYH 1UA6H 4F8TA 2JK5A 1JN6A 1AHMA 3PGFL 1AE6H 2IDUA 4NUMA 3RWDA 4EIUA 4FL4C 4BUGA 2QZQA 1FNEA 3KBFA 4IBLT 3WEBA 2BSTA 1A3RH 1AQHA 5I8CB 4YEEA 3ZE0E 3X1BA 2X6CA 3DRTB 4M5YL 1ZLDA 1F90H 5T1MB 4PJAA 5FYKD 3KPMA 1IV8A 2FIKA 3L9EA 5CINL 1UXMA 2YKLL 1CLOH 2C5DC 3HNSL 3Q1SH 5EZPA 1B4JH 2IALA 4AT6B 2J5WA 1T3FA 4ZMQA 1Z32X 5AVQB 3D85B 3LN5A 1U3NA 3OD3A 4OZHF 4MJHA 1CE1H 1CXFA 2AJUH 4YC2B 2IFFL 1OW0C 2R59A 3GB7B 1SJEB 3L7FA 1DBOA 2EABA 5EOCH 2ZAIA 4K23H 3DO4A 1S9XB 3QK0A 4QGYA 1IGMH 3BP5A 5IKCB 3GUTB 4YO0A 1HHGA 3D0LB 1SLWA 4P2QE 4YHZH 3A4AA 3L48A 1T0MB 2PO6B 4LHQB 5FV2A 3S36L 1EE6A 1OGAA 5AVSB 5EG6C 1RUMH 5E08H 3RNKA 3ARSA 4MD0A 4V2BA 1TIUA 4YJZL 4X5PA 1CDUA 2EDKA 4YBQD 3FC8A 3FMGL 5GGSA 4FFWD 2KPNA 2NUPA 3UBXB 4J12A 4ZXBA 1ZSHA 2IANE 4IJTA 4Q89A 4CBZA 4F7MA 1JBJA 1AXTL 3RB7A 4WUUA 3MA7B 2IPKB 1LHZA 2IWGA 3MLYH 2CDFB 3SPGA 4DK5A 2K3TA 4Y5VC 1X5XA 1Q0YH 1YQVH 3QRLA 1XL4A 4M61A 4OF5A 5H4YA 3UTTA 3BVNB 2F7QA 1J8HA 1E3XA 3C60A 3D0VB 1OB1A 5J6HB 3NJFA 2XWJA 1WYJA 4S0SD 2F5AL 4HZLB 4E0RB 3LYCA 4P3DB 5FWRA 2WLYA 4JKPH 4NYLB 4Q97A 2MOQA 3DYOA 5DQJA 2ICWJ 2LQRA 4WEEA 1DBAH 1WA1X 5K9KB 2QQNH 3NEEA 1ZV9A 3EJQA 2LAGB 1PZ5A 3ABGA 1BD2D 3LZLA 4HJGA 4E9XA 3DDFA 3L3HA 2Q5BA 2XX1A 1FJ1B 5LN4A 1UM4L 1OGSA 2F8OA 3AU1B 4L2LA 5E5MA 5AFAA 2OV0A 3BP6A 3TEZA 5HYEA 5JIDA 4B0MB 1QATA 2A77H 3QYCA 5H2BA 3S4SG 3K72A 5KVGE 1XCTA 3PGDB 3FQTB 5FW7A 1YCSA 1UZ8B 2JQMA 3FT2A 3V55A 1QRBA 3Q3GB 5GZOD 2VOTA 3INUH 5I1KL 1KBGH 1T7WA 2ZSVB 2OJEA 5C0JA 5K1NA 3WTWA 1LK3H 3QEQA 4PJDE 5C0IA 4ES8A 3UGXA 4AEIH 2G3NA 5AB0A 3L4VA 1RMFL 2PYFB 1H9DA 1HJBC 1V27A 3GXNA 4Y7MA 5CM1A 1XB3A 2BSDA 4P2CG 3RZCC 4PIBA 1MPAL 1QFWI 2ITCA 4OGXH 4WI3A 3A23A 3LY6A 3GMOA 4P2RD 1NCBL 2DQCL 5KZCD 1U91B 2WSDA 1GC1L 2V9QA 3SE8H 4NBXB 2VM9A 4RGNE 3L81A 3TCLA 4DO4A 1PZCA 3NK3A 4KMTH 5A2JH 1PY9A 3A67L 5EBMA 5DLMH 4LVHC 4X6DE 3SDDC 4M00A 5FYJL 2QELA 1J5CA 5C0EA 1GQ8A 1DBML 2VDOH 3DOIA 4HX1B 4J3TA 2WK2A 2C3VB 4APXA 4XMLL 2NY5L 1NEPA 2GI0A 2W0PA 5E4EC 3L45A 5IHZB 3VI4E 3FZUC 1CICB 5ESAA 1WP6A 4HLEA 3DHPA 2P45B 2ITDB 2VAJA 4XCYA 3TBWB 3TIEA 3GIZH 4RSYA 3TNNB 1KJ2B 5AALA 1M7IA 1XWVA 5DJCA 3IMRA 5AOMA 4XN7A 5F9OL 3S4SA 3RGVC 4OJ6A 1T7YA 4R7NA 4TVPL 3RWCA 5FUZH 5JDSB 1N0XL 1MHPL 1QPXA 1R9FA 1VADA 2J6EA 1D5ZB 1VJSA 1T5XB 4HMEA 5CJXA 3C8KB 2CJTA 4XKVA 1MCOH 2V5TA 3HUJB 4G1EA 1ET7A 1M7DB 4KRMB 2AS5M 4FHBD 1OT4A 4NQQA 4A6YL 1BBJB 4LAQH 2VL4A 3ZYZA 3FCGA 3MRPB 3WLWC 3S9DB 3MRKB 2ROYA 3JV0A 4M3JA 2DY2A 3QNZB 2V3EA 5IMLB 1ZJAA 3ARFB 3B6SB 3LX9A 4IHOB 4ONOA 3NCMA 1Z3GH 4L4TD 3UJTH 1FIGL 1KDIA 4ZFZA 2AGJH 3VMNA 4MXQD 3TP4A 2HN7B 1ZCRA 3S35L 1Y1UA 2AQQA 3EGSA 2VDML 2E46A 2WBKA 4K94L 4TTGA 1PDKB 2XQBL 3B7UX 5K93A 1PKQA 1KENL 5ERWB 4BKSC 1RK7A 4HD5A 2EKJA 4YZFE 3SZEA 1E4JA 2J25A 4Y5XB 2Z34A 2DS4A 3GMPB 3KW7A 2GK0A 2PW1B 3PWUB 2FZ3A 5FYKU 1ORQB 1TO5A 1L9RA 2EVJA 1DJHA 5CLTA 3E8UH 3POCA 1RK1B 3GKZA 3FSAA 4OLEA 2HPTA 2FATH 4MJID 4OLWL 1Z0MA 1Q90A 1CE6A 3V6ZA 1NGZA 1KELL 3T4YB 2VSCA 4XQFA 1E42A 3DUSA 4YDNA 4XMZA 4YMPA 3DIFA 4I3GA 4PJ8C 4P3CH 3LRLA 3ARZA 2I9TB 2VDQB 3ZLQC 5F3HB 4NO5B 4H20L 2VLMD 1IT9H 3IEAA 3MRJB 2XWXA 2WXHA 2W0FB 5I1CH 1JMZA 4XP6H 4TMPA 3GBEA 3F6LA 5JZ7C 3O3AB 5SWQB 3I75B 2NDGA 3KD4A 3OKNA 2OMZB 2EH7H 5J1AA 3IT8D 4FFYA 4G59C 1C08A 1C5BH 3BGMA 4JPIB 1BMZA 2ITEA 1AIFB 1ZLEA 1TCRB 1A6AA 4U7SA 3AQYA 5CUSL 2FX7L 2X0WA 1QUNB 2ZP0T 2VH5L 2XJKA 2PCFA 1CR9H 3N0AA 4JR9H 2LABA 2NXZB 5KG9A 3QO1B 4GLRH 4CSTA 3RZCD 2R69L 3KXFD 4NO2A 4R3SA 1G9ML 2O5XH 2AJVL 4Q9CA 4KTEH 2A6DB 3HZKB 5AZ2L 3L7EB 4J3OF 2CM6A 3RL2B 3X12A 3O11B 4PS7A 3RFZC 3IF1A 5HI5C 1NFIA 4ODWB 3RFRA 4WGVB 4N8CL 1IJNA 2A4CA 5IVXB 3S8WA 1CTMA 4GAGL 4X5RA 3SDDD 4R7VA 5HVHB 1MNUH 2X6WA 5JW4R 5EU4A 4YSUA 3KYOB 3ZJAA 2EEAA 1PZ3A 4Z78A 1MKFA 2K8QA 1ZT7A 3JWOC 3PP3K 3FZUD 4XMUA 2CHWA 3L2LA 1OP5H 5JLVC 5D2LF 2Q10A 2VDKL 1IU1A 4UIKL 1ZDSA 2JSFA 1CF8L 4G9DA 1IB5A 3WGVB 4H13C 3D3VD 2NSPA 1J10A 1NLDL 3B4NA 4HF5H 4AV5A 1HHJA 5I0WA 5IG7A 4JFDE 5JA9A 3MRMA 1R4XA 1MH5B 1WTLA 1NAML 4XB3A 2P1YA 2VR3A 2FQFA 2X1WL 3EO9L 2WZ0A 2BVEA 3OV6A 5DZ9A 5KOMC 3WO3B 3BQUB 5I6XC 3ZBMA 2FR4B 4TL5A 1JHLL 2G5BA 3I9GL 5EO0B 1XZ0A 3NIFF 5DJYB 4EIBA 5B8CA 1A7RL 5CP3A 3LKQA 4MXVE 4FABL 5F7DA 2OPCA 3V5DA 3NFNB 1N12A 2JXMB 3WLWD 5IHUL 3BYYA 1ZLWK 4MA7H 3UTZA 1XH0A 4HV8B 4NN5B 5EZOL 5ISZA 1TQBB 5B39A 4AYMC 1L4IA 5D2NC 4F1SA 1B0IA 4QKXB 4DFHA 4N2FA 2OL3L 2QV2A 4UQAA 3ULUC 2R27A 3T0BA 5JORA 2F19H 2N56A 1AO7A 2VC2L 3E38A 3PV7A 4ACPA 4U6TA 4E41A 5B1CA 1MRCL 5D6DA 2Y0SA 4AVHA 5DS1A 3G08B 1ID5I 4PJXB 4G82A 4JQIA 1XHHA 5GJTH 2H26A 3UDWA 1DQQB 2BSRA 5FFLA 4D8PA 1R0AL 2XXGA 4EN3A 4QRUB 5AAWA 5JLZA 1LWJA 2NCMA 2VLKD 3GFUA 3HMWH 4PRHE 4GQ9H 2OCCB 4NUGH 3PWJB 3HI1A 4AEHH 4LSTH 5TK4A 4OCRL 4NSKA 2XY1A 3MJ7B 3C5ZC 4PJ8D 4UT6L 3S8FB 4YCQA 3MOQA 1IA5A 4XP1H 3IPBA 2YD9A 3ROLB 3BZ4A 1R5IA 5DA0B 4F57H 2PXYC 2OTUA 5EBLA 3UBGA 4Z7QB 4Z7OB 3U9PH 1H3WM 2ED8A 3OGCA 4FULA 4GP8B 5I18L 3DXAA 3ZKNC 3MBXL 2QQKH 3AMKA 2WW8A 2FJHB 3T65A 1IBFA 1QO3B 4PRPB 2K9FB 1KIQA 1XDTT 4NO3B 3ZR5A 2KERA 3S2CA 4HBCL 3T2LA 5KYXA 4MDIA 1EO5A 1FZMA 4B95C 5F89A 5DHDA 4HKZA 1YEJH 2RCSL 1JPFB 4KXCA 5FYJE 1M3JA 1OTTC 1BFVL 2FE0A 1FZKA 3I3BA 3QUZC 2V33A 1NIDA 4ONFH 4QO1B 3TJEH 5AOIA 4G1MA 4EBQL 5EPMA 2BP3A 4FXLA 4H25B 3DSNA 2JTYA 2N0KA 3VI3A 2DJSA 1DVXA 4GUOA 3NCJL 3GWJA 4UNTA 1GGIH 3GSNA 3ULVL 3DUUA 3OR6B 4LL4A 3IFNL 1JZHA 1FV1A 3AXLB 1FLTX 4YWGH 4S2SA 3QORA 2V2XB 1MHCB 2AEQH 4TVPE 3MRQA 2WO2B 3LHPL 2R1XB 2X87A 1QBLH 1AVAA 25C8L 2DEWX 2VDRL 3G04B 2EECA 1S9YA 4BZ2L 3ARPA 3M1CA 4F7KA 1XIWB 4A7GF 3UAJC 5F6HI 2YRZA 4XN3A 1GSKA 4FD0A 2VO5A 4NZDA 2P44B 3HI6L 2VW4A 1UM6H 4TPRL 1TTAA 4WJ5B 5CJ8A 5IB5B 3VRIA 3SQBB 3W81A 5LAPA 4U2YA 2ZQKA 1YECL 4P59H 5HHOA 4F7EB 4PGEB 4XT1C 1YEHL 3T4AB 4GW5A 4Q6IA 3RLSA 5DZOA 1QMUA 3WG7B 1JTPA 3DETC 3WMSA 2BHYA 2YC1A 1OM3L 2YZ1A 5EUOE 2F7OA 4UQCA 2L4OA 1MLCA 1JYVA 4GBXC 5D5ME 1AR2A 1FVEB 1RK0A 4F8OA 1TSRA 5TE4L 4GO6B 4PLJC 4OTXH 3E6HA 4RGMC 3VSUA 2W65A 3TZVC 4PGZA 4W9FC 2CO7B 4TS6A 3C2AH 4JZJA 1A6WL 1KGJA 2R23A 1OGOX 3Q8EA 2AEOA 2ZWNA 1LEKB 1L1IA 5D1QB 2BC4A 2K4AA 1V7NH 5E8PA 3GJEA 4R83A 5IEKA 4QCIB 2ODIA 4FCHA 1GS6X 3GJFB 5FGBA 2ILLA 2MCAA 3ULUD 4KRNA 3N6YA 4KQ4H 4E9LA 5CBAA 4LIQL 5F1SA 5EEUA 1F4WL 4XN2A 1OD9A 3NCBB 4FEMA 3T3PF 3T0EB 1DP0A 2DM7A 2XTSA 2O5ZH 4I89A 3MBEA 5JNYA 5F8QC 3C75A 3EYOA 3K5RA 4OZHA 1NL0L 4IBVA 4Y5YB 2A6JA 3HZYA 1N59B 1EFQA 2EIEA 4XMVA 2ZSWB 3U36A 1PY4A 3PWPB 4DTGL 3CVHA 4BHUA 5FK9A 2BIPA 8FABA 1M7XA 1W72H 4FP8L 4LPCA 2NY1C 1SHSA 2WXLA 5DK2A 3S5LA 1LLZA 1NCAL 1EXGA 2X1QA 1MFAH 5JHLH 3ESOA 1JUFA 2V17L 4M56A 1MJ7H 1FORL 4YHIB 1QBAA 5ITFA 4PJBA 1OAYL 1U2HA 5DZPA 1EZUA 4M6MH 3C5ZD 3ZDYE 3EG9B 4ECNA 4G8GD 5AVYB 5MEPA 4XMYA 3HUJF 1U58A 1FYHB 3ARQA 4BKLB 3OPZH 2WQ8A 1FFRA 2B08A 4JQVC 5F9WC 2BOCA 4NXSA 4CU8A 2PXYD 1MFUA 3FU7A 4LASL 4YLQT 4M6OL 5DCCA 1J88A 2FJGA 1AG6A 3L8QA 4EI6A 4NHCL 4P5KB 3ZKND 4PTTA 1Q9KB 3BSZA 1W0VA 5AOZA 3QFGA 5D7KD 2A4ZA 4M5TA 5LGYA 4C4KT 2JB6A 1S5HB 1M05A 2F08A 2NY3B 4N28A 3ML9A 4WW1B 2QKIB 5LN8A 1AGFB 4MNGA 4KVCH 4QEGA 3T6VA 2A2QT 2JIXB 3FT1A 2ZCZA 4JUTA 1E90A 1OTTD 3AB0C 4JKKA 3ZVVA 5C9JB 1DZBA 3QUZD 4HWBH 2FWUA 4YSRA 4YN3A 3FK3A 3O6KL 3BH6B 2CU9A 5C9KA 1K8IB 5KSAC 1XXDC 4DAGL 5LXVA 1D5MB 3OM3B 1QVOB 3BSGA 2BWIA 1NC2A 3EJSA 1ERNA 1R3KA 3C5JA 5T5FL 1OK0A 3HFML 3HMXL 4Z03A 2BP8B 5C0GB 5HYFA 2LLGA 4CNIA 4GRWE 2COVD 2J7LA 3H9SA 2V7NB 4NLHA 1HK6A 1ODUA 3QNFA 3DPBA 2D7PA 3TN0B 3Q6FB 3LJ3A 3CX2A 4QLRA 4FQCH 4EKXA 4G70B 4Z5RA 4QXTA 4BFOA 1UJ3B 4DCQB 1ASPA 3MGOA 4TUJB 2GIMA 1KT2B 1JGLL 4GSDL 5LDSA 5FOJA 2Y6SC 1RZFL 4OAWB 3UAJD 4OLXH 2YMXH 3JZ7A 4EUPB 1A7PH 5LGJA 1MVFA 3T9GA 1QA1A 4HAKA 4LEXL 4W93A 1O9WA 2IWKA 3CIQA 5T5NG 2B9BA 3BIBX 4Y1AE 1JI1A 5BS0D 2VITA 2Z1PA 3QULB 4HIPA 1I9JL 3GBNH 3P9LA 4DP6X 1WZ1L 3S5YA 2VMEA 1IC4L 2ZYRA 2WNWA 1KCSL 3FO2B 4Z3HA 4WWKC 1VGKB 3DETD 2DQTL 1VACB 2H2SD 1DDHA 3PLYA 4F2ME 3LSOA 2VUOA 2XT2A 1P4UA 4FFYL 3PWLB 3LQZA 4H8WL 5CU9A 2ZWYA 1NOAA 1WBXA 3QDMA 4PTUB 1E5CA 4ODVL 2BINA 3MREA 1Q9LB 1UD3A 2J57A 5DHYB 1EERB 3QUMB 2WZPD 4GBXD 2NXYB 4BV1A 2IAMB 4D7BA 1YDPB 4PLJD 5JYLA 4AQOA 2XPGA 3TCXA 2JKLA 3CHPA 4PJGB 3TZVD 2FJUB 2BNRB 2LR4A 2PWEA 1UZGA 1P4IH 1X7SA 1BXAA 1MAJA 4MNQA 2R8SH 1F58L 4UOZA 5IV2B 3WI9A 2HKFH 1ZT4B 3MRCA 4S1QH 4C58B 5I19H 5IVXF 5I0YA 4PRDB 1UD4A 5DD1L 1QWNA 4L8DB 4WGWB 4OF3A 3UZVB 1WCBA 3HE6C 4M48L 4PQXA 1CQKA 1BZQK 5C0BE 2VIRA 4XOAA 1NGWA 3V6FA 1WTGT 2V2TB 1DEEB 2YPLD 3APNA 3WIIH 3E8VA 5AD0A 4MFHA 1BMWA 4H8QA 2F6AA 4LGRB 3E2HB 3CSGA 4Z7WB 3D5OF 1EHLH 4FQHA 2XV6B 2NY1D 3ARTA 2P5EE 3MROA 3OB0H 3LEXB 5TTRA 1JZFA 4NZ8A 4ZYKA 2J6WA 3LVEA 4MD4A 5I66B 2AQNA 4ETQA 3B3IB 3KYMB 5EFIA 1JGUL 4AG4H 3QI9A 2BNQA 3IDJB 4L1LA 1Q72H 5BRZB 4MA1B 3CFKB 1KTJA 4K3DH 4QPEA 3KPTA 2GY5A 3QE5A 3BVVA 1T2JA 1BLNA 2PCPA 5J5EA 4NQEA 4XB8A 3UYRL 2X4RA 3BXNB 3LMJL 2YAHA 2RJMA 1A9BA 3MV8B 1HSAA 3R06A 4IBYA 3TO4B 1I8IB 3RWFA 2JVUA 1QSFD 2DTSA 3RVWC 3W0WB 2HFTA 3ULVE 4LO9A 2J4WH 1AS8A 2XTLA 2H6PB 3QNYB 1G6VK 2RQ8A 3NGBB 4ZMOA 3WSQL 1KLGB 1G1CA 3ALPA 3DLQR 3RJQB 4NQXB 1JTOA 4X80H 3ATBA 5HHXL 1BQ5A 4LPTA 1NCJA 1IRAY 3RNQA 1OAJA 1XVSA 2AJYL 2PPDA 5E8OA 2Q6WA 3TBCA 2B3RA 5EEXA 2B1AH 1ES0B 3PDOA 4LCUA 2ESVB 4QRSB 1JHTA 3TBTA 5KVGH 3VFOA 2J43A 3MACH 1F5WA 5T1DL 5E2JA 3QQDB 4ZMLA 3QNXA 4FJYA 5I1EH 1WUZA 3NZUA 2A3TA 1N70A 4BINA 4DWHA 2W9EH 4PJXF 2IDFA 4FNSA 4HKBB 4U6YA 4HIEB 3U1PA 1U6AL 5KSAD 4FLOA 5I1AA 1LYQA 1FWXA 3VXUB 2AI0H 4IMKA 4MKTA 3LYRA 4NNPL 5I1JL 2A7BA 5JOPD 3BN9C 3O0LA 3D39A 3NCEB 5J11C 4EXPX 3PHOA 4H40A 5D70H 1X4YA 1IFGA 2PPFA 1TMCB 2CXKA 4MJ6A 1OANA 1K5NB 3T6XA 3BQVA 1E5AA 3DTXA 4JVUA 1G7IA 3L4YA 4PJCE 4BFIA 3PREA 1O6SB 2W07A 3FN3A 3MFFB 2CLVB 2Y1AA 2Y6SD 1JWSB 2CUAA 3POHA 5E1AA 4JKNA 1KBPA 4Z7QF 4Z7OF 4OB5H 3RPKA 1IBYA 5CEZD 4NO0A 2BFVL 4ZTEA 3ELAT 3V0DA 2WWKT 4GRLC 3P9WB 3UG4A 1ND0B 1R3JA 2D2CC 1U8JA 5AVUB 5FYJU 1T83A 1B3IA 1FUNA 2IGFL 5JR1L 5LQBH 5IW6A 2Q3ZA 3SZKC 3GJFK 1P5UC 4DOHB 1SLVA 4UIMA 4MMXC 4X5QA 4AVJA 2FCBA 5F8RC 3VU1A 4XPFH 4C54A 3SCMC 3QEHB 1OAUL 4WWKD 3FF8A 4LCWD 2J71A 3QQ4A 4RVBA 3SBQA 1R47A 1BZEA 1RZIA 2JQAA 4KKNA 4LIQE 1QSEA 4MCZA 3NSFA 1SY6H 4A2FA 1HG8A 4WENB 3HI5L 1ZHKA 2X6AA 1ML0A 3IMTA 1ZA3A 3MLXL 2BIQA 5DMKA 3FL7A 5CBEB 6PCYA 1A3ZA 4B9GA 3DJRA 2APTA 1N6QL 3AGWA 2Z4QA 4L18A 1G9EA 4D7PA 1AZZC 3IVKB 3CDGA 5G5DA 3OWEA 2F53E 1WAAE 2GK2A 3DI2B 5KW9H 2GTZB 2NW3A 3RWHA 3U1QA 5MI0B 1FDLH 3AAZB 4R0LC 3ZDZE 1Q9OB 4IIQC 4OLZL 5EU7E 3QZNA 4F24A 1NBVH 4UTCA 4QRRA 4Q9QL 4AJWA 1E65A 4XWGL 3GSVA 5HDRA 5T1KD 2ZXAA 3FFOA 2E9WA 1GGTA 2IXQA 4HJJH 3TIDA 4V11A 3DI3B 4YE4L 1GAFL 3HE6D 4Q0XH 5SWZB 3IDUA 4BELD 4P5TC 4BK5C 5L88H 5E1HB 1NM4A 3MNZA 3MV7B 1AQDA 4HS6A 4CU6A 5HHQB 3CDZB 3SO5A 3BEVB 3SBWC 4N6RA 1M9WA 4PSPA 3WNOA 4C56A 2PW2B 1IGFH 3A6CL 3JUYA 4Z7NE 1BYOA 2RQEA 3EYUH 4HXAH 4S0HA 3DYMA 3E3QC 4HQQL 3GSWA 3JSSA 4F3FA 3HE7B 2CO6B 1V55B 1ZDQA 4Y16D 2EYSB 2AK4D 1NCOA 3AS0A 2B1OA 2NY4C 3F7YA 3DVGA 5C07D 5TGBA 4CN6A 5B21A 3SY0B 2APBA 4UV7H 4XNZB 3OLIA 2ZX7A 5EU6D 3QXDB 1CT8A 4I48A 1U8CB 3EZJB 2IAAC 4OQ1A 4D9RE 1MCFA 1PKQE 3MRNA 3STZB 1R24A 2QT6A 2I60L 3RVWD 2C4FT 5L4IA 3H0TB 5I28A 3GMRB 1IAOB 3EJRA 2V9RA 5IK3B 3TT1H 4DGYL 3QW9A 4MAZA 2ICEA 1NFDB 3FTGB 1EA0A 1J5DA 2FTAA 3FO1A 1D6EB 3WFBH 2A73B 4OU3A 5MP6H 3O2DA 1M2VB 3B43A 4HUXB 4MB4A 3HPJB 1LDPH 4PYHA 4AC2A 5GIRB 5AVZB 1GZPB 3GZQA 2UZYA 3CXHJ 3TVMC 4XX1E 3SPJA 5EH1A 5KVMC 3VG0L 4GIPD 4KRPC 4P04A 3IKCB 2W38A 4M43H 3QDGD 4HS3B 1JHKH 4ODXB 5F7WC 1B0RA 2DKUA 2W5PA 1KTDA 4LVNB 3BN9D 5EA0L 1S9XA 1V3JA 3D07A 1QTPA 2WWNA 2J8UE 5I24A 5GGTA 2BS71 5D6CA 1HWGB 1JPTH 4HK0B 5EUKB 1MFDL 4N2HA 3CVHL 2D03H 4Q8BA 2FWSA 5K9QI 3L3OC 5L0QC 1T1YA 1NCDL 3JT0A 4IQHA 2EP6A 2YKLH 2ZX8A 3QQ3A 1MCHA 4PGCB 4GS7B 4G43B 4FMKA 5JQIB 3SKJL 4KZ0A 2VDNL 1S7XB 3CFBA 3MA7A 3KMDA 2DWDA 4JW3A 3CSTA 3MTXA 4FE9A 3FB6B 2Z0BA 3M86A 1P2CB 1JFHA 3BSZL 4XNQB 5CFHA 1KB9K 4F27A 3SCMD 1BVLB 4P3DA 2A6IB 1KCRL 1TEYA 4NC1E 2ZOWA 4Z77B 4OZFG 1ZLSH 1MJUL 2V5RA 3NEOA 2H6UA 3ZXAC 3P30L 3FW6A 1HQ4B 4KX7A 1DSWA 1WEJH 3FN9A 3QJFA 3NIDF 1ZHBB 4DEUA 3HAEG 2OQJA 2MCPL 1FJ1A 1A0QL 3T8XB 2Y1YA 1V05A 3GMMA 1KDJA 3QJZA 4NP4H 4U6VH 1AJ7H 4GKNB 3V0WL 4ZMVA 5TQ2L 3IJ9A 1AD0B 1E9PA 1G1KA 4ZTOL 3NH7L 1U3HA 4JB9L 4K07A 4AL8H 2VAAB 3VXME 2ZSVA 4R4FL 2RA1A 5JPMA 1GY2A 2WCGA 1PL3A 4PLKC 3HRZC 4AENA 3DRQB 4W9GC 1FNHA 4TNGA 4P5TD 3T0VA 5AENA 4U0RC 1DSFL 4JRYA 2KPWA 5TPWH 1C12B 2H0JA 4M8RA 1AI1L 5F9DC 1UM4H 5E9DE 5CKAA 4JFOA 4Z0XA 2LU7A 3G5XB 2R29H 1CDGA 4IOIB 1T2QL 4Y4FB 3NVQA 2YXFA 1F45A 3K0YA 2P5WB 3ZW3A 3WL9A 1WQVT 4S1RL 1I1AC 3KPSD 1HOEA 2CKBL 3VFRA 2NY4D 5BV7B 4MHHG 5DUBB 4V1DB 3KLDA 3SKNB 3LD8B 4KJWC 4XVTH 3FU0A 4K3HA 4XGZB 3CFQA 4YX2L 1ESOA 1X9RA 1AO7E 1TFPA 2P3YA 5DMYA 3US1A 3EHBC 4PJGF 4E41E 2C3VA 4K7FB 1IKOP 2YOAA 3VD5A 5A6IA 2APFA 5IHZA 5DD0H 5LAXB 4X0KB 4BCZA 3PSZA 2YK1L 1LD9B 5GRYA 3HAEA 4P05A 4WFHD 4PREA 3TBWA 4ZFOL 3TNNA 1KJ2A 4IOFC 4NK6A 4O51A 4P99A 2JCCB 4Y2DC 4KXZH 4J3XA 3N85L 3TPUB 4G9FD 4BFBD 4WUKH 4WZ9A 3U48A 2G4EA 5L7XL 3TVMD 4HWZA 4W9JC 3A67H 4UTAH 4G6JH 1ZIBA 1T5XA 2H2PC 4KRPD 4YNYB 3C8KA 1U30A 2YBRB 1DCLA 3AT0A 1WZAA 1KPVA 3SKMA 3VNZA 4Z7WF 4JFZL 5I8KL 2A9DA 1PZUB 1H5BC 3CFDB 1BBJA 4NC2B 3A47A 3GLZA 1NCTA 2B59B 2CBPA 5I8OL 3BFQG 2H8PB 3U4BL 2CLZB 3MRKA 1RJZA 1T1ZA 5IB2B 1QQDB 3KEHA 4YBLC 4JY6A 2ZG1A 1MUJA 2N7SA 1DO6A 4FQXB 4IHOA 4TQIA 5F9OH 3T0XA 4ODHL 1EK3A 4L9LC 4OCNC 2ZTBA 4JFHE 3P0VL 1RHHB 1MDTA 4KKCC 3CZFB 2HN7A 5AL0A 5E4AA 5TDOB 3TTYA 4IYKA 3OJDB 5JHBA 2PYGA 3V0HA 4KY2A 4B5EA 4GJTB 2FLBT 5IB1A 5HGDB 1PDKA 1YG9A 4JHWH 5K33A 1JGDA 3NTCL 2Z6FA 1BZ7A 1CZFA 4Y5XA 4ALAL 1IC7L 3GMPA 2PW1A 1ZTMA 4MJ5A 2J72A 3LZRA 3QXUA 4MAUH 5C71A 3ARGC 4JFXB 5F9AC 5D4IA 3BFOA 2JB5L 3IJYB 1F3JB 3RBGA 1JD9A 2ZXDA 2XQYG 2P8LA 1U8NB 5H37A 2NY6C 2W60A 1FIGH 5DS8B 4H2AA 4Z6AT 4WEBH 2HJLA 1IGJA 3IJSB 3LNEA 5INDB 1XGRB 2FO8A 3BUTA 3QUKB 1XGUB 3UTSA 3KHQA 1I7RA 3QWRD 3TWCH 5F3HA 4U6XB 4QF1B 1N0LA 4UTBH 4XE5B 4K7PL 5FW6A 3O3AA 2ZUXA 3O3EA 4R2GB 1A14H 1OZTG 3QS3A 4AI7A 3KBHE 1KCWA 3EJTA 3IDGA 3QIBC 3TF7C 3O6LH 3WE6A 4P9ML 4BRVA 5B38G 4N2OA 3IFLH 4PLKD 2NZMA 2XZAH 1AIFA 3W9EA 5FF6A 1QLEH 5JHDE 3QJTB 2GKIA 1E7VA 1MWOA 1UGNA 3LPPA 3VFSB 1MCRA 3QO1A 1EHNA 4NRZA 4LP8A 3PQYD 4WO4D 4NQDE 5B7EA 3LRSB 4QRFA 1ECYA 2A6DA 2OR8A 3FB5B 4Y4HC 3MO1A 1IGIL 3KJ6L 3O11A 4WSKA 1I1AD 2WTPA 2LU5A 1HAWA 4HMCA 4HG4J 4KUCD 1PFOA 4MQ7B 3UABA 4W8TA 4RISH 4FQ1L 4KJWD 4C83A 4MQSB 4R4NC 2DLGA 1SF3A 4U4IA 1AKJA 2EDFA 1MWAA 1T22A 3G5VA 1KSRA 3SJVE 5GGQL 3GMLB 15C8H 3EHBD 3O2VH 4U1MA 5J56B 2CDEA 1A6TB 1BF2A 2H0FA 5LNDA 3EDEA 4OZHE 1YNKL 2C1PA 3X11B 4W4OC 3QP3A 3BWUC 5FW8A 1TVBB 4UWQB 2HP4A 5D93C 4HUKB 3LAFA 4YGVB 2H45A 4UM9B 4Z05A 5DHXB 5DU7A 4ELMB 1HAUA 2I26N 5A2AA 5BQ7B 1ILUA 1Z9OA 4IOFD 2OMVB 4JO4H 3V8CA 1QI5A 2E47A 2Y07H 1CLWA 4Y2DD 4CVZB 4LLQB 3X3GH 3O4LE 2I5YL 1MH5A 3CMOH 3NFSH 2DQ6A 4GKZA 4XO3A 3QHZL 2E4FA 4G6KH 3K4DA 3ME0A 5C08E 2H2PD 2IMMA 1HEHC 4KX9A 2IQ7A 1YA5A 3CE1A 3I9AA 1WZKA 5D1XC 3A24A 5LCVH 5DJYA 2XN1A 3RILA 2HXAA 2DEXX 3PUUA 4GFXA 4UIKH 1XL6A 4TSAL 3BRFA 1NDMA 43C9A 3WTUA 2J12B 5D72L 1PYWA 1KY7A 1OSYA 2DD8L 3PHSA 4KKCD 3SO3B 4BBWA 3VQLA 1NMCB 3ARXA 3EO9H 3IFPA 1C5DA 5FV1L 2UXFA 5TE6H 3O6FC 5CJBA 1A3LL 2QSQA 3NJXA 2EUWA 3HBZA 4XVSL 5CSBA 4N85A 1GYAA 4K3JL 1NFDF 4FHKA 3F62A 1WXRA 3VFWA 4DN4L 5J0BA 1HFUA 2V3DA 5F7EL 3WFCL 3I6GB 1I1CA 1DQQA 1XG2A 4NN7C 3ARGD 2F8XC 3OL2A 2WNGA 2GCYA 2DI7A 3A5VA 3MCKB 2R7EA 2NY6D 3EO0B 3G6JA 3PWJA 3SQVA 2OL3H 2OYKA 2R0ZL 5KAQG 1K2DB 1U8QB 4Z7UA 2JE8A 3TM6A 2A74B 1OCCB 4RAVB 2ZJSH 4P4KC 4ORZC 3K4ZA 3WDIA 4KXDA 2XTJB 5CXPA 1MRCH 2X3HA 1X6LA 5IJKC 1AHWA 3U46B 2NLJA 4Y9CA 1KACB 1INEH 2VWEE 1S7SA 5AG8A 4OIBA 1FRGL 1XH1A 4B96A 4JM2C 2VN7A 3L5XL 4ZAKB 3CLEH 1N64H 3KPRD 4FQ2H 4G6MH 4XP9L 3QIBD 4ZDHA 1FAIH 1Y07A 4JFEA 3KW8A 1T1WB 1JXDA 2QQLH 2HRLA 2V9TA 4OVUA 5I17A 2Z7WA 4AGOA 3B37A 2KS0A 1VFOA 1HHHA 4X42A 5IVNA 3A3YB 5AW9B 3TBSB 1BWWA 1HVXA 1TNNA 2Y1ZA 5GGUB 4JLRA 5I18H 3MBXH 3OR6A 1NINA 2ATPB 1UGKA 4IGBC 4Y4HD 3C5SA 2VMDA 2QTVA 3HHSB 4GI6A 4PWJA 5J06A 3F2LA 1RULL 3VCLA 4JDZB 5GSRB 3OJVC 4R4ND 2AJSH 1KN2H 4Q74A 5KWYC 1DLHA 4FYQA 1OAZL 3FF7A 1XIWA 1UFUA 1G9NH 3ZDXF 3DGDA 2OULB 1NGXB 1M1SA 1M57B 1IARB 4LHUD 3T1FA 1YYMH 1LP9A 4GXUM 1OP3K 3BVWA 1MY7A 5DHVB 5L4FA 3LNFA 2VR4A 3QHFL 4UNVA 4FXKB 5KUKA 3VRJB 4NPKA 1F1DA 4MB3A 4L4VE 5E8EB 1ZVSA 1MAML 5C09B 2V5IA 3VXSA 2HFGL 3S3CB 3T4AA 4RMRA 5CMAB 5JDJA 5DXWA 1DL7L 2Y7OA 4NRYA 3LZQA 5KANI 1SOXA 3TC9A 1CS6A 3C12A 1YPZB 5I6MA 1IKNC 4MMZA 4OZFB 3H42H 1UCBH 1KBBA 3E7JA 3MJ9A 4Y19E 3BJLA 1CTOA 3SGEH 4PY7B 1HWHB 3AWFA 5D1XD 5CCGE 4TUOB 2INVA 5ECGA 1SMDA 1A3QA 3N1FC 3FUDA 4TPRH 4WWID 1QLFB 2AITA 5CEXA 3X13A 4MLSA 4AQ8A 4JFFE 4EAEA 5BMFH 3LJYA 4LBAA 5DYOA 4RZCA 4KK9C 4BFJA 1X5FA 1RL1A 4QD2E 4JO2L 4N87A 4QRTB 1E5ZA 1FGNL 4HA1A 3VWKA 4H1LA 1PSKL 4JFSA 2OMXB 2VMJA 1IEBB 3JWNG 1OGTA 3O6FD 4AGMA 3FUIA 4CSPA 2WBXA 1HH6B 1XCXA 3PWVB 3S5ZA 3ZTNH 2NT1A 4ODUB 2BVPA 3D6GA 2LV4A 5FGCE 5IVZA 2FHCA 1P69B 2NT9A 4QRPD 1OK8A 2BCKB 2X1OA 4YSOA 3DMMC 4Y5YA 5IB4B 3K71A 1ANUA 1N59A 4KUZL 5AOLA 5T5NF 2UZXB 3RZWA 1Q0XH 3F7VA 3LXAA 1A6WH 2BDNL 3PWPA 4QT5B 3IDYC 2JCCF 1NUNB 3HS8A 2VKXA 3O6ML 4OGYL 4OUUA 4YFLF 1AH1A 2HG5A 1X6NA 5HGAB 1HL8A 1SUJA 3SGDH 4LZKA 3VXRE 1ZT1A 5AB2A 1KJ2L 2WLZA 1LO2L 3AY4A 3MRLB 5K69A 4ESKA 4GPVA 5H35B 1GKOA 1GW0A 2ARJQ 2GEEA 3KCPB 1B2YA 4L0ZA 5T8IA 3B7YA 5F1OB 1YUHB 3KNBA 3EG9A 3FONB 1FH5H 3L2NA 4OM1L 1F4WH 3PDGA 4P4KD 4I85A 3ZRCC 1U8PB 5CD3A 4U1GB 4NZUL 5LVEA 4HCFA 3I2CL 4YSDA 3F3HA 2X1XR 2XT4A 5INCB 4EDXB 2UX6A 2QV4A 1WFNA 1MCCA 4RQQB 2WLIB 2ZUQB 3V8OA 4ZMNA 5E4OA 2I32A 1R6VA 4NKDB 1OFEA 4FA8A 3OF6A 1UA7A 4APQC 4JM2D 3DUHA 4L3ED 4BDVB 3IGAB 5I1GH 1AGFA 2V17H 1IGYA 1Q1JL 2YFNA 3WKML 4PY8J 4JPVL 4G80A 1HCYA 2YD4A 1OAQH 1OAYH 2GITA 2EYTB 2BP0B 5E1QA 4QJ3B 5AVRB 3OG6B 1FFPA 1I53A 2G9HA 3K2MC 4AIZA 2J6EH 3BAJA 3DNKA 2YAEA 1K8IA 1OEZW 4EEEA 4D0CB 4HWEH 1K5CA 4M6OH 1M2OA 2VLJD 1QVOA 3DVFA 3NUKA 4UNUA 3V4VB 4HH9A 2JNZA 5IROA 4IGBD 5D2LE 1X9LA 3EYFA 4OLVH 3UC0H 4OSUL 3WHXB 3R4DA 5IGXL 5EIIG 3KVPA 1R33A 1G84A 1MRFH 4TUJA 1BREA 4GIOA 1U4FA 1VCBC 4I1RA 1BOGA 1JRHL 2UZPA 9CGTA 4NQCE 5GGRB 4YDIH 3E6FB 3CXDH 2OTWB 5A1AA 2VDQL 1KLFB 2XXCB 4V33A 4EUPA 3KDMB 2GTQA 1BD2B 1IEAB 2NX5A 2Z8WC 3TLRA 4C56E 1NQB