3VSZA

Crystal structure of ct1,3gal43a in complex with galactan
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
461
structure length
461
Chain Sequence
EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 131
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vszA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vszA01
1TP0A 5FK8A 2D22A 2Y9WC 4HR6C 5F8WA 3MPPG 1PT2A 3R4ZA 2Q9XA 1UV4A 4D47A 4NOVA 1K5VA 3MALA 2K43A 3FGMA 3UD9A 3BAOA 3UD7A 3N7KA 3ZXGA 1K5UA 3UJ4A 4IY8A 2AEYA 2VXTI 4D0ZA 3FFZA 2X8FA 3OM5A 3CRHA 3IM6A 3FJIA 1IJTA 3R67A 3OM7A 4GAFA 2D23A 5DSSB 5BXTA 4IQPA 3C2UA 2DRYA 2KKIA 3BA7A 5D62A 1UYPA 3JRRA 3BYNA 1F31A 4LO2A 5FMDA 31BIA 2F8XC 3AKHA 4PVAA 4LO2C 4KEKA 4LO8B 3I29B 3CRGA 1RMLA 5D63A 3OM2A 3AH4A 2X8TA 1CE7B 1DZDA 3CA0A 3WO2A 1W2TA 3C9ZA 4I1BA 3AH2A 3I2XA 1IHKA 3HSMA 3K1XA 1YIFA 2Z49A 4O8OA 5GLRA 1MD6A 1M16A 4P0JA 5JOYA 4OEGA 3FJCA 1Q03A 1ISYA 2WBCA 3CQAA 3H6QA 1S0DA 1XG6A 2XQRA 2I1BA 3FUQA 1IT0A 4II0A 3WMVA 1XZZA 5FMBA 1SR4A 4KCBA 3BYKA 2D43A 3NBCA 5FZUA 4ZA3B 2X2TA 3OBRA 4ZLBB 3IM7A 4AK7A 3F1RA 2GZBA 2AFGA 2K4AB 4G9NA 2Y9FA 2BEBA 2DRZA 5GLKA 2BEAA 3OBTA 2YFRA 1G9BA 3KMVA 5JMCA 3WO3A 3VUOA 4J2YA 4Z8SB 3D60A 3ZC8A 4AK5A 2P39A 1G9CA 1S0CA 5BP5C 1S0LA 3KF5A 2IWTB 4X39A 2EXJA 3A22A 3QEFA 3Q7XA 4I4XA 3FJBA 3BAHA 3U75A 1Y4WA 3FJ8A 3CA3A 1FWVA 3AKGA 4EFPA 4LO0A 3CA1A 2ADDA 4XFTA 4A7KA 3FJJA 2WRYA 3QC2A 5AY9A 3AJ6A 4OEEA 3V79C 2VSAA 4I0YA 3BAVA 1D0HA 4LO7B 4I2SA 1Z0HA 3F62B 1HWMB 1HWPB 2AXMA 4JQ0A 4AN6A 2XOAA 1YRZA 3WN1A 2KI6B 2R9KB 2KH2A 4QC4A 4QO3A 1XHBA 1AVXB 4XFUA 2QQUA 3LEMA 3I2AA 4XFSA 5FZYA 2K8RA 1HKNA 1FWUA 1JY0A 4R6UB 4U6DA 4COTA 5BXPA 2HWAA 1G9AA 2HWMA 4DENA 4DEPA 1GGPB 1ISVA 1V6VA 3HOMA 3IAGC 5JLVA 4EFQA 2QN4A 4OWLA 3BADA 3LTQA 3N7LA 1JQZA 2VSEA 1OQLB 2VLCA 1PUMB 4LO3C 4ZOTA 1GYDB 3QEDA 2RSTA 1E0OA 4LO1A 3H6RA 2HZ9A 3VSRA 4TLPA 1YI7A 5A7VA 1UPSA 3BTAA 5GAQA 3IIRA 4GP0A 1JT4A 1WBCA 5FZZA 1W3GA 3VT1A 2ESUA 4N4BA 4KMIA 1PWAA 1FMMS 2VU9A 2NZ9A 3AZVA 1W3FA 3BAUA 2AC1A 2ZQNA 1II4A 3OM4A 3BYJA 2QYIB 3TC2A 1FMZA 4P0KA 41BIA 4USPA 3Q7YA 1AVAC 3VT2A 1BLDA 4IZXA 1JT3A 1T9FA 4JRAA 4MLGA 1RZOB 5B6TA 3HN1A 5JOWA 3AKFA 4O8PA 3TAWA 3H6RB 3LFIA 3B9UA 3A07A 3AH1A 4I4VA 4OWJA 3C7EA 4X3AA 3CU1B 1JT7A 2ERMA 4I4SA 5B2HA 2QQVA 3P2NA 4KC8A 3WMUA 3D61A 4N1IA 1ISZA 5DVHA 4ZFYB 3R4YA 3OGGA 1Q1UA 4UDIA 1PC8B 4L4IA 1TWMA 1HWOB 4J23B 1VKDA 3O4CA 4KBBA 4QD2C 4F83A 9ILBA 3BYLA 1TOOA 1AXMA 1GYEB 3CA6A 2ET2A 2NVHA 2NP0A 3OGFA 4QALA 1TTUA 1S0EA 3LV4A 3LIGA 2NTDA 4XKIA 2YFTA 1AF9A 4AN7B 4FFIA 5BXRA 3FJFA 4J2XA 5GLLA 4H04A 3VEQA 2J3PA 4OEFA 4U6BA 3O4OA 3UGHA 1DIWA 3FJAA 1V6XA 3BRFA 1R8NA 4ZFUB 3V0AA 3ZXKA 4QBCA 4L4HA 3LIHA 3UGFA 1FGAA 2YUGA 1FV2A 5I1BA 3JUTA 1TIEA 4I4QA 3P6IA 1DFQA 1WBAA 3VWCA 4F34A 3WO4A 2BFHA 2D1ZA 4X38A 2VXRA 3NBNA 4H9WA 3HMYA 5BP5A 3OM6A 4KC7A 2IHOA 3ILAA 5F8YA 1IRPA 2F2FA 2GO2A 3D5ZA 3E8LC 2Y9GA 1IOBA 2F2FC 3SNVA 5FKBA 1PZZA 4I4OA 3UD8A 4IZEA 4D8HA 1ISXA 3QR5A 1WD4A 3O4AA 2EXIA 3U14A 4Q91A 2E4MA 3SC7X 4JP0A 2X2SA 4KEJA 2VUAA 2E4MC 5EC5A 1JT5A 5ANNA 3C7GA 3BRGC 3NJ5A 4HA2A 2B4WA 2D7IA 3FUOA 3WA1A 4HJJA 1R8OA 4FFFA 6I1BA 3N0KA 3FJKA 2FDBM 5GLMA 5DZUA 3RMXA 1DZCA 1BFBA 3FJDA 1DQOA 4KC3A 3OJ2A 3WASA 1Y7BA 5C0PA 7I1BA 3OJVA 4FVVA 4I4RA 1OYGA 2P23A 2Z48A 3O49A 4OWKA 4EFRA 3QEEA 3R4SA 3WN0A 4FGFA 3AJ5A 1Z4SA 2AQZA 4ZFWB 2D20A 3O4DA 4J2KA 4LO3A 1Q04A 3W9TA 2M49A 2LIEA 2NM1A 3LLPA 4WBCA 3PIJA 4I6IA 1S0GA 2MLLB 8I1BA 3RTJB 4JKQA 1T4QA 3BX1C 3RSJA 2QQWA 3C7OA 1FQ9A 4I1EA 5FIXA 1I1EA 3BB2A 5BQUC 1S0FA 3P6JA 2EXKA 4GOYA 3A23A 5FNWA 5A8DA 3HBWA 2NYYA 4A7YA 3KSTA 4Q9GA 4EQVA 3S8JA 3CAHA 5JOXA 5E24E 4QKSA 5GLNA 5EHAA 1YF8B 3VT0A 4N2ZA 2MIBA 5A7VB 3PG0A 4ZKTB 3BA5A 1BFGA 4UDKA 4KCAA 1V6WA 4EEEB 3O5WB 3LDRA 1AVUA 4P0LA 2RQ9A 1A8DA 1HWNB 1N4KA 3Q7WA 1IILA 2FFVA 2AAIB 3WMZA 4UDKE 1J0SA 3O4BA 4Z9WB 5HPZA 4ONZA 2LIQA 3VSFA 4OUJA 4DCKC 1JLXA 1ILR1 1IRAX 3C7FA 5B6SA 4PVIA 2DS0A 4Q9PA 3BA4A 1DJSB 3RTIB 4UDGA 3KF3A 1ITBA 3WINA 1BLAA 1ONKB 3O3QA 3WINC 1CVSA 4I37A 2EXHA 1HIBA 3POKA 4ZBVB 1W18A 3ZX7A 1BFFA 5GLQA 3FJHA 3HALA 4OW4A 1QQKA 5GLOA 1YTOA 4I4PA 2FFUA 1SZ6B 1DFCA 3WAUA 3PUBA 1NUNA 3P53A 1G82A 3PMEA 2ZQOA 1YBIA 4QD2B 4ZGRB 1EV2A 5AYDA 4X37A 4EB2B 2D44A 3RMYA 4FFGA 5FMCA 2D24A 3CU9A 1TWEA 3NBDA 1RG8A 3WPZA 1YYNA 4IY9A 4GOVA 1QQLA 1EYLA 5D61A 2UUSA 1NZKA 4J2SA 4PC4A 3UJ0A 5G00A 3ZC9A 5FK7A 1QXMA 3K1UA 3AZWA 1I1BA 4EKXB 1Y9MA 1SR4C 4IYBA 5BVPI 2OXBA 3D7WB 4QBVA 4YOLA 5F8SA 5EG6C 4P6AA 3NQHA 3ZXLA 5A8CA 1KNMA 1JLYA 3A21A 3QYDA 3O44A 3EF2A 4GAIA 1YXWA 3V0AB 1JTCA 5FKCA 3R4UA 3FJ9A 4G6MA 3WMYA 3CA5A 3V0BA 4LO7C 1GYHA 1WL7A 2FGFA 3C7HA 2Y9XE 3CA4A 3ZXDA 5GLPA 3QZ4A 1BFCA 4ISQA 4UDJA 4JKXB 4G1RA 3ZXJA 1BARA 3OJMA 1M2TB 4IHZA 5JOZA 3IM5A 3NBEA 4A7ZA 5AYEA 1G9DA 1WD3A 1V6UA 4I3NA 3AKIA 2FO1A 2MC2A 3UDAA 5AYCA 1HCEA 5DUYA 1P63A 3LDKA 3RWKX 1HCDA 1AFCA 1BASA 21BIA 3N7JA 3FJEA 2L5XA 3BAGA 3D5YA 4LO0C 1BA7A 2Q3NB 2HW9A 2VDTA 4CJMA 4D0TA 1MC9A 4I4YA 3V0BB 3LF7A 1FN0A 4QKRA 4USOA 1Z2VA 4N2RA 3WN2A 1DQGA 3T8SA 1EPWA 2DREA 1L2HA 4ISRA 5FNXA 2X8SA 4G6JA 2ZR1B 3VSZA 1ST8A 2KLLA 1ISWA 1DLLA 3PHZA 2RG9B 4G9MA 5BQUA 1W3AA 4I7IA 1S0BA 3WPYA 4JAWA 3UGGA 3VSSA 1Y9GA 1XYFA 2ADEA 4FFHA 2D7RA 3BRDA 5F90A 4I96A 4QQSA 3WPVA 3H6SE 2AEZA 4LO1C 1AVWB 3CRIA 4KEIA 3WPUA 4O8NA 2KI4A 1VCLA 1FV3A 3PIGA 1PUUB 5FLWA 4I4UA 4AK6A 4ENDA 1EVTA 3WATA 4JPZA 5BXSA 2YFSA 4I8MA 5BOWA 3S8KA 1RY7A 1ABRB 4GP3A 4IONA 3BAQA 3N7MA 1TFMB
chains in the Genus database with same CATH superfamily
1TP0A 5FK8A 2D22A 2Y9WC 4HR6C 5F8WA 3MPPG 1PT2A 3R4ZA 2Q9XA 1UV4A 4D47A 4NOVA 1K5VA 3MALA 2K43A 3FGMA 3UD9A 3BAOA 3UD7A 3N7KA 3ZXGA 1K5UA 3UJ4A 4IY8A 2AEYA 2VXTI 4D0ZA 3FFZA 2X8FA 3OM5A 3CRHA 3IM6A 3FJIA 1IJTA 3R67A 3OM7A 4GAFA 2D23A 5DSSB 5BXTA 4IQPA 3C2UA 2DRYA 2KKIA 3BA7A 5D62A 1UYPA 3JRRA 3BYNA 1F31A 4LO2A 5FMDA 31BIA 2F8XC 3AKHA 4PVAA 4LO2C 4KEKA 4LO8B 3I29B 3CRGA 1RMLA 5D63A 3OM2A 3AH4A 2X8TA 1CE7B 1DZDA 4MZGB 3CA0A 3WO2A 1W2TA 3C9ZA 4I1BA 3AH2A 3I2XA 1IHKA 3HSMA 3K1XA 1YIFA 2Z49A 4O8OA 5GLRA 1MD6A 1M16A 4P0JA 5JOYA 4OEGA 3FJCA 1Q03A 1ISYA 2WBCA 3CQAA 3H6QA 1S0DA 1XG6A 2XQRA 2I1BA 3FUQA 1IT0A 4II0A 3WMVA 1XZZA 5FMBA 1SR4A 4KCBA 3BYKA 2D43A 3NBCA 5FZUA 4ZA3B 2X2TA 3OBRA 4ZLBB 3IM7A 4AK7A 3F1RA 2GZBA 2AFGA 2K4AB 4G9NA 2Y9FA 2BEBA 2DRZA 5GLKA 2BEAA 3OBTA 2YFRA 1G9BA 3KMVA 5JMCA 3WO3A 3VUOA 4J2YA 4Z8SB 3D60A 3ZC8A 4AK5A 2P39A 1G9CA 1S0CA 5BP5C 1S0LA 3KF5A 2IWTB 4X39A 2EXJA 3A22A 3QEFA 3Q7XA 4I4XA 3FJBA 3BAHA 3U75A 1Y4WA 3FJ8A 3CA3A 4UY4A 1FWVA 3AKGA 4EFPA 4LO0A 3CA1A 2ADDA 4XFTA 4A7KA 3FJJA 2WRYA 3QC2A 5AY9A 3AJ6A 4OEEA 3V79C 2VSAA 4I0YA 3BAVA 1D0HA 4LO7B 4I2SA 1Z0HA 3F62B 1HWMB 1HWPB 2AXMA 4JQ0A 4AN6A 2XOAA 1YRZA 3WN1A 2KI6B 2R9KB 2KH2A 4QC4A 4QO3A 1XHBA 1AVXB 4XFUA 2QQUA 3LEMA 3I2AA 4XFSA 5FZYA 2K8RA 1HKNA 1FWUA 1JY0A 4R6UB 4U6DA 4COTA 5BXPA 2HWAA 1G9AA 2HWMA 4DENA 4DEPA 1GGPB 1ISVA 1V6VA 3HOMA 3IAGC 5JLVA 4EFQA 2QN4A 4OWLA 3BADA 3LTQA 3N7LA 1JQZA 2VSEA 1OQLB 2VLCA 1PUMB 4LO3C 4ZOTA 1GYDB 3QEDA 2RSTA 1E0OA 4LO1A 3H6RA 2HZ9A 3VSRA 4TLPA 1YI7A 5A7VA 1UPSA 3BTAA 5GAQA 3IIRA 4GP0A 1JT4A 1WBCA 5FZZA 1W3GA 3VT1A 2ESUA 4N4BA 4KMIA 1PWAA 1FMMS 2VU9A 2NZ9A 3AZVA 1W3FA 3BAUA 1TL2A 2AC1A 2ZQNA 1II4A 3OM4A 3BYJA 2QYIB 3TC2A 1FMZA 4P0KA 41BIA 4USPA 3Q7YA 1AVAC 3VT2A 1BLDA 4IZXA 1JT3A 1T9FA 4JRAA 4MLGA 1RZOB 5B6TA 3HN1A 5JOWA 3AKFA 4O8PA 3TAWA 3H6RB 3LFIA 3B9UA 3A07A 3AH1A 4I4VA 4OWJA 3C7EA 4X3AA 3CU1B 1JT7A 2ERMA 4I4SA 5B2HA 2QQVA 3P2NA 4KC8A 3WMUA 3D61A 4N1IA 1ISZA 5DVHA 4ZFYB 3R4YA 3OGGA 1Q1UA 4UDIA 1PC8B 4L4IA 1TWMA 1HWOB 4J23B 1VKDA 3O4CA 4KBBA 4QD2C 4F83A 9ILBA 3BYLA 1TOOA 1AXMA 1GYEB 3CA6A 2ET2A 2NVHA 2NP0A 3OGFA 4QALA 1TTUA 1S0EA 3LV4A 3LIGA 2NTDA 4XKIA 2YFTA 1AF9A 4AN7B 4FFIA 5BXRA 3FJFA 4J2XA 5GLLA 4H04A 3VEQA 2J3PA 4OEFA 4U6BA 3O4OA 3UGHA 1DIWA 3FJAA 1V6XA 4MZFB 3BRFA 1R8NA 4ZFUB 3V0AA 3ZXKA 4QBCA 4L4HA 3LIHA 3UGFA 1FGAA 2YUGA 1FV2A 5I1BA 3JUTA 1TIEA 4I4QA 3P6IA 1DFQA 1WBAA 3VWCA 4F34A 3WO4A 2BFHA 2D1ZA 4X38A 2VXRA 3NBNA 4H9WA 3HMYA 5BP5A 3OM6A 4KC7A 2IHOA 3ILAA 5F8YA 1IRPA 2F2FA 2GO2A 3D5ZA 3E8LC 2Y9GA 1IOBA 2F2FC 3SNVA 5FKBA 1PZZA 4I4OA 3UD8A 4IZEA 4D8HA 1ISXA 3QR5A 1WD4A 3O4AA 2EXIA 3U14A 4Q91A 2E4MA 3SC7X 4JP0A 2X2SA 4KEJA 2VUAA 2E4MC 5EC5A 1JT5A 5ANNA 3C7GA 3BRGC 3NJ5A 4HA2A 2B4WA 2D7IA 3FUOA 3WA1A 4HJJA 1R8OA 4FFFA 6I1BA 3N0KA 3FJKA 2FDBM 5GLMA 5DZUA 3RMXA 1DZCA 1BFBA 3FJDA 1DQOA 4KC3A 3OJ2A 3WASA 1Y7BA 5C0PA 7I1BA 3OJVA 4FVVA 4I4RA 1OYGA 2P23A 2Z48A 3O49A 4OWKA 4H75A 4EFRA 3QEEA 3R4SA 3WN0A 4FGFA 3AJ5A 1Z4SA 2AQZA 4ZFWB 2D20A 3O4DA 4J2KA 4LO3A 1Q04A 3W9TA 2M49A 2LIEA 2NM1A 3LLPA 4WBCA 3PIJA 4I6IA 1S0GA 2MLLB 8I1BA 3RTJB 4JKQA 1T4QA 3BX1C 3RSJA 2QQWA 3C7OA 1FQ9A 4I1EA 5FIXA 1I1EA 3BB2A 5BQUC 1S0FA 3P6JA 2EXKA 4GOYA 3A23A 4MZHA 5FNWA 5A8DA 3HBWA 2NYYA 4A7YA 3KSTA 4Q9GA 4EQVA 3S8JA 3CAHA 5JOXA 5E24E 4QKSA 5GLNA 5EHAA 1YF8B 3VT0A 4N2ZA 2MIBA 5A7VB 3PG0A 4ZKTB 3BA5A 1BFGA 4UDKA 4KCAA 1V6WA 4EEEB 3O5WB 3LDRA 1AVUA 4P0LA 2RQ9A 1A8DA 1HWNB 1N4KA 3Q7WA 1IILA 2FFVA 2AAIB 3WMZA 4UDKE 1J0SA 3O4BA 4Z9WB 5HPZA 4ONZA 2LIQA 3VSFA 4OUJA 4DCKC 1JLXA 1ILR1 1IRAX 3C7FA 5B6SA 4PVIA 2DS0A 4Q9PA 3BA4A 1DJSB 3RTIB 4UDGA 3KF3A 1ITBA 3WINA 1BLAA 1ONKB 3O3QA 3WINC 1CVSA 4I37A 2EXHA 1HIBA 3POKA 4ZBVB 1W18A 3ZX7A 1BFFA 5GLQA 3FJHA 3HALA 4OW4A 1QQKA 5GLOA 1YTOA 4I4PA 2FFUA 1SZ6B 1DFCA 3WAUA 3PUBA 1NUNA 3P53A 1G82A 3PMEA 2ZQOA 1YBIA 4QD2B 4ZGRB 1EV2A 5AYDA 4X37A 4EB2B 2D44A 3RMYA 4FFGA 5FMCA 2D24A 3CU9A 1TWEA 3NBDA 1RG8A 3WPZA 1YYNA 4IY9A 4GOVA 1QQLA 1EYLA 5D61A 2UUSA 1NZKA 4J2SA 4PC4A 3UJ0A 5G00A 3ZC9A 5FK7A 1QXMA 3K1UA 3AZWA 1I1BA 4EKXB 2NS2A 1Y9MA 1SR4C 4IYBA 5BVPI 2OXBA 3D7WB 4QBVA 4YOLA 5F8SA 5EG6C 4P6AA 3NQHA 3ZXLA 5A8CA 1KNMA 1JLYA 3A21A 3QYDA 3O44A 3EF2A 4GAIA 1YXWA 3V0AB 5C2MA 1JTCA 5FKCA 3R4UA 3FJ9A 4G6MA 3WMYA 3CA5A 3V0BA 4LO7C 1GYHA 1WL7A 2FGFA 3C7HA 2Y9XE 3CA4A 3ZXDA 5GLPA 3QZ4A 1BFCA 4ISQA 4UDJA 4JKXB 4G1RA 3ZXJA 1BARA 3OJMA 1M2TB 4IHZA 5JOZA 3IM5A 3NBEA 4A7ZA 5AYEA 1G9DA 1WD3A 1V6UA 4I3NA 3AKIA 2FO1A 2MC2A 3UDAA 5AYCA 1HCEA 5DUYA 1P63A 3LDKA 3RWKX 1HCDA 1AFCA 1BASA 21BIA 3N7JA 3FJEA 2L5XA 3BAGA 3D5YA 4LO0C 1BA7A 2Q3NB 2HW9A 2VDTA 4CJMA 4D0TA 1MC9A 4I4YA 3V0BB 3LF7A 1FN0A 4QKRA 4USOA 1Z2VA 4N2RA 3WN2A 1DQGA 3T8SA 1EPWA 2DREA 1L2HA 4ISRA 5FNXA 2X8SA 4G6JA 2ZR1B 3VSZA 1ST8A 2KLLA 1ISWA 1DLLA 3PHZA 2RG9B 4G9MA 5BQUA 1W3AA 4I7IA 1S0BA 3WPYA 4JAWA 3UGGA 3VSSA 1Y9GA 1XYFA 2ADEA 4FFHA 2D7RA 3BRDA 5F90A 4I96A 4QQSA 3WPVA 3H6SE 2AEZA 4LO1C 1AVWB 3CRIA 4KEIA 3WPUA 4O8NA 2KI4A 1VCLA 1FV3A 3PIGA 1PUUB 5FLWA 4I4UA 4AK6A 4ENDA 1EVTA 3WATA 4JPZA 5BXSA 2YFSA 4I8MA 5BOWA 3S8KA 1RY7A 1ABRB 4GP3A 4IONA 3BAQA 3N7MA 1TFMB
chains in the Genus database with same CATH topology
1TP0A 5FK8A 2D22A 2Y9WC 4HR6C 5F8WA 3MPPG 1PT2A 3R4ZA 2Q9XA 1UV4A 4D47A 4NOVA 1K5VA 3MALA 2K43A 3FGMA 3UD9A 3BAOA 3UD7A 3N7KA 3ZXGA 1K5UA 3UJ4A 4IY8A 2AEYA 2VXTI 4D0ZA 3FFZA 2X8FA 3OM5A 3CRHA 3IM6A 3FJIA 1IJTA 3R67A 3OM7A 4GAFA 2D23A 5DSSB 5BXTA 4IQPA 3C2UA 2DRYA 2KKIA 3BA7A 5D62A 1UYPA 3JRRA 3BYNA 1F31A 4LO2A 5FMDA 31BIA 2F8XC 3AKHA 4PVAA 4LO2C 4KEKA 4LO8B 3I29B 3CRGA 1RMLA 5D63A 3OM2A 3AH4A 2X8TA 1CE7B 1DZDA 4MZGB 3CA0A 3WO2A 1W2TA 3C9ZA 4I1BA 3AH2A 3I2XA 1IHKA 3HSMA 3K1XA 1YIFA 2Z49A 4O8OA 5GLRA 1MD6A 1M16A 4P0JA 5JOYA 4OEGA 3FJCA 1Q03A 1ISYA 2WBCA 3CQAA 3H6QA 1S0DA 1XG6A 2XQRA 2I1BA 3FUQA 1IT0A 4II0A 3WMVA 1XZZA 5FMBA 1SR4A 4KCBA 3BYKA 2D43A 3NBCA 5FZUA 4ZA3B 2X2TA 3OBRA 4ZLBB 3IM7A 4AK7A 3F1RA 2GZBA 2AFGA 2K4AB 4G9NA 2Y9FA 2BEBA 2DRZA 5GLKA 2BEAA 3OBTA 2YFRA 1G9BA 3KMVA 5JMCA 3WO3A 3VUOA 4J2YA 4Z8SB 3D60A 3ZC8A 4AK5A 2P39A 1G9CA 1S0CA 5BP5C 1S0LA 3KF5A 2IWTB 4X39A 2EXJA 3A22A 3QEFA 3Q7XA 4I4XA 3FJBA 3BAHA 3U75A 1Y4WA 3FJ8A 3CA3A 4UY4A 1FWVA 3AKGA 4EFPA 4LO0A 3CA1A 2ADDA 4XFTA 4A7KA 3FJJA 2WRYA 3QC2A 5AY9A 3AJ6A 4OEEA 3V79C 2VSAA 4I0YA 3BAVA 1D0HA 4LO7B 4I2SA 1Z0HA 3F62B 1HWMB 1HWPB 2AXMA 4JQ0A 4AN6A 2XOAA 1YRZA 3WN1A 2KI6B 2R9KB 2KH2A 4QC4A 4QO3A 1XHBA 1AVXB 4XFUA 2QQUA 3LEMA 3I2AA 4XFSA 5FZYA 2K8RA 1HKNA 1FWUA 1JY0A 4R6UB 4U6DA 4COTA 5BXPA 2HWAA 1G9AA 2HWMA 4DENA 4DEPA 1GGPB 1ISVA 1V6VA 3HOMA 3IAGC 5JLVA 4EFQA 2QN4A 4OWLA 3BADA 3LTQA 3N7LA 1JQZA 2VSEA 1OQLB 2VLCA 1PUMB 4LO3C 4ZOTA 1GYDB 3QEDA 2RSTA 1E0OA 4LO1A 3H6RA 2HZ9A 3VSRA 4TLPA 1YI7A 5A7VA 1UPSA 3BTAA 5GAQA 3IIRA 4GP0A 1JT4A 1WBCA 5FZZA 1W3GA 3VT1A 2ESUA 4N4BA 4KMIA 1PWAA 1FMMS 2VU9A 2NZ9A 3AZVA 1W3FA 3BAUA 2AC1A 2ZQNA 1II4A 3OM4A 3BYJA 2QYIB 3TC2A 1FMZA 4P0KA 41BIA 4USPA 3Q7YA 1AVAC 3VT2A 1BLDA 4IZXA 1JT3A 1T9FA 4JRAA 4MLGA 1RZOB 5B6TA 3HN1A 5JOWA 3AKFA 4O8PA 3TAWA 3H6RB 3LFIA 3B9UA 3A07A 3AH1A 4I4VA 4OWJA 3C7EA 4X3AA 3CU1B 1JT7A 2ERMA 4I4SA 5B2HA 2QQVA 3P2NA 4KC8A 3WMUA 3D61A 4N1IA 1ISZA 5DVHA 4ZFYB 3R4YA 3OGGA 1Q1UA 4UDIA 1PC8B 4L4IA 1TWMA 1HWOB 4J23B 1VKDA 3O4CA 4KBBA 4QD2C 4F83A 9ILBA 3BYLA 1TOOA 1AXMA 1GYEB 3CA6A 2ET2A 2NVHA 2NP0A 3OGFA 4QALA 1TTUA 1S0EA 3LV4A 3LIGA 2NTDA 4XKIA 2YFTA 1AF9A 4AN7B 4FFIA 5BXRA 3FJFA 4J2XA 5GLLA 4H04A 3VEQA 2J3PA 4OEFA 4U6BA 3O4OA 3UGHA 1DIWA 3FJAA 1V6XA 4MZFB 3BRFA 1R8NA 4ZFUB 3V0AA 3ZXKA 4QBCA 4L4HA 3LIHA 3UGFA 1FGAA 2YUGA 1FV2A 5I1BA 3JUTA 1TIEA 4I4QA 3P6IA 1DFQA 1WBAA 3VWCA 4F34A 3WO4A 2BFHA 2D1ZA 4X38A 2VXRA 3NBNA 4H9WA 3HMYA 5BP5A 3OM6A 4KC7A 2IHOA 3ILAA 5F8YA 1IRPA 2F2FA 2GO2A 3D5ZA 3E8LC 2Y9GA 1IOBA 2F2FC 3SNVA 5FKBA 1PZZA 4I4OA 3UD8A 4IZEA 4D8HA 1ISXA 3QR5A 1WD4A 3O4AA 2EXIA 3U14A 4Q91A 2E4MA 3SC7X 4JP0A 2X2SA 4KEJA 2VUAA 2E4MC 5EC5A 1JT5A 5ANNA 3C7GA 3BRGC 3NJ5A 4HA2A 2B4WA 2D7IA 3FUOA 3WA1A 4HJJA 1R8OA 4FFFA 6I1BA 3N0KA 3FJKA 2FDBM 5GLMA 5DZUA 3RMXA 1DZCA 1BFBA 3FJDA 1DQOA 4KC3A 3OJ2A 3WASA 1Y7BA 5C0PA 7I1BA 3OJVA 4FVVA 4I4RA 1OYGA 2P23A 2Z48A 3O49A 4OWKA 4H75A 4EFRA 3QEEA 3R4SA 3WN0A 4FGFA 3AJ5A 1Z4SA 2AQZA 4ZFWB 2D20A 3O4DA 4J2KA 4LO3A 1Q04A 3W9TA 2M49A 2LIEA 2NM1A 3LLPA 4WBCA 3PIJA 4I6IA 1S0GA 2MLLB 8I1BA 3RTJB 4JKQA 1T4QA 3BX1C 3RSJA 2QQWA 3C7OA 1FQ9A 4I1EA 5FIXA 1I1EA 3BB2A 5BQUC 1S0FA 3P6JA 2EXKA 4GOYA 3A23A 4MZHA 5FNWA 5A8DA 3HBWA 2NYYA 4A7YA 3KSTA 4Q9GA 4EQVA 3S8JA 3CAHA 5JOXA 5E24E 4QKSA 5GLNA 5EHAA 1YF8B 3VT0A 4N2ZA 2MIBA 5A7VB 3PG0A 4ZKTB 3BA5A 1BFGA 4UDKA 4KCAA 1V6WA 4EEEB 3O5WB 3LDRA 1AVUA 4P0LA 2RQ9A 1A8DA 1HWNB 1N4KA 3Q7WA 1IILA 2FFVA 2AAIB 3WMZA 4UDKE 1J0SA 3O4BA 4Z9WB 5HPZA 4ONZA 2LIQA 3VSFA 4OUJA 4DCKC 1JLXA 1ILR1 1IRAX 3C7FA 5B6SA 4PVIA 2DS0A 4Q9PA 3BA4A 1DJSB 3RTIB 4UDGA 3KF3A 1ITBA 3WINA 1BLAA 1ONKB 3O3QA 3WINC 1CVSA 4I37A 2EXHA 1HIBA 3POKA 4ZBVB 1W18A 3ZX7A 1BFFA 5GLQA 3FJHA 3HALA 4OW4A 1QQKA 5GLOA 1YTOA 4I4PA 2FFUA 1SZ6B 1DFCA 3WAUA 3PUBA 1NUNA 3P53A 1G82A 3PMEA 2ZQOA 1YBIA 4QD2B 4ZGRB 1EV2A 5AYDA 4X37A 4EB2B 2D44A 3RMYA 4FFGA 5FMCA 2D24A 3CU9A 1TWEA 3NBDA 1RG8A 3WPZA 1YYNA 4IY9A 4GOVA 1QQLA 1EYLA 5D61A 2UUSA 1NZKA 4J2SA 4PC4A 3UJ0A 5G00A 3ZC9A 5FK7A 1QXMA 3K1UA 3AZWA 1I1BA 4EKXB 2NS2A 1Y9MA 1SR4C 4IYBA 5BVPI 2OXBA 3D7WB 4QBVA 4YOLA 5F8SA 5EG6C 4P6AA 3NQHA 3ZXLA 5A8CA 1KNMA 1JLYA 3A21A 3QYDA 3O44A 3EF2A 4GAIA 1YXWA 3V0AB 1JTCA 5FKCA 3R4UA 3FJ9A 4G6MA 3WMYA 3CA5A 3V0BA 4LO7C 1GYHA 1WL7A 2FGFA 3C7HA 2Y9XE 3CA4A 3ZXDA 5GLPA 3QZ4A 1BFCA 4ISQA 4UDJA 4JKXB 4G1RA 3ZXJA 1BARA 3OJMA 1M2TB 4IHZA 5JOZA 3IM5A 3NBEA 4A7ZA 5AYEA 1G9DA 1WD3A 1V6UA 4I3NA 3AKIA 2FO1A 2MC2A 3UDAA 5AYCA 1HCEA 5DUYA 1P63A 3LDKA 3RWKX 1HCDA 1AFCA 1BASA 21BIA 3N7JA 3FJEA 2L5XA 3BAGA 3D5YA 4LO0C 1BA7A 2Q3NB 2HW9A 2VDTA 4CJMA 4D0TA 1MC9A 4I4YA 3V0BB 3LF7A 1FN0A 4QKRA 4USOA 1Z2VA 4N2RA 3WN2A 1DQGA 3T8SA 1EPWA 2DREA 1L2HA 4ISRA 5FNXA 2X8SA 4G6JA 2ZR1B 3VSZA 1ST8A 2KLLA 1ISWA 1DLLA 3PHZA 2RG9B 4G9MA 5BQUA 1W3AA 4I7IA 1S0BA 3WPYA 4JAWA 3UGGA 3VSSA 1Y9GA 1XYFA 2ADEA 4FFHA 2D7RA 3BRDA 5F90A 4I96A 4QQSA 3WPVA 3H6SE 2AEZA 4LO1C 1AVWB 3CRIA 4KEIA 3WPUA 4O8NA 2KI4A 1VCLA 1FV3A 3PIGA 1PUUB 5FLWA 4I4UA 4AK6A 4ENDA 1EVTA 3WATA 4JPZA 5BXSA 2YFSA 4I8MA 5BOWA 3S8KA 1RY7A 1ABRB 4GP3A 4IONA 3BAQA 3N7MA 1TFMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TP0 A;  5FK8 A;  2D22 A;  2Y9W C;  4HR6 C;  5F8W A;  3MPP G;  1PT2 A;  3R4Z A;  2Q9X A;  1UV4 A;  4D47 A;  4NOV A;  1K5V A;  3MAL A;  2K43 A;  3FGM A;  3UD9 A;  3BAO A;  3UD7 A;  3N7K A;  3ZXG A;  1K5U A;  3UJ4 A;  4IY8 A;  2AEY A;  2VXT I;  4D0Z A;  3FFZ A;  2X8F A;  3OM5 A;  3CRH A;  3IM6 A;  3FJI A;  1IJT A;  3R67 A;  3OM7 A;  4GAF A;  2D23 A;  5DSS B;  5BXT A;  4IQP A;  3C2U A;  2DRY A;  2KKI A;  3BA7 A;  5D62 A;  1UYP A;  3JRR A;  3BYN A;  1F31 A;  4LO2 A;  5FMD A;  31BI A;  2F8X C;  3AKH A;  4PVA A;  4LO2 C;  4KEK A;  4LO8 B;  3I29 B;  3CRG A;  1RML A;  5D63 A;  3OM2 A;  3AH4 A;  2X8T A;  1CE7 B;  1DZD A;  3CA0 A;  3WO2 A;  1W2T A;  3C9Z A;  4I1B A;  3AH2 A;  3I2X A;  1IHK A;  3HSM A;  3K1X A;  1YIF A;  2Z49 A;  4O8O A;  5GLR A;  1MD6 A;  1M16 A;  4P0J A;  5JOY A;  4OEG A;  3FJC A;  1Q03 A;  1ISY A;  2WBC A;  3CQA A;  3H6Q A;  1S0D A;  1XG6 A;  2XQR A;  2I1B A;  3FUQ A;  1IT0 A;  4II0 A;  3WMV A;  1XZZ A;  5FMB A;  1SR4 A;  4KCB A;  3BYK A;  2D43 A;  3NBC A;  5FZU A;  4ZA3 B;  2X2T A;  3OBR A;  4ZLB B;  3IM7 A;  4AK7 A;  3F1R A;  2GZB A;  2AFG A;  2K4A B;  4G9N A;  2Y9F A;  2BEB A;  2DRZ A;  5GLK A;  2BEA A;  3OBT A;  2YFR A;  1G9B A;  3KMV A;  5JMC A;  3WO3 A;  3VUO A;  4J2Y A;  4Z8S B;  3D60 A;  3ZC8 A;  4AK5 A;  2P39 A;  1G9C A;  1S0C A;  5BP5 C;  1S0L A;  3KF5 A;  2IWT B;  4X39 A;  2EXJ A;  3A22 A;  3QEF A;  3Q7X A;  4I4X A;  3FJB A;  3BAH A;  3U75 A;  1Y4W A;  3FJ8 A;  3CA3 A;  1FWV A;  3AKG A;  4EFP A;  4LO0 A;  3CA1 A;  2ADD A;  4XFT A;  4A7K A;  3FJJ A;  2WRY A;  3QC2 A;  5AY9 A;  3AJ6 A;  4OEE A;  3V79 C;  2VSA A;  4I0Y A;  3BAV A;  1D0H A;  4LO7 B;  4I2S A;  1Z0H A;  3F62 B;  1HWM B;  1HWP B;  2AXM A;  4JQ0 A;  4AN6 A;  2XOA A;  1YRZ A;  3WN1 A;  2KI6 B;  2R9K B;  2KH2 A;  4QC4 A;  4QO3 A;  1XHB A;  1AVX B;  4XFU A;  2QQU A;  3LEM A;  3I2A A;  4XFS A;  5FZY A;  2K8R A;  1HKN A;  1FWU A;  1JY0 A;  4R6U B;  4U6D A;  4COT A;  5BXP A;  2HWA A;  1G9A A;  2HWM A;  4DEN A;  4DEP A;  1GGP B;  1ISV A;  1V6V A;  3HOM A;  3IAG C;  5JLV A;  4EFQ A;  2QN4 A;  4OWL A;  3BAD A;  3LTQ A;  3N7L A;  1JQZ A;  2VSE A;  1OQL B;  2VLC A;  1PUM B;  4LO3 C;  4ZOT A;  1GYD B;  3QED A;  2RST A;  1E0O A;  4LO1 A;  3H6R A;  2HZ9 A;  3VSR A;  4TLP A;  1YI7 A;  5A7V A;  1UPS A;  3BTA A;  5GAQ A;  3IIR A;  4GP0 A;  1JT4 A;  1WBC A;  5FZZ A;  1W3G A;  3VT1 A;  2ESU A;  4N4B A;  4KMI A;  1PWA A;  1FMM S;  2VU9 A;  2NZ9 A;  3AZV A;  1W3F A;  3BAU A;  2AC1 A;  2ZQN A;  1II4 A;  3OM4 A;  3BYJ A;  2QYI B;  3TC2 A;  1FMZ A;  4P0K A;  41BI A;  4USP A;  3Q7Y A;  1AVA C;  3VT2 A;  1BLD A;  4IZX A;  1JT3 A;  1T9F A;  4JRA A;  4MLG A;  1RZO B;  5B6T A;  3HN1 A;  5JOW A;  3AKF A;  4O8P A;  3TAW A;  3H6R B;  3LFI A;  3B9U A;  3A07 A;  3AH1 A;  4I4V A;  4OWJ A;  3C7E A;  4X3A A;  3CU1 B;  1JT7 A;  2ERM A;  4I4S A;  5B2H A;  2QQV A;  3P2N A;  4KC8 A;  3WMU A;  3D61 A;  4N1I A;  1ISZ A;  5DVH A;  4ZFY B;  3R4Y A;  3OGG A;  1Q1U A;  4UDI A;  1PC8 B;  4L4I A;  1TWM A;  1HWO B;  4J23 B;  1VKD A;  3O4C A;  4KBB A;  4QD2 C;  4F83 A;  9ILB A;  3BYL A;  1TOO A;  1AXM A;  1GYE B;  3CA6 A;  2ET2 A;  2NVH A;  2NP0 A;  3OGF A;  4QAL A;  1TTU A;  1S0E A;  3LV4 A;  3LIG A;  2NTD A;  4XKI A;  2YFT A;  1AF9 A;  4AN7 B;  4FFI A;  5BXR A;  3FJF A;  4J2X A;  5GLL A;  4H04 A;  3VEQ A;  2J3P A;  4OEF A;  4U6B A;  3O4O A;  3UGH A;  1DIW A;  3FJA A;  1V6X A;  3BRF A;  1R8N A;  4ZFU B;  3V0A A;  3ZXK A;  4QBC A;  4L4H A;  3LIH A;  3UGF A;  1FGA A;  2YUG A;  1FV2 A;  5I1B A;  3JUT A;  1TIE A;  4I4Q A;  3P6I A;  1DFQ A;  1WBA A;  3VWC A;  4F34 A;  3WO4 A;  2BFH A;  2D1Z A;  4X38 A;  2VXR A;  3NBN A;  4H9W A;  3HMY A;  5BP5 A;  3OM6 A;  4KC7 A;  2IHO A;  3ILA A;  5F8Y A;  1IRP A;  2F2F A;  2GO2 A;  3D5Z A;  3E8L C;  2Y9G A;  1IOB A;  2F2F C;  3SNV A;  5FKB A;  1PZZ A;  4I4O A;  3UD8 A;  4IZE A;  4D8H A;  1ISX A;  3QR5 A;  1WD4 A;  3O4A A;  2EXI A;  3U14 A;  4Q91 A;  2E4M A;  3SC7 X;  4JP0 A;  2X2S A;  4KEJ A;  2VUA A;  2E4M C;  5EC5 A;  1JT5 A;  5ANN A;  3C7G A;  3BRG C;  3NJ5 A;  4HA2 A;  2B4W A;  2D7I A;  3FUO A;  3WA1 A;  4HJJ A;  1R8O A;  4FFF A;  6I1B A;  3N0K A;  3FJK A;  2FDB M;  5GLM A;  5DZU A;  3RMX A;  1DZC A;  1BFB A;  3FJD A;  1DQO A;  4KC3 A;  3OJ2 A;  3WAS A;  1Y7B A;  5C0P A;  7I1B A;  3OJV A;  4FVV A;  4I4R A;  1OYG A;  2P23 A;  2Z48 A;  3O49 A;  4OWK A;  4EFR A;  3QEE A;  3R4S A;  3WN0 A;  4FGF A;  3AJ5 A;  1Z4S A;  2AQZ A;  4ZFW B;  2D20 A;  3O4D A;  4J2K A;  4LO3 A;  1Q04 A;  3W9T A;  2M49 A;  2LIE A;  2NM1 A;  3LLP A;  4WBC A;  3PIJ A;  4I6I A;  1S0G A;  2MLL B;  8I1B A;  3RTJ B;  4JKQ A;  1T4Q A;  3BX1 C;  3RSJ A;  2QQW A;  3C7O A;  1FQ9 A;  4I1E A;  5FIX A;  1I1E A;  3BB2 A;  5BQU C;  1S0F A;  3P6J A;  2EXK A;  4GOY A;  3A23 A;  5FNW A;  5A8D A;  3HBW A;  2NYY A;  4A7Y A;  3KST A;  4Q9G A;  4EQV A;  3S8J A;  3CAH A;  5JOX A;  5E24 E;  4QKS A;  5GLN A;  5EHA A;  1YF8 B;  3VT0 A;  4N2Z A;  2MIB A;  5A7V B;  3PG0 A;  4ZKT B;  3BA5 A;  1BFG A;  4UDK A;  4KCA A;  1V6W A;  4EEE B;  3O5W B;  3LDR A;  1AVU A;  4P0L A;  2RQ9 A;  1A8D A;  1HWN B;  1N4K A;  3Q7W A;  1IIL A;  2FFV A;  2AAI B;  3WMZ A;  4UDK E;  1J0S A;  3O4B A;  4Z9W B;  5HPZ A;  4ONZ A;  2LIQ A;  3VSF A;  4OUJ A;  4DCK C;  1JLX A;  1ILR 1;  1IRA X;  3C7F A;  5B6S A;  4PVI A;  2DS0 A;  4Q9P A;  3BA4 A;  1DJS B;  3RTI B;  4UDG A;  3KF3 A;  1ITB A;  3WIN A;  1BLA A;  1ONK B;  3O3Q A;  3WIN C;  1CVS A;  4I37 A;  2EXH A;  1HIB A;  3POK A;  4ZBV B;  1W18 A;  3ZX7 A;  1BFF A;  5GLQ A;  3FJH A;  3HAL A;  4OW4 A;  1QQK A;  5GLO A;  1YTO A;  4I4P A;  2FFU A;  1SZ6 B;  1DFC A;  3WAU A;  3PUB A;  1NUN A;  3P53 A;  1G82 A;  3PME A;  2ZQO A;  1YBI A;  4QD2 B;  4ZGR B;  1EV2 A;  5AYD A;  4X37 A;  4EB2 B;  2D44 A;  3RMY A;  4FFG A;  5FMC A;  2D24 A;  3CU9 A;  1TWE A;  3NBD A;  1RG8 A;  3WPZ A;  1YYN A;  4IY9 A;  4GOV A;  1QQL A;  1EYL A;  5D61 A;  2UUS A;  1NZK A;  4J2S A;  4PC4 A;  3UJ0 A;  5G00 A;  3ZC9 A;  5FK7 A;  1QXM A;  3K1U A;  3AZW A;  1I1B A;  4EKX B;  1Y9M A;  1SR4 C;  4IYB A;  5BVP I;  2OXB A;  3D7W B;  4QBV A;  4YOL A;  5F8S A;  5EG6 C;  4P6A A;  3NQH A;  3ZXL A;  5A8C A;  1KNM A;  1JLY A;  3A21 A;  3QYD A;  3O44 A;  3EF2 A;  4GAI A;  1YXW A;  3V0A B;  1JTC A;  5FKC A;  3R4U A;  3FJ9 A;  4G6M A;  3WMY A;  3CA5 A;  3V0B A;  4LO7 C;  1GYH A;  1WL7 A;  2FGF A;  3C7H A;  2Y9X E;  3CA4 A;  3ZXD A;  5GLP A;  3QZ4 A;  1BFC A;  4ISQ A;  4UDJ A;  4JKX B;  4G1R A;  3ZXJ A;  1BAR A;  3OJM A;  1M2T B;  4IHZ A;  5JOZ A;  3IM5 A;  3NBE A;  4A7Z A;  5AYE A;  1G9D A;  1WD3 A;  1V6U A;  4I3N A;  3AKI A;  2FO1 A;  2MC2 A;  3UDA A;  5AYC A;  1HCE A;  5DUY A;  1P63 A;  3LDK A;  3RWK X;  1HCD A;  1AFC A;  1BAS A;  21BI A;  3N7J A;  3FJE A;  2L5X A;  3BAG A;  3D5Y A;  4LO0 C;  1BA7 A;  2Q3N B;  2HW9 A;  2VDT A;  4CJM A;  4D0T A;  1MC9 A;  4I4Y A;  3V0B B;  3LF7 A;  1FN0 A;  4QKR A;  4USO A;  1Z2V A;  4N2R A;  3WN2 A;  1DQG A;  3T8S A;  1EPW A;  2DRE A;  1L2H A;  4ISR A;  5FNX A;  2X8S A;  4G6J A;  2ZR1 B;  3VSZ A;  1ST8 A;  2KLL A;  1ISW A;  1DLL A;  3PHZ A;  2RG9 B;  4G9M A;  5BQU A;  1W3A A;  4I7I A;  1S0B A;  3WPY A;  4JAW A;  3UGG A;  3VSS A;  1Y9G A;  1XYF A;  2ADE A;  4FFH A;  2D7R A;  3BRD A;  5F90 A;  4I96 A;  4QQS A;  3WPV A;  3H6S E;  2AEZ A;  4LO1 C;  1AVW B;  3CRI A;  4KEI A;  3WPU A;  4O8N A;  2KI4 A;  1VCL A;  1FV3 A;  3PIG A;  1PUU B;  5FLW A;  4I4U A;  4AK6 A;  4END A;  1EVT A;  3WAT A;  4JPZ A;  5BXS A;  2YFS A;  4I8M A;  5BOW A;  3S8K A;  1RY7 A;  1ABR B;  4GP3 A;  4ION A;  3BAQ A;  3N7M A;  1TFM B; 
#chains in the Genus database with same CATH topology
 1TP0 A;  5FK8 A;  2D22 A;  2Y9W C;  4HR6 C;  5F8W A;  3MPP G;  1PT2 A;  3R4Z A;  2Q9X A;  1UV4 A;  4D47 A;  4NOV A;  1K5V A;  3MAL A;  2K43 A;  3FGM A;  3UD9 A;  3BAO A;  3UD7 A;  3N7K A;  3ZXG A;  1K5U A;  3UJ4 A;  4IY8 A;  2AEY A;  2VXT I;  4D0Z A;  3FFZ A;  2X8F A;  3OM5 A;  3CRH A;  3IM6 A;  3FJI A;  1IJT A;  3R67 A;  3OM7 A;  4GAF A;  2D23 A;  5DSS B;  5BXT A;  4IQP A;  3C2U A;  2DRY A;  2KKI A;  3BA7 A;  5D62 A;  1UYP A;  3JRR A;  3BYN A;  1F31 A;  4LO2 A;  5FMD A;  31BI A;  2F8X C;  3AKH A;  4PVA A;  4LO2 C;  4KEK A;  4LO8 B;  3I29 B;  3CRG A;  1RML A;  5D63 A;  3OM2 A;  3AH4 A;  2X8T A;  1CE7 B;  1DZD A;  4MZG B;  3CA0 A;  3WO2 A;  1W2T A;  3C9Z A;  4I1B A;  3AH2 A;  3I2X A;  1IHK A;  3HSM A;  3K1X A;  1YIF A;  2Z49 A;  4O8O A;  5GLR A;  1MD6 A;  1M16 A;  4P0J A;  5JOY A;  4OEG A;  3FJC A;  1Q03 A;  1ISY A;  2WBC A;  3CQA A;  3H6Q A;  1S0D A;  1XG6 A;  2XQR A;  2I1B A;  3FUQ A;  1IT0 A;  4II0 A;  3WMV A;  1XZZ A;  5FMB A;  1SR4 A;  4KCB A;  3BYK A;  2D43 A;  3NBC A;  5FZU A;  4ZA3 B;  2X2T A;  3OBR A;  4ZLB B;  3IM7 A;  4AK7 A;  3F1R A;  2GZB A;  2AFG A;  2K4A B;  4G9N A;  2Y9F A;  2BEB A;  2DRZ A;  5GLK A;  2BEA A;  3OBT A;  2YFR A;  1G9B A;  3KMV A;  5JMC A;  3WO3 A;  3VUO A;  4J2Y A;  4Z8S B;  3D60 A;  3ZC8 A;  4AK5 A;  2P39 A;  1G9C A;  1S0C A;  5BP5 C;  1S0L A;  3KF5 A;  2IWT B;  4X39 A;  2EXJ A;  3A22 A;  3QEF A;  3Q7X A;  4I4X A;  3FJB A;  3BAH A;  3U75 A;  1Y4W A;  3FJ8 A;  3CA3 A;  4UY4 A;  1FWV A;  3AKG A;  4EFP A;  4LO0 A;  3CA1 A;  2ADD A;  4XFT A;  4A7K A;  3FJJ A;  2WRY A;  3QC2 A;  5AY9 A;  3AJ6 A;  4OEE A;  3V79 C;  2VSA A;  4I0Y A;  3BAV A;  1D0H A;  4LO7 B;  4I2S A;  1Z0H A;  3F62 B;  1HWM B;  1HWP B;  2AXM A;  4JQ0 A;  4AN6 A;  2XOA A;  1YRZ A;  3WN1 A;  2KI6 B;  2R9K B;  2KH2 A;  4QC4 A;  4QO3 A;  1XHB A;  1AVX B;  4XFU A;  2QQU A;  3LEM A;  3I2A A;  4XFS A;  5FZY A;  2K8R A;  1HKN A;  1FWU A;  1JY0 A;  4R6U B;  4U6D A;  4COT A;  5BXP A;  2HWA A;  1G9A A;  2HWM A;  4DEN A;  4DEP A;  1GGP B;  1ISV A;  1V6V A;  3HOM A;  3IAG C;  5JLV A;  4EFQ A;  2QN4 A;  4OWL A;  3BAD A;  3LTQ A;  3N7L A;  1JQZ A;  2VSE A;  1OQL B;  2VLC A;  1PUM B;  4LO3 C;  4ZOT A;  1GYD B;  3QED A;  2RST A;  1E0O A;  4LO1 A;  3H6R A;  2HZ9 A;  3VSR A;  4TLP A;  1YI7 A;  5A7V A;  1UPS A;  3BTA A;  5GAQ A;  3IIR A;  4GP0 A;  1JT4 A;  1WBC A;  5FZZ A;  1W3G A;  3VT1 A;  2ESU A;  4N4B A;  4KMI A;  1PWA A;  1FMM S;  2VU9 A;  2NZ9 A;  3AZV A;  1W3F A;  3BAU A;  1TL2 A;  2AC1 A;  2ZQN A;  1II4 A;  3OM4 A;  3BYJ A;  2QYI B;  3TC2 A;  1FMZ A;  4P0K A;  41BI A;  4USP A;  3Q7Y A;  1AVA C;  3VT2 A;  1BLD A;  4IZX A;  1JT3 A;  1T9F A;  4JRA A;  4MLG A;  1RZO B;  5B6T A;  3HN1 A;  5JOW A;  3AKF A;  4O8P A;  3TAW A;  3H6R B;  3LFI A;  3B9U A;  3A07 A;  3AH1 A;  4I4V A;  4OWJ A;  3C7E A;  4X3A A;  3CU1 B;  1JT7 A;  2ERM A;  4I4S A;  5B2H A;  2QQV A;  3P2N A;  4KC8 A;  3WMU A;  3D61 A;  4N1I A;  1ISZ A;  5DVH A;  4ZFY B;  3R4Y A;  3OGG A;  1Q1U A;  4UDI A;  1PC8 B;  4L4I A;  1TWM A;  1HWO B;  4J23 B;  1VKD A;  3O4C A;  4KBB A;  4QD2 C;  4F83 A;  9ILB A;  3BYL A;  1TOO A;  1AXM A;  1GYE B;  3CA6 A;  2ET2 A;  2NVH A;  2NP0 A;  3OGF A;  4QAL A;  1TTU A;  1S0E A;  3LV4 A;  3LIG A;  2NTD A;  4XKI A;  2YFT A;  1AF9 A;  4AN7 B;  4FFI A;  5BXR A;  3FJF A;  4J2X A;  5GLL A;  4H04 A;  3VEQ A;  2J3P A;  4OEF A;  4U6B A;  3O4O A;  3UGH A;  1DIW A;  3FJA A;  1V6X A;  4MZF B;  3BRF A;  1R8N A;  4ZFU B;  3V0A A;  3ZXK A;  4QBC A;  4L4H A;  3LIH A;  3UGF A;  1FGA A;  2YUG A;  1FV2 A;  5I1B A;  3JUT A;  1TIE A;  4I4Q A;  3P6I A;  1DFQ A;  1WBA A;  3VWC A;  4F34 A;  3WO4 A;  2BFH A;  2D1Z A;  4X38 A;  2VXR A;  3NBN A;  4H9W A;  3HMY A;  5BP5 A;  3OM6 A;  4KC7 A;  2IHO A;  3ILA A;  5F8Y A;  1IRP A;  2F2F A;  2GO2 A;  3D5Z A;  3E8L C;  2Y9G A;  1IOB A;  2F2F C;  3SNV A;  5FKB A;  1PZZ A;  4I4O A;  3UD8 A;  4IZE A;  4D8H A;  1ISX A;  3QR5 A;  1WD4 A;  3O4A A;  2EXI A;  3U14 A;  4Q91 A;  2E4M A;  3SC7 X;  4JP0 A;  2X2S A;  4KEJ A;  2VUA A;  2E4M C;  5EC5 A;  1JT5 A;  5ANN A;  3C7G A;  3BRG C;  3NJ5 A;  4HA2 A;  2B4W A;  2D7I A;  3FUO A;  3WA1 A;  4HJJ A;  1R8O A;  4FFF A;  6I1B A;  3N0K A;  3FJK A;  2FDB M;  5GLM A;  5DZU A;  3RMX A;  1DZC A;  1BFB A;  3FJD A;  1DQO A;  4KC3 A;  3OJ2 A;  3WAS A;  1Y7B A;  5C0P A;  7I1B A;  3OJV A;  4FVV A;  4I4R A;  1OYG A;  2P23 A;  2Z48 A;  3O49 A;  4OWK A;  4H75 A;  4EFR A;  3QEE A;  3R4S A;  3WN0 A;  4FGF A;  3AJ5 A;  1Z4S A;  2AQZ A;  4ZFW B;  2D20 A;  3O4D A;  4J2K A;  4LO3 A;  1Q04 A;  3W9T A;  2M49 A;  2LIE A;  2NM1 A;  3LLP A;  4WBC A;  3PIJ A;  4I6I A;  1S0G A;  2MLL B;  8I1B A;  3RTJ B;  4JKQ A;  1T4Q A;  3BX1 C;  3RSJ A;  2QQW A;  3C7O A;  1FQ9 A;  4I1E A;  5FIX A;  1I1E A;  3BB2 A;  5BQU C;  1S0F A;  3P6J A;  2EXK A;  4GOY A;  3A23 A;  4MZH A;  5FNW A;  5A8D A;  3HBW A;  2NYY A;  4A7Y A;  3KST A;  4Q9G A;  4EQV A;  3S8J A;  3CAH A;  5JOX A;  5E24 E;  4QKS A;  5GLN A;  5EHA A;  1YF8 B;  3VT0 A;  4N2Z A;  2MIB A;  5A7V B;  3PG0 A;  4ZKT B;  3BA5 A;  1BFG A;  4UDK A;  4KCA A;  1V6W A;  4EEE B;  3O5W B;  3LDR A;  1AVU A;  4P0L A;  2RQ9 A;  1A8D A;  1HWN B;  1N4K A;  3Q7W A;  1IIL A;  2FFV A;  2AAI B;  3WMZ A;  4UDK E;  1J0S A;  3O4B A;  4Z9W B;  5HPZ A;  4ONZ A;  2LIQ A;  3VSF A;  4OUJ A;  4DCK C;  1JLX A;  1ILR 1;  1IRA X;  3C7F A;  5B6S A;  4PVI A;  2DS0 A;  4Q9P A;  3BA4 A;  1DJS B;  3RTI B;  4UDG A;  3KF3 A;  1ITB A;  3WIN A;  1BLA A;  1ONK B;  3O3Q A;  3WIN C;  1CVS A;  4I37 A;  2EXH A;  1HIB A;  3POK A;  4ZBV B;  1W18 A;  3ZX7 A;  1BFF A;  5GLQ A;  3FJH A;  3HAL A;  4OW4 A;  1QQK A;  5GLO A;  1YTO A;  4I4P A;  2FFU A;  1SZ6 B;  1DFC A;  3WAU A;  3PUB A;  1NUN A;  3P53 A;  1G82 A;  3PME A;  2ZQO A;  1YBI A;  4QD2 B;  4ZGR B;  1EV2 A;  5AYD A;  4X37 A;  4EB2 B;  2D44 A;  3RMY A;  4FFG A;  5FMC A;  2D24 A;  3CU9 A;  1TWE A;  3NBD A;  1RG8 A;  3WPZ A;  1YYN A;  4IY9 A;  4GOV A;  1QQL A;  1EYL A;  5D61 A;  2UUS A;  1NZK A;  4J2S A;  4PC4 A;  3UJ0 A;  5G00 A;  3ZC9 A;  5FK7 A;  1QXM A;  3K1U A;  3AZW A;  1I1B A;  4EKX B;  2NS2 A;  1Y9M A;  1SR4 C;  4IYB A;  5BVP I;  2OXB A;  3D7W B;  4QBV A;  4YOL A;  5F8S A;  5EG6 C;  4P6A A;  3NQH A;  3ZXL A;  5A8C A;  1KNM A;  1JLY A;  3A21 A;  3QYD A;  3O44 A;  3EF2 A;  4GAI A;  1YXW A;  3V0A B;  5C2M A;  1JTC A;  5FKC A;  3R4U A;  3FJ9 A;  4G6M A;  3WMY A;  3CA5 A;  3V0B A;  4LO7 C;  1GYH A;  1WL7 A;  2FGF A;  3C7H A;  2Y9X E;  3CA4 A;  3ZXD A;  5GLP A;  3QZ4 A;  1BFC A;  4ISQ A;  4UDJ A;  4JKX B;  4G1R A;  3ZXJ A;  1BAR A;  3OJM A;  1M2T B;  4IHZ A;  5JOZ A;  3IM5 A;  3NBE A;  4A7Z A;  5AYE A;  1G9D A;  1WD3 A;  1V6U A;  4I3N A;  3AKI A;  2FO1 A;  2MC2 A;  3UDA A;  5AYC A;  1HCE A;  5DUY A;  1P63 A;  3LDK A;  3RWK X;  1HCD A;  1AFC A;  1BAS A;  21BI A;  3N7J A;  3FJE A;  2L5X A;  3BAG A;  3D5Y A;  4LO0 C;  1BA7 A;  2Q3N B;  2HW9 A;  2VDT A;  4CJM A;  4D0T A;  1MC9 A;  4I4Y A;  3V0B B;  3LF7 A;  1FN0 A;  4QKR A;  4USO A;  1Z2V A;  4N2R A;  3WN2 A;  1DQG A;  3T8S A;  1EPW A;  2DRE A;  1L2H A;  4ISR A;  5FNX A;  2X8S A;  4G6J A;  2ZR1 B;  3VSZ A;  1ST8 A;  2KLL A;  1ISW A;  1DLL A;  3PHZ A;  2RG9 B;  4G9M A;  5BQU A;  1W3A A;  4I7I A;  1S0B A;  3WPY A;  4JAW A;  3UGG A;  3VSS A;  1Y9G A;  1XYF A;  2ADE A;  4FFH A;  2D7R A;  3BRD A;  5F90 A;  4I96 A;  4QQS A;  3WPV A;  3H6S E;  2AEZ A;  4LO1 C;  1AVW B;  3CRI A;  4KEI A;  3WPU A;  4O8N A;  2KI4 A;  1VCL A;  1FV3 A;  3PIG A;  1PUU B;  5FLW A;  4I4U A;  4AK6 A;  4END A;  1EVT A;  3WAT A;  4JPZ A;  5BXS A;  2YFS A;  4I8M A;  5BOW A;  3S8K A;  1RY7 A;  1ABR B;  4GP3 A;  4ION A;  3BAQ A;  3N7M A;  1TFM B; 
#chains in the Genus database with same CATH homology
 1TP0 A;  5FK8 A;  2D22 A;  2Y9W C;  4HR6 C;  5F8W A;  3MPP G;  1PT2 A;  3R4Z A;  2Q9X A;  1UV4 A;  4D47 A;  4NOV A;  1K5V A;  3MAL A;  2K43 A;  3FGM A;  3UD9 A;  3BAO A;  3UD7 A;  3N7K A;  3ZXG A;  1K5U A;  3UJ4 A;  4IY8 A;  2AEY A;  2VXT I;  4D0Z A;  3FFZ A;  2X8F A;  3OM5 A;  3CRH A;  3IM6 A;  3FJI A;  1IJT A;  3R67 A;  3OM7 A;  4GAF A;  2D23 A;  5DSS B;  5BXT A;  4IQP A;  3C2U A;  2DRY A;  2KKI A;  3BA7 A;  5D62 A;  1UYP A;  3JRR A;  3BYN A;  1F31 A;  4LO2 A;  5FMD A;  31BI A;  2F8X C;  3AKH A;  4PVA A;  4LO2 C;  4KEK A;  4LO8 B;  3I29 B;  3CRG A;  1RML A;  5D63 A;  3OM2 A;  3AH4 A;  2X8T A;  1CE7 B;  1DZD A;  4MZG B;  3CA0 A;  3WO2 A;  1W2T A;  3C9Z A;  4I1B A;  3AH2 A;  3I2X A;  1IHK A;  3HSM A;  3K1X A;  1YIF A;  2Z49 A;  4O8O A;  5GLR A;  1MD6 A;  1M16 A;  4P0J A;  5JOY A;  4OEG A;  3FJC A;  1Q03 A;  1ISY A;  2WBC A;  3CQA A;  3H6Q A;  1S0D A;  1XG6 A;  2XQR A;  2I1B A;  3FUQ A;  1IT0 A;  4II0 A;  3WMV A;  1XZZ A;  5FMB A;  1SR4 A;  4KCB A;  3BYK A;  2D43 A;  3NBC A;  5FZU A;  4ZA3 B;  2X2T A;  3OBR A;  4ZLB B;  3IM7 A;  4AK7 A;  3F1R A;  2GZB A;  2AFG A;  2K4A B;  4G9N A;  2Y9F A;  2BEB A;  2DRZ A;  5GLK A;  2BEA A;  3OBT A;  2YFR A;  1G9B A;  3KMV A;  5JMC A;  3WO3 A;  3VUO A;  4J2Y A;  4Z8S B;  3D60 A;  3ZC8 A;  4AK5 A;  2P39 A;  1G9C A;  1S0C A;  5BP5 C;  1S0L A;  3KF5 A;  2IWT B;  4X39 A;  2EXJ A;  3A22 A;  3QEF A;  3Q7X A;  4I4X A;  3FJB A;  3BAH A;  3U75 A;  1Y4W A;  3FJ8 A;  3CA3 A;  4UY4 A;  1FWV A;  3AKG A;  4EFP A;  4LO0 A;  3CA1 A;  2ADD A;  4XFT A;  4A7K A;  3FJJ A;  2WRY A;  3QC2 A;  5AY9 A;  3AJ6 A;  4OEE A;  3V79 C;  2VSA A;  4I0Y A;  3BAV A;  1D0H A;  4LO7 B;  4I2S A;  1Z0H A;  3F62 B;  1HWM B;  1HWP B;  2AXM A;  4JQ0 A;  4AN6 A;  2XOA A;  1YRZ A;  3WN1 A;  2KI6 B;  2R9K B;  2KH2 A;  4QC4 A;  4QO3 A;  1XHB A;  1AVX B;  4XFU A;  2QQU A;  3LEM A;  3I2A A;  4XFS A;  5FZY A;  2K8R A;  1HKN A;  1FWU A;  1JY0 A;  4R6U B;  4U6D A;  4COT A;  5BXP A;  2HWA A;  1G9A A;  2HWM A;  4DEN A;  4DEP A;  1GGP B;  1ISV A;  1V6V A;  3HOM A;  3IAG C;  5JLV A;  4EFQ A;  2QN4 A;  4OWL A;  3BAD A;  3LTQ A;  3N7L A;  1JQZ A;  2VSE A;  1OQL B;  2VLC A;  1PUM B;  4LO3 C;  4ZOT A;  1GYD B;  3QED A;  2RST A;  1E0O A;  4LO1 A;  3H6R A;  2HZ9 A;  3VSR A;  4TLP A;  1YI7 A;  5A7V A;  1UPS A;  3BTA A;  5GAQ A;  3IIR A;  4GP0 A;  1JT4 A;  1WBC A;  5FZZ A;  1W3G A;  3VT1 A;  2ESU A;  4N4B A;  4KMI A;  1PWA A;  1FMM S;  2VU9 A;  2NZ9 A;  3AZV A;  1W3F A;  3BAU A;  2AC1 A;  2ZQN A;  1II4 A;  3OM4 A;  3BYJ A;  2QYI B;  3TC2 A;  1FMZ A;  4P0K A;  41BI A;  4USP A;  3Q7Y A;  1AVA C;  3VT2 A;  1BLD A;  4IZX A;  1JT3 A;  1T9F A;  4JRA A;  4MLG A;  1RZO B;  5B6T A;  3HN1 A;  5JOW A;  3AKF A;  4O8P A;  3TAW A;  3H6R B;  3LFI A;  3B9U A;  3A07 A;  3AH1 A;  4I4V A;  4OWJ A;  3C7E A;  4X3A A;  3CU1 B;  1JT7 A;  2ERM A;  4I4S A;  5B2H A;  2QQV A;  3P2N A;  4KC8 A;  3WMU A;  3D61 A;  4N1I A;  1ISZ A;  5DVH A;  4ZFY B;  3R4Y A;  3OGG A;  1Q1U A;  4UDI A;  1PC8 B;  4L4I A;  1TWM A;  1HWO B;  4J23 B;  1VKD A;  3O4C A;  4KBB A;  4QD2 C;  4F83 A;  9ILB A;  3BYL A;  1TOO A;  1AXM A;  1GYE B;  3CA6 A;  2ET2 A;  2NVH A;  2NP0 A;  3OGF A;  4QAL A;  1TTU A;  1S0E A;  3LV4 A;  3LIG A;  2NTD A;  4XKI A;  2YFT A;  1AF9 A;  4AN7 B;  4FFI A;  5BXR A;  3FJF A;  4J2X A;  5GLL A;  4H04 A;  3VEQ A;  2J3P A;  4OEF A;  4U6B A;  3O4O A;  3UGH A;  1DIW A;  3FJA A;  1V6X A;  4MZF B;  3BRF A;  1R8N A;  4ZFU B;  3V0A A;  3ZXK A;  4QBC A;  4L4H A;  3LIH A;  3UGF A;  1FGA A;  2YUG A;  1FV2 A;  5I1B A;  3JUT A;  1TIE A;  4I4Q A;  3P6I A;  1DFQ A;  1WBA A;  3VWC A;  4F34 A;  3WO4 A;  2BFH A;  2D1Z A;  4X38 A;  2VXR A;  3NBN A;  4H9W A;  3HMY A;  5BP5 A;  3OM6 A;  4KC7 A;  2IHO A;  3ILA A;  5F8Y A;  1IRP A;  2F2F A;  2GO2 A;  3D5Z A;  3E8L C;  2Y9G A;  1IOB A;  2F2F C;  3SNV A;  5FKB A;  1PZZ A;  4I4O A;  3UD8 A;  4IZE A;  4D8H A;  1ISX A;  3QR5 A;  1WD4 A;  3O4A A;  2EXI A;  3U14 A;  4Q91 A;  2E4M A;  3SC7 X;  4JP0 A;  2X2S A;  4KEJ A;  2VUA A;  2E4M C;  5EC5 A;  1JT5 A;  5ANN A;  3C7G A;  3BRG C;  3NJ5 A;  4HA2 A;  2B4W A;  2D7I A;  3FUO A;  3WA1 A;  4HJJ A;  1R8O A;  4FFF A;  6I1B A;  3N0K A;  3FJK A;  2FDB M;  5GLM A;  5DZU A;  3RMX A;  1DZC A;  1BFB A;  3FJD A;  1DQO A;  4KC3 A;  3OJ2 A;  3WAS A;  1Y7B A;  5C0P A;  7I1B A;  3OJV A;  4FVV A;  4I4R A;  1OYG A;  2P23 A;  2Z48 A;  3O49 A;  4OWK A;  4H75 A;  4EFR A;  3QEE A;  3R4S A;  3WN0 A;  4FGF A;  3AJ5 A;  1Z4S A;  2AQZ A;  4ZFW B;  2D20 A;  3O4D A;  4J2K A;  4LO3 A;  1Q04 A;  3W9T A;  2M49 A;  2LIE A;  2NM1 A;  3LLP A;  4WBC A;  3PIJ A;  4I6I A;  1S0G A;  2MLL B;  8I1B A;  3RTJ B;  4JKQ A;  1T4Q A;  3BX1 C;  3RSJ A;  2QQW A;  3C7O A;  1FQ9 A;  4I1E A;  5FIX A;  1I1E A;  3BB2 A;  5BQU C;  1S0F A;  3P6J A;  2EXK A;  4GOY A;  3A23 A;  4MZH A;  5FNW A;  5A8D A;  3HBW A;  2NYY A;  4A7Y A;  3KST A;  4Q9G A;  4EQV A;  3S8J A;  3CAH A;  5JOX A;  5E24 E;  4QKS A;  5GLN A;  5EHA A;  1YF8 B;  3VT0 A;  4N2Z A;  2MIB A;  5A7V B;  3PG0 A;  4ZKT B;  3BA5 A;  1BFG A;  4UDK A;  4KCA A;  1V6W A;  4EEE B;  3O5W B;  3LDR A;  1AVU A;  4P0L A;  2RQ9 A;  1A8D A;  1HWN B;  1N4K A;  3Q7W A;  1IIL A;  2FFV A;  2AAI B;  3WMZ A;  4UDK E;  1J0S A;  3O4B A;  4Z9W B;  5HPZ A;  4ONZ A;  2LIQ A;  3VSF A;  4OUJ A;  4DCK C;  1JLX A;  1ILR 1;  1IRA X;  3C7F A;  5B6S A;  4PVI A;  2DS0 A;  4Q9P A;  3BA4 A;  1DJS B;  3RTI B;  4UDG A;  3KF3 A;  1ITB A;  3WIN A;  1BLA A;  1ONK B;  3O3Q A;  3WIN C;  1CVS A;  4I37 A;  2EXH A;  1HIB A;  3POK A;  4ZBV B;  1W18 A;  3ZX7 A;  1BFF A;  5GLQ A;  3FJH A;  3HAL A;  4OW4 A;  1QQK A;  5GLO A;  1YTO A;  4I4P A;  2FFU A;  1SZ6 B;  1DFC A;  3WAU A;  3PUB A;  1NUN A;  3P53 A;  1G82 A;  3PME A;  2ZQO A;  1YBI A;  4QD2 B;  4ZGR B;  1EV2 A;  5AYD A;  4X37 A;  4EB2 B;  2D44 A;  3RMY A;  4FFG A;  5FMC A;  2D24 A;  3CU9 A;  1TWE A;  3NBD A;  1RG8 A;  3WPZ A;  1YYN A;  4IY9 A;  4GOV A;  1QQL A;  1EYL A;  5D61 A;  2UUS A;  1NZK A;  4J2S A;  4PC4 A;  3UJ0 A;  5G00 A;  3ZC9 A;  5FK7 A;  1QXM A;  3K1U A;  3AZW A;  1I1B A;  4EKX B;  2NS2 A;  1Y9M A;  1SR4 C;  4IYB A;  5BVP I;  2OXB A;  3D7W B;  4QBV A;  4YOL A;  5F8S A;  5EG6 C;  4P6A A;  3NQH A;  3ZXL A;  5A8C A;  1KNM A;  1JLY A;  3A21 A;  3QYD A;  3O44 A;  3EF2 A;  4GAI A;  1YXW A;  3V0A B;  1JTC A;  5FKC A;  3R4U A;  3FJ9 A;  4G6M A;  3WMY A;  3CA5 A;  3V0B A;  4LO7 C;  1GYH A;  1WL7 A;  2FGF A;  3C7H A;  2Y9X E;  3CA4 A;  3ZXD A;  5GLP A;  3QZ4 A;  1BFC A;  4ISQ A;  4UDJ A;  4JKX B;  4G1R A;  3ZXJ A;  1BAR A;  3OJM A;  1M2T B;  4IHZ A;  5JOZ A;  3IM5 A;  3NBE A;  4A7Z A;  5AYE A;  1G9D A;  1WD3 A;  1V6U A;  4I3N A;  3AKI A;  2FO1 A;  2MC2 A;  3UDA A;  5AYC A;  1HCE A;  5DUY A;  1P63 A;  3LDK A;  3RWK X;  1HCD A;  1AFC A;  1BAS A;  21BI A;  3N7J A;  3FJE A;  2L5X A;  3BAG A;  3D5Y A;  4LO0 C;  1BA7 A;  2Q3N B;  2HW9 A;  2VDT A;  4CJM A;  4D0T A;  1MC9 A;  4I4Y A;  3V0B B;  3LF7 A;  1FN0 A;  4QKR A;  4USO A;  1Z2V A;  4N2R A;  3WN2 A;  1DQG A;  3T8S A;  1EPW A;  2DRE A;  1L2H A;  4ISR A;  5FNX A;  2X8S A;  4G6J A;  2ZR1 B;  3VSZ A;  1ST8 A;  2KLL A;  1ISW A;  1DLL A;  3PHZ A;  2RG9 B;  4G9M A;  5BQU A;  1W3A A;  4I7I A;  1S0B A;  3WPY A;  4JAW A;  3UGG A;  3VSS A;  1Y9G A;  1XYF A;  2ADE A;  4FFH A;  2D7R A;  3BRD A;  5F90 A;  4I96 A;  4QQS A;  3WPV A;  3H6S E;  2AEZ A;  4LO1 C;  1AVW B;  3CRI A;  4KEI A;  3WPU A;  4O8N A;  2KI4 A;  1VCL A;  1FV3 A;  3PIG A;  1PUU B;  5FLW A;  4I4U A;  4AK6 A;  4END A;  1EVT A;  3WAT A;  4JPZ A;  5BXS A;  2YFS A;  4I8M A;  5BOW A;  3S8K A;  1RY7 A;  1ABR B;  4GP3 A;  4ION A;  3BAQ A;  3N7M A;  1TFM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...