3VSZA

Crystal structure of ct1,3gal43a in complex with galactan
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
461
structure length
461
Chain Sequence
b'EGVIVNGTQFKDTSGNVIHAHGGGMLKHGDYYYWYGEYRDDSNLFLGVSCYRSKDLVNWEYRGEVLSRNSAPELNHCNIERPKVMYNASTGEFVMWMHWENGINYGQARAAVAYSKTPDGKFTYIRSFRPMQDTGVMDHGLPGYMSRDCNVFVDTDGKGYFISAANENMDLHLYELTPDYKNIASLKAKLFVGQQREAPCLIKRNGYYYLITSGCTGWNPNQAKYAYSKDLASGWSQLYNLGNSTTYRSQPTFIIPVQGSSGTSYLYMGDRWAGAWGGKVNDSQYVWLPLNFISDTTLELPYYDSVKIDASSGIISEYIPDTTRYKLVNKNSGKVLDVLDGSVDNAAQIVQWTDNGSLSQQWYLVDVGGGYKKIVNVKSGRALDVKDESKEDGGVLIQYTSNGGYNQHWKFTDIGDGYYKISSRHCGKLIDVRKWSTEDGGIIQQWSDAGGTNQHWKLVLV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ricin B lectin
publication title Crystal structure of 1,3Gal43A, an exo-beta-1,3-galactanase from Clostridium thermocellum
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Sugar binding protein
total genus 131
structure length 461
sequence length 461
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vszA02
2.115.10.20 Mainly Beta 5 Propeller Tachylectin-2; Chain A Glycosyl hydrolase domain; family 43 3vszA01
4GAFA 5BXRA 2Q9XA 3WMYA 5FZUA 4F83A 4I4OA 3JUTA 3UD7A 2Z48A 3VSZA 4OEGA 2RG9B 3CU1B 3HMYA 2MC2A 3CRIA 2DREA 1ITBA 4OWLA 4XFSA 4I4QA 3P6JA 2X8FA 1HWMB 4R6UB 3BAOA 2YFSA 4KCBA 3WINC 2D20A 1YTOA 5FK7A 3JRRA 3WPYA 1II4A 3BRDA 5BXTA 4GP3A 3HOMA 1S0DA 4G9MA 3RWKX 5BXPA 5FMCA 4P6AA 4WBCA 1ST8A 4II0A 3FJHA 2VUAA 3LIHA 2KLLA 3NQHA 1ISYA 1K5VA 1DFCA 4X3AA 2E4MA 1TP0A 1ABRB 1IRAX 4FFIA 4USOA 1IJTA 3N7MA 4I96A 3C7FA 1AXMA 2D1ZA 1BFGA 3D5YA 1PUUB 3QEEA 4IZXA 2QN4A 2ERMA 2KI4A 3OM7A 1JT3A 2RSTA 4ISQA 3VT0A 3CRHA 5D61A 3OM5A 4N2RA 3VSSA 2XQRA 1V6XA 4ENDA 4IZEA 3LEMA 3WN2A 2K4AB 1IT0A 1BASA 2D22A 2Y9FA 3FJCA 3RSJA 2ESUA 3FFZA 1BARA 2MIBA 3FJAA 1VCLA 3UD9A 5BP5A 3A22A 3BAUA 1PZZA 3AKHA 1IOBA 4N2ZA 3QZ4A 9ILBA 2QQVA 4KMIA 4X39A 1W18A 3FJJA 3BADA 3Q7XA 4QC4A 5BOWA 4Z9WB 1R8OA 3PMEA 5FMBA 4UDIA 1XZZA 5G00A 3N7JA 3HALA 1Z0HA 3WA1A 3V0AA 1HIBA 3U14A 3AZVA 3LFIA 4NOVA 4L4HA 1AVXB 1YYNA 4IQPA 1YBIA 4G6JA 2Q3NB 4JPZA 1UPSA 1Y4WA 3WN0A 1I1BA 4LO7B 5AYDA 2YUGA 1FWUA 2F8XC 1R8NA 3T8SA 3SC7X 41BIA 3P53A 1NZKA 5F8SA 4D0TA 1G82A 3AKGA 4I7IA 1SR4C 4I4RA 4ZOTA 1AF9A 3KF3A 3CA0A 4FFFA 1CVSA 4HJJA 5JLVA 4UDKE 1XHBA 2J3PA 3H6RA 3IAGC 2UUSA 4GOYA 4LO3C 2IWTB 5FK8A 4J23B 4CJMA 3QR5A 3R67A 5A8CA 3N7LA 3QEFA 4KC7A 2X8SA 5AY9A 4N4BA 5ANNA 3WPVA 1QXMA 1FMMS 4IHZA 3BYNA 2LIEA 3V0AB 1YF8B 3B9UA 3K1UA 1PUMB 3PUBA 3WINA 4P0JA 4QKSA 4JKQA 4P0LA 3S8JA 5A8DA 1RMLA 3AJ6A 3V0BB 2X2SA 1HWPB 1TIEA 1TFMB 4IYBA 3ILAA 4A7YA 2NZ9A 1JY0A 3CA3A 1DZDA 4I1EA 1V6UA 3FJBA 4LO1C 5GLOA 1ONKB 5JOZA 2VSAA 3F1RA 4X37A 1W3FA 3R4SA 4H04A 3WN1A 2VXRA 1W2TA 4I1BA 5C0PA 2FDBM 3UGHA 3FJEA 2QQUA 1ISVA 1E0OA 1DIWA 2NP0A 4N1IA 1RG8A 3O4DA 4GP0A 5GLLA 3AZWA 4I8MA 3OJVA 1EYLA 2LIQA 5FZZA 4OW4A 3VWCA 1UYPA 4D47A 5B6TA 3KMVA 4KCAA 4FVVA 2VLCA 3BB2A 1S0EA 4ISRA 3WPZA 3O3QA 5GLMA 4MLGA 3LLPA 4ONZA 5B6SA 1JTCA 3BA7A 4U6DA 2D7IA 5FLWA 5JOYA 2AEYA 5FNXA 5FMDA 3W9TA 3R4ZA 3OJ2A 1NUNA 2BEBA 4DEPA 1Y7BA 3VSRA 4OWKA 2F2FA 4OEEA 2Y9WC 3OM6A 5FKBA 5JMCA 1FGAA 3LDRA 3I2XA 4USPA 2NVHA 2IHOA 3RTIB 1HWOB 1EV2A 1MD6A 1QQKA 2M49A 4ZA3B 1DJSB 3WASA 4ZBVB 1Q03A 4AK5A 3LIGA 5GLKA 1ILR1 4D0ZA 3NBEA 2EXIA 1SR4A 1S0FA 4ZFUB 3UJ4A 1XG6A 1FWVA 2KH2A 5F8YA 3O4AA 4LO3A 3UGFA 3HN1A 1S0GA 3WO3A 5BXSA 4IONA 4QQSA 1GYEB 3OBTA 4LO2C 5DVHA 3C2UA 2Y9XE 2F2FC 3BAVA 3CA6A 3O44A 1W3GA 4ZKTB 3BYLA 1VKDA 3C7OA 2ADDA 3H6QA 4EB2B 3ZXLA 1BFCA 3D7WB 3CQAA 4GAIA 3OM2A 4OWJA 5FKCA 2FGFA 4EKXB 7I1BA 4H9WA 2VU9A 5EC5A 3BRGC 4J2SA 4JAWA 3CU9A 2NM1A 3D5ZA 3ZXKA 1V6VA 1I1EA 1DZCA 5JOWA 1AVUA 3D61A 1WL7A 3LTQA 1BLDA 4XFUA 4DENA 1YI7A 4UDGA 4G6MA 3IM6A 4XFTA 4KEKA 3V0BA 5EG6C 2Y9GA 3BA5A 5GLRA 2HZ9A 1BA7A 4PC4A 2HWAA 3MPPG 3TAWA 3WO4A 2D24A 4OUJA 3WMVA 5AYEA 1OQLB 3C9ZA 3C7GA 2HW9A 3BA4A 1T9FA 4FFHA 4I6IA 4LO1A 1BLAA 3H6SE 1IILA 1FQ9A 1N4KA 3E8LC 2XOAA 1UV4A 4I4YA 4IY8A 1WBAA 3ZC8A 1AFCA 1DQOA 3NBCA 3IM7A 3OM4A 3Q7YA 4J2KA 2NYYA 1YRZA 1JLXA 3CAHA 1ISXA 1DFQA 2DS0A 3FJIA 4O8PA 3OGFA 3Q7WA 1TWEA 1G9BA 2NTDA 1IRPA 1CE7B 2K43A 2P23A 5HPZA 2YFRA 3BYKA 3WPUA 4PVAA 1FN0A 5D62A 3UD8A 3PIGA 5AYCA 4QD2C 4UDKA 3A23A 3FUOA 2B4WA 1G9AA 2AC1A 1Y9MA 1FV3A 3QC2A 4ZFYB 4A7KA 3NBNA 2EXKA 4U6BA 1MC9A 2X2TA 4FFGA 3WMZA 2ZQOA 1Q1UA 1WD4A 5FZYA 1ISWA 5F8WA 4EFQA 1AVAC 3BAHA 3VEQA 5JOXA 3A07A 2OXBA 2VXTI 2AFGA 4I4XA 1XYFA 21BIA 4IY9A 1P63A 2R9KB 3P2NA 2EXJA 4D8HA 4AK7A 1WD3A 3R4UA 4I4SA 4QKRA 4UDJA 1T4QA 3OJMA 3POKA 3S8KA 3ZXJA 3N7KA 2VSEA 3FJDA 1Z2VA 1SZ6B 1HCEA 8I1BA 5GAQA 4KC8A 4ZLBB 3AKFA 3QYDA 4EQVA 2AXMA 1S0BA 4KC3A 3HSMA 4XKIA 3RTJB 1Q04A 4Q91A 3BTAA 3AH4A 4I4PA 4QBCA 3BX1C 3FJ8A 3VUOA 3EF2A 3VSFA 4ZGRB 3FJKA 3PIJA 4LO2A 3C7EA 5DSSB 5DUYA 3LDKA 5B2HA 6I1BA 3AKIA 3HBWA 4OEFA 3AH1A 1W3AA 2Z49A 3CA4A 1WBCA 4LO0C 4Z8SB 2YFTA 3CA1A 1M2TB 2WBCA 1BFBA 4J2XA 1OYGA 1D0HA 1S0CA 4HA2A 3ZXGA 2EXHA 3LF7A 4EEEB 3UJ0A 5A7VA 2MLLB 4I0YA 3VT2A 1QQLA 1TTUA 3MALA 2QYIB 4DCKC 5BQUC 4PVIA 1S0LA 3RMXA 1FV2A 1EVTA 1KNMA 3FJFA 1L2HA 3FGMA 5F90A 2DRYA 4Q9GA 5EHAA 2GO2A 1GYDB 1GGPB 1ISZA 3O4CA 1RZOB 4F34A 5GLPA 4ZFWB 4Q9PA 3FUQA 3BRFA 2VDTA 3TC2A 3VT1A 3P6IA 3A21A 4AN7B 4JKXB 4L4IA 1PC8B 2D43A 4G9NA 5FNWA 3I29B 3O5WB 4EFRA 3O4BA 4I4VA 4EFPA 1HKNA 4P0KA 3C7HA 4I2SA 2QQWA 4GOVA 4KEJA 5D63A 1JT5A 1FMZA 4QALA 1JT4A 4KEIA 4KBBA 2AEZA 2E4MC 5A7VB 2WRYA 4LO8B 2DRZA 2FO1A 1JLYA 3ZX7A 1G9CA 2FFUA 3ZC9A 4I3NA 1AVWB 1A8DA 1HCDA 1JT7A 1TOOA 2KI6B 3K1XA 4COTA 4TLPA 1GYHA 3OGGA 2ET2A 1M16A 1V6WA 4LO7C 1JQZA 3ZXDA 3PHZA 3CRGA 4JQ0A 5BVPI 2P39A 5DZUA 1HWNB 4O8NA 3FJ9A 4O8OA 4FGFA 3R4YA 4I37A 1Z4SA 3KSTA 1K5UA 1EPWA 3O49A 3KF5A 4JP0A 2RQ9A 3I2AA 3N0KA 5I1BA 1PT2A 2BEAA 5BP5C 2HWMA 3IM5A 4QO3A 4YOLA 3D60A 2D44A 2GZBA 2D7RA 3CA5A 3NJ5A 3BAQA 1DLLA 1IHKA 3V79C 1J0SA 3LV4A 2AQZA 1YIFA 4A7ZA 3IIRA 2D23A 2K8RA 3SNVA 1F31A 4I4UA 5GLNA 4QD2B 2L5XA 2ADEA 3BYJA 2KKIA 3OBRA 3RMYA 4JRAA 1DQGA 3F62B 3O4OA 3UGGA 1G9DA 3UDAA 4G1RA 5BQUA 2X8TA 4AK6A 5GLQA 5FIXA 5E24E 3WATA 3WAUA 4QBVA 3U75A 1BFFA 3AJ5A 3WMUA 4AN6A 4LO0A 2FFVA 1YXWA 3QEDA 1TWMA 4HR6C 3BAGA 2BFHA 1Y9GA 1RY7A 2ZQNA 3NBDA 4J2YA 3WO2A 2AAIB 3AH2A 2I1BA 3H6RB 1PWAA 31BIA 3PG0A 2ZR1B 4X38A
chains in the Genus database with same CATH superfamily
4GAFA 5BXRA 2Q9XA 3WMYA 4H75A 5FZUA 4F83A 4I4OA 3JUTA 3UD7A 2Z48A 3VSZA 4OEGA 2RG9B 3CU1B 3HMYA 2MC2A 3CRIA 2DREA 1ITBA 4OWLA 4XFSA 4I4QA 3P6JA 2X8FA 1HWMB 4R6UB 3BAOA 2YFSA 4KCBA 3WINC 2D20A 1YTOA 5FK7A 3JRRA 3WPYA 1II4A 3BRDA 5BXTA 4GP3A 3HOMA 1S0DA 4G9MA 3RWKX 5BXPA 5FMCA 4P6AA 4WBCA 1ST8A 4II0A 3FJHA 2VUAA 3LIHA 2KLLA 3NQHA 1ISYA 1K5VA 1DFCA 4X3AA 2E4MA 1TP0A 1ABRB 1IRAX 4FFIA 4USOA 1IJTA 3N7MA 4I96A 3C7FA 5C2MA 1AXMA 2D1ZA 1BFGA 3D5YA 1PUUB 3QEEA 4IZXA 2QN4A 2ERMA 2KI4A 3OM7A 1JT3A 2RSTA 4ISQA 3VT0A 3CRHA 5D61A 3OM5A 4N2RA 3VSSA 2XQRA 1V6XA 4ENDA 4IZEA 3LEMA 3WN2A 2K4AB 1IT0A 1BASA 2D22A 2Y9FA 3FJCA 3RSJA 2ESUA 3FFZA 1BARA 2MIBA 1TL2A 3FJAA 1VCLA 3UD9A 5BP5A 3A22A 3BAUA 1PZZA 3AKHA 1IOBA 4N2ZA 3QZ4A 9ILBA 2QQVA 4KMIA 4X39A 1W18A 3FJJA 3BADA 3Q7XA 4QC4A 5BOWA 4Z9WB 1R8OA 3PMEA 5FMBA 4UDIA 1XZZA 5G00A 3N7JA 3HALA 1Z0HA 3WA1A 3V0AA 1HIBA 3U14A 3AZVA 3LFIA 4NOVA 4L4HA 1AVXB 1YYNA 4IQPA 1YBIA 4G6JA 2Q3NB 4JPZA 1UPSA 1Y4WA 3WN0A 1I1BA 4LO7B 5AYDA 2YUGA 1FWUA 2F8XC 1R8NA 3T8SA 3SC7X 41BIA 3P53A 1NZKA 5F8SA 4D0TA 1G82A 3AKGA 4I7IA 1SR4C 4I4RA 4ZOTA 1AF9A 3KF3A 3CA0A 4FFFA 1CVSA 4HJJA 5JLVA 4UDKE 1XHBA 2J3PA 3H6RA 3IAGC 2UUSA 4GOYA 4LO3C 2IWTB 5FK8A 4J23B 4CJMA 3QR5A 3R67A 5A8CA 3N7LA 3QEFA 4KC7A 2X8SA 5AY9A 4N4BA 5ANNA 3WPVA 1QXMA 1FMMS 4IHZA 3BYNA 2LIEA 3V0AB 1YF8B 3B9UA 3K1UA 1PUMB 3PUBA 3WINA 4P0JA 4QKSA 4JKQA 4P0LA 3S8JA 5A8DA 1RMLA 3AJ6A 3V0BB 2X2SA 1HWPB 1TIEA 1TFMB 4IYBA 3ILAA 4A7YA 2NZ9A 1JY0A 3CA3A 1DZDA 4I1EA 1V6UA 3FJBA 4LO1C 5GLOA 1ONKB 5JOZA 2VSAA 3F1RA 4X37A 1W3FA 3R4SA 4H04A 3WN1A 2VXRA 1W2TA 4I1BA 5C0PA 2FDBM 3UGHA 3FJEA 2QQUA 1ISVA 1E0OA 1DIWA 2NP0A 4N1IA 1RG8A 3O4DA 4GP0A 5GLLA 3AZWA 4I8MA 3OJVA 1EYLA 2LIQA 5FZZA 4OW4A 3VWCA 1UYPA 4D47A 5B6TA 3KMVA 4KCAA 4FVVA 2VLCA 3BB2A 1S0EA 4ISRA 3WPZA 3O3QA 5GLMA 4MLGA 3LLPA 4ONZA 5B6SA 1JTCA 3BA7A 4U6DA 2D7IA 5FLWA 5JOYA 2AEYA 5FNXA 5FMDA 3W9TA 3R4ZA 3OJ2A 1NUNA 2BEBA 4DEPA 1Y7BA 3VSRA 4OWKA 2F2FA 4OEEA 2Y9WC 3OM6A 5FKBA 5JMCA 1FGAA 3LDRA 3I2XA 4USPA 2NVHA 2IHOA 3RTIB 1HWOB 1EV2A 1MD6A 1QQKA 2M49A 4ZA3B 1DJSB 3WASA 4ZBVB 1Q03A 4AK5A 3LIGA 5GLKA 1ILR1 4D0ZA 3NBEA 2EXIA 1SR4A 1S0FA 4ZFUB 3UJ4A 1XG6A 1FWVA 2KH2A 5F8YA 3O4AA 4LO3A 3UGFA 3HN1A 1S0GA 3WO3A 5BXSA 4IONA 4QQSA 1GYEB 3OBTA 4LO2C 5DVHA 3C2UA 2Y9XE 2F2FC 3BAVA 3CA6A 3O44A 1W3GA 4ZKTB 3BYLA 1VKDA 3C7OA 2ADDA 3H6QA 4EB2B 3ZXLA 1BFCA 3D7WB 3CQAA 4GAIA 3OM2A 4OWJA 5FKCA 2FGFA 4EKXB 7I1BA 4H9WA 2VU9A 5EC5A 3BRGC 4J2SA 4JAWA 3CU9A 2NM1A 3D5ZA 3ZXKA 1V6VA 1I1EA 1DZCA 5JOWA 1AVUA 3D61A 1WL7A 3LTQA 1BLDA 4XFUA 4DENA 1YI7A 4UDGA 4G6MA 3IM6A 4XFTA 4KEKA 3V0BA 5EG6C 2Y9GA 3BA5A 5GLRA 2HZ9A 1BA7A 4PC4A 2HWAA 3MPPG 3TAWA 3WO4A 2D24A 4OUJA 3WMVA 5AYEA 1OQLB 3C9ZA 3C7GA 2HW9A 3BA4A 1T9FA 4FFHA 4I6IA 4LO1A 1BLAA 3H6SE 1IILA 1FQ9A 1N4KA 3E8LC 2XOAA 1UV4A 4I4YA 4IY8A 1WBAA 3ZC8A 1AFCA 1DQOA 3NBCA 3IM7A 3OM4A 3Q7YA 4J2KA 2NYYA 1YRZA 1JLXA 3CAHA 1ISXA 1DFQA 2DS0A 3FJIA 4O8PA 3OGFA 3Q7WA 1TWEA 1G9BA 2NTDA 1IRPA 1CE7B 2K43A 2P23A 5HPZA 2YFRA 3BYKA 3WPUA 4PVAA 1FN0A 5D62A 3UD8A 3PIGA 5AYCA 4QD2C 4UDKA 3A23A 3FUOA 2B4WA 2NS2A 1G9AA 2AC1A 1Y9MA 1FV3A 3QC2A 4ZFYB 4A7KA 3NBNA 2EXKA 4U6BA 1MC9A 2X2TA 4FFGA 3WMZA 2ZQOA 1Q1UA 1WD4A 5FZYA 1ISWA 5F8WA 4EFQA 1AVAC 3BAHA 3VEQA 5JOXA 3A07A 2OXBA 2VXTI 2AFGA 4I4XA 1XYFA 21BIA 4IY9A 1P63A 2R9KB 3P2NA 2EXJA 4D8HA 4AK7A 1WD3A 3R4UA 4I4SA 4QKRA 4UDJA 1T4QA 3OJMA 3POKA 3S8KA 3ZXJA 3N7KA 2VSEA 3FJDA 1Z2VA 1SZ6B 1HCEA 4UY4A 5GAQA 8I1BA 4KC8A 4ZLBB 3AKFA 3QYDA 4EQVA 2AXMA 1S0BA 4KC3A 3HSMA 4XKIA 3RTJB 1Q04A 4Q91A 3BTAA 3AH4A 4I4PA 4QBCA 3BX1C 3FJ8A 3VUOA 3EF2A 3VSFA 4ZGRB 3FJKA 3PIJA 4LO2A 3C7EA 5DSSB 5DUYA 3LDKA 5B2HA 6I1BA 3AKIA 3HBWA 4OEFA 3AH1A 1W3AA 2Z49A 3CA4A 1WBCA 4LO0C 4Z8SB 2YFTA 3CA1A 1M2TB 2WBCA 1BFBA 4J2XA 1OYGA 1D0HA 1S0CA 4HA2A 3ZXGA 2EXHA 3LF7A 4EEEB 3UJ0A 5A7VA 2MLLB 4I0YA 3VT2A 1QQLA 1TTUA 3MALA 2QYIB 4DCKC 5BQUC 4PVIA 1S0LA 3RMXA 1FV2A 1EVTA 1KNMA 3FJFA 1L2HA 3FGMA 5F90A 2DRYA 4Q9GA 5EHAA 2GO2A 1GYDB 1GGPB 1ISZA 3O4CA 1RZOB 4F34A 5GLPA 4ZFWB 4Q9PA 3FUQA 3BRFA 2VDTA 3TC2A 3VT1A 3P6IA 3A21A 4AN7B 4JKXB 4L4IA 1PC8B 2D43A 4G9NA 5FNWA 3I29B 3O5WB 4MZHA 4EFRA 3O4BA 4I4VA 4EFPA 1HKNA 4P0KA 3C7HA 4I2SA 2QQWA 4GOVA 4KEJA 5D63A 1JT5A 1FMZA 4MZFB 4QALA 1JT4A 4KEIA 4KBBA 2AEZA 2E4MC 5A7VB 2WRYA 4LO8B 2DRZA 2FO1A 1JLYA 3ZX7A 1G9CA 2FFUA 3ZC9A 4I3NA 1AVWB 1A8DA 1HCDA 1JT7A 1TOOA 2KI6B 3K1XA 4COTA 4TLPA 1GYHA 3OGGA 2ET2A 1M16A 1V6WA 4LO7C 1JQZA 3ZXDA 3PHZA 3CRGA 4JQ0A 5BVPI 2P39A 5DZUA 1HWNB 4O8NA 3FJ9A 4O8OA 4FGFA 3R4YA 4I37A 1Z4SA 3KSTA 1K5UA 1EPWA 3O49A 3KF5A 4JP0A 2RQ9A 3I2AA 3N0KA 5I1BA 1PT2A 2BEAA 5BP5C 2HWMA 3IM5A 4QO3A 4YOLA 3D60A 2D44A 2GZBA 2D7RA 3CA5A 3NJ5A 3BAQA 1DLLA 1IHKA 3V79C 1J0SA 3LV4A 2AQZA 1YIFA 4A7ZA 3IIRA 2D23A 2K8RA 3SNVA 1F31A 4I4UA 5GLNA 4QD2B 2L5XA 2ADEA 3BYJA 2KKIA 3OBRA 3RMYA 4JRAA 1DQGA 3F62B 3O4OA 3UGGA 1G9DA 3UDAA 4G1RA 5BQUA 2X8TA 4AK6A 5GLQA 5FIXA 5E24E 3WATA 4MZGB 3WAUA 4QBVA 3U75A 1BFFA 3AJ5A 3WMUA 4AN6A 4LO0A 2FFVA 1YXWA 3QEDA 1TWMA 4HR6C 3BAGA 2BFHA 1Y9GA 1RY7A 2ZQNA 3NBDA 4J2YA 3WO2A 2AAIB 3AH2A 2I1BA 3H6RB 1PWAA 31BIA 3PG0A 2ZR1B 4X38A
chains in the Genus database with same CATH topology
4GAFA 5BXRA 2Q9XA 3WMYA 4H75A 5FZUA 4F83A 4I4OA 3JUTA 3UD7A 2Z48A 3VSZA 4OEGA 2RG9B 3CU1B 3HMYA 2MC2A 3CRIA 2DREA 1ITBA 4OWLA 4XFSA 4I4QA 3P6JA 2X8FA 1HWMB 4R6UB 3BAOA 2YFSA 4KCBA 3WINC 2D20A 1YTOA 5FK7A 3JRRA 3WPYA 1II4A 3BRDA 5BXTA 4GP3A 3HOMA 1S0DA 4G9MA 3RWKX 5BXPA 5FMCA 4P6AA 4WBCA 1ST8A 4II0A 3FJHA 2VUAA 3LIHA 2KLLA 3NQHA 1ISYA 1K5VA 1DFCA 4X3AA 2E4MA 1TP0A 1ABRB 1IRAX 4FFIA 4USOA 1IJTA 3N7MA 4I96A 3C7FA 1AXMA 2D1ZA 1BFGA 3D5YA 1PUUB 3QEEA 4IZXA 2QN4A 2ERMA 2KI4A 3OM7A 1JT3A 2RSTA 4ISQA 3VT0A 3CRHA 5D61A 3OM5A 4N2RA 3VSSA 2XQRA 1V6XA 4ENDA 4IZEA 3LEMA 3WN2A 2K4AB 1IT0A 1BASA 2D22A 2Y9FA 3FJCA 3RSJA 2ESUA 3FFZA 1BARA 2MIBA 3FJAA 1VCLA 3UD9A 5BP5A 3A22A 3BAUA 1PZZA 3AKHA 1IOBA 4N2ZA 3QZ4A 9ILBA 2QQVA 4KMIA 4X39A 1W18A 3FJJA 3BADA 3Q7XA 4QC4A 5BOWA 4Z9WB 1R8OA 3PMEA 5FMBA 4UDIA 1XZZA 5G00A 3N7JA 3HALA 1Z0HA 3WA1A 3V0AA 1HIBA 3U14A 3AZVA 3LFIA 4NOVA 4L4HA 1AVXB 1YYNA 4IQPA 1YBIA 4G6JA 2Q3NB 4JPZA 1UPSA 1Y4WA 3WN0A 1I1BA 4LO7B 5AYDA 2YUGA 1FWUA 2F8XC 1R8NA 3T8SA 3SC7X 41BIA 3P53A 1NZKA 5F8SA 4D0TA 1G82A 3AKGA 4I7IA 1SR4C 4I4RA 4ZOTA 1AF9A 3KF3A 3CA0A 4FFFA 1CVSA 4HJJA 5JLVA 4UDKE 1XHBA 2J3PA 3H6RA 3IAGC 2UUSA 4GOYA 4LO3C 2IWTB 5FK8A 4J23B 4CJMA 3QR5A 3R67A 5A8CA 3N7LA 3QEFA 4KC7A 2X8SA 5AY9A 4N4BA 5ANNA 3WPVA 1QXMA 1FMMS 4IHZA 3BYNA 2LIEA 3V0AB 1YF8B 3B9UA 3K1UA 1PUMB 3PUBA 3WINA 4P0JA 4QKSA 4JKQA 4P0LA 3S8JA 5A8DA 1RMLA 3AJ6A 3V0BB 2X2SA 1HWPB 1TIEA 1TFMB 4IYBA 3ILAA 4A7YA 2NZ9A 1JY0A 3CA3A 1DZDA 4I1EA 1V6UA 3FJBA 4LO1C 5GLOA 1ONKB 5JOZA 2VSAA 3F1RA 4X37A 1W3FA 3R4SA 4H04A 3WN1A 2VXRA 1W2TA 4I1BA 5C0PA 2FDBM 3UGHA 3FJEA 2QQUA 1ISVA 1E0OA 1DIWA 2NP0A 4N1IA 1RG8A 3O4DA 4GP0A 5GLLA 3AZWA 4I8MA 3OJVA 1EYLA 2LIQA 5FZZA 4OW4A 3VWCA 1UYPA 4D47A 5B6TA 3KMVA 4KCAA 4FVVA 2VLCA 3BB2A 1S0EA 4ISRA 3WPZA 3O3QA 5GLMA 4MLGA 3LLPA 4ONZA 5B6SA 1JTCA 3BA7A 4U6DA 2D7IA 5FLWA 5JOYA 2AEYA 5FNXA 5FMDA 3W9TA 3R4ZA 3OJ2A 1NUNA 2BEBA 4DEPA 1Y7BA 3VSRA 4OWKA 2F2FA 4OEEA 2Y9WC 3OM6A 5FKBA 5JMCA 1FGAA 3LDRA 3I2XA 4USPA 2NVHA 2IHOA 3RTIB 1HWOB 1EV2A 1MD6A 1QQKA 2M49A 4ZA3B 1DJSB 3WASA 4ZBVB 1Q03A 4AK5A 3LIGA 5GLKA 1ILR1 4D0ZA 3NBEA 2EXIA 1SR4A 1S0FA 4ZFUB 3UJ4A 1XG6A 1FWVA 2KH2A 5F8YA 3O4AA 4LO3A 3UGFA 3HN1A 1S0GA 3WO3A 5BXSA 4IONA 4QQSA 1GYEB 3OBTA 4LO2C 5DVHA 3C2UA 2Y9XE 2F2FC 3BAVA 3CA6A 3O44A 1W3GA 4ZKTB 3BYLA 1VKDA 3C7OA 2ADDA 3H6QA 4EB2B 3ZXLA 1BFCA 3D7WB 3CQAA 4GAIA 3OM2A 4OWJA 5FKCA 2FGFA 4EKXB 7I1BA 4H9WA 2VU9A 5EC5A 3BRGC 4J2SA 4JAWA 3CU9A 2NM1A 3D5ZA 3ZXKA 1V6VA 1I1EA 1DZCA 5JOWA 1AVUA 3D61A 1WL7A 3LTQA 1BLDA 4XFUA 4DENA 1YI7A 4UDGA 4G6MA 3IM6A 4XFTA 4KEKA 3V0BA 5EG6C 2Y9GA 3BA5A 5GLRA 2HZ9A 1BA7A 4PC4A 2HWAA 3MPPG 3TAWA 3WO4A 2D24A 4OUJA 3WMVA 5AYEA 1OQLB 3C9ZA 3C7GA 2HW9A 3BA4A 1T9FA 4FFHA 4I6IA 4LO1A 1BLAA 3H6SE 1IILA 1FQ9A 1N4KA 3E8LC 2XOAA 1UV4A 4I4YA 4IY8A 1WBAA 3ZC8A 1AFCA 1DQOA 3NBCA 3IM7A 3OM4A 3Q7YA 4J2KA 2NYYA 1YRZA 1JLXA 3CAHA 1ISXA 1DFQA 2DS0A 3FJIA 4O8PA 3OGFA 3Q7WA 1TWEA 1G9BA 2NTDA 1IRPA 1CE7B 2K43A 2P23A 5HPZA 2YFRA 3BYKA 3WPUA 4PVAA 1FN0A 5D62A 3UD8A 3PIGA 5AYCA 4QD2C 4UDKA 3A23A 3FUOA 2B4WA 2NS2A 1G9AA 2AC1A 1Y9MA 1FV3A 3QC2A 4ZFYB 4A7KA 3NBNA 2EXKA 4U6BA 1MC9A 2X2TA 4FFGA 3WMZA 2ZQOA 1Q1UA 1WD4A 5FZYA 1ISWA 5F8WA 4EFQA 1AVAC 3BAHA 3VEQA 5JOXA 3A07A 2OXBA 2VXTI 2AFGA 4I4XA 1XYFA 21BIA 4IY9A 1P63A 2R9KB 3P2NA 2EXJA 4D8HA 4AK7A 1WD3A 3R4UA 4I4SA 4QKRA 4UDJA 1T4QA 3OJMA 3POKA 3S8KA 3ZXJA 3N7KA 2VSEA 3FJDA 1Z2VA 1SZ6B 1HCEA 4UY4A 5GAQA 8I1BA 4KC8A 4ZLBB 3AKFA 3QYDA 4EQVA 2AXMA 1S0BA 4KC3A 3HSMA 4XKIA 3RTJB 1Q04A 4Q91A 3BTAA 3AH4A 4I4PA 4QBCA 3BX1C 3FJ8A 3VUOA 3EF2A 3VSFA 4ZGRB 3FJKA 3PIJA 4LO2A 3C7EA 5DSSB 5DUYA 3LDKA 5B2HA 6I1BA 3AKIA 3HBWA 4OEFA 3AH1A 1W3AA 2Z49A 3CA4A 1WBCA 4LO0C 4Z8SB 2YFTA 3CA1A 1M2TB 2WBCA 1BFBA 4J2XA 1OYGA 1D0HA 1S0CA 4HA2A 3ZXGA 2EXHA 3LF7A 4EEEB 3UJ0A 5A7VA 2MLLB 4I0YA 3VT2A 1QQLA 1TTUA 3MALA 2QYIB 4DCKC 5BQUC 4PVIA 1S0LA 3RMXA 1FV2A 1EVTA 1KNMA 3FJFA 1L2HA 3FGMA 5F90A 2DRYA 4Q9GA 5EHAA 2GO2A 1GYDB 1GGPB 1ISZA 3O4CA 1RZOB 4F34A 5GLPA 4ZFWB 4Q9PA 3FUQA 3BRFA 2VDTA 3TC2A 3VT1A 3P6IA 3A21A 4AN7B 4JKXB 4L4IA 1PC8B 2D43A 4G9NA 5FNWA 3I29B 3O5WB 4MZHA 4EFRA 3O4BA 4I4VA 4EFPA 1HKNA 4P0KA 3C7HA 4I2SA 2QQWA 4GOVA 4KEJA 5D63A 1JT5A 1FMZA 4MZFB 4QALA 1JT4A 4KEIA 4KBBA 2AEZA 2E4MC 5A7VB 2WRYA 4LO8B 2DRZA 2FO1A 1JLYA 3ZX7A 1G9CA 2FFUA 3ZC9A 4I3NA 1AVWB 1A8DA 1HCDA 1JT7A 1TOOA 2KI6B 3K1XA 4COTA 4TLPA 1GYHA 3OGGA 2ET2A 1M16A 1V6WA 4LO7C 1JQZA 3ZXDA 3PHZA 3CRGA 4JQ0A 5BVPI 2P39A 5DZUA 1HWNB 4O8NA 3FJ9A 4O8OA 4FGFA 3R4YA 4I37A 1Z4SA 3KSTA 1K5UA 1EPWA 3O49A 3KF5A 4JP0A 2RQ9A 3I2AA 3N0KA 5I1BA 1PT2A 2BEAA 5BP5C 2HWMA 3IM5A 4QO3A 4YOLA 3D60A 2D44A 2GZBA 2D7RA 3CA5A 3NJ5A 3BAQA 1DLLA 1IHKA 3V79C 1J0SA 3LV4A 2AQZA 1YIFA 4A7ZA 3IIRA 2D23A 2K8RA 3SNVA 1F31A 4I4UA 5GLNA 4QD2B 2L5XA 2ADEA 3BYJA 2KKIA 3OBRA 3RMYA 4JRAA 1DQGA 3F62B 3O4OA 3UGGA 1G9DA 3UDAA 4G1RA 5BQUA 2X8TA 4AK6A 5GLQA 5FIXA 5E24E 3WATA 4MZGB 3WAUA 4QBVA 3U75A 1BFFA 3AJ5A 3WMUA 4AN6A 4LO0A 2FFVA 1YXWA 3QEDA 1TWMA 4HR6C 3BAGA 2BFHA 1Y9GA 1RY7A 2ZQNA 3NBDA 4J2YA 3WO2A 2AAIB 3AH2A 2I1BA 3H6RB 1PWAA 31BIA 3PG0A 2ZR1B 4X38A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GAF A;  5BXR A;  2Q9X A;  3WMY A;  5FZU A;  4F83 A;  4I4O A;  3JUT A;  3UD7 A;  2Z48 A;  3VSZ A;  4OEG A;  2RG9 B;  3CU1 B;  3HMY A;  2MC2 A;  3CRI A;  2DRE A;  1ITB A;  4OWL A;  4XFS A;  4I4Q A;  3P6J A;  2X8F A;  1HWM B;  4R6U B;  3BAO A;  2YFS A;  4KCB A;  3WIN C;  2D20 A;  1YTO A;  5FK7 A;  3JRR A;  3WPY A;  1II4 A;  3BRD A;  5BXT A;  4GP3 A;  3HOM A;  1S0D A;  4G9M A;  3RWK X;  5BXP A;  5FMC A;  4P6A A;  4WBC A;  1ST8 A;  4II0 A;  3FJH A;  2VUA A;  3LIH A;  2KLL A;  3NQH A;  1ISY A;  1K5V A;  1DFC A;  4X3A A;  2E4M A;  1TP0 A;  1ABR B;  1IRA X;  4FFI A;  4USO A;  1IJT A;  3N7M A;  4I96 A;  3C7F A;  1AXM A;  2D1Z A;  1BFG A;  3D5Y A;  1PUU B;  3QEE A;  4IZX A;  2QN4 A;  2ERM A;  2KI4 A;  3OM7 A;  1JT3 A;  2RST A;  4ISQ A;  3VT0 A;  3CRH A;  5D61 A;  3OM5 A;  4N2R A;  3VSS A;  2XQR A;  1V6X A;  4END A;  4IZE A;  3LEM A;  3WN2 A;  2K4A B;  1IT0 A;  1BAS A;  2D22 A;  2Y9F A;  3FJC A;  3RSJ A;  2ESU A;  3FFZ A;  1BAR A;  2MIB A;  3FJA A;  1VCL A;  3UD9 A;  5BP5 A;  3A22 A;  3BAU A;  1PZZ A;  3AKH A;  1IOB A;  4N2Z A;  3QZ4 A;  9ILB A;  2QQV A;  4KMI A;  4X39 A;  1W18 A;  3FJJ A;  3BAD A;  3Q7X A;  4QC4 A;  5BOW A;  4Z9W B;  1R8O A;  3PME A;  5FMB A;  4UDI A;  1XZZ A;  5G00 A;  3N7J A;  3HAL A;  1Z0H A;  3WA1 A;  3V0A A;  1HIB A;  3U14 A;  3AZV A;  3LFI A;  4NOV A;  4L4H A;  1AVX B;  1YYN A;  4IQP A;  1YBI A;  4G6J A;  2Q3N B;  4JPZ A;  1UPS A;  1Y4W A;  3WN0 A;  1I1B A;  4LO7 B;  5AYD A;  2YUG A;  1FWU A;  2F8X C;  1R8N A;  3T8S A;  3SC7 X;  41BI A;  3P53 A;  1NZK A;  5F8S A;  4D0T A;  1G82 A;  3AKG A;  4I7I A;  1SR4 C;  4I4R A;  4ZOT A;  1AF9 A;  3KF3 A;  3CA0 A;  4FFF A;  1CVS A;  4HJJ A;  5JLV A;  4UDK E;  1XHB A;  2J3P A;  3H6R A;  3IAG C;  2UUS A;  4GOY A;  4LO3 C;  2IWT B;  5FK8 A;  4J23 B;  4CJM A;  3QR5 A;  3R67 A;  5A8C A;  3N7L A;  3QEF A;  4KC7 A;  2X8S A;  5AY9 A;  4N4B A;  5ANN A;  3WPV A;  1QXM A;  1FMM S;  4IHZ A;  3BYN A;  2LIE A;  3V0A B;  1YF8 B;  3B9U A;  3K1U A;  1PUM B;  3PUB A;  3WIN A;  4P0J A;  4QKS A;  4JKQ A;  4P0L A;  3S8J A;  5A8D A;  1RML A;  3AJ6 A;  3V0B B;  2X2S A;  1HWP B;  1TIE A;  1TFM B;  4IYB A;  3ILA A;  4A7Y A;  2NZ9 A;  1JY0 A;  3CA3 A;  1DZD A;  4I1E A;  1V6U A;  3FJB A;  4LO1 C;  5GLO A;  1ONK B;  5JOZ A;  2VSA A;  3F1R A;  4X37 A;  1W3F A;  3R4S A;  4H04 A;  3WN1 A;  2VXR A;  1W2T A;  4I1B A;  5C0P A;  2FDB M;  3UGH A;  3FJE A;  2QQU A;  1ISV A;  1E0O A;  1DIW A;  2NP0 A;  4N1I A;  1RG8 A;  3O4D A;  4GP0 A;  5GLL A;  3AZW A;  4I8M A;  3OJV A;  1EYL A;  2LIQ A;  5FZZ A;  4OW4 A;  3VWC A;  1UYP A;  4D47 A;  5B6T A;  3KMV A;  4KCA A;  4FVV A;  2VLC A;  3BB2 A;  1S0E A;  4ISR A;  3WPZ A;  3O3Q A;  5GLM A;  4MLG A;  3LLP A;  4ONZ A;  5B6S A;  1JTC A;  3BA7 A;  4U6D A;  2D7I A;  5FLW A;  5JOY A;  2AEY A;  5FNX A;  5FMD A;  3W9T A;  3R4Z A;  3OJ2 A;  1NUN A;  2BEB A;  4DEP A;  1Y7B A;  3VSR A;  4OWK A;  2F2F A;  4OEE A;  2Y9W C;  3OM6 A;  5FKB A;  5JMC A;  1FGA A;  3LDR A;  3I2X A;  4USP A;  2NVH A;  2IHO A;  3RTI B;  1HWO B;  1EV2 A;  1MD6 A;  1QQK A;  2M49 A;  4ZA3 B;  1DJS B;  3WAS A;  4ZBV B;  1Q03 A;  4AK5 A;  3LIG A;  5GLK A;  1ILR 1;  4D0Z A;  3NBE A;  2EXI A;  1SR4 A;  1S0F A;  4ZFU B;  3UJ4 A;  1XG6 A;  1FWV A;  2KH2 A;  5F8Y A;  3O4A A;  4LO3 A;  3UGF A;  3HN1 A;  1S0G A;  3WO3 A;  5BXS A;  4ION A;  4QQS A;  1GYE B;  3OBT A;  4LO2 C;  5DVH A;  3C2U A;  2Y9X E;  2F2F C;  3BAV A;  3CA6 A;  3O44 A;  1W3G A;  4ZKT B;  3BYL A;  1VKD A;  3C7O A;  2ADD A;  3H6Q A;  4EB2 B;  3ZXL A;  1BFC A;  3D7W B;  3CQA A;  4GAI A;  3OM2 A;  4OWJ A;  5FKC A;  2FGF A;  4EKX B;  7I1B A;  4H9W A;  2VU9 A;  5EC5 A;  3BRG C;  4J2S A;  4JAW A;  3CU9 A;  2NM1 A;  3D5Z A;  3ZXK A;  1V6V A;  1I1E A;  1DZC A;  5JOW A;  1AVU A;  3D61 A;  1WL7 A;  3LTQ A;  1BLD A;  4XFU A;  4DEN A;  1YI7 A;  4UDG A;  4G6M A;  3IM6 A;  4XFT A;  4KEK A;  3V0B A;  5EG6 C;  2Y9G A;  3BA5 A;  5GLR A;  2HZ9 A;  1BA7 A;  4PC4 A;  2HWA A;  3MPP G;  3TAW A;  3WO4 A;  2D24 A;  4OUJ A;  3WMV A;  5AYE A;  1OQL B;  3C9Z A;  3C7G A;  2HW9 A;  3BA4 A;  1T9F A;  4FFH A;  4I6I A;  4LO1 A;  1BLA A;  3H6S E;  1IIL A;  1FQ9 A;  1N4K A;  3E8L C;  2XOA A;  1UV4 A;  4I4Y A;  4IY8 A;  1WBA A;  3ZC8 A;  1AFC A;  1DQO A;  3NBC A;  3IM7 A;  3OM4 A;  3Q7Y A;  4J2K A;  2NYY A;  1YRZ A;  1JLX A;  3CAH A;  1ISX A;  1DFQ A;  2DS0 A;  3FJI A;  4O8P A;  3OGF A;  3Q7W A;  1TWE A;  1G9B A;  2NTD A;  1IRP A;  1CE7 B;  2K43 A;  2P23 A;  5HPZ A;  2YFR A;  3BYK A;  3WPU A;  4PVA A;  1FN0 A;  5D62 A;  3UD8 A;  3PIG A;  5AYC A;  4QD2 C;  4UDK A;  3A23 A;  3FUO A;  2B4W A;  1G9A A;  2AC1 A;  1Y9M A;  1FV3 A;  3QC2 A;  4ZFY B;  4A7K A;  3NBN A;  2EXK A;  4U6B A;  1MC9 A;  2X2T A;  4FFG A;  3WMZ A;  2ZQO A;  1Q1U A;  1WD4 A;  5FZY A;  1ISW A;  5F8W A;  4EFQ A;  1AVA C;  3BAH A;  3VEQ A;  5JOX A;  3A07 A;  2OXB A;  2VXT I;  2AFG A;  4I4X A;  1XYF A;  21BI A;  4IY9 A;  1P63 A;  2R9K B;  3P2N A;  2EXJ A;  4D8H A;  4AK7 A;  1WD3 A;  3R4U A;  4I4S A;  4QKR A;  4UDJ A;  1T4Q A;  3OJM A;  3POK A;  3S8K A;  3ZXJ A;  3N7K A;  2VSE A;  3FJD A;  1Z2V A;  1SZ6 B;  1HCE A;  8I1B A;  5GAQ A;  4KC8 A;  4ZLB B;  3AKF A;  3QYD A;  4EQV A;  2AXM A;  1S0B A;  4KC3 A;  3HSM A;  4XKI A;  3RTJ B;  1Q04 A;  4Q91 A;  3BTA A;  3AH4 A;  4I4P A;  4QBC A;  3BX1 C;  3FJ8 A;  3VUO A;  3EF2 A;  3VSF A;  4ZGR B;  3FJK A;  3PIJ A;  4LO2 A;  3C7E A;  5DSS B;  5DUY A;  3LDK A;  5B2H A;  6I1B A;  3AKI A;  3HBW A;  4OEF A;  3AH1 A;  1W3A A;  2Z49 A;  3CA4 A;  1WBC A;  4LO0 C;  4Z8S B;  2YFT A;  3CA1 A;  1M2T B;  2WBC A;  1BFB A;  4J2X A;  1OYG A;  1D0H A;  1S0C A;  4HA2 A;  3ZXG A;  2EXH A;  3LF7 A;  4EEE B;  3UJ0 A;  5A7V A;  2MLL B;  4I0Y A;  3VT2 A;  1QQL A;  1TTU A;  3MAL A;  2QYI B;  4DCK C;  5BQU C;  4PVI A;  1S0L A;  3RMX A;  1FV2 A;  1EVT A;  1KNM A;  3FJF A;  1L2H A;  3FGM A;  5F90 A;  2DRY A;  4Q9G A;  5EHA A;  2GO2 A;  1GYD B;  1GGP B;  1ISZ A;  3O4C A;  1RZO B;  4F34 A;  5GLP A;  4ZFW B;  4Q9P A;  3FUQ A;  3BRF A;  2VDT A;  3TC2 A;  3VT1 A;  3P6I A;  3A21 A;  4AN7 B;  4JKX B;  4L4I A;  1PC8 B;  2D43 A;  4G9N A;  5FNW A;  3I29 B;  3O5W B;  4EFR A;  3O4B A;  4I4V A;  4EFP A;  1HKN A;  4P0K A;  3C7H A;  4I2S A;  2QQW A;  4GOV A;  4KEJ A;  5D63 A;  1JT5 A;  1FMZ A;  4QAL A;  1JT4 A;  4KEI A;  4KBB A;  2AEZ A;  2E4M C;  5A7V B;  2WRY A;  4LO8 B;  2DRZ A;  2FO1 A;  1JLY A;  3ZX7 A;  1G9C A;  2FFU A;  3ZC9 A;  4I3N A;  1AVW B;  1A8D A;  1HCD A;  1JT7 A;  1TOO A;  2KI6 B;  3K1X A;  4COT A;  4TLP A;  1GYH A;  3OGG A;  2ET2 A;  1M16 A;  1V6W A;  4LO7 C;  1JQZ A;  3ZXD A;  3PHZ A;  3CRG A;  4JQ0 A;  5BVP I;  2P39 A;  5DZU A;  1HWN B;  4O8N A;  3FJ9 A;  4O8O A;  4FGF A;  3R4Y A;  4I37 A;  1Z4S A;  3KST A;  1K5U A;  1EPW A;  3O49 A;  3KF5 A;  4JP0 A;  2RQ9 A;  3I2A A;  3N0K A;  5I1B A;  1PT2 A;  2BEA A;  5BP5 C;  2HWM A;  3IM5 A;  4QO3 A;  4YOL A;  3D60 A;  2D44 A;  2GZB A;  2D7R A;  3CA5 A;  3NJ5 A;  3BAQ A;  1DLL A;  1IHK A;  3V79 C;  1J0S A;  3LV4 A;  2AQZ A;  1YIF A;  4A7Z A;  3IIR A;  2D23 A;  2K8R A;  3SNV A;  1F31 A;  4I4U A;  5GLN A;  4QD2 B;  2L5X A;  2ADE A;  3BYJ A;  2KKI A;  3OBR A;  3RMY A;  4JRA A;  1DQG A;  3F62 B;  3O4O A;  3UGG A;  1G9D A;  3UDA A;  4G1R A;  5BQU A;  2X8T A;  4AK6 A;  5GLQ A;  5FIX A;  5E24 E;  3WAT A;  3WAU A;  4QBV A;  3U75 A;  1BFF A;  3AJ5 A;  3WMU A;  4AN6 A;  4LO0 A;  2FFV A;  1YXW A;  3QED A;  1TWM A;  4HR6 C;  3BAG A;  2BFH A;  1Y9G A;  1RY7 A;  2ZQN A;  3NBD A;  4J2Y A;  3WO2 A;  2AAI B;  3AH2 A;  2I1B A;  3H6R B;  1PWA A;  31BI A;  3PG0 A;  2ZR1 B;  4X38 A; 
#chains in the Genus database with same CATH topology
 4GAF A;  5BXR A;  2Q9X A;  3WMY A;  4H75 A;  5FZU A;  4F83 A;  4I4O A;  3JUT A;  3UD7 A;  2Z48 A;  3VSZ A;  4OEG A;  2RG9 B;  3CU1 B;  3HMY A;  2MC2 A;  3CRI A;  2DRE A;  1ITB A;  4OWL A;  4XFS A;  4I4Q A;  3P6J A;  2X8F A;  1HWM B;  4R6U B;  3BAO A;  2YFS A;  4KCB A;  3WIN C;  2D20 A;  1YTO A;  5FK7 A;  3JRR A;  3WPY A;  1II4 A;  3BRD A;  5BXT A;  4GP3 A;  3HOM A;  1S0D A;  4G9M A;  3RWK X;  5BXP A;  5FMC A;  4P6A A;  4WBC A;  1ST8 A;  4II0 A;  3FJH A;  2VUA A;  3LIH A;  2KLL A;  3NQH A;  1ISY A;  1K5V A;  1DFC A;  4X3A A;  2E4M A;  1TP0 A;  1ABR B;  1IRA X;  4FFI A;  4USO A;  1IJT A;  3N7M A;  4I96 A;  3C7F A;  5C2M A;  1AXM A;  2D1Z A;  1BFG A;  3D5Y A;  1PUU B;  3QEE A;  4IZX A;  2QN4 A;  2ERM A;  2KI4 A;  3OM7 A;  1JT3 A;  2RST A;  4ISQ A;  3VT0 A;  3CRH A;  5D61 A;  3OM5 A;  4N2R A;  3VSS A;  2XQR A;  1V6X A;  4END A;  4IZE A;  3LEM A;  3WN2 A;  2K4A B;  1IT0 A;  1BAS A;  2D22 A;  2Y9F A;  3FJC A;  3RSJ A;  2ESU A;  3FFZ A;  1BAR A;  2MIB A;  1TL2 A;  3FJA A;  1VCL A;  3UD9 A;  5BP5 A;  3A22 A;  3BAU A;  1PZZ A;  3AKH A;  1IOB A;  4N2Z A;  3QZ4 A;  9ILB A;  2QQV A;  4KMI A;  4X39 A;  1W18 A;  3FJJ A;  3BAD A;  3Q7X A;  4QC4 A;  5BOW A;  4Z9W B;  1R8O A;  3PME A;  5FMB A;  4UDI A;  1XZZ A;  5G00 A;  3N7J A;  3HAL A;  1Z0H A;  3WA1 A;  3V0A A;  1HIB A;  3U14 A;  3AZV A;  3LFI A;  4NOV A;  4L4H A;  1AVX B;  1YYN A;  4IQP A;  1YBI A;  4G6J A;  2Q3N B;  4JPZ A;  1UPS A;  1Y4W A;  3WN0 A;  1I1B A;  4LO7 B;  5AYD A;  2YUG A;  1FWU A;  2F8X C;  1R8N A;  3T8S A;  3SC7 X;  41BI A;  3P53 A;  1NZK A;  5F8S A;  4D0T A;  1G82 A;  3AKG A;  4I7I A;  1SR4 C;  4I4R A;  4ZOT A;  1AF9 A;  3KF3 A;  3CA0 A;  4FFF A;  1CVS A;  4HJJ A;  5JLV A;  4UDK E;  1XHB A;  2J3P A;  3H6R A;  3IAG C;  2UUS A;  4GOY A;  4LO3 C;  2IWT B;  5FK8 A;  4J23 B;  4CJM A;  3QR5 A;  3R67 A;  5A8C A;  3N7L A;  3QEF A;  4KC7 A;  2X8S A;  5AY9 A;  4N4B A;  5ANN A;  3WPV A;  1QXM A;  1FMM S;  4IHZ A;  3BYN A;  2LIE A;  3V0A B;  1YF8 B;  3B9U A;  3K1U A;  1PUM B;  3PUB A;  3WIN A;  4P0J A;  4QKS A;  4JKQ A;  4P0L A;  3S8J A;  5A8D A;  1RML A;  3AJ6 A;  3V0B B;  2X2S A;  1HWP B;  1TIE A;  1TFM B;  4IYB A;  3ILA A;  4A7Y A;  2NZ9 A;  1JY0 A;  3CA3 A;  1DZD A;  4I1E A;  1V6U A;  3FJB A;  4LO1 C;  5GLO A;  1ONK B;  5JOZ A;  2VSA A;  3F1R A;  4X37 A;  1W3F A;  3R4S A;  4H04 A;  3WN1 A;  2VXR A;  1W2T A;  4I1B A;  5C0P A;  2FDB M;  3UGH A;  3FJE A;  2QQU A;  1ISV A;  1E0O A;  1DIW A;  2NP0 A;  4N1I A;  1RG8 A;  3O4D A;  4GP0 A;  5GLL A;  3AZW A;  4I8M A;  3OJV A;  1EYL A;  2LIQ A;  5FZZ A;  4OW4 A;  3VWC A;  1UYP A;  4D47 A;  5B6T A;  3KMV A;  4KCA A;  4FVV A;  2VLC A;  3BB2 A;  1S0E A;  4ISR A;  3WPZ A;  3O3Q A;  5GLM A;  4MLG A;  3LLP A;  4ONZ A;  5B6S A;  1JTC A;  3BA7 A;  4U6D A;  2D7I A;  5FLW A;  5JOY A;  2AEY A;  5FNX A;  5FMD A;  3W9T A;  3R4Z A;  3OJ2 A;  1NUN A;  2BEB A;  4DEP A;  1Y7B A;  3VSR A;  4OWK A;  2F2F A;  4OEE A;  2Y9W C;  3OM6 A;  5FKB A;  5JMC A;  1FGA A;  3LDR A;  3I2X A;  4USP A;  2NVH A;  2IHO A;  3RTI B;  1HWO B;  1EV2 A;  1MD6 A;  1QQK A;  2M49 A;  4ZA3 B;  1DJS B;  3WAS A;  4ZBV B;  1Q03 A;  4AK5 A;  3LIG A;  5GLK A;  1ILR 1;  4D0Z A;  3NBE A;  2EXI A;  1SR4 A;  1S0F A;  4ZFU B;  3UJ4 A;  1XG6 A;  1FWV A;  2KH2 A;  5F8Y A;  3O4A A;  4LO3 A;  3UGF A;  3HN1 A;  1S0G A;  3WO3 A;  5BXS A;  4ION A;  4QQS A;  1GYE B;  3OBT A;  4LO2 C;  5DVH A;  3C2U A;  2Y9X E;  2F2F C;  3BAV A;  3CA6 A;  3O44 A;  1W3G A;  4ZKT B;  3BYL A;  1VKD A;  3C7O A;  2ADD A;  3H6Q A;  4EB2 B;  3ZXL A;  1BFC A;  3D7W B;  3CQA A;  4GAI A;  3OM2 A;  4OWJ A;  5FKC A;  2FGF A;  4EKX B;  7I1B A;  4H9W A;  2VU9 A;  5EC5 A;  3BRG C;  4J2S A;  4JAW A;  3CU9 A;  2NM1 A;  3D5Z A;  3ZXK A;  1V6V A;  1I1E A;  1DZC A;  5JOW A;  1AVU A;  3D61 A;  1WL7 A;  3LTQ A;  1BLD A;  4XFU A;  4DEN A;  1YI7 A;  4UDG A;  4G6M A;  3IM6 A;  4XFT A;  4KEK A;  3V0B A;  5EG6 C;  2Y9G A;  3BA5 A;  5GLR A;  2HZ9 A;  1BA7 A;  4PC4 A;  2HWA A;  3MPP G;  3TAW A;  3WO4 A;  2D24 A;  4OUJ A;  3WMV A;  5AYE A;  1OQL B;  3C9Z A;  3C7G A;  2HW9 A;  3BA4 A;  1T9F A;  4FFH A;  4I6I A;  4LO1 A;  1BLA A;  3H6S E;  1IIL A;  1FQ9 A;  1N4K A;  3E8L C;  2XOA A;  1UV4 A;  4I4Y A;  4IY8 A;  1WBA A;  3ZC8 A;  1AFC A;  1DQO A;  3NBC A;  3IM7 A;  3OM4 A;  3Q7Y A;  4J2K A;  2NYY A;  1YRZ A;  1JLX A;  3CAH A;  1ISX A;  1DFQ A;  2DS0 A;  3FJI A;  4O8P A;  3OGF A;  3Q7W A;  1TWE A;  1G9B A;  2NTD A;  1IRP A;  1CE7 B;  2K43 A;  2P23 A;  5HPZ A;  2YFR A;  3BYK A;  3WPU A;  4PVA A;  1FN0 A;  5D62 A;  3UD8 A;  3PIG A;  5AYC A;  4QD2 C;  4UDK A;  3A23 A;  3FUO A;  2B4W A;  2NS2 A;  1G9A A;  2AC1 A;  1Y9M A;  1FV3 A;  3QC2 A;  4ZFY B;  4A7K A;  3NBN A;  2EXK A;  4U6B A;  1MC9 A;  2X2T A;  4FFG A;  3WMZ A;  2ZQO A;  1Q1U A;  1WD4 A;  5FZY A;  1ISW A;  5F8W A;  4EFQ A;  1AVA C;  3BAH A;  3VEQ A;  5JOX A;  3A07 A;  2OXB A;  2VXT I;  2AFG A;  4I4X A;  1XYF A;  21BI A;  4IY9 A;  1P63 A;  2R9K B;  3P2N A;  2EXJ A;  4D8H A;  4AK7 A;  1WD3 A;  3R4U A;  4I4S A;  4QKR A;  4UDJ A;  1T4Q A;  3OJM A;  3POK A;  3S8K A;  3ZXJ A;  3N7K A;  2VSE A;  3FJD A;  1Z2V A;  1SZ6 B;  1HCE A;  4UY4 A;  5GAQ A;  8I1B A;  4KC8 A;  4ZLB B;  3AKF A;  3QYD A;  4EQV A;  2AXM A;  1S0B A;  4KC3 A;  3HSM A;  4XKI A;  3RTJ B;  1Q04 A;  4Q91 A;  3BTA A;  3AH4 A;  4I4P A;  4QBC A;  3BX1 C;  3FJ8 A;  3VUO A;  3EF2 A;  3VSF A;  4ZGR B;  3FJK A;  3PIJ A;  4LO2 A;  3C7E A;  5DSS B;  5DUY A;  3LDK A;  5B2H A;  6I1B A;  3AKI A;  3HBW A;  4OEF A;  3AH1 A;  1W3A A;  2Z49 A;  3CA4 A;  1WBC A;  4LO0 C;  4Z8S B;  2YFT A;  3CA1 A;  1M2T B;  2WBC A;  1BFB A;  4J2X A;  1OYG A;  1D0H A;  1S0C A;  4HA2 A;  3ZXG A;  2EXH A;  3LF7 A;  4EEE B;  3UJ0 A;  5A7V A;  2MLL B;  4I0Y A;  3VT2 A;  1QQL A;  1TTU A;  3MAL A;  2QYI B;  4DCK C;  5BQU C;  4PVI A;  1S0L A;  3RMX A;  1FV2 A;  1EVT A;  1KNM A;  3FJF A;  1L2H A;  3FGM A;  5F90 A;  2DRY A;  4Q9G A;  5EHA A;  2GO2 A;  1GYD B;  1GGP B;  1ISZ A;  3O4C A;  1RZO B;  4F34 A;  5GLP A;  4ZFW B;  4Q9P A;  3FUQ A;  3BRF A;  2VDT A;  3TC2 A;  3VT1 A;  3P6I A;  3A21 A;  4AN7 B;  4JKX B;  4L4I A;  1PC8 B;  2D43 A;  4G9N A;  5FNW A;  3I29 B;  3O5W B;  4MZH A;  4EFR A;  3O4B A;  4I4V A;  4EFP A;  1HKN A;  4P0K A;  3C7H A;  4I2S A;  2QQW A;  4GOV A;  4KEJ A;  5D63 A;  1JT5 A;  1FMZ A;  4MZF B;  4QAL A;  1JT4 A;  4KEI A;  4KBB A;  2AEZ A;  2E4M C;  5A7V B;  2WRY A;  4LO8 B;  2DRZ A;  2FO1 A;  1JLY A;  3ZX7 A;  1G9C A;  2FFU A;  3ZC9 A;  4I3N A;  1AVW B;  1A8D A;  1HCD A;  1JT7 A;  1TOO A;  2KI6 B;  3K1X A;  4COT A;  4TLP A;  1GYH A;  3OGG A;  2ET2 A;  1M16 A;  1V6W A;  4LO7 C;  1JQZ A;  3ZXD A;  3PHZ A;  3CRG A;  4JQ0 A;  5BVP I;  2P39 A;  5DZU A;  1HWN B;  4O8N A;  3FJ9 A;  4O8O A;  4FGF A;  3R4Y A;  4I37 A;  1Z4S A;  3KST A;  1K5U A;  1EPW A;  3O49 A;  3KF5 A;  4JP0 A;  2RQ9 A;  3I2A A;  3N0K A;  5I1B A;  1PT2 A;  2BEA A;  5BP5 C;  2HWM A;  3IM5 A;  4QO3 A;  4YOL A;  3D60 A;  2D44 A;  2GZB A;  2D7R A;  3CA5 A;  3NJ5 A;  3BAQ A;  1DLL A;  1IHK A;  3V79 C;  1J0S A;  3LV4 A;  2AQZ A;  1YIF A;  4A7Z A;  3IIR A;  2D23 A;  2K8R A;  3SNV A;  1F31 A;  4I4U A;  5GLN A;  4QD2 B;  2L5X A;  2ADE A;  3BYJ A;  2KKI A;  3OBR A;  3RMY A;  4JRA A;  1DQG A;  3F62 B;  3O4O A;  3UGG A;  1G9D A;  3UDA A;  4G1R A;  5BQU A;  2X8T A;  4AK6 A;  5GLQ A;  5FIX A;  5E24 E;  3WAT A;  4MZG B;  3WAU A;  4QBV A;  3U75 A;  1BFF A;  3AJ5 A;  3WMU A;  4AN6 A;  4LO0 A;  2FFV A;  1YXW A;  3QED A;  1TWM A;  4HR6 C;  3BAG A;  2BFH A;  1Y9G A;  1RY7 A;  2ZQN A;  3NBD A;  4J2Y A;  3WO2 A;  2AAI B;  3AH2 A;  2I1B A;  3H6R B;  1PWA A;  31BI A;  3PG0 A;  2ZR1 B;  4X38 A; 
#chains in the Genus database with same CATH homology
 4GAF A;  5BXR A;  2Q9X A;  3WMY A;  4H75 A;  5FZU A;  4F83 A;  4I4O A;  3JUT A;  3UD7 A;  2Z48 A;  3VSZ A;  4OEG A;  2RG9 B;  3CU1 B;  3HMY A;  2MC2 A;  3CRI A;  2DRE A;  1ITB A;  4OWL A;  4XFS A;  4I4Q A;  3P6J A;  2X8F A;  1HWM B;  4R6U B;  3BAO A;  2YFS A;  4KCB A;  3WIN C;  2D20 A;  1YTO A;  5FK7 A;  3JRR A;  3WPY A;  1II4 A;  3BRD A;  5BXT A;  4GP3 A;  3HOM A;  1S0D A;  4G9M A;  3RWK X;  5BXP A;  5FMC A;  4P6A A;  4WBC A;  1ST8 A;  4II0 A;  3FJH A;  2VUA A;  3LIH A;  2KLL A;  3NQH A;  1ISY A;  1K5V A;  1DFC A;  4X3A A;  2E4M A;  1TP0 A;  1ABR B;  1IRA X;  4FFI A;  4USO A;  1IJT A;  3N7M A;  4I96 A;  3C7F A;  1AXM A;  2D1Z A;  1BFG A;  3D5Y A;  1PUU B;  3QEE A;  4IZX A;  2QN4 A;  2ERM A;  2KI4 A;  3OM7 A;  1JT3 A;  2RST A;  4ISQ A;  3VT0 A;  3CRH A;  5D61 A;  3OM5 A;  4N2R A;  3VSS A;  2XQR A;  1V6X A;  4END A;  4IZE A;  3LEM A;  3WN2 A;  2K4A B;  1IT0 A;  1BAS A;  2D22 A;  2Y9F A;  3FJC A;  3RSJ A;  2ESU A;  3FFZ A;  1BAR A;  2MIB A;  3FJA A;  1VCL A;  3UD9 A;  5BP5 A;  3A22 A;  3BAU A;  1PZZ A;  3AKH A;  1IOB A;  4N2Z A;  3QZ4 A;  9ILB A;  2QQV A;  4KMI A;  4X39 A;  1W18 A;  3FJJ A;  3BAD A;  3Q7X A;  4QC4 A;  5BOW A;  4Z9W B;  1R8O A;  3PME A;  5FMB A;  4UDI A;  1XZZ A;  5G00 A;  3N7J A;  3HAL A;  1Z0H A;  3WA1 A;  3V0A A;  1HIB A;  3U14 A;  3AZV A;  3LFI A;  4NOV A;  4L4H A;  1AVX B;  1YYN A;  4IQP A;  1YBI A;  4G6J A;  2Q3N B;  4JPZ A;  1UPS A;  1Y4W A;  3WN0 A;  1I1B A;  4LO7 B;  5AYD A;  2YUG A;  1FWU A;  2F8X C;  1R8N A;  3T8S A;  3SC7 X;  41BI A;  3P53 A;  1NZK A;  5F8S A;  4D0T A;  1G82 A;  3AKG A;  4I7I A;  1SR4 C;  4I4R A;  4ZOT A;  1AF9 A;  3KF3 A;  3CA0 A;  4FFF A;  1CVS A;  4HJJ A;  5JLV A;  4UDK E;  1XHB A;  2J3P A;  3H6R A;  3IAG C;  2UUS A;  4GOY A;  4LO3 C;  2IWT B;  5FK8 A;  4J23 B;  4CJM A;  3QR5 A;  3R67 A;  5A8C A;  3N7L A;  3QEF A;  4KC7 A;  2X8S A;  5AY9 A;  4N4B A;  5ANN A;  3WPV A;  1QXM A;  1FMM S;  4IHZ A;  3BYN A;  2LIE A;  3V0A B;  1YF8 B;  3B9U A;  3K1U A;  1PUM B;  3PUB A;  3WIN A;  4P0J A;  4QKS A;  4JKQ A;  4P0L A;  3S8J A;  5A8D A;  1RML A;  3AJ6 A;  3V0B B;  2X2S A;  1HWP B;  1TIE A;  1TFM B;  4IYB A;  3ILA A;  4A7Y A;  2NZ9 A;  1JY0 A;  3CA3 A;  1DZD A;  4I1E A;  1V6U A;  3FJB A;  4LO1 C;  5GLO A;  1ONK B;  5JOZ A;  2VSA A;  3F1R A;  4X37 A;  1W3F A;  3R4S A;  4H04 A;  3WN1 A;  2VXR A;  1W2T A;  4I1B A;  5C0P A;  2FDB M;  3UGH A;  3FJE A;  2QQU A;  1ISV A;  1E0O A;  1DIW A;  2NP0 A;  4N1I A;  1RG8 A;  3O4D A;  4GP0 A;  5GLL A;  3AZW A;  4I8M A;  3OJV A;  1EYL A;  2LIQ A;  5FZZ A;  4OW4 A;  3VWC A;  1UYP A;  4D47 A;  5B6T A;  3KMV A;  4KCA A;  4FVV A;  2VLC A;  3BB2 A;  1S0E A;  4ISR A;  3WPZ A;  3O3Q A;  5GLM A;  4MLG A;  3LLP A;  4ONZ A;  5B6S A;  1JTC A;  3BA7 A;  4U6D A;  2D7I A;  5FLW A;  5JOY A;  2AEY A;  5FNX A;  5FMD A;  3W9T A;  3R4Z A;  3OJ2 A;  1NUN A;  2BEB A;  4DEP A;  1Y7B A;  3VSR A;  4OWK A;  2F2F A;  4OEE A;  2Y9W C;  3OM6 A;  5FKB A;  5JMC A;  1FGA A;  3LDR A;  3I2X A;  4USP A;  2NVH A;  2IHO A;  3RTI B;  1HWO B;  1EV2 A;  1MD6 A;  1QQK A;  2M49 A;  4ZA3 B;  1DJS B;  3WAS A;  4ZBV B;  1Q03 A;  4AK5 A;  3LIG A;  5GLK A;  1ILR 1;  4D0Z A;  3NBE A;  2EXI A;  1SR4 A;  1S0F A;  4ZFU B;  3UJ4 A;  1XG6 A;  1FWV A;  2KH2 A;  5F8Y A;  3O4A A;  4LO3 A;  3UGF A;  3HN1 A;  1S0G A;  3WO3 A;  5BXS A;  4ION A;  4QQS A;  1GYE B;  3OBT A;  4LO2 C;  5DVH A;  3C2U A;  2Y9X E;  2F2F C;  3BAV A;  3CA6 A;  3O44 A;  1W3G A;  4ZKT B;  3BYL A;  1VKD A;  3C7O A;  2ADD A;  3H6Q A;  4EB2 B;  3ZXL A;  1BFC A;  3D7W B;  3CQA A;  4GAI A;  3OM2 A;  4OWJ A;  5FKC A;  2FGF A;  4EKX B;  7I1B A;  4H9W A;  2VU9 A;  5EC5 A;  3BRG C;  4J2S A;  4JAW A;  3CU9 A;  2NM1 A;  3D5Z A;  3ZXK A;  1V6V A;  1I1E A;  1DZC A;  5JOW A;  1AVU A;  3D61 A;  1WL7 A;  3LTQ A;  1BLD A;  4XFU A;  4DEN A;  1YI7 A;  4UDG A;  4G6M A;  3IM6 A;  4XFT A;  4KEK A;  3V0B A;  5EG6 C;  2Y9G A;  3BA5 A;  5GLR A;  2HZ9 A;  1BA7 A;  4PC4 A;  2HWA A;  3MPP G;  3TAW A;  3WO4 A;  2D24 A;  4OUJ A;  3WMV A;  5AYE A;  1OQL B;  3C9Z A;  3C7G A;  2HW9 A;  3BA4 A;  1T9F A;  4FFH A;  4I6I A;  4LO1 A;  1BLA A;  3H6S E;  1IIL A;  1FQ9 A;  1N4K A;  3E8L C;  2XOA A;  1UV4 A;  4I4Y A;  4IY8 A;  1WBA A;  3ZC8 A;  1AFC A;  1DQO A;  3NBC A;  3IM7 A;  3OM4 A;  3Q7Y A;  4J2K A;  2NYY A;  1YRZ A;  1JLX A;  3CAH A;  1ISX A;  1DFQ A;  2DS0 A;  3FJI A;  4O8P A;  3OGF A;  3Q7W A;  1TWE A;  1G9B A;  2NTD A;  1IRP A;  1CE7 B;  2K43 A;  2P23 A;  5HPZ A;  2YFR A;  3BYK A;  3WPU A;  4PVA A;  1FN0 A;  5D62 A;  3UD8 A;  3PIG A;  5AYC A;  4QD2 C;  4UDK A;  3A23 A;  3FUO A;  2B4W A;  2NS2 A;  1G9A A;  2AC1 A;  1Y9M A;  1FV3 A;  3QC2 A;  4ZFY B;  4A7K A;  3NBN A;  2EXK A;  4U6B A;  1MC9 A;  2X2T A;  4FFG A;  3WMZ A;  2ZQO A;  1Q1U A;  1WD4 A;  5FZY A;  1ISW A;  5F8W A;  4EFQ A;  1AVA C;  3BAH A;  3VEQ A;  5JOX A;  3A07 A;  2OXB A;  2VXT I;  2AFG A;  4I4X A;  1XYF A;  21BI A;  4IY9 A;  1P63 A;  2R9K B;  3P2N A;  2EXJ A;  4D8H A;  4AK7 A;  1WD3 A;  3R4U A;  4I4S A;  4QKR A;  4UDJ A;  1T4Q A;  3OJM A;  3POK A;  3S8K A;  3ZXJ A;  3N7K A;  2VSE A;  3FJD A;  1Z2V A;  1SZ6 B;  1HCE A;  4UY4 A;  5GAQ A;  8I1B A;  4KC8 A;  4ZLB B;  3AKF A;  3QYD A;  4EQV A;  2AXM A;  1S0B A;  4KC3 A;  3HSM A;  4XKI A;  3RTJ B;  1Q04 A;  4Q91 A;  3BTA A;  3AH4 A;  4I4P A;  4QBC A;  3BX1 C;  3FJ8 A;  3VUO A;  3EF2 A;  3VSF A;  4ZGR B;  3FJK A;  3PIJ A;  4LO2 A;  3C7E A;  5DSS B;  5DUY A;  3LDK A;  5B2H A;  6I1B A;  3AKI A;  3HBW A;  4OEF A;  3AH1 A;  1W3A A;  2Z49 A;  3CA4 A;  1WBC A;  4LO0 C;  4Z8S B;  2YFT A;  3CA1 A;  1M2T B;  2WBC A;  1BFB A;  4J2X A;  1OYG A;  1D0H A;  1S0C A;  4HA2 A;  3ZXG A;  2EXH A;  3LF7 A;  4EEE B;  3UJ0 A;  5A7V A;  2MLL B;  4I0Y A;  3VT2 A;  1QQL A;  1TTU A;  3MAL A;  2QYI B;  4DCK C;  5BQU C;  4PVI A;  1S0L A;  3RMX A;  1FV2 A;  1EVT A;  1KNM A;  3FJF A;  1L2H A;  3FGM A;  5F90 A;  2DRY A;  4Q9G A;  5EHA A;  2GO2 A;  1GYD B;  1GGP B;  1ISZ A;  3O4C A;  1RZO B;  4F34 A;  5GLP A;  4ZFW B;  4Q9P A;  3FUQ A;  3BRF A;  2VDT A;  3TC2 A;  3VT1 A;  3P6I A;  3A21 A;  4AN7 B;  4JKX B;  4L4I A;  1PC8 B;  2D43 A;  4G9N A;  5FNW A;  3I29 B;  3O5W B;  4MZH A;  4EFR A;  3O4B A;  4I4V A;  4EFP A;  1HKN A;  4P0K A;  3C7H A;  4I2S A;  2QQW A;  4GOV A;  4KEJ A;  5D63 A;  1JT5 A;  1FMZ A;  4MZF B;  4QAL A;  1JT4 A;  4KEI A;  4KBB A;  2AEZ A;  2E4M C;  5A7V B;  2WRY A;  4LO8 B;  2DRZ A;  2FO1 A;  1JLY A;  3ZX7 A;  1G9C A;  2FFU A;  3ZC9 A;  4I3N A;  1AVW B;  1A8D A;  1HCD A;  1JT7 A;  1TOO A;  2KI6 B;  3K1X A;  4COT A;  4TLP A;  1GYH A;  3OGG A;  2ET2 A;  1M16 A;  1V6W A;  4LO7 C;  1JQZ A;  3ZXD A;  3PHZ A;  3CRG A;  4JQ0 A;  5BVP I;  2P39 A;  5DZU A;  1HWN B;  4O8N A;  3FJ9 A;  4O8O A;  4FGF A;  3R4Y A;  4I37 A;  1Z4S A;  3KST A;  1K5U A;  1EPW A;  3O49 A;  3KF5 A;  4JP0 A;  2RQ9 A;  3I2A A;  3N0K A;  5I1B A;  1PT2 A;  2BEA A;  5BP5 C;  2HWM A;  3IM5 A;  4QO3 A;  4YOL A;  3D60 A;  2D44 A;  2GZB A;  2D7R A;  3CA5 A;  3NJ5 A;  3BAQ A;  1DLL A;  1IHK A;  3V79 C;  1J0S A;  3LV4 A;  2AQZ A;  1YIF A;  4A7Z A;  3IIR A;  2D23 A;  2K8R A;  3SNV A;  1F31 A;  4I4U A;  5GLN A;  4QD2 B;  2L5X A;  2ADE A;  3BYJ A;  2KKI A;  3OBR A;  3RMY A;  4JRA A;  1DQG A;  3F62 B;  3O4O A;  3UGG A;  1G9D A;  3UDA A;  4G1R A;  5BQU A;  2X8T A;  4AK6 A;  5GLQ A;  5FIX A;  5E24 E;  3WAT A;  4MZG B;  3WAU A;  4QBV A;  3U75 A;  1BFF A;  3AJ5 A;  3WMU A;  4AN6 A;  4LO0 A;  2FFV A;  1YXW A;  3QED A;  1TWM A;  4HR6 C;  3BAG A;  2BFH A;  1Y9G A;  1RY7 A;  2ZQN A;  3NBD A;  4J2Y A;  3WO2 A;  2AAI B;  3AH2 A;  2I1B A;  3H6R B;  1PWA A;  31BI A;  3PG0 A;  2ZR1 B;  4X38 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...