3VTGA

High choriolytic enzyme 1 (hce-1), a hatching enzyme zinc-protease from oryzias latipes (medaka fish)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
200
structure length
200
Chain Sequence
NAMKCWSSSCFWKKASNGLVVIPYVISSEYSGGEVATIEGAMRAFNGKTCIRFVRRTNEYDFISVVSKTGCYSELGRKGGQQELSINRGGCMYSGIIQHELNHALGFQHEQTRSDRDSYVRINWENIIPASAYNFNKHDTNNLNTPYDYSSIMHYGRDAFSIAYGRDSITPIPNPNVPIGQRNGMSRWDITRINVLYNCR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords High choriolytic enzyme 1
publication title Crystal Structure of High choriolytic enzyme 1 (HCE-1), a hatching enzyme from Oryzias latipes (Medaka fish)
rcsb
molecule tags Hydrolase
total genus 71
structure length 200
sequence length 200
ec nomenclature ec 3.4.24.67: Choriolysin H.
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01400 Astacin Astacin (Peptidase family M12A)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3vtgA00
3NX7A 4I03A 4FVLA 3ZUKA 4FU4A 1ROSA 3K7LA 1BM6A 3L0TA 4JQGA 5CUHA 5JMYA 2JSDA 1HV5A 3AIGA 1IADA 1BZSA 2V4BA 3F1AA 4R3VA 1XFUA 1UMSA 1JK3A 4XBHA 2ERPA 2YB9A 3KHIA 1CQRA 1IAAA 2KRJA 1G49A 2MZIA 4GR3A 5I4OA 3EDZA 3F15A 3OHOA 2D1NA 3F19A 4IN9A 4H82A 1QJJA 1MMPA 3LILA 1B8YA 2WO8A 4ZR5A 1YCMA 1OM7A 1PWQA 2QPJA 3USNA 4PKUA 2OW0A 3DNGA 4G0DA 2JT6A 4H76A 3F16A 3VI1A 4A7BA 1EUBA 5I12A 1SRPA 4DF9A 1KUGA 2OW9A 1UTTA 2AIGP 1BUDA 2ERQA 5LABA 1OO9A 2O3EA 3P24A 3TSKA 2FV5A 3GBOA 1HTDA 4Q1LA 1D7XA 3TVCA 2MZHA 1O0TA 1QIAA 1XFWA 4GR0A 1JJ9A 1KUIA 1JIZA 2RJPA 4XM8A 4DV8A 3CKIA 2YIGA 1G4KA 1L6JA 5D3CA 2DDYA 1I1IP 5I3MA 3WV1A 3EDHA 3MA2A 3HDBA 1DMTA 1JAPA 1I76A 2K2GA 1G12A 1KUKA 1KUHA 3N2UA 1JH1A 4H3XA 2OVZA 1BSWA 3F18A 3HBUP 1XURA 1Z3JA 1Y0VA 3SHIA 3HY9A 1PWPA 4GUYA 1OS9A 3KMCA 2OXZA 1R1JA 1Q3AA 3F17A 2XS4A 4H2EA 4JPAA 2N8RA 1USNA 1MMRA 1ZTQA 3KECA 4I35A 2X3BA 1SLMA 4XCTA 1UMTA 3B8ZA 3TT4A 966CA 1GO8P 4PKQA 2MLRA 3K7NA 3B2ZA 4GQLA 2X3AA 4JIJA 830CA 1D8MA 5L7FA 1HY7A 2DW0A 1IAGA 1ZXCA 2W14A 4FXQA 2O36A 1BKCI 5I2ZA 3KWVC 1QJIA 1SMPA 4GR8A 1FBLA 1YP1A 1Y93A 4PKRA 1PWUA 1OS2A 2W13A 4XM6A 2USNA 3DPEA 2WOAA 2DDFA 2OXWA 2X3CA 4AXQA 5D1UA 3P1VA 1FLSA 4L6TA 4AUOA 5BOYA 3L0VA 2EROA 2W0DA 1WNIA 2AYKA 4WKEA 4WZVA 1MNCA 2FV9A 3HDAP 1JANA 1JIWP 2HU6A 2D1OA 1FM1A 3DSLA 1IACA 2Y6CA 3ZXHA 4QKZA 1KBCA 5CZMA 2JIHA 4IUWA 1IABA 2E3XA 2DW2A 3O2XA 1YQYA 1XFXA 2OY2A 3AYUA 3ELMA 1JAOA 5D7WA 3LJGA 3N2VA 3I7IA 1R1HA 5B5OA 2PJTA 5I43A 4IJOA 1HFSA 4HX3A 4H1QA 1ZXVA 1UEAA 4H84A 3OHLA 3Q2GA 4J4MA 3WV2A 3HB2P 3DWBA 1G9KA 3LK8A 4HMAA 3Q2HA 3LKAA 3LQ0A 2OW1A 3LE9A 1PWVA 1A86A 1OM6A 4WF6A 5D2BA 3DL1A 1QIBA 3LJZA 2K9CA 3G42A 1UTZA 3E8RA 4DPEA 2DW1A 4DD8A 3V96B 1G05A 1CGFA 4AYKA 3RTTA 2X7MA 1H71P 1D5JA 1D8FA 3WV3A 2XS3A 4PKSA 1C7KA 3LQBA 3DPFA 456CA 1C3IA 2A8HA 1S4BP 3HY7A 2OVXA 3O64A 2I47A 5BOTA 4AIGA 1AF0A 2JNPA 4JP4A 1GE7A 2Z2DA 1SLNA 3BA0A 4EFSA 2MLSA 5BPAA 2OZRA 5L79A 3KEKA 3ZVSA 2CLTA 4ILWD 3TS4A 4WK7A 1GXDA 1EB6A 4PKWA 4H30A 1BQQM 1ZS0A 2POJA 4FXYP 1QICA 2SRTA 2MZEA 3EWJA 1Y8JA 4PKTA 1OMJA 2L0RA 1J7NA 4WKIA 1GE5A 1CXVA 4L63A 1ATLA 3LUNA 4A3WA 1XFYA 5H8XA 3LUMA 5D1SA 1R1IA 1JKYA 1ND1A 3G5CA 1MMBA 1DTHA 5D1TA 2WO9A 1SATA 3LGPA 1ZP5A 1XUDA 2Y6DA 1XUCA 1SU3A 2OY4A 1XFZA 3B92A 1BQOA 2J0TA 2JT5A 1OM8A 4JA1A 3I7GA 4GWNA 3EHXA 1JAQA 1XFVA 2RJQA 1EAKA 2OI0A 1CIZA 4GF1A 5B5PA 1GO7P 1I73A 1RM8A 2OW2A 3EDIA 3KEJA 1AKLA 1R55A 1AYKA 4G9LA 1KUFA 2W15A 2W12A 2E2DA 3LEAA 1ASTA 1K7QA 3U1RA 1CAQA 1B3DA 1PWWA 1YOUA 1CK7A 1BKCE 1O0QA 5I0LA 1K7GA 3LIKA 1ZVXA 1CGEA 3EHYA 1BIWA 1BKCA 3KMEA 3VTGA 2J83A 4GWMA 4CTHA 1K7IA 3AYKA 2TCLA 3EDGA 1MMQA 1GKCA 3HYGA 1HOVA 1IAEA 1KAPP 4H49A 2OXUA 1A85A 3KRYA 1GKDA 1C8TA 1R54A 1HFCA 4XM7A 1CGLA 5CXAA 3HBVP 4PKVA 3RTSA 1QUAA 1BUVM 4ON1A 3LIRA 3LJTA 2CKIA 1RMZA 4L19A 3LMCA 1GE6A 3UVCA
chains in the Genus database with same CATH superfamily
3NX7A 4I03A 4FVLA 3ZUKA 4FU4A 1ROSA 3K7LA 1BM6A 3L0TA 4JQGA 5CUHA 5JMYA 2JSDA 1HV5A 3AIGA 1IADA 1BZSA 2V4BA 3F1AA 4R3VA 1XFUA 1UMSA 1JK3A 4XBHA 2ERPA 2YB9A 3KHIA 1CQRA 1IAAA 2KRJA 1G49A 2MZIA 4GR3A 5I4OA 3EDZA 3F15A 3OHOA 2D1NA 3F19A 4IN9A 4H82A 1QJJA 1MMPA 3LILA 1B8YA 2WO8A 4ZR5A 1YCMA 1OM7A 1PWQA 2QPJA 3USNA 4PKUA 2OW0A 3DNGA 4G0DA 2JT6A 4H76A 3F16A 3VI1A 4A7BA 1EUBA 5I12A 1SRPA 4DF9A 1KUGA 2OW9A 1UTTA 2AIGP 1BUDA 2ERQA 5LABA 1OO9A 2O3EA 3P24A 3TSKA 2FV5A 3GBOA 1HTDA 4Q1LA 1D7XA 3TVCA 2MZHA 1O0TA 1QIAA 1XFWA 4GR0A 1JJ9A 1KUIA 1JIZA 2RJPA 4XM8A 4DV8A 3CKIA 2YIGA 1G4KA 1L6JA 5D3CA 2DDYA 1I1IP 5I3MA 3WV1A 3EDHA 3MA2A 3HDBA 1DMTA 1JAPA 1I76A 2K2GA 1G12A 1KUKA 1KUHA 3N2UA 1JH1A 4H3XA 2OVZA 1BSWA 3F18A 3HBUP 1XURA 1Z3JA 1Y0VA 3SHIA 3HY9A 1PWPA 4GUYA 1OS9A 3KMCA 2OXZA 1R1JA 1Q3AA 3F17A 2XS4A 4H2EA 4JPAA 2N8RA 1USNA 1MMRA 1ZTQA 3KECA 4I35A 2X3BA 1SLMA 4XCTA 1UMTA 3B8ZA 3TT4A 966CA 1GO8P 4PKQA 2MLRA 3K7NA 3B2ZA 4GQLA 2X3AA 4JIJA 830CA 1D8MA 5L7FA 1HY7A 2DW0A 1XAXA 1IAGA 1ZXCA 2W14A 4FXQA 2O36A 1BKCI 5I2ZA 3KWVC 1QJIA 1SMPA 4GR8A 1FBLA 1YP1A 1Y93A 4PKRA 1PWUA 1OS2A 2W13A 4XM6A 2USNA 3DPEA 2WOAA 2DDFA 2OXWA 2X3CA 4AXQA 5D1UA 3P1VA 4L7AA 1FLSA 4L6TA 4AUOA 5BOYA 3L0VA 2EROA 2W0DA 1WNIA 2AYKA 4WKEA 4WZVA 1MNCA 3DTKA 2FV9A 3HDAP 1JANA 1JIWP 2HU6A 2D1OA 1FM1A 3DSLA 1IACA 2Y6CA 3ZXHA 4QKZA 1KBCA 5CZMA 2JIHA 4IUWA 1IABA 2E3XA 2DW2A 3O2XA 1YQYA 1XFXA 2OY2A 3AYUA 3ELMA 1JAOA 5D7WA 3LJGA 3N2VA 3I7IA 1R1HA 5B5OA 2PJTA 5I43A 4IJOA 1HFSA 1XM5A 4HX3A 4H1QA 1ZXVA 1UEAA 4H84A 3OHLA 3Q2GA 4J4MA 3WV2A 3HB2P 3DWBA 1G9KA 3LK8A 4HMAA 3Q2HA 3LKAA 3LQ0A 2OW1A 3LE9A 1PWVA 1A86A 1OM6A 4WF6A 5D2BA 3DL1A 1QIBA 3LJZA 2K9CA 3G42A 1UTZA 3E8RA 4DPEA 2DW1A 4DD8A 3V96B 1G05A 1CGFA 4AYKA 3RTTA 2X7MA 1H71P 1D5JA 1D8FA 3WV3A 2XS3A 4PKSA 1C7KA 3LQBA 3DPFA 456CA 1C3IA 2A8HA 1S4BP 3HY7A 2OVXA 3O64A 2I47A 5BOTA 4AIGA 2YUFA 1AF0A 2JNPA 4JP4A 1GE7A 2Z2DA 1SLNA 3BA0A 4EFSA 2MLSA 5BPAA 2OZRA 5L79A 3KEKA 3ZVSA 2CLTA 4ILWD 3TS4A 4WK7A 1GXDA 1EB6A 4PKWA 4H30A 1BQQM 1ZS0A 2POJA 4FXYP 1QICA 2SRTA 2MZEA 3EWJA 1Y8JA 4PKTA 1OMJA 2L0RA 1J7NA 4WKIA 1GE5A 1CXVA 4L63A 1ATLA 3LUNA 4A3WA 1XFYA 5H8XA 3LUMA 5D1SA 1R1IA 1JKYA 1ND1A 3G5CA 1MMBA 1DTHA 5D1TA 2WO9A 1SATA 3LGPA 1ZP5A 1XUDA 2Y6DA 1XUCA 1SU3A 2OY4A 1XFZA 3B92A 1BQOA 2J0TA 2JT5A 1OM8A 4JA1A 3I7GA 4GWNA 3EHXA 1JAQA 1XFVA 2RJQA 1EAKA 2OI0A 1CIZA 4GF1A 5B5PA 1GO7P 1I73A 1RM8A 2OW2A 3EDIA 3KEJA 1AKLA 1R55A 1AYKA 4G9LA 1KUFA 2W15A 2W12A 2E2DA 3LEAA 1ASTA 1K7QA 3U1RA 1CAQA 1B3DA 1PWWA 1YOUA 1CK7A 1BKCE 1O0QA 5I0LA 1K7GA 3LIKA 1ZVXA 1OZ9A 1CGEA 3EHYA 1BIWA 1BKCA 3KMEA 3VTGA 2J83A 4GWMA 4CTHA 1K7IA 3AYKA 2TCLA 3EDGA 1MMQA 3DTEA 1GKCA 3HYGA 1HOVA 3DTIA 1IAEA 1KAPP 4H49A 2OXUA 1TVIA 1A85A 3KRYA 1GKDA 1C8TA 1R54A 1HFCA 4XM7A 1CGLA 5CXAA 3HBVP 4PKVA 3RTSA 1QUAA 1BUVM 4ON1A 3LIRA 2CKIA 3LJTA 1RMZA 4L19A 3LMCA 1GE6A 3UVCA
chains in the Genus database with same CATH topology
3NX7A 4I03A 4FVLA 3ZUKA 4FU4A 1ROSA 3K7LA 1BM6A 3L0TA 4JQGA 5CUHA 5JMYA 2JSDA 1HV5A 3AIGA 1IADA 1BZSA 2V4BA 3F1AA 4R3VA 1XFUA 1UMSA 1JK3A 4XBHA 2ERPA 2YB9A 3KHIA 1CQRA 1IAAA 2KRJA 1G49A 2MZIA 4GR3A 5I4OA 3EDZA 3F15A 3OHOA 2D1NA 3F19A 4IN9A 4H82A 1QJJA 1MMPA 3LILA 1B8YA 2WO8A 4ZR5A 1YCMA 1OM7A 1PWQA 2QPJA 3USNA 4PKUA 2OW0A 3DNGA 4G0DA 2JT6A 4H76A 3F16A 3VI1A 4A7BA 1EUBA 5I12A 1SRPA 4DF9A 1KUGA 2OW9A 1UTTA 2AIGP 1BUDA 2ERQA 5LABA 1OO9A 2O3EA 3P24A 3TSKA 2FV5A 3GBOA 1HTDA 4Q1LA 1D7XA 3TVCA 2MZHA 1O0TA 1QIAA 1XFWA 4GR0A 1JJ9A 1KUIA 1JIZA 2RJPA 4XM8A 4DV8A 3CKIA 2YIGA 1G4KA 1L6JA 5D3CA 2DDYA 1I1IP 5I3MA 3WV1A 3EDHA 3MA2A 3HDBA 1DMTA 1JAPA 1I76A 2K2GA 1G12A 1KUKA 1KUHA 3N2UA 1JH1A 4H3XA 2OVZA 1BSWA 3F18A 3HBUP 1XURA 1Z3JA 1Y0VA 3SHIA 3HY9A 1PWPA 4GUYA 1OS9A 3KMCA 2OXZA 1R1JA 1Q3AA 3F17A 2XS4A 4H2EA 4JPAA 2N8RA 1USNA 1MMRA 1ZTQA 3KECA 4I35A 2X3BA 1SLMA 4XCTA 1UMTA 3B8ZA 3TT4A 966CA 1GO8P 4PKQA 2MLRA 3K7NA 3B2ZA 4GQLA 2X3AA 4JIJA 830CA 1D8MA 5L7FA 1HY7A 2DW0A 1IAGA 1ZXCA 2W14A 4FXQA 2O36A 1BKCI 5I2ZA 3KWVC 1QJIA 1SMPA 4GR8A 1FBLA 1YP1A 1Y93A 4PKRA 1PWUA 1OS2A 2W13A 4XM6A 2USNA 3DPEA 2WOAA 2DDFA 2OXWA 2X3CA 4AXQA 5D1UA 3P1VA 4L7AA 1FLSA 4L6TA 4AUOA 5BOYA 3L0VA 2EROA 2W0DA 1WNIA 2AYKA 4WKEA 4WZVA 1MNCA 3DTKA 2FV9A 3HDAP 1JANA 1JIWP 2HU6A 2D1OA 1FM1A 3DSLA 1IACA 2Y6CA 3ZXHA 4QKZA 1KBCA 5CZMA 2JIHA 4IUWA 1IABA 2E3XA 2DW2A 3O2XA 1YQYA 1XFXA 2OY2A 3AYUA 3ELMA 1JAOA 5D7WA 3LJGA 3N2VA 3I7IA 1R1HA 5B5OA 2PJTA 5I43A 4IJOA 1HFSA 4HX3A 4H1QA 1ZXVA 1UEAA 4H84A 3OHLA 3Q2GA 4J4MA 3WV2A 3HB2P 3DWBA 1G9KA 3LK8A 4HMAA 3Q2HA 3LKAA 3LQ0A 2OW1A 3LE9A 1PWVA 1A86A 1OM6A 4WF6A 5D2BA 3DL1A 1QIBA 3LJZA 2K9CA 3G42A 1UTZA 3E8RA 4DPEA 2DW1A 4DD8A 3V96B 1G05A 1CGFA 4AYKA 3RTTA 2X7MA 1H71P 1D5JA 1D8FA 3WV3A 2XS3A 4PKSA 1C7KA 3LQBA 3DPFA 456CA 1C3IA 2A8HA 1S4BP 3HY7A 2OVXA 3O64A 2I47A 5BOTA 4AIGA 2YUFA 1AF0A 2JNPA 4JP4A 1GE7A 2Z2DA 1SLNA 3BA0A 4EFSA 2MLSA 5BPAA 2OZRA 5L79A 3KEKA 3ZVSA 2CLTA 4ILWD 3TS4A 4WK7A 1GXDA 1EB6A 4PKWA 4H30A 1BQQM 1ZS0A 2POJA 4FXYP 1QICA 2SRTA 2MZEA 3EWJA 1Y8JA 4PKTA 1OMJA 2L0RA 1J7NA 4WKIA 1GE5A 1CXVA 4L63A 1ATLA 3LUNA 4A3WA 1XFYA 5H8XA 3LUMA 5D1SA 1R1IA 1JKYA 1ND1A 3G5CA 1MMBA 1DTHA 5D1TA 2WO9A 1SATA 3LGPA 1ZP5A 1XUDA 2Y6DA 1XUCA 1SU3A 2OY4A 1XFZA 3B92A 1BQOA 2J0TA 2JT5A 1OM8A 4JA1A 3I7GA 4GWNA 3EHXA 1JAQA 1XFVA 2RJQA 1EAKA 2OI0A 1CIZA 4GF1A 5B5PA 1GO7P 1I73A 1RM8A 2OW2A 3EDIA 3KEJA 1AKLA 1R55A 1AYKA 4G9LA 1KUFA 2W15A 2W12A 2E2DA 3LEAA 1ASTA 1K7QA 3U1RA 1CAQA 1B3DA 1PWWA 1YOUA 1CK7A 1BKCE 1O0QA 5I0LA 1K7GA 3LIKA 1ZVXA 1CGEA 3EHYA 1BIWA 1BKCA 3KMEA 3VTGA 2J83A 4GWMA 4CTHA 1K7IA 3AYKA 2TCLA 3EDGA 1MMQA 3DTEA 1GKCA 3HYGA 1HOVA 3DTIA 1IAEA 1KAPP 4H49A 2OXUA 1A85A 3KRYA 1GKDA 1C8TA 1R54A 1HFCA 4XM7A 1CGLA 5CXAA 3HBVP 4PKVA 3RTSA 1QUAA 1BUVM 4ON1A 3LIRA 2CKIA 3LJTA 1RMZA 4L19A 3LMCA 1GE6A 3UVCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NX7 A;  4I03 A;  4FVL A;  3ZUK A;  4FU4 A;  1ROS A;  3K7L A;  1BM6 A;  3L0T A;  4JQG A;  5CUH A;  5JMY A;  2JSD A;  1HV5 A;  3AIG A;  1IAD A;  1BZS A;  2V4B A;  3F1A A;  4R3V A;  1XFU A;  1UMS A;  1JK3 A;  4XBH A;  2ERP A;  2YB9 A;  3KHI A;  1CQR A;  1IAA A;  2KRJ A;  1G49 A;  2MZI A;  4GR3 A;  5I4O A;  3EDZ A;  3F15 A;  3OHO A;  2D1N A;  3F19 A;  4IN9 A;  4H82 A;  1QJJ A;  1MMP A;  3LIL A;  1B8Y A;  2WO8 A;  4ZR5 A;  1YCM A;  1OM7 A;  1PWQ A;  2QPJ A;  3USN A;  4PKU A;  2OW0 A;  3DNG A;  4G0D A;  2JT6 A;  4H76 A;  3F16 A;  3VI1 A;  4A7B A;  1EUB A;  5I12 A;  1SRP A;  4DF9 A;  1KUG A;  2OW9 A;  1UTT A;  2AIG P;  1BUD A;  2ERQ A;  5LAB A;  1OO9 A;  2O3E A;  3P24 A;  3TSK A;  2FV5 A;  3GBO A;  1HTD A;  4Q1L A;  1D7X A;  3TVC A;  2MZH A;  1O0T A;  1QIA A;  1XFW A;  4GR0 A;  1JJ9 A;  1KUI A;  1JIZ A;  2RJP A;  4XM8 A;  4DV8 A;  3CKI A;  2YIG A;  1G4K A;  1L6J A;  5D3C A;  2DDY A;  1I1I P;  5I3M A;  3WV1 A;  3EDH A;  3MA2 A;  3HDB A;  1DMT A;  1JAP A;  1I76 A;  2K2G A;  1G12 A;  1KUK A;  1KUH A;  3N2U A;  1JH1 A;  4H3X A;  2OVZ A;  1BSW A;  3F18 A;  3HBU P;  1XUR A;  1Z3J A;  1Y0V A;  3SHI A;  3HY9 A;  1PWP A;  4GUY A;  1OS9 A;  3KMC A;  2OXZ A;  1R1J A;  1Q3A A;  3F17 A;  2XS4 A;  4H2E A;  4JPA A;  2N8R A;  1USN A;  1MMR A;  1ZTQ A;  3KEC A;  4I35 A;  2X3B A;  1SLM A;  4XCT A;  1UMT A;  3B8Z A;  3TT4 A;  966C A;  1GO8 P;  4PKQ A;  2MLR A;  3K7N A;  3B2Z A;  4GQL A;  2X3A A;  4JIJ A;  830C A;  1D8M A;  5L7F A;  1HY7 A;  2DW0 A;  1IAG A;  1ZXC A;  2W14 A;  4FXQ A;  2O36 A;  1BKC I;  5I2Z A;  3KWV C;  1QJI A;  1SMP A;  4GR8 A;  1FBL A;  1YP1 A;  1Y93 A;  4PKR A;  1PWU A;  1OS2 A;  2W13 A;  4XM6 A;  2USN A;  3DPE A;  2WOA A;  2DDF A;  2OXW A;  2X3C A;  4AXQ A;  5D1U A;  3P1V A;  1FLS A;  4L6T A;  4AUO A;  5BOY A;  3L0V A;  2ERO A;  2W0D A;  1WNI A;  2AYK A;  4WKE A;  4WZV A;  1MNC A;  2FV9 A;  3HDA P;  1JAN A;  1JIW P;  2HU6 A;  2D1O A;  1FM1 A;  3DSL A;  1IAC A;  2Y6C A;  3ZXH A;  4QKZ A;  1KBC A;  5CZM A;  2JIH A;  4IUW A;  1IAB A;  2E3X A;  2DW2 A;  3O2X A;  1YQY A;  1XFX A;  2OY2 A;  3AYU A;  3ELM A;  1JAO A;  5D7W A;  3LJG A;  3N2V A;  3I7I A;  1R1H A;  5B5O A;  2PJT A;  5I43 A;  4IJO A;  1HFS A;  4HX3 A;  4H1Q A;  1ZXV A;  1UEA A;  4H84 A;  3OHL A;  3Q2G A;  4J4M A;  3WV2 A;  3HB2 P;  3DWB A;  1G9K A;  3LK8 A;  4HMA A;  3Q2H A;  3LKA A;  3LQ0 A;  2OW1 A;  3LE9 A;  1PWV A;  1A86 A;  1OM6 A;  4WF6 A;  5D2B A;  3DL1 A;  1QIB A;  3LJZ A;  2K9C A;  3G42 A;  1UTZ A;  3E8R A;  4DPE A;  2DW1 A;  4DD8 A;  3V96 B;  1G05 A;  1CGF A;  4AYK A;  3RTT A;  2X7M A;  1H71 P;  1D5J A;  1D8F A;  3WV3 A;  2XS3 A;  4PKS A;  1C7K A;  3LQB A;  3DPF A;  456C A;  1C3I A;  2A8H A;  1S4B P;  3HY7 A;  2OVX A;  3O64 A;  2I47 A;  5BOT A;  4AIG A;  1AF0 A;  2JNP A;  4JP4 A;  1GE7 A;  2Z2D A;  1SLN A;  3BA0 A;  4EFS A;  2MLS A;  5BPA A;  2OZR A;  5L79 A;  3KEK A;  3ZVS A;  2CLT A;  4ILW D;  3TS4 A;  4WK7 A;  1GXD A;  1EB6 A;  4PKW A;  4H30 A;  1BQQ M;  1ZS0 A;  2POJ A;  4FXY P;  1QIC A;  2SRT A;  2MZE A;  3EWJ A;  1Y8J A;  4PKT A;  1OMJ A;  2L0R A;  1J7N A;  4WKI A;  1GE5 A;  1CXV A;  4L63 A;  1ATL A;  3LUN A;  4A3W A;  1XFY A;  5H8X A;  3LUM A;  5D1S A;  1R1I A;  1JKY A;  1ND1 A;  3G5C A;  1MMB A;  1DTH A;  5D1T A;  2WO9 A;  1SAT A;  3LGP A;  1ZP5 A;  1XUD A;  2Y6D A;  1XUC A;  1SU3 A;  2OY4 A;  1XFZ A;  3B92 A;  1BQO A;  2J0T A;  2JT5 A;  1OM8 A;  4JA1 A;  3I7G A;  4GWN A;  3EHX A;  1JAQ A;  1XFV A;  2RJQ A;  1EAK A;  2OI0 A;  1CIZ A;  4GF1 A;  5B5P A;  1GO7 P;  1I73 A;  1RM8 A;  2OW2 A;  3EDI A;  3KEJ A;  1AKL A;  1R55 A;  1AYK A;  4G9L A;  1KUF A;  2W15 A;  2W12 A;  2E2D A;  3LEA A;  1AST A;  1K7Q A;  3U1R A;  1CAQ A;  1B3D A;  1PWW A;  1YOU A;  1CK7 A;  1BKC E;  1O0Q A;  5I0L A;  1K7G A;  3LIK A;  1ZVX A;  1CGE A;  3EHY A;  1BIW A;  1BKC A;  3KME A;  3VTG A;  2J83 A;  4GWM A;  4CTH A;  1K7I A;  3AYK A;  2TCL A;  3EDG A;  1MMQ A;  1GKC A;  3HYG A;  1HOV A;  1IAE A;  1KAP P;  4H49 A;  2OXU A;  1A85 A;  3KRY A;  1GKD A;  1C8T A;  1R54 A;  1HFC A;  4XM7 A;  1CGL A;  5CXA A;  3HBV P;  4PKV A;  3RTS A;  1QUA A;  1BUV M;  4ON1 A;  3LIR A;  3LJT A;  2CKI A;  1RMZ A;  4L19 A;  3LMC A;  1GE6 A;  3UVC A; 
#chains in the Genus database with same CATH topology
 3NX7 A;  4I03 A;  4FVL A;  3ZUK A;  4FU4 A;  1ROS A;  3K7L A;  1BM6 A;  3L0T A;  4JQG A;  5CUH A;  5JMY A;  2JSD A;  1HV5 A;  3AIG A;  1IAD A;  1BZS A;  2V4B A;  3F1A A;  4R3V A;  1XFU A;  1UMS A;  1JK3 A;  4XBH A;  2ERP A;  2YB9 A;  3KHI A;  1CQR A;  1IAA A;  2KRJ A;  1G49 A;  2MZI A;  4GR3 A;  5I4O A;  3EDZ A;  3F15 A;  3OHO A;  2D1N A;  3F19 A;  4IN9 A;  4H82 A;  1QJJ A;  1MMP A;  3LIL A;  1B8Y A;  2WO8 A;  4ZR5 A;  1YCM A;  1OM7 A;  1PWQ A;  2QPJ A;  3USN A;  4PKU A;  2OW0 A;  3DNG A;  4G0D A;  2JT6 A;  4H76 A;  3F16 A;  3VI1 A;  4A7B A;  1EUB A;  5I12 A;  1SRP A;  4DF9 A;  1KUG A;  2OW9 A;  1UTT A;  2AIG P;  1BUD A;  2ERQ A;  5LAB A;  1OO9 A;  2O3E A;  3P24 A;  3TSK A;  2FV5 A;  3GBO A;  1HTD A;  4Q1L A;  1D7X A;  3TVC A;  2MZH A;  1O0T A;  1QIA A;  1XFW A;  4GR0 A;  1JJ9 A;  1KUI A;  1JIZ A;  2RJP A;  4XM8 A;  4DV8 A;  3CKI A;  2YIG A;  1G4K A;  1L6J A;  5D3C A;  2DDY A;  1I1I P;  5I3M A;  3WV1 A;  3EDH A;  3MA2 A;  3HDB A;  1DMT A;  1JAP A;  1I76 A;  2K2G A;  1G12 A;  1KUK A;  1KUH A;  3N2U A;  1JH1 A;  4H3X A;  2OVZ A;  1BSW A;  3F18 A;  3HBU P;  1XUR A;  1Z3J A;  1Y0V A;  3SHI A;  3HY9 A;  1PWP A;  4GUY A;  1OS9 A;  3KMC A;  2OXZ A;  1R1J A;  1Q3A A;  3F17 A;  2XS4 A;  4H2E A;  4JPA A;  2N8R A;  1USN A;  1MMR A;  1ZTQ A;  3KEC A;  4I35 A;  2X3B A;  1SLM A;  4XCT A;  1UMT A;  3B8Z A;  3TT4 A;  966C A;  1GO8 P;  4PKQ A;  2MLR A;  3K7N A;  3B2Z A;  4GQL A;  2X3A A;  4JIJ A;  830C A;  1D8M A;  5L7F A;  1HY7 A;  2DW0 A;  1XAX A;  1IAG A;  1ZXC A;  2W14 A;  4FXQ A;  2O36 A;  1BKC I;  5I2Z A;  3KWV C;  1QJI A;  1SMP A;  4GR8 A;  1FBL A;  1YP1 A;  1Y93 A;  4PKR A;  1PWU A;  1OS2 A;  2W13 A;  4XM6 A;  2USN A;  3DPE A;  2WOA A;  2DDF A;  2OXW A;  2X3C A;  4AXQ A;  5D1U A;  3P1V A;  4L7A A;  1FLS A;  4L6T A;  4AUO A;  5BOY A;  3L0V A;  2ERO A;  2W0D A;  1WNI A;  2AYK A;  4WKE A;  4WZV A;  1MNC A;  3DTK A;  2FV9 A;  3HDA P;  1JAN A;  1JIW P;  2HU6 A;  2D1O A;  1FM1 A;  3DSL A;  1IAC A;  2Y6C A;  3ZXH A;  4QKZ A;  1KBC A;  5CZM A;  2JIH A;  4IUW A;  1IAB A;  2E3X A;  2DW2 A;  3O2X A;  1YQY A;  1XFX A;  2OY2 A;  3AYU A;  3ELM A;  1JAO A;  5D7W A;  3LJG A;  3N2V A;  3I7I A;  1R1H A;  5B5O A;  2PJT A;  5I43 A;  4IJO A;  1HFS A;  1XM5 A;  4HX3 A;  4H1Q A;  1ZXV A;  1UEA A;  4H84 A;  3OHL A;  3Q2G A;  4J4M A;  3WV2 A;  3HB2 P;  3DWB A;  1G9K A;  3LK8 A;  4HMA A;  3Q2H A;  3LKA A;  3LQ0 A;  2OW1 A;  3LE9 A;  1PWV A;  1A86 A;  1OM6 A;  4WF6 A;  5D2B A;  3DL1 A;  1QIB A;  3LJZ A;  2K9C A;  3G42 A;  1UTZ A;  3E8R A;  4DPE A;  2DW1 A;  4DD8 A;  3V96 B;  1G05 A;  1CGF A;  4AYK A;  3RTT A;  2X7M A;  1H71 P;  1D5J A;  1D8F A;  3WV3 A;  2XS3 A;  4PKS A;  1C7K A;  3LQB A;  3DPF A;  456C A;  1C3I A;  2A8H A;  1S4B P;  3HY7 A;  2OVX A;  3O64 A;  2I47 A;  5BOT A;  4AIG A;  2YUF A;  1AF0 A;  2JNP A;  4JP4 A;  1GE7 A;  2Z2D A;  1SLN A;  3BA0 A;  4EFS A;  2MLS A;  5BPA A;  2OZR A;  5L79 A;  3KEK A;  3ZVS A;  2CLT A;  4ILW D;  3TS4 A;  4WK7 A;  1GXD A;  1EB6 A;  4PKW A;  4H30 A;  1BQQ M;  1ZS0 A;  2POJ A;  4FXY P;  1QIC A;  2SRT A;  2MZE A;  3EWJ A;  1Y8J A;  4PKT A;  1OMJ A;  2L0R A;  1J7N A;  4WKI A;  1GE5 A;  1CXV A;  4L63 A;  1ATL A;  3LUN A;  4A3W A;  1XFY A;  5H8X A;  3LUM A;  5D1S A;  1R1I A;  1JKY A;  1ND1 A;  3G5C A;  1MMB A;  1DTH A;  5D1T A;  2WO9 A;  1SAT A;  3LGP A;  1ZP5 A;  1XUD A;  2Y6D A;  1XUC A;  1SU3 A;  2OY4 A;  1XFZ A;  3B92 A;  1BQO A;  2J0T A;  2JT5 A;  1OM8 A;  4JA1 A;  3I7G A;  4GWN A;  3EHX A;  1JAQ A;  1XFV A;  2RJQ A;  1EAK A;  2OI0 A;  1CIZ A;  4GF1 A;  5B5P A;  1GO7 P;  1I73 A;  1RM8 A;  2OW2 A;  3EDI A;  3KEJ A;  1AKL A;  1R55 A;  1AYK A;  4G9L A;  1KUF A;  2W15 A;  2W12 A;  2E2D A;  3LEA A;  1AST A;  1K7Q A;  3U1R A;  1CAQ A;  1B3D A;  1PWW A;  1YOU A;  1CK7 A;  1BKC E;  1O0Q A;  5I0L A;  1K7G A;  3LIK A;  1ZVX A;  1OZ9 A;  1CGE A;  3EHY A;  1BIW A;  1BKC A;  3KME A;  3VTG A;  2J83 A;  4GWM A;  4CTH A;  1K7I A;  3AYK A;  2TCL A;  3EDG A;  1MMQ A;  3DTE A;  1GKC A;  3HYG A;  1HOV A;  3DTI A;  1IAE A;  1KAP P;  4H49 A;  2OXU A;  1TVI A;  1A85 A;  3KRY A;  1GKD A;  1C8T A;  1R54 A;  1HFC A;  4XM7 A;  1CGL A;  5CXA A;  3HBV P;  4PKV A;  3RTS A;  1QUA A;  1BUV M;  4ON1 A;  3LIR A;  2CKI A;  3LJT A;  1RMZ A;  4L19 A;  3LMC A;  1GE6 A;  3UVC A; 
#chains in the Genus database with same CATH homology
 3NX7 A;  4I03 A;  4FVL A;  3ZUK A;  4FU4 A;  1ROS A;  3K7L A;  1BM6 A;  3L0T A;  4JQG A;  5CUH A;  5JMY A;  2JSD A;  1HV5 A;  3AIG A;  1IAD A;  1BZS A;  2V4B A;  3F1A A;  4R3V A;  1XFU A;  1UMS A;  1JK3 A;  4XBH A;  2ERP A;  2YB9 A;  3KHI A;  1CQR A;  1IAA A;  2KRJ A;  1G49 A;  2MZI A;  4GR3 A;  5I4O A;  3EDZ A;  3F15 A;  3OHO A;  2D1N A;  3F19 A;  4IN9 A;  4H82 A;  1QJJ A;  1MMP A;  3LIL A;  1B8Y A;  2WO8 A;  4ZR5 A;  1YCM A;  1OM7 A;  1PWQ A;  2QPJ A;  3USN A;  4PKU A;  2OW0 A;  3DNG A;  4G0D A;  2JT6 A;  4H76 A;  3F16 A;  3VI1 A;  4A7B A;  1EUB A;  5I12 A;  1SRP A;  4DF9 A;  1KUG A;  2OW9 A;  1UTT A;  2AIG P;  1BUD A;  2ERQ A;  5LAB A;  1OO9 A;  2O3E A;  3P24 A;  3TSK A;  2FV5 A;  3GBO A;  1HTD A;  4Q1L A;  1D7X A;  3TVC A;  2MZH A;  1O0T A;  1QIA A;  1XFW A;  4GR0 A;  1JJ9 A;  1KUI A;  1JIZ A;  2RJP A;  4XM8 A;  4DV8 A;  3CKI A;  2YIG A;  1G4K A;  1L6J A;  5D3C A;  2DDY A;  1I1I P;  5I3M A;  3WV1 A;  3EDH A;  3MA2 A;  3HDB A;  1DMT A;  1JAP A;  1I76 A;  2K2G A;  1G12 A;  1KUK A;  1KUH A;  3N2U A;  1JH1 A;  4H3X A;  2OVZ A;  1BSW A;  3F18 A;  3HBU P;  1XUR A;  1Z3J A;  1Y0V A;  3SHI A;  3HY9 A;  1PWP A;  4GUY A;  1OS9 A;  3KMC A;  2OXZ A;  1R1J A;  1Q3A A;  3F17 A;  2XS4 A;  4H2E A;  4JPA A;  2N8R A;  1USN A;  1MMR A;  1ZTQ A;  3KEC A;  4I35 A;  2X3B A;  1SLM A;  4XCT A;  1UMT A;  3B8Z A;  3TT4 A;  966C A;  1GO8 P;  4PKQ A;  2MLR A;  3K7N A;  3B2Z A;  4GQL A;  2X3A A;  4JIJ A;  830C A;  1D8M A;  5L7F A;  1HY7 A;  2DW0 A;  1IAG A;  1ZXC A;  2W14 A;  4FXQ A;  2O36 A;  1BKC I;  5I2Z A;  3KWV C;  1QJI A;  1SMP A;  4GR8 A;  1FBL A;  1YP1 A;  1Y93 A;  4PKR A;  1PWU A;  1OS2 A;  2W13 A;  4XM6 A;  2USN A;  3DPE A;  2WOA A;  2DDF A;  2OXW A;  2X3C A;  4AXQ A;  5D1U A;  3P1V A;  4L7A A;  1FLS A;  4L6T A;  4AUO A;  5BOY A;  3L0V A;  2ERO A;  2W0D A;  1WNI A;  2AYK A;  4WKE A;  4WZV A;  1MNC A;  3DTK A;  2FV9 A;  3HDA P;  1JAN A;  1JIW P;  2HU6 A;  2D1O A;  1FM1 A;  3DSL A;  1IAC A;  2Y6C A;  3ZXH A;  4QKZ A;  1KBC A;  5CZM A;  2JIH A;  4IUW A;  1IAB A;  2E3X A;  2DW2 A;  3O2X A;  1YQY A;  1XFX A;  2OY2 A;  3AYU A;  3ELM A;  1JAO A;  5D7W A;  3LJG A;  3N2V A;  3I7I A;  1R1H A;  5B5O A;  2PJT A;  5I43 A;  4IJO A;  1HFS A;  4HX3 A;  4H1Q A;  1ZXV A;  1UEA A;  4H84 A;  3OHL A;  3Q2G A;  4J4M A;  3WV2 A;  3HB2 P;  3DWB A;  1G9K A;  3LK8 A;  4HMA A;  3Q2H A;  3LKA A;  3LQ0 A;  2OW1 A;  3LE9 A;  1PWV A;  1A86 A;  1OM6 A;  4WF6 A;  5D2B A;  3DL1 A;  1QIB A;  3LJZ A;  2K9C A;  3G42 A;  1UTZ A;  3E8R A;  4DPE A;  2DW1 A;  4DD8 A;  3V96 B;  1G05 A;  1CGF A;  4AYK A;  3RTT A;  2X7M A;  1H71 P;  1D5J A;  1D8F A;  3WV3 A;  2XS3 A;  4PKS A;  1C7K A;  3LQB A;  3DPF A;  456C A;  1C3I A;  2A8H A;  1S4B P;  3HY7 A;  2OVX A;  3O64 A;  2I47 A;  5BOT A;  4AIG A;  2YUF A;  1AF0 A;  2JNP A;  4JP4 A;  1GE7 A;  2Z2D A;  1SLN A;  3BA0 A;  4EFS A;  2MLS A;  5BPA A;  2OZR A;  5L79 A;  3KEK A;  3ZVS A;  2CLT A;  4ILW D;  3TS4 A;  4WK7 A;  1GXD A;  1EB6 A;  4PKW A;  4H30 A;  1BQQ M;  1ZS0 A;  2POJ A;  4FXY P;  1QIC A;  2SRT A;  2MZE A;  3EWJ A;  1Y8J A;  4PKT A;  1OMJ A;  2L0R A;  1J7N A;  4WKI A;  1GE5 A;  1CXV A;  4L63 A;  1ATL A;  3LUN A;  4A3W A;  1XFY A;  5H8X A;  3LUM A;  5D1S A;  1R1I A;  1JKY A;  1ND1 A;  3G5C A;  1MMB A;  1DTH A;  5D1T A;  2WO9 A;  1SAT A;  3LGP A;  1ZP5 A;  1XUD A;  2Y6D A;  1XUC A;  1SU3 A;  2OY4 A;  1XFZ A;  3B92 A;  1BQO A;  2J0T A;  2JT5 A;  1OM8 A;  4JA1 A;  3I7G A;  4GWN A;  3EHX A;  1JAQ A;  1XFV A;  2RJQ A;  1EAK A;  2OI0 A;  1CIZ A;  4GF1 A;  5B5P A;  1GO7 P;  1I73 A;  1RM8 A;  2OW2 A;  3EDI A;  3KEJ A;  1AKL A;  1R55 A;  1AYK A;  4G9L A;  1KUF A;  2W15 A;  2W12 A;  2E2D A;  3LEA A;  1AST A;  1K7Q A;  3U1R A;  1CAQ A;  1B3D A;  1PWW A;  1YOU A;  1CK7 A;  1BKC E;  1O0Q A;  5I0L A;  1K7G A;  3LIK A;  1ZVX A;  1CGE A;  3EHY A;  1BIW A;  1BKC A;  3KME A;  3VTG A;  2J83 A;  4GWM A;  4CTH A;  1K7I A;  3AYK A;  2TCL A;  3EDG A;  1MMQ A;  3DTE A;  1GKC A;  3HYG A;  1HOV A;  3DTI A;  1IAE A;  1KAP P;  4H49 A;  2OXU A;  1A85 A;  3KRY A;  1GKD A;  1C8T A;  1R54 A;  1HFC A;  4XM7 A;  1CGL A;  5CXA A;  3HBV P;  4PKV A;  3RTS A;  1QUA A;  1BUV M;  4ON1 A;  3LIR A;  2CKI A;  3LJT A;  1RMZ A;  4L19 A;  3LMC A;  1GE6 A;  3UVC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...