3VTYA

Crystal structure of mama
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
175
structure length
175
Chain Sequence
ETTTIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAVKYFKKALEKEEKKAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inter-phylum structural conservation of the magnetosome-associated TPR-containing protein, MamA
pubmed doi rcsb
source organism Candidatus magnetobacterium bavaricum
molecule tags Protein binding
molecule keywords MamA
total genus 76
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13414 TPR_11 TPR repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vtyA00
5EX0A 3S7BA 1QZ2A 5CHEE 4NQ0A 3TAXA 4HOTA 3SF4A 4JA7A 4J0UA 3JYSA 3O48A 4KYOB 2AVPA 2HYZA 3MEKA 4N3CA 4UI9K 4H7XA 5D0OD 3RJVA 4ABNA 3QWVA 3ZFWA 4G25A 1XNFA 2C2LA 1IYGA 2Q7FA 2JLBA 3K9IA 3OXLA 3QWWA 5FZSA 3PE3A 4I2WA 5KJMA 4YVQC 4N39A 1NA3A 2L6JA 3FWVA 1QQEA 2Y4UA 4G24A 1P5QA 2MHKA 3Q4AB 3TG4A 5BNWA 5M72A 5FJYA 2LNIA 2XCBA 3CVNA 4IN3B 3BEEA 2I6HA 4U07A 4AM9A 4N3BA 2YQ8A 3QWPA 3CEQA 2FI7A 3S7JA 3U4TA 3CVQA 4UI9J 4Y6WA 4I2ZA 4CDRA 2LSUA 1HH8A 2HR2A 2HO1A 2XCCA 4HOQA 1W3BA 2PQRA 5EX3A 4N2SA 2PQNA 3QKYA 4GA2A 4J8EA 3MV2B 5FZQA 4B94A 3CV0A 1NZNA 5DBKA 3FFLA 3ASGA 3ULQA 1OUVA 1ZBPA 1ELWA 3LY8A 4I1AA 3WXXA 3ZHEA 5KJKA 5LCWJ 3URZA 5FZRA 3U3WA 4HOSA 5ARGA 1KT0A 4CGWA 2XPIA 1TJCA 4WNEA 4F3VA 4GCOA 4JL0A 4NRHB 3LKUA 3ZGQA 3PE4A 1HZ4A 3NF1A 4CGVA 2ONDA 1NA0A 5FT9A 2IF4A 3CKBA 1IHGA 3LCAA 4J8DA 4J8FA 4LEUA 5C1DA 5CCMA 4KBQA 4G1TA 3VTYA 4GYWA 3RO3A 3CK7A 4O6FA 1WM5A 3E4BA 5FTPA 3ZHEB 4BTBA 5KJNA 4GPKA 2R5SA 3GZ1A 4U0ZA 2UWJG 3KAEA 4A1SA 2WPVA 3RO2A 2NC9A 4UI9C 4H7YA 4XI9A 2VGXB 3UUXA 4YNDA 4U04A 3ZPJA 2WQHA 5BT1A 5A6CA 2J9QA 3HYMB 5D0QD 3TG5A 2FBNA 2XGSA 4I9EA 3SZ7A 5JJTA 2UY1B 2VSYA 5G05C 4APOA 4G23A 4RG9A 4N2QA 3AS5A 2FO7A 3S7FA 3KS2A 3ASDA 4AY5A 3ASHA 4N3AA 2IFUA 3CK9A 4W9RA 4JHRA 2PZIA 3R9AB 3PDNA 2C0MA 3Q5MA 3CKCA 2XGOA 4UQYA 3LY7A 4Y6CA 5EKQD 3ASFA 1WAO1 2C0LA 1KLXA 2PL2A 4G26A 4I17A 3FP3A 3ESKA 3RIBA 4XIFA 5HI7A 4AY6A 3UPVA 5AYWD 2P58C 3LY9A 1ZU2A 3GW4A 2VGYA 2XEVA 4GZ6A 4XI0A 3CK8A 4GZ5A 5G04J 3CVLA 2V5FA 4RG6A 1ELRA 3UQ3A 4U0SA 4UQZA 3QOUA 4G2VA 5CCLA 3GYZA 4U0UA 3TGOA 3N71A 3Q15A 5JJ6A 2VYIA 3MA5A 3Q49B 3OXGA 4ME2A 5BW8C 4BTAA 5HQ8A 4HORA 2GW1A 5G05J 4JA9A 2OOEA 1A17A 3AS4A 4HOUA 4YVOA 3S7DA 2KATA 1Y8MA 2VSNA 3Q47B 4WNGA 5DIZA 4N5CA 2KCLA 4AIFA 5G04C 2KCVA 3EDTB 4WNFA 2UY1A 4GA1A 3MKRA 3VTXA 5LCWC 3ZN3A 4GA0A 2KC7A 1B89A 3GZ2A 5ARFA 2FEZA 2QFCA 2YHCA 1KT1A 4KXKB 2DBAA 5A7DB 4BT9A 3RKVA 5KJLA 3CVPA 4GCNA 3AS8A 2BUGA 4GYYA 4UQXA 3LPZA 3IEGA 5JJ7A 1FCHA 2VQ2A 3QDNA 4GZ3A 3KD7A 4I9CA 3OXFA 1E96B 1YA0A 2VGXA 1PC2A 2FF4A 2XGMA 2Y4TA 2LSVA 4GYOA 3RU0A 4WUYA 4BT8A 2KCKA 1HXIA 3LYAA 4BWRA 4EQFA 3MV3B 4WNDA 2E2EA
chains in the Genus database with same CATH superfamily
5BXUA 4XKBA 3MGBA 1Q2ZA 1D8DA 3ZHEA 5LCWJ 3HRAA 4QQIA 3QWVA 3U66A 3HVEB 2P9SG 1INZA 2WXLA 4U8YD 3TG4A 3LJ3A 2KBXA 4TUUA 3BEEA 5LP0A 4FULA 2OVFA 1H2TC 5D66A 4I2ZA 2HO1A 1W3BA 3FFLA 3UT7A 3MKQB 4K0RA 4RVBA 3ABLE 2X6KA 3PZDA 3TWRA 2PNNA 2Y0BG 3ZNGA 3KAEA 5T8IA 5JA4D 3ZPJA 4U04A 1X81A 4FU3A 3SFYA 3CK9A 3DSVA 2IONA 4LRZA 3ASFA 2IQCA 3CVXA 3FUFA 1FT1A 3SFZA 4J8SA 4ANVA 3PUKA 3Q47B 3FEXA 2ZGDA 1TNYA 5LCWC 5CBNA 5CMWA 1N0QA 4URKA 3I3NA 1KT1A 1DCQA 5E76A 2R2LA 3W9GA 5JJ7A 5G2NA 1E96B 1PC2A 3B7RL 1NP7A 3RU0A 3CHRA 5AENA 4LCTA 3ABME 3FH5A 3TWWA 3MV3B 1FT2A 4FADA 4CDNA 1OWLA 2EIME 4I1OB 2AVPA 3TWXA 4ABNA 3RJVA 3DWLG 4G8KA 3CVYA 1XNFA 4BSZB 2DCPA 4A63B 5FJYA 3CVNA 4N3BA 2YQ8A 1A5EA 3ONLA 3QB2A 3CEQA 2BTDA 2V5QC 3AU5A 1HH8A 2XHEA 4BX8A 4GA2A 4B94A 3ULQA 5CEDB 4DPRA 4EECA 4MS6A 4GTMA 1N0RA 2DYSE 3CKBA 4J6IA 4M7CA 1HG5A 4M3OA 3EUVA 2BF0X 3GZ1A 1K8KG 3R7RA 3UUXA 3V31A 2IO3C 5E75A 4Q69A 3CHOA 4FLHA 4O1PA 4ATZD 3S7FA 5EIBE 3ASDA 4AY5A 3JXJA 3Q7AA 4Y6CA 3RIBA 3FP3A 3UKRG 2EQXA 5HI7A 3D9KA 2KZTA 4AP2A 4FLBA 3CSTA 4G2VA 3TGOA 3T9KA 4ZHBA 2X38A 4HRMB 2BEDA 2KATA 1Y8MA 4LSZE 3UTMA 4UQXA 1O1RA 1FCHA 2EILE 4UWHA 4YDEA 4BY6A 2OV8A 3ZVVA 5BXOA 2WXMA 1JCSA 4ANUA 4BWRA 3HXDA 2WXPA 5EN5D 1QZ2A 4DX5D 4J0UA 2P9UG 1K1BA 3IXEA 3JQ0A 2OCCE 1FVHA 5BV0A 3AU4A 1V54E 4DX1A 3U4TA 2I2OA 1KZPA 2HM8A 3L54A 3FUEA 4N2SA 5EX3A 5CBOA 4J8EA 3G2VA 3MCXA 3MZLB 4U8HA 3FU5A 4O1OA 4TXQA 2DVWA 4J8FA 3ML9A 1FPPA 2WPVA 4PS3A 3RO2A 4HBDA 4YNDA 4QFVA 5AARA 3VLDA 4LNBA 3CQCB 1WG0A 5LOZA 3PRZA 2X6HA 3J5QB 4I6EA 1OT8A 5AYWD 1NFIE 2P58C 3LY9A 2EIKE 3CVWA 3FUJA 2H6FA 3BG0B 2VYIA 4PUCA 5BW8C 3EHMA 2OOEA 3FU0A 4YVOA 3JUEA 4AIFA 2V4LA 1E8ZA 2RKKA 5BV1A 2P2CP 1UJKA 3QARA 3FH7A 3FUKA 3LXUX 3UX4A 3CVPA 3AS8A 4GZ3A 5ENRD 4I9CA 3RRMB 3IHVA 3UIOC 2KXPC 3ZKJA 3SNXA 3IBEA 3MJWA 3S2AA 2R17C 1LF8A 4JA7A 4L7TA 3J5PA 4UI9K 4YDYA 3P2BA 5BNWA 3LVRE 3CVQA 1LD8A 3D9PA 5JHAA 4G11A 1OUVA 1ZBPA 4I1AA 3ML8A 1N54A 1KT0A 3IKOB 4FP7A 3PE4A 5A23A 2VTBB 3UM2A 3ZHEB 4HB5A 1N4PA 1YMPA 2A5UA 2VGXB 1TNBA 4YDWA 2V4HC 3SQVA 2IFUA 2X6IA 5EILA 2WXJA 4GTPA 2OEWA 3EHRA 4DX6D 3D9LA 3DXMG 2WM9A 5CCLA 3Q9NC 3N71A 4GPMA 3MA5A 4BTAA 1KPSB 4JHJA 4HOUA 3L6AA 4WNGA 4LUNU 4N5CA 1UN9A 3L13A 1UOHA 3VTXA 1TN6A 2RG8A 5ARFA 2QFCA 1KZOA 3TWTA 4GCNA 4TRQA 2IJGX 4TXRA 4JEUA 4HXIA 2VGXA 2ETBA 3JCKC 3E32A 3D9IA 2L0TB 4KYOB 4EHMA 4H7XA 2WMNA 2VTBA 3FWVA 1G3NB 3AJIA 3ZXPA 3HXBA 3S7JA 2PQRA 5KJKA 3AG1E 3B7BA 2KZTB 2GRNB 3ZYQA 4WNEA 4JHKA 3ZGQA 2J49A 4HVBA 5CCMA 3VTYA 2E0IA 3KSLA 5ENPD 5J90A 1WM5A 1Z3YA 1MZCA 3T5VA 2WQHA 3NAWA 2FBNA 3NOCD 5KWDA 5AN8A 2WXNA 3CKCA 3F6QA 2PL2A 2V8SE 1SW6A 3B7UX 3GW4A 3CHMA 1VDYA 3ASOE 3UKUG 2QYUA 3SY2A 1UW4B 4C0EA 5HQ8A 4FJZA 5G05J 4BX9A 4KVMA 3FEYA 2KCVA 4AXHA 2ZIRA 3PNTB 2XEEA 4Q94A 1AWCB 1YYHA 5KJLA 2RFMA 4D10C 4MRUA 4GYOA 3RK6A 5J08A 1O1TA 1HXIA 4GMRA 3G2UA 5ENTD 1H2UA 5ENNA 4TUMA 4JXTA 5CRUA 4N3CA 4TV3A 4G25A 4I2WA 3ZYKA 4GTQA 3C5RA 3SD5A 2JABA 2LNIA 2XCBA 4U07A 3LEWA 3QWPA 1MX6A 4Q96A 3QKYA 4OVVA 4GZCA 4EBAG 4HOSA 2BKKB 2IEJA 1BI7B 3E33A 1WY6A 5FQ8A 4DLQA 5CERB 4HNAD 4HRNA 5FIOA 4LEUA 2DZOA 1OCRE 4BESA 3E34A 1O1SA 3NZSA 5HS0A 5G05C 3FTUA 5KBAA 3TWUA 3PDNA 1WAO1 2QY7A 1XGWA 4AV7A 4DUIA 4GZ6A 1ZU2A 5EYLA 4B8CB 4RG6A 3QOUA 3O4ZA 4BFRA 3Q49B 1DVPA 4JW1A 4HI9A 2WQ7A 2CFZA 3T8KA 5KCMA 1X5BA 3NOGD 5EIDA 1S64A 5CEAA 3FY4A 1TNOA 2AXVA 1BD8A 5T4YA 2HE0A 3CR3A 3IEGA 3PREA 2KCKA 4B8AA 2L0IA 3FTXA 3MEKA 4GU5A 2I1JA 2C2LA 3MYVA 3EJNA 2YINA 4OAUC 1P5QA 4HLEA 3FH8A 3ASNE 4IN3B 4AM9A 4DRXE 4UI9J 3EU9A 1EYHA 1OCOE 3UT4A 1YCSB 3I4GA 3ASGA 3V2XA 2XQ0A 2J07A 4GB9A 2ONDA 1N4RA 5C1DA 4BTBA 4UWLA 2UWJG 4N5QA 1UJJA 4AEZC 4XI9A 5BT1A 1TR4A 5B3SE 2X6JA 3R9AB 2C0MA 5AQBA 3IV0A 1BLXB 5ENQD 4U0SA 1D9SA 3RRUA 4ILIA 4DLOA 1E90A 2GRQB 3BG1B 4R7LA 3IHYA 3ISMC 3LPZA 2RD0A 1HE8A 4CZ2D 5B1AE 2LSVA 1IQRA 4BT8A 1QNFA 3B7TA 1OY3D 3QC1A 3Q75A 1MYOA 4NQ0A 1TNUA 4ANWA 2ZU6B 3PE3A 1EF1C 3CQGB 3JQ1A 4YDOA 3QAQA 3ZXSA 3TL5A 4LNGA 3HG0D 2F37A 3I4RB 4UWKA 4CGWA 4I6GA 4DJAA 1PY1A 4G1TA 3CHQA 2GRMA 3R9MA 3HYMB 3SZ7A 3NQPA 4APOA 4UUCA 3D9JA 3QK0A 1HFAA 4J8YA 2KM4A 4XIFA 1U3CA 3DRAA 1NL4A 2LO6A 3CSFA 3KSQA 4LERA 1ELRA 4UQZA 2VGEA 3LDZA 1TN8A 2WXHA 2A4ZA 4JA9A 3SHFA 3AS4A 2L9BA 2OEVA 2AWIA 2VSNA 4ILHB 3OTNA 2EIJE 3DEOA 3CIAA 2LAHA 3T5XA 1B89A 3HDXA 4AVXA 2XS8A 5ENOD 2PM6A 3L22A 2IY0C 1JCRA 3EIQC 3BU8A 5EX0A 1Z5SC 4CYMD 3VLEA 2Q7FA 5D2MC 4YVQC 4HS2A 2I6HA 2ZXWE 2FI7A 1SQMA 5JHBA 2XZTG 3PZ2A 1E8YA 1QYMA 4DX2A 5FT9A 4PH4B 1UG3A 5JMND 3D9NA 2WVIA 4F7AA 5FINA 5JJTA 2XPZA 4G23A 3AS5A 4MBGA 3FUIA 3ASHA 4PS7A 3LS8A 4JHRA 3Q5MA 3CGHA 5CRVA 3UMVA 3PH0C 3EHNA 3C98A 2X6FA 2NSZA 4PS8A 3E37A 3BQOA 2VGYA 5G04J 3GZSA 4EZLA 3BUAA 3SBTB 4IYPA 3SO8A 4ILGA 2KCLA 4GA1A 4U95D 2XPYA 3GZ2A 4K5BA 2YHCA 2A5EA 3SBSA 5A7DB 1H2VC 1H6KA 4AJWA 3KD7A 4JZYA 3L17A 1IHBA 3C3OA 2ILRA 4BETA 1FVFA 4CT4A 2JEKA 4L2YA 3TAXA 4PDXA 3OXLA 3DSXA 2NYJA 2L6JA 2YNQA 4TXPA 2Y4UA 3ZRHA 3ZYMA 2ZISA 4FC8A 2R59A 2DIWA 1TJFA 3FTYA 1OCZE 2R02A 2WXFA 5BUZA 4EZKA 1NZNA 5DBKA 1O5MA 3LY8A 2FO1E 4JVSA 3C3QA 3FUNA 5FWQA 4KZ0A 2GRPB 3D9MA 4ACKA 3T8MA 5AQAA 4KBQA 2WXGA 5FTPA 2VSOE 3ULEG 3ENEA 2Y1LE 2NC9A 4H7YA 4GAAA 3TG5A 1HO8A 2AXUA 4JEHA 2EINE 3B13A 3DSTA 1ELKA 4MKTA 3UM0A 1SA5A 3UQ3A 2J8SD 3GYZA 5AAOA 2WXRA 1JWGA 4ME2A 4A1GA 3LVQE 3UM3A 4CCAA 4HQDA 2WB2A 2MOWA 1ZB1A 1HS6A 3DSWA 3TWSA 3APFA 2Y4TA 2PM7A 3LYAA 3L08A 4B0ZA 2I9CA 4WNDA 1JPLA 3G2SA 3S7BA 2XENA 1IYGA 5FZSA 5ITZF 4GTSA 4U96D 2VJ8A 4FHJA 4UWGA 4RLYA 2PQNA 2IO2C 3JXIA 3R7QA 1ELWA 3URZA 5ARGA 1TJCA 1V55E 1NA0A 3FU6A 2IF4A 3RO3A 2FULA 3E4BA 2R5SA 1H6PA 4GMJA 1D8EA 3HVEA 4U63A 3UXGA 2UY1B 4MLPA 5HRYA 5AJDA 3CHPA 4L2LA 2PZIA 2YHEA 3ZFWA 2C0LA 4G26A 4AY6A 3UPVA 3TXNA 3C72A 3DBSA 3SGHA 2XEVA 4GPKA 3CVLA 1OCCE 4E6HA 1OWMA 4Z68A 2M63A 2WMOA 2WXQA 1BPOA 1AP7A 1DCEA 1MHQA 4EBAA 2CG3A 3DPDA 2Y3AA 3PVLA 2IU1A 2QYJA 3AG3E 4IULA 4OVUA 3DXKG 2UY1A 3UINC 3ZN3A 2KC7A 3L16A 2DBAA 1L5JA 2H6HA 3RSEG 5HKPA 1IXVA 4HRLA 2GROB 1TN7A 3JYSA 4JC8A 3TXMA 5T3RA 3NBNB 3D9OA 3DEPA 5KJMA 1NA3A 4K5CA 1SZAA 5G55A 3P1UA 4L1BA 4CRWA 3V2OA 2B6CA 3PUJA 2CG2A 4HI8A 3WXXA 3UM1A 2QZAA 1TNZA 3Q73A 3HHMA 5KJNA 4XE0A 3WG7E 2J08A 3RRNB 5D0QD 4I9EA 2XGSA 3PS6A 1HF8A 3X2QE 1BI8B 4N2QA 2XZDG 3FDHA 4XKCA 3PZ1A 4L9PA 4KVOA 3PZ3A 3Q7FA 5C2YA 5EKQD 1KLXA 5LFAA 5A6CA 2H6IA 2V5FA 3PZ4A 4X8QA 2ZGGA 4U0UA 3W9FA 4HORA 3AG4E 4EPZA 3S7DA 5EYPF 4NIKA 2R03A 3FTSA 3ONKA 4RSYA 4F1PA 1RZ4A 3ULYA 4K03A 1JWFA 4GTTA 3FTVA 4BSXA 2CHXA 3OXFA 3B95A 5AQ9A 4DX7D 1H0AA 1Y6IA 3V30A 4DI3A 5CHEE 3FTWA 5FQ7A 4P29A 3Q79A 5KNHD 1OXJA 1GW6A 3TJPA 2J4DA 4BEPA 1S0PA 2Y69E 2I1KA 4C0MA 1N4SA 4CDRA 4OYSA 2CHWA 4IRUA 4F3VA 4EZJA 4HFGA 1HZ4A 1SA4A 4KMOA 4WWOA 3JUIA 4CEMA 2LAIA 2NXPA 3ZW3A 3AG2E 3CK7A 2DZNA 2ETAA 4U7EB 4U0ZA 4DI4A 3U64A 2GGFA 1E8WA 2MYOA 2F0YA 4O60A 2BKGA 3ESKA 2P9PG 2AJAA 2DYRE 1PAQA 4A3VA 3PEUB 1MJ0A 5CMYA 3KEZA 3DPYA 4XX5A 4A55A 2IOLA 2P9KG 3ZEFA 3EIJA 3G2TA 5DIZA 3QNKA 5G04C 3FUHA 2VSXE 1EPUA 4WAFA 4E85A 2V0PA 2WXOA 4F6RD 2BUGA 4GYYA 1U2VG 3QDNA 2FF4A 2XGMA 3CVUA 3ZYLA 1E7UA 4RQIA 2X3MA 1H19A 2E2EA 5AQ7A 3SF4A 1SVXA 3D3MA 3O48A 4KZCA 4K5AB 2JLBA 4G24A 2MHKA 3Q4AB 4U8VD 2AW6A 2J4BA 4Y6WA 2LSUA 2HR2A 2XCCA 3UIPC 4I43A 1DC2A 2B0OE 2CHZA 4GCOA 4JL0A 3NF1A 4LNUD 3AAAC 2J09A 4J8DA 3TWQA 4JB8P 1HU3A 4B93B 4A1SA 4UI9C 2P9IG 4RG9A 3HXFA 3ZUVB 1WDYA 1IKND 4N3AA 3APDA 3Q9UC 4L23A 4I17A 4UWFA 4OAVB 3CK8A 2P9LG 3KEAA 5ENSD 5JJ6A 2GW1A 4FA6A 3E30A 4WWPA 4CT0A 3EDTB 4FHKA 1S70B 5B1BE 2LXMA 1E7VA 4APFA 3VLFA 4BT9A 4F1SA 3RKVA 4ATGA 2F8XK 2H6GA 3HIZA 4NACA 2MRIA 2VQ2A 5AIJA 4EQFA 4V3IA 3MX3A 1U3DA 1MX4A 3ABKE 4XZ4A 5D0OD 4GTVA 3K9IA 3QWWA 5H7PA 2GRRB 1QQEA 5M72A 2CFUA 4GZDA 2LUHA 1N4QA 2XRZA 4LG6A 1DNPA 3MV2B 5FZQA 4DK5A 3CVVA 3CV0A 4AOFA 3U3WA 1LD7A 4CGVA 4CDMA 4O6FA 3I5PA 3UI2A 1HX8A 1MQSA 3FULA 2AXZA 3CHSA 4NURA 2FO7A 3APCA 4ACLA 4W9RA 4G8LA 2XS1A 2WXIA 1QBQA 3ESLA 3FUDA 2ETCA 5FQ4A 4JPSA 1K3ZD 4GZ5A 4FJYA 4BERA 2LXLA 2WXKA 3SI5A 2DWZA 3Q15A 5EDSA 1N9AA 3ZU7B 1H6OA 3C3RA 3SFXA 3FUMA 4WNFA 3MKRA 3PEVB 1BU9A 3FU3A 3QJZA 3L82A 2FEZA 3D9HA 4HLLA 2P9NG 4JD2G 2XEHA 3EHQA 1Z3XA 5ANRA 5KNGA 3CLJA 4GTRA 1IQUA 4A3TA 4I6JA 3G2WA 3ZIMA 3NB2A 1OWNA 1TYQG 4HOTA 3B7SA 2HYZA 1N52A 5IY5E 4N39A 5AJLA 5ANLA 1TEZA 1JCQA 4GTOA 1LTXA 4J7WA 4HOQA 2XRYA 4F53A 2OVBA 1S63A 5FZRA 2RFAA 2XPIA 3FTZA 3UT8A 3EU5A 4NRHB 1OWPA 1E8XA 3LKUA 4KT6B 3LCAA 1IHGA 1EDUA 1NI1A 3DSSA 1N94A 4ANXA 4GYWA 3NZUA 4XEIG 3TWVA 5FQ6A 3RAUA 3U9WA 3OAWA 2J9QA 2QC9A 3Q78A 2VSYA 1HG2A 1JUQA 2IOSA 3KS2A 3HXCA 4ZFHA 2R05A 5LX8A 2XGOA 4UQYA 3LY7A 3V79K 3LJNA 4XI0A 1OWOA 1RW2A 5BPPA 1N95A 4WWNA 3OXGA 2GRLA 2L6BA 1A17A 1K1AA 3MKQA 4I1MA 4C9BB 3PNLB 3HXEA 2WQ6A 4GA0A 4B89A 1SZ9A 1Z6TA 4KXKB 3L9TA 2F8YA 1UN8A 4C48B 5CECB 1N11A 3DSUA 3FHEA 1YA0A 4WUYA 4GMLA 1MX2A
chains in the Genus database with same CATH topology
5EX0A 4DI3A 5CHEE 3FTWA 5FQ7A 2L0TB 3MGBA 4P29A 4XKBA 4KYOB 3ZHEA 5LCWJ 4H7XA 2WMNA 3QWVA 3VLEA 2Q7FA 1GW6A 3TJPA 3U66A 2VTBA 3HVEB 2J4DA 4YVQC 4HS2A 1INZA 2WXLA 3FWVA 1S0PA 3TG4A 3LJ3A 2I1KA 4TUUA 3BEEA 2I6HA 5LP0A 4FULA 2OVFA 1H2TC 2FI7A 3S7JA 4C0MA 4I2ZA 4CDRA 4OYSA 2CHWA 1SQMA 2HO1A 1W3BA 2PQRA 5JHBA 3FFLA 5KJKA 2KZTB 3MKQB 3UT7A 1E8YA 3ZYQA 4IRUA 4K0RA 4WNEA 4JHKA 4F3VA 4EZJA 4HFGA 3ZGQA 1HZ4A 4KMOA 4RVBA 4WWOA 2J49A 4HVBA 3JUIA 2X6KA 4PH4B 2LAIA 2NXPA 5FT9A 4CEMA 5CCMA 3VTYA 2E0IA 3ZW3A 3PZDA 5J90A 3CK7A 1UG3A 1WM5A 1Z3YA 4U0ZA 4DI4A 3KAEA 5T8IA 3T5VA 3D9NA 2WVIA 4F7AA 3U64A 3ZPJA 4U04A 2GGFA 2WQHA 1E8WA 5JJTA 2XPZA 2FBNA 4G23A 3AS5A 4FU3A 3FUIA 3ASHA 3CK9A 4PS7A 3LS8A 4JHRA 3Q5MA 3CGHA 2WXNA 3CKCA 2IONA 4LRZA 3UMVA 3ASFA 3PH0C 2IQCA 2PL2A 2V8SE 3EHNA 3CVXA 3ESKA 3C98A 2X6FA 3FUFA 2NSZA 3B7UX 4PS8A 3GW4A 2VGYA 3SFZA 1PAQA 3CHMA 5G04J 4J8SA 3GZSA 1VDYA 4EZLA 4A3VA 3PEUB 5CMYA 3KEZA 4A55A 4XX5A 2IOLA 1UW4B 4C0EA 4ANVA 5HQ8A 3SBTB 3PUKA 4FJZA 5G05J 3ZEFA 4BX9A 3EIJA 4IYPA 3G2TA 3Q47B 5DIZA 4ILGA 4KVMA 3QNKA 2KCLA 5G04C 3FEXA 3FEYA 2KCVA 3FUHA 2VSXE 4AXHA 4GA1A 5LCWC 5CMWA 1EPUA 3PNTB 4Q94A 2XPYA 3GZ2A 3I3NA 4WAFA 4E85A 4URKA 2YHCA 1KT1A 3SBSA 5A7DB 5E76A 5KJLA 1H2VC 2V0PA 2WXOA 2BUGA 4GYYA 5JJ7A 4D10C 1H6KA 3QDNA 4AJWA 3KD7A 4JZYA 3L17A 2ILRA 5G2NA 4MRUA 1E96B 2FF4A 2XGMA 1PC2A 4GYOA 3B7RL 3RK6A 1NP7A 3RU0A 3CHRA 5AENA 4LCTA 1FVFA 1HXIA 1E7UA 3FH5A 3G2UA 3ZYLA 4CT4A 2X3MA 3MV3B 1H19A 2JEKA 2E2EA 4FADA 4CDNA 1OWLA 4L2YA 3TAXA 1H2UA 5ENNA 3SF4A 4JXTA 3D3MA 4PDXA 4I1OB 3O48A 2AVPA 4ABNA 4N3CA 3RJVA 4KZCA 4TV3A 4G25A 1XNFA 3CVYA 3OXLA 2JLBA 2DCPA 4I2WA 3ZYKA 2L6JA 2YNQA 2Y4UA 4G24A 3SD5A 3ZRHA 2MHKA 3Q4AB 5FJYA 3ZYMA 4FC8A 2LNIA 2R59A 2DIWA 2XCBA 3CVNA 1TJFA 4U07A 2AW6A 2YQ8A 3LEWA 2J4BA 3FTYA 3ONLA 3QB2A 3QWPA 3CEQA 4N3BA 2BTDA 4Q96A 4Y6WA 2WXFA 2LSUA 3AU5A 1HH8A 2HR2A 2XCCA 4I43A 2XHEA 4BX8A 3QKYA 4GA2A 4B94A 4EZKA 5BUZA 1NZNA 5DBKA 3ULQA 3CVUA 3LY8A 4OVVA 4GZCA 4EBAG 4DPRA 4HOSA 4JVSA 3FUNA 2CHZA 4GCOA 1WY6A 4JL0A 5FQ8A 4KZ0A 5FWQA 4DLQA 3D9MA 3NF1A 4ACKA 4EECA 4MS6A 2J09A 3CKBA 4J8DA 4J6IA 3T8MA 4LEUA 1HG5A 4KBQA 2WXGA 4M3OA 1HU3A 5FTPA 2VSOE 2BF0X 3ENEA 3GZ1A 3R7RA 4A1SA 3NZSA 2NC9A 4UI9C 4H7YA 3UUXA 4GAAA 3TG5A 5E75A 1HO8A 5G05C 2AXUA 3FTUA 3CHOA 4RG9A 4Q69A 4FLHA 3S7FA 3ASDA 4AY5A 4N3AA 3APDA 4JEHA 3PDNA 4L23A 4Y6CA 3RIBA 1WAO1 2QY7A 1XGWA 3FP3A 4I17A 4AV7A 3B13A 4UWFA 2EQXA 5HI7A 3D9KA 2KZTA 4GZ6A 1ZU2A 1ELKA 4B8CB 3CK8A 4MKTA 4RG6A 4AP2A 4FLBA 3UQ3A 3CSTA 3QOUA 4G2VA 3GYZA 3TGOA 3O4ZA 4BFRA 2WXRA 2X38A 5JJ6A 1JWGA 3Q49B 4ME2A 1DVPA 2GW1A 4JW1A 4FA6A 4A1GA 4WWPA 2WQ7A 2KATA 1Y8MA 2CFZA 3LVQE 4CT0A 4CCAA 3EDTB 4FHKA 1X5BA 5KCMA 2WB2A 3FY4A 2MOWA 1E7VA 1HS6A 4APFA 3VLFA 4BT9A 4F1SA 3RKVA 4ATGA 3HIZA 4NACA 2AXVA 4UQXA 2MRIA 3CR3A 3IEGA 5T4YA 3APFA 1FCHA 2VQ2A 4UWHA 4BY6A 2OV8A 3ZVVA 2WXMA 3PREA 2Y4TA 5AIJA 2PM7A 2KCKA 3L08A 3LYAA 4B0ZA 2I9CA 4ANUA 4BWRA 4EQFA 4WNDA 1JPLA 4V3IA 4B8AA 3MX3A 1U3DA 3G2SA 3S7BA 2WXPA 1QZ2A 4J0UA 2L0IA 3FTXA 3MEKA 4XZ4A 4GU5A 2I1JA 5D0OD 3JQ0A 1IYGA 2C2LA 3K9IA 3MYVA 5FZSA 3QWWA 1FVHA 3EJNA 2YINA 5BV0A 1QQEA 1P5QA 3AU4A 4HLEA 3FH8A 5M72A 2VJ8A 4FHJA 2CFUA 4UWGA 4IN3B 4AM9A 4GZDA 3U4TA 2I2OA 4UI9J 2HM8A 1EYHA 3L54A 3FUEA 3UT4A 5EX3A 4N2SA 2PQNA 3I4GA 2XRZA 1DNPA 4J8EA 3MV2B 5FZQA 3G2VA 4DK5A 3CV0A 3R7QA 3CVVA 3MCXA 3ASGA 3MZLB 4U8HA 4AOFA 1ELWA 3U3WA 3URZA 5ARGA 1TJCA 2XQ0A 3FU5A 2J07A 4GB9A 4CGVA 2ONDA 1NA0A 3FU6A 2IF4A 4CDMA 4J8FA 5C1DA 3ML9A 3RO3A 4BTBA 4O6FA 3I5PA 2FULA 3E4BA 2R5SA 4UWLA 1HX8A 2UWJG 4GMJA 1MQSA 2WPVA 3FULA 4PS3A 1UJJA 3RO2A 3HVEA 4U63A 4XI9A 4AEZC 4YNDA 5BT1A 4QFVA 2AXZA 2UY1B 3VLDA 3CHSA 4MLPA 4NURA 2FO7A 3APCA 5AJDA 2X6JA 3CHPA 4ACLA 3CQCB 4L2LA 4W9RA 2PZIA 3R9AB 2C0MA 2WXIA 5LOZA 3PRZA 2YHEA 2X6HA 3ZFWA 3IV0A 4I6EA 2C0LA 4G26A 3ESLA 3FUDA 4AY6A 5FQ4A 3UPVA 5AYWD 2P58C 3TXNA 3DBSA 3LY9A 4JPSA 2XEVA 3SGHA 4GPKA 4GZ5A 3CVLA 4FJYA 1OWMA 4E6HA 3CVWA 2M63A 2WMOA 2WXQA 4U0SA 1BPOA 3FUJA 1MHQA 4EBAA 2WXKA 3RRUA 3SI5A 3BG0B 3Q15A 2VYIA 5EDSA 4PUCA 4ILIA 5BW8C 2CG3A 3DPDA 3EHMA 4DLOA 2Y3AA 3PVLA 2OOEA 3FU0A 4YVOA 2IU1A 1E90A 3BG1B 4AIFA 4IULA 2V4LA 4OVUA 3FUMA 4WNFA 2UY1A 4R7LA 3MKRA 1E8ZA 3PEVB 3ZN3A 5BV1A 2KC7A 3FU3A 1UJKA 3IHYA 3L16A 3QJZA 2FEZA 3QARA 3FH7A 2DBAA 3FUKA 3LXUX 3UX4A 1L5JA 3CVPA 3AS8A 3LPZA 2RD0A 1Z3XA 4GZ3A 1HE8A 5ANRA 4I9CA 3CLJA 3RRMB 3IHVA 1IQUA 4A3TA 1IQRA 2LSVA 4BT8A 3SNXA 1QNFA 4I6JA 3G2WA 3B7TA 3ZIMA 1OWNA 3IBEA 3MJWA 3S2AA 3QC1A 4NQ0A 2R17C 4HOTA 3B7SA 1LF8A 4JA7A 3JYSA 4L7TA 4JC8A 2HYZA 3TXMA 4UI9K 5T3RA 4ANWA 1N52A 2ZU6B 3D9OA 3P2BA 5KJMA 3PE3A 1EF1C 4N39A 1NA3A 3CQGB 1SZAA 3JQ1A 3QAQA 5BNWA 5AJLA 5G55A 3P1UA 5ANLA 4L1BA 3ZXSA 3LVRE 1TEZA 3CVQA 3TL5A 4CRWA 3D9PA 4HOQA 2XRYA 4F53A 3PUJA 2CG2A 5JHAA 2OVBA 3I4RB 4G11A 1OUVA 1ZBPA 4I1AA 3WXXA 3ML8A 5FZRA 1N54A 4UWKA 1KT0A 3FTZA 2XPIA 4CGWA 4I6GA 3UT8A 3IKOB 4FP7A 4NRHB 1OWPA 1E8XA 3LKUA 3PE4A 5A23A 4KT6B 4DJAA 2VTBB 1PY1A 3LCAA 1IHGA 1EDUA 3HHMA 4G1TA 4ANXA 4GYWA 3NZUA 3ZHEB 5KJNA 3CHQA 2GRMA 4XE0A 2J08A 2A5UA 5FQ6A 2VGXB 3RRNB 3U9WA 3OAWA 2J9QA 3HYMB 5D0QD 5J08A 4I9EA 2XGSA 3SZ7A 3PS6A 2VSYA 1HG2A 1HF8A 1JUQA 3NQPA 4APOA 4N2QA 2IOSA 3D9JA 3KS2A 3FDHA 4XKCA 2IFUA 4KVOA 3QK0A 5LX8A 1HFAA 2XGOA 3LY7A 4UQYA 5EKQD 5C2YA 1KLXA 2X6IA 5LFAA 2KM4A 4XIFA 1U3CA 2WXJA 5A6CA 4XI0A 1OWOA 2LO6A 3CSFA 2V5FA 4LERA 5BPPA 1ELRA 3D9LA 4UQZA 2WM9A 5CCLA 4U0UA 3N71A 4WWNA 3LDZA 3MA5A 4BTAA 4HORA 3OXGA 4JHJA 2GRLA 2WXHA 2A4ZA 4EPZA 4JA9A 3SHFA 1A17A 3AS4A 2L9BA 3L6AA 4HOUA 3S7DA 2VSNA 2AWIA 4WNGA 4LUNU 3MKQA 4ILHB 3OTNA 4N5CA 1UN9A 3L13A 4I1MA 4C9BB 3PNLB 2WQ6A 3VTXA 3CIAA 3FTSA 3ONKA 4GA0A 2LAHA 4B89A 2RG8A 1B89A 4RSYA 3T5XA 5ARFA 2QFCA 1SZ9A 1Z6TA 3HDXA 4KXKB 4AVXA 1UN8A 4K03A 1JWFA 4GCNA 3FHEA 4TRQA 2PM6A 3L22A 3FTVA 2IJGX 4BSXA 4JEUA 2CHXA 3OXFA 1YA0A 4HXIA 2VGXA 3EIQC 1H0AA 1Y6IA 3JCKC 4WUYA 4GMLA 3D9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EX0 A;  3S7B A;  1QZ2 A;  5CHE E;  4NQ0 A;  3TAX A;  4HOT A;  3SF4 A;  4JA7 A;  4J0U A;  3JYS A;  3O48 A;  4KYO B;  2AVP A;  2HYZ A;  3MEK A;  4N3C A;  4UI9 K;  4H7X A;  5D0O D;  3RJV A;  4ABN A;  3QWV A;  3ZFW A;  4G25 A;  1XNF A;  2C2L A;  1IYG A;  2Q7F A;  2JLB A;  3K9I A;  3OXL A;  3QWW A;  5FZS A;  3PE3 A;  4I2W A;  5KJM A;  4YVQ C;  4N39 A;  1NA3 A;  2L6J A;  3FWV A;  1QQE A;  2Y4U A;  4G24 A;  1P5Q A;  2MHK A;  3Q4A B;  3TG4 A;  5BNW A;  5M72 A;  5FJY A;  2LNI A;  2XCB A;  3CVN A;  4IN3 B;  3BEE A;  2I6H A;  4U07 A;  4AM9 A;  4N3B A;  2YQ8 A;  3QWP A;  3CEQ A;  2FI7 A;  3S7J A;  3U4T A;  3CVQ A;  4UI9 J;  4Y6W A;  4I2Z A;  4CDR A;  2LSU A;  1HH8 A;  2HR2 A;  2HO1 A;  2XCC A;  4HOQ A;  1W3B A;  2PQR A;  5EX3 A;  4N2S A;  2PQN A;  3QKY A;  4GA2 A;  4J8E A;  3MV2 B;  5FZQ A;  4B94 A;  3CV0 A;  1NZN A;  5DBK A;  3FFL A;  3ASG A;  3ULQ A;  1OUV A;  1ZBP A;  1ELW A;  3LY8 A;  4I1A A;  3WXX A;  3ZHE A;  5KJK A;  5LCW J;  3URZ A;  5FZR A;  3U3W A;  4HOS A;  5ARG A;  1KT0 A;  4CGW A;  2XPI A;  1TJC A;  4WNE A;  4F3V A;  4GCO A;  4JL0 A;  4NRH B;  3LKU A;  3ZGQ A;  3PE4 A;  1HZ4 A;  3NF1 A;  4CGV A;  2OND A;  1NA0 A;  5FT9 A;  2IF4 A;  3CKB A;  1IHG A;  3LCA A;  4J8D A;  4J8F A;  4LEU A;  5C1D A;  5CCM A;  4KBQ A;  4G1T A;  3VTY A;  4GYW A;  3RO3 A;  3CK7 A;  4O6F A;  1WM5 A;  3E4B A;  5FTP A;  3ZHE B;  4BTB A;  5KJN A;  4GPK A;  2R5S A;  3GZ1 A;  4U0Z A;  2UWJ G;  3KAE A;  4A1S A;  2WPV A;  3RO2 A;  2NC9 A;  4UI9 C;  4H7Y A;  4XI9 A;  2VGX B;  3UUX A;  4YND A;  4U04 A;  3ZPJ A;  2WQH A;  5BT1 A;  5A6C A;  2J9Q A;  3HYM B;  5D0Q D;  3TG5 A;  2FBN A;  2XGS A;  4I9E A;  3SZ7 A;  5JJT A;  2UY1 B;  2VSY A;  5G05 C;  4APO A;  4G23 A;  4RG9 A;  4N2Q A;  3AS5 A;  2FO7 A;  3S7F A;  3KS2 A;  3ASD A;  4AY5 A;  3ASH A;  4N3A A;  2IFU A;  3CK9 A;  4W9R A;  4JHR A;  2PZI A;  3R9A B;  3PDN A;  2C0M A;  3Q5M A;  3CKC A;  2XGO A;  4UQY A;  3LY7 A;  4Y6C A;  5EKQ D;  3ASF A;  1WAO 1;  2C0L A;  1KLX A;  2PL2 A;  4G26 A;  4I17 A;  3FP3 A;  3ESK A;  3RIB A;  4XIF A;  5HI7 A;  4AY6 A;  3UPV A;  5AYW D;  2P58 C;  3LY9 A;  1ZU2 A;  3GW4 A;  2VGY A;  2XEV A;  4GZ6 A;  4XI0 A;  3CK8 A;  4GZ5 A;  5G04 J;  3CVL A;  2V5F A;  4RG6 A;  1ELR A;  3UQ3 A;  4U0S A;  4UQZ A;  3QOU A;  4G2V A;  5CCL A;  3GYZ A;  4U0U A;  3TGO A;  3N71 A;  3Q15 A;  5JJ6 A;  2VYI A;  3MA5 A;  3Q49 B;  3OXG A;  4ME2 A;  5BW8 C;  4BTA A;  5HQ8 A;  4HOR A;  2GW1 A;  5G05 J;  4JA9 A;  2OOE A;  1A17 A;  3AS4 A;  4HOU A;  4YVO A;  3S7D A;  2KAT A;  1Y8M A;  2VSN A;  3Q47 B;  4WNG A;  5DIZ A;  4N5C A;  2KCL A;  4AIF A;  5G04 C;  2KCV A;  3EDT B;  4WNF A;  2UY1 A;  4GA1 A;  3MKR A;  3VTX A;  5LCW C;  3ZN3 A;  4GA0 A;  2KC7 A;  1B89 A;  3GZ2 A;  5ARF A;  2FEZ A;  2QFC A;  2YHC A;  1KT1 A;  4KXK B;  2DBA A;  5A7D B;  4BT9 A;  3RKV A;  5KJL A;  3CVP A;  4GCN A;  3AS8 A;  2BUG A;  4GYY A;  4UQX A;  3LPZ A;  3IEG A;  5JJ7 A;  1FCH A;  2VQ2 A;  3QDN A;  4GZ3 A;  3KD7 A;  4I9C A;  3OXF A;  1E96 B;  1YA0 A;  2VGX A;  1PC2 A;  2FF4 A;  2XGM A;  2Y4T A;  2LSV A;  4GYO A;  3RU0 A;  4WUY A;  4BT8 A;  2KCK A;  1HXI A;  3LYA A;  4BWR A;  4EQF A;  3MV3 B;  4WND A;  2E2E A; 
#chains in the Genus database with same CATH topology
 5BXU A;  4XKB A;  3MGB A;  1Q2Z A;  1D8D A;  3ZHE A;  5LCW J;  3HRA A;  4QQI A;  3QWV A;  3U66 A;  3HVE B;  2P9S G;  1INZ A;  2WXL A;  4U8Y D;  3TG4 A;  3LJ3 A;  2KBX A;  4TUU A;  3BEE A;  5LP0 A;  4FUL A;  2OVF A;  1H2T C;  5D66 A;  4I2Z A;  2HO1 A;  1W3B A;  3FFL A;  3UT7 A;  3MKQ B;  4K0R A;  4RVB A;  3ABL E;  2X6K A;  3PZD A;  3TWR A;  2PNN A;  2Y0B G;  3ZNG A;  3KAE A;  5T8I A;  5JA4 D;  3ZPJ A;  4U04 A;  1X81 A;  4FU3 A;  3SFY A;  3CK9 A;  3DSV A;  2ION A;  4LRZ A;  3ASF A;  2IQC A;  3CVX A;  3FUF A;  1FT1 A;  3SFZ A;  4J8S A;  4ANV A;  3PUK A;  3Q47 B;  3FEX A;  2ZGD A;  1TNY A;  5LCW C;  5CBN A;  5CMW A;  1N0Q A;  4URK A;  3I3N A;  1KT1 A;  1DCQ A;  5E76 A;  2R2L A;  3W9G A;  5JJ7 A;  5G2N A;  1E96 B;  1PC2 A;  3B7R L;  1NP7 A;  3RU0 A;  3CHR A;  5AEN A;  4LCT A;  3ABM E;  3FH5 A;  3TWW A;  3MV3 B;  1FT2 A;  4FAD A;  4CDN A;  1OWL A;  2EIM E;  4I1O B;  2AVP A;  3TWX A;  4ABN A;  3RJV A;  3DWL G;  4G8K A;  3CVY A;  1XNF A;  4BSZ B;  2DCP A;  4A63 B;  5FJY A;  3CVN A;  4N3B A;  2YQ8 A;  1A5E A;  3ONL A;  3QB2 A;  3CEQ A;  2BTD A;  2V5Q C;  3AU5 A;  1HH8 A;  2XHE A;  4BX8 A;  4GA2 A;  4B94 A;  3ULQ A;  5CED B;  4DPR A;  4EEC A;  4MS6 A;  4GTM A;  1N0R A;  2DYS E;  3CKB A;  4J6I A;  4M7C A;  1HG5 A;  4M3O A;  3EUV A;  2BF0 X;  3GZ1 A;  1K8K G;  3R7R A;  3UUX A;  3V31 A;  2IO3 C;  5E75 A;  4Q69 A;  3CHO A;  4FLH A;  4O1P A;  4ATZ D;  3S7F A;  5EIB E;  3ASD A;  4AY5 A;  3JXJ A;  3Q7A A;  4Y6C A;  3RIB A;  3FP3 A;  3UKR G;  2EQX A;  5HI7 A;  3D9K A;  2KZT A;  4AP2 A;  4FLB A;  3CST A;  4G2V A;  3TGO A;  3T9K A;  4ZHB A;  2X38 A;  4HRM B;  2BED A;  2KAT A;  1Y8M A;  4LSZ E;  3UTM A;  4UQX A;  1O1R A;  1FCH A;  2EIL E;  4UWH A;  4YDE A;  4BY6 A;  2OV8 A;  3ZVV A;  5BXO A;  2WXM A;  1JCS A;  4ANU A;  4BWR A;  3HXD A;  2WXP A;  5EN5 D;  1QZ2 A;  4DX5 D;  4J0U A;  2P9U G;  1K1B A;  3IXE A;  3JQ0 A;  2OCC E;  1FVH A;  5BV0 A;  3AU4 A;  1V54 E;  4DX1 A;  3U4T A;  2I2O A;  1KZP A;  2HM8 A;  3L54 A;  3FUE A;  4N2S A;  5EX3 A;  5CBO A;  4J8E A;  3G2V A;  3MCX A;  3MZL B;  4U8H A;  3FU5 A;  4O1O A;  4TXQ A;  2DVW A;  4J8F A;  3ML9 A;  1FPP A;  2WPV A;  4PS3 A;  3RO2 A;  4HBD A;  4YND A;  4QFV A;  5AAR A;  3VLD A;  4LNB A;  3CQC B;  1WG0 A;  5LOZ A;  3PRZ A;  2X6H A;  3J5Q B;  4I6E A;  1OT8 A;  5AYW D;  1NFI E;  2P58 C;  3LY9 A;  2EIK E;  3CVW A;  3FUJ A;  2H6F A;  3BG0 B;  2VYI A;  4PUC A;  5BW8 C;  3EHM A;  2OOE A;  3FU0 A;  4YVO A;  3JUE A;  4AIF A;  2V4L A;  1E8Z A;  2RKK A;  5BV1 A;  2P2C P;  1UJK A;  3QAR A;  3FH7 A;  3FUK A;  3LXU X;  3UX4 A;  3CVP A;  3AS8 A;  4GZ3 A;  5ENR D;  4I9C A;  3RRM B;  3IHV A;  3UIO C;  2KXP C;  3ZKJ A;  3SNX A;  3IBE A;  3MJW A;  3S2A A;  2R17 C;  1LF8 A;  4JA7 A;  4L7T A;  3J5P A;  4UI9 K;  4YDY A;  3P2B A;  5BNW A;  3LVR E;  3CVQ A;  1LD8 A;  3D9P A;  5JHA A;  4G11 A;  1OUV A;  1ZBP A;  4I1A A;  3ML8 A;  1N54 A;  1KT0 A;  3IKO B;  4FP7 A;  3PE4 A;  5A23 A;  2VTB B;  3UM2 A;  3ZHE B;  4HB5 A;  1N4P A;  1YMP A;  2A5U A;  2VGX B;  1TNB A;  4YDW A;  2V4H C;  3SQV A;  2IFU A;  2X6I A;  5EIL A;  2WXJ A;  4GTP A;  2OEW A;  3EHR A;  4DX6 D;  3D9L A;  3DXM G;  2WM9 A;  5CCL A;  3Q9N C;  3N71 A;  4GPM A;  3MA5 A;  4BTA A;  1KPS B;  4JHJ A;  4HOU A;  3L6A A;  4WNG A;  4LUN U;  4N5C A;  1UN9 A;  3L13 A;  1UOH A;  3VTX A;  1TN6 A;  2RG8 A;  5ARF A;  2QFC A;  1KZO A;  3TWT A;  4GCN A;  4TRQ A;  2IJG X;  4TXR A;  4JEU A;  4HXI A;  2VGX A;  2ETB A;  3JCK C;  3E32 A;  3D9I A;  2L0T B;  4KYO B;  4EHM A;  4H7X A;  2WMN A;  2VTB A;  3FWV A;  1G3N B;  3AJI A;  3ZXP A;  3HXB A;  3S7J A;  2PQR A;  5KJK A;  3AG1 E;  3B7B A;  2KZT B;  2GRN B;  3ZYQ A;  4WNE A;  4JHK A;  3ZGQ A;  2J49 A;  4HVB A;  5CCM A;  3VTY A;  2E0I A;  3KSL A;  5ENP D;  5J90 A;  1WM5 A;  1Z3Y A;  1MZC A;  3T5V A;  2WQH A;  3NAW A;  2FBN A;  3NOC D;  5KWD A;  5AN8 A;  2WXN A;  3CKC A;  3F6Q A;  2PL2 A;  2V8S E;  1SW6 A;  3B7U X;  3GW4 A;  3CHM A;  1VDY A;  3ASO E;  3UKU G;  2QYU A;  3SY2 A;  1UW4 B;  4C0E A;  5HQ8 A;  4FJZ A;  5G05 J;  4BX9 A;  4KVM A;  3FEY A;  2KCV A;  4AXH A;  2ZIR A;  3PNT B;  2XEE A;  4Q94 A;  1AWC B;  1YYH A;  5KJL A;  2RFM A;  4D10 C;  4MRU A;  4GYO A;  3RK6 A;  5J08 A;  1O1T A;  1HXI A;  4GMR A;  3G2U A;  5ENT D;  1H2U A;  5ENN A;  4TUM A;  4JXT A;  5CRU A;  4N3C A;  4TV3 A;  4G25 A;  4I2W A;  3ZYK A;  4GTQ A;  3C5R A;  3SD5 A;  2JAB A;  2LNI A;  2XCB A;  4U07 A;  3LEW A;  3QWP A;  1MX6 A;  4Q96 A;  3QKY A;  4OVV A;  4GZC A;  4EBA G;  4HOS A;  2BKK B;  2IEJ A;  1BI7 B;  3E33 A;  1WY6 A;  5FQ8 A;  4DLQ A;  5CER B;  4HNA D;  4HRN A;  5FIO A;  4LEU A;  2DZO A;  1OCR E;  4BES A;  3E34 A;  1O1S A;  3NZS A;  5HS0 A;  5G05 C;  3FTU A;  5KBA A;  3TWU A;  3PDN A;  1WAO 1;  2QY7 A;  1XGW A;  4AV7 A;  4DUI A;  4GZ6 A;  1ZU2 A;  5EYL A;  4B8C B;  4RG6 A;  3QOU A;  3O4Z A;  4BFR A;  3Q49 B;  1DVP A;  4JW1 A;  4HI9 A;  2WQ7 A;  2CFZ A;  3T8K A;  5KCM A;  1X5B A;  3NOG D;  5EID A;  1S64 A;  5CEA A;  3FY4 A;  1TNO A;  2AXV A;  1BD8 A;  5T4Y A;  2HE0 A;  3CR3 A;  3IEG A;  3PRE A;  2KCK A;  4B8A A;  2L0I A;  3FTX A;  3MEK A;  4GU5 A;  2I1J A;  2C2L A;  3MYV A;  3EJN A;  2YIN A;  4OAU C;  1P5Q A;  4HLE A;  3FH8 A;  3ASN E;  4IN3 B;  4AM9 A;  4DRX E;  4UI9 J;  3EU9 A;  1EYH A;  1OCO E;  3UT4 A;  1YCS B;  3I4G A;  3ASG A;  3V2X A;  2XQ0 A;  2J07 A;  4GB9 A;  2OND A;  1N4R A;  5C1D A;  4BTB A;  4UWL A;  2UWJ G;  4N5Q A;  1UJJ A;  4AEZ C;  4XI9 A;  5BT1 A;  1TR4 A;  5B3S E;  2X6J A;  3R9A B;  2C0M A;  5AQB A;  3IV0 A;  1BLX B;  5ENQ D;  4U0S A;  1D9S A;  3RRU A;  4ILI A;  4DLO A;  1E90 A;  2GRQ B;  3BG1 B;  4R7L A;  3IHY A;  3ISM C;  3LPZ A;  2RD0 A;  1HE8 A;  4CZ2 D;  5B1A E;  2LSV A;  1IQR A;  4BT8 A;  1QNF A;  3B7T A;  1OY3 D;  3QC1 A;  3Q75 A;  1MYO A;  4NQ0 A;  1TNU A;  4ANW A;  2ZU6 B;  3PE3 A;  1EF1 C;  3CQG B;  3JQ1 A;  4YDO A;  3QAQ A;  3ZXS A;  3TL5 A;  4LNG A;  3HG0 D;  2F37 A;  3I4R B;  4UWK A;  4CGW A;  4I6G A;  4DJA A;  1PY1 A;  4G1T A;  3CHQ A;  2GRM A;  3R9M A;  3HYM B;  3SZ7 A;  3NQP A;  4APO A;  4UUC A;  3D9J A;  3QK0 A;  1HFA A;  4J8Y A;  2KM4 A;  4XIF A;  1U3C A;  3DRA A;  1NL4 A;  2LO6 A;  3CSF A;  3KSQ A;  4LER A;  1ELR A;  4UQZ A;  2VGE A;  3LDZ A;  1TN8 A;  2WXH A;  2A4Z A;  4JA9 A;  3SHF A;  3AS4 A;  2L9B A;  2OEV A;  2AWI A;  2VSN A;  4ILH B;  3OTN A;  2EIJ E;  3DEO A;  3CIA A;  2LAH A;  3T5X A;  1B89 A;  3HDX A;  4AVX A;  2XS8 A;  5ENO D;  2PM6 A;  3L22 A;  2IY0 C;  1JCR A;  3EIQ C;  3BU8 A;  5EX0 A;  1Z5S C;  4CYM D;  3VLE A;  2Q7F A;  5D2M C;  4YVQ C;  4HS2 A;  2I6H A;  2ZXW E;  2FI7 A;  1SQM A;  5JHB A;  2XZT G;  3PZ2 A;  1E8Y A;  1QYM A;  4DX2 A;  5FT9 A;  4PH4 B;  1UG3 A;  5JMN D;  3D9N A;  2WVI A;  4F7A A;  5FIN A;  5JJT A;  2XPZ A;  4G23 A;  3AS5 A;  4MBG A;  3FUI A;  3ASH A;  4PS7 A;  3LS8 A;  4JHR A;  3Q5M A;  3CGH A;  5CRV A;  3UMV A;  3PH0 C;  3EHN A;  3C98 A;  2X6F A;  2NSZ A;  4PS8 A;  3E37 A;  3BQO A;  2VGY A;  5G04 J;  3GZS A;  4EZL A;  3BUA A;  3SBT B;  4IYP A;  3SO8 A;  4ILG A;  2KCL A;  4GA1 A;  4U95 D;  2XPY A;  3GZ2 A;  4K5B A;  2YHC A;  2A5E A;  3SBS A;  5A7D B;  1H2V C;  1H6K A;  4AJW A;  3KD7 A;  4JZY A;  3L17 A;  1IHB A;  3C3O A;  2ILR A;  4BET A;  1FVF A;  4CT4 A;  2JEK A;  4L2Y A;  3TAX A;  4PDX A;  3OXL A;  3DSX A;  2NYJ A;  2L6J A;  2YNQ A;  4TXP A;  2Y4U A;  3ZRH A;  3ZYM A;  2ZIS A;  4FC8 A;  2R59 A;  2DIW A;  1TJF A;  3FTY A;  1OCZ E;  2R02 A;  2WXF A;  5BUZ A;  4EZK A;  1NZN A;  5DBK A;  1O5M A;  3LY8 A;  2FO1 E;  4JVS A;  3C3Q A;  3FUN A;  5FWQ A;  4KZ0 A;  2GRP B;  3D9M A;  4ACK A;  3T8M A;  5AQA A;  4KBQ A;  2WXG A;  5FTP A;  2VSO E;  3ULE G;  3ENE A;  2Y1L E;  2NC9 A;  4H7Y A;  4GAA A;  3TG5 A;  1HO8 A;  2AXU A;  4JEH A;  2EIN E;  3B13 A;  3DST A;  1ELK A;  4MKT A;  3UM0 A;  1SA5 A;  3UQ3 A;  2J8S D;  3GYZ A;  5AAO A;  2WXR A;  1JWG A;  4ME2 A;  4A1G A;  3LVQ E;  3UM3 A;  4CCA A;  4HQD A;  2WB2 A;  2MOW A;  1ZB1 A;  1HS6 A;  3DSW A;  3TWS A;  3APF A;  2Y4T A;  2PM7 A;  3LYA A;  3L08 A;  4B0Z A;  2I9C A;  4WND A;  1JPL A;  3G2S A;  3S7B A;  2XEN A;  1IYG A;  5FZS A;  5ITZ F;  4GTS A;  4U96 D;  2VJ8 A;  4FHJ A;  4UWG A;  4RLY A;  2PQN A;  2IO2 C;  3JXI A;  3R7Q A;  1ELW A;  3URZ A;  5ARG A;  1TJC A;  1V55 E;  1NA0 A;  3FU6 A;  2IF4 A;  3RO3 A;  2FUL A;  3E4B A;  2R5S A;  1H6P A;  4GMJ A;  1D8E A;  3HVE A;  4U63 A;  3UXG A;  2UY1 B;  4MLP A;  5HRY A;  5AJD A;  3CHP A;  4L2L A;  2PZI A;  2YHE A;  3ZFW A;  2C0L A;  4G26 A;  4AY6 A;  3UPV A;  3TXN A;  3C72 A;  3DBS A;  3SGH A;  2XEV A;  4GPK A;  3CVL A;  1OCC E;  4E6H A;  1OWM A;  4Z68 A;  2M63 A;  2WMO A;  2WXQ A;  1BPO A;  1AP7 A;  1DCE A;  1MHQ A;  4EBA A;  2CG3 A;  3DPD A;  2Y3A A;  3PVL A;  2IU1 A;  2QYJ A;  3AG3 E;  4IUL A;  4OVU A;  3DXK G;  2UY1 A;  3UIN C;  3ZN3 A;  2KC7 A;  3L16 A;  2DBA A;  1L5J A;  2H6H A;  3RSE G;  5HKP A;  1IXV A;  4HRL A;  2GRO B;  1TN7 A;  3JYS A;  4JC8 A;  3TXM A;  5T3R A;  3NBN B;  3D9O A;  3DEP A;  5KJM A;  1NA3 A;  4K5C A;  1SZA A;  5G55 A;  3P1U A;  4L1B A;  4CRW A;  3V2O A;  2B6C A;  3PUJ A;  2CG2 A;  4HI8 A;  3WXX A;  3UM1 A;  2QZA A;  1TNZ A;  3Q73 A;  3HHM A;  5KJN A;  4XE0 A;  3WG7 E;  2J08 A;  3RRN B;  5D0Q D;  4I9E A;  2XGS A;  3PS6 A;  1HF8 A;  3X2Q E;  1BI8 B;  4N2Q A;  2XZD G;  3FDH A;  4XKC A;  3PZ1 A;  4L9P A;  4KVO A;  3PZ3 A;  3Q7F A;  5C2Y A;  5EKQ D;  1KLX A;  5LFA A;  5A6C A;  2H6I A;  2V5F A;  3PZ4 A;  4X8Q A;  2ZGG A;  4U0U A;  3W9F A;  4HOR A;  3AG4 E;  4EPZ A;  3S7D A;  5EYP F;  4NIK A;  2R03 A;  3FTS A;  3ONK A;  4RSY A;  4F1P A;  1RZ4 A;  3ULY A;  4K03 A;  1JWF A;  4GTT A;  3FTV A;  4BSX A;  2CHX A;  3OXF A;  3B95 A;  5AQ9 A;  4DX7 D;  1H0A A;  1Y6I A;  3V30 A;  4DI3 A;  5CHE E;  3FTW A;  5FQ7 A;  4P29 A;  3Q79 A;  5KNH D;  1OXJ A;  1GW6 A;  3TJP A;  2J4D A;  4BEP A;  1S0P A;  2Y69 E;  2I1K A;  4C0M A;  1N4S A;  4CDR A;  4OYS A;  2CHW A;  4IRU A;  4F3V A;  4EZJ A;  4HFG A;  1HZ4 A;  1SA4 A;  4KMO A;  4WWO A;  3JUI A;  4CEM A;  2LAI A;  2NXP A;  3ZW3 A;  3AG2 E;  3CK7 A;  2DZN A;  2ETA A;  4U7E B;  4U0Z A;  4DI4 A;  3U64 A;  2GGF A;  1E8W A;  2MYO A;  2F0Y A;  4O60 A;  2BKG A;  3ESK A;  2P9P G;  2AJA A;  2DYR E;  1PAQ A;  4A3V A;  3PEU B;  1MJ0 A;  5CMY A;  3KEZ A;  3DPY A;  4XX5 A;  4A55 A;  2IOL A;  2P9K G;  3ZEF A;  3EIJ A;  3G2T A;  5DIZ A;  3QNK A;  5G04 C;  3FUH A;  2VSX E;  1EPU A;  4WAF A;  4E85 A;  2V0P A;  2WXO A;  4F6R D;  2BUG A;  4GYY A;  1U2V G;  3QDN A;  2FF4 A;  2XGM A;  3CVU A;  3ZYL A;  1E7U A;  4RQI A;  2X3M A;  1H19 A;  2E2E A;  5AQ7 A;  3SF4 A;  1SVX A;  3D3M A;  3O48 A;  4KZC A;  4K5A B;  2JLB A;  4G24 A;  2MHK A;  3Q4A B;  4U8V D;  2AW6 A;  2J4B A;  4Y6W A;  2LSU A;  2HR2 A;  2XCC A;  3UIP C;  4I43 A;  1DC2 A;  2B0O E;  2CHZ A;  4GCO A;  4JL0 A;  3NF1 A;  4LNU D;  3AAA C;  2J09 A;  4J8D A;  3TWQ A;  4JB8 P;  1HU3 A;  4B93 B;  4A1S A;  4UI9 C;  2P9I G;  4RG9 A;  3HXF A;  3ZUV B;  1WDY A;  1IKN D;  4N3A A;  3APD A;  3Q9U C;  4L23 A;  4I17 A;  4UWF A;  4OAV B;  3CK8 A;  2P9L G;  3KEA A;  5ENS D;  5JJ6 A;  2GW1 A;  4FA6 A;  3E30 A;  4WWP A;  4CT0 A;  3EDT B;  4FHK A;  1S70 B;  5B1B E;  2LXM A;  1E7V A;  4APF A;  3VLF A;  4BT9 A;  4F1S A;  3RKV A;  4ATG A;  2F8X K;  2H6G A;  3HIZ A;  4NAC A;  2MRI A;  2VQ2 A;  5AIJ A;  4EQF A;  4V3I A;  3MX3 A;  1U3D A;  1MX4 A;  3ABK E;  4XZ4 A;  5D0O D;  4GTV A;  3K9I A;  3QWW A;  5H7P A;  2GRR B;  1QQE A;  5M72 A;  2CFU A;  4GZD A;  2LUH A;  1N4Q A;  2XRZ A;  4LG6 A;  1DNP A;  3MV2 B;  5FZQ A;  4DK5 A;  3CVV A;  3CV0 A;  4AOF A;  3U3W A;  1LD7 A;  4CGV A;  4CDM A;  4O6F A;  3I5P A;  3UI2 A;  1HX8 A;  1MQS A;  3FUL A;  2AXZ A;  3CHS A;  4NUR A;  2FO7 A;  3APC A;  4ACL A;  4W9R A;  4G8L A;  2XS1 A;  2WXI A;  1QBQ A;  3ESL A;  3FUD A;  2ETC A;  5FQ4 A;  4JPS A;  1K3Z D;  4GZ5 A;  4FJY A;  4BER A;  2LXL A;  2WXK A;  3SI5 A;  2DWZ A;  3Q15 A;  5EDS A;  1N9A A;  3ZU7 B;  1H6O A;  3C3R A;  3SFX A;  3FUM A;  4WNF A;  3MKR A;  3PEV B;  1BU9 A;  3FU3 A;  3QJZ A;  3L82 A;  2FEZ A;  3D9H A;  4HLL A;  2P9N G;  4JD2 G;  2XEH A;  3EHQ A;  1Z3X A;  5ANR A;  5KNG A;  3CLJ A;  4GTR A;  1IQU A;  4A3T A;  4I6J A;  3G2W A;  3ZIM A;  3NB2 A;  1OWN A;  1TYQ G;  4HOT A;  3B7S A;  2HYZ A;  1N52 A;  5IY5 E;  4N39 A;  5AJL A;  5ANL A;  1TEZ A;  1JCQ A;  4GTO A;  1LTX A;  4J7W A;  4HOQ A;  2XRY A;  4F53 A;  2OVB A;  1S63 A;  5FZR A;  2RFA A;  2XPI A;  3FTZ A;  3UT8 A;  3EU5 A;  4NRH B;  1OWP A;  1E8X A;  3LKU A;  4KT6 B;  3LCA A;  1IHG A;  1EDU A;  1NI1 A;  3DSS A;  1N94 A;  4ANX A;  4GYW A;  3NZU A;  4XEI G;  3TWV A;  5FQ6 A;  3RAU A;  3U9W A;  3OAW A;  2J9Q A;  2QC9 A;  3Q78 A;  2VSY A;  1HG2 A;  1JUQ A;  2IOS A;  3KS2 A;  3HXC A;  4ZFH A;  2R05 A;  5LX8 A;  2XGO A;  4UQY A;  3LY7 A;  3V79 K;  3LJN A;  4XI0 A;  1OWO A;  1RW2 A;  5BPP A;  1N95 A;  4WWN A;  3OXG A;  2GRL A;  2L6B A;  1A17 A;  1K1A A;  3MKQ A;  4I1M A;  4C9B B;  3PNL B;  3HXE A;  2WQ6 A;  4GA0 A;  4B89 A;  1SZ9 A;  1Z6T A;  4KXK B;  3L9T A;  2F8Y A;  1UN8 A;  4C48 B;  5CEC B;  1N11 A;  3DSU A;  3FHE A;  1YA0 A;  4WUY A;  4GML A;  1MX2 A; 
#chains in the Genus database with same CATH homology
 5EX0 A;  4DI3 A;  5CHE E;  3FTW A;  5FQ7 A;  2L0T B;  3MGB A;  4P29 A;  4XKB A;  4KYO B;  3ZHE A;  5LCW J;  4H7X A;  2WMN A;  3QWV A;  3VLE A;  2Q7F A;  1GW6 A;  3TJP A;  3U66 A;  2VTB A;  3HVE B;  2J4D A;  4YVQ C;  4HS2 A;  1INZ A;  2WXL A;  3FWV A;  1S0P A;  3TG4 A;  3LJ3 A;  2I1K A;  4TUU A;  3BEE A;  2I6H A;  5LP0 A;  4FUL A;  2OVF A;  1H2T C;  2FI7 A;  3S7J A;  4C0M A;  4I2Z A;  4CDR A;  4OYS A;  2CHW A;  1SQM A;  2HO1 A;  1W3B A;  2PQR A;  5JHB A;  3FFL A;  5KJK A;  2KZT B;  3MKQ B;  3UT7 A;  1E8Y A;  3ZYQ A;  4IRU A;  4K0R A;  4WNE A;  4JHK A;  4F3V A;  4EZJ A;  4HFG A;  3ZGQ A;  1HZ4 A;  4KMO A;  4RVB A;  4WWO A;  2J49 A;  4HVB A;  3JUI A;  2X6K A;  4PH4 B;  2LAI A;  2NXP A;  5FT9 A;  4CEM A;  5CCM A;  3VTY A;  2E0I A;  3ZW3 A;  3PZD A;  5J90 A;  3CK7 A;  1UG3 A;  1WM5 A;  1Z3Y A;  4U0Z A;  4DI4 A;  3KAE A;  5T8I A;  3T5V A;  3D9N A;  2WVI A;  4F7A A;  3U64 A;  3ZPJ A;  4U04 A;  2GGF A;  2WQH A;  1E8W A;  5JJT A;  2XPZ A;  2FBN A;  4G23 A;  3AS5 A;  4FU3 A;  3FUI A;  3ASH A;  3CK9 A;  4PS7 A;  3LS8 A;  4JHR A;  3Q5M A;  3CGH A;  2WXN A;  3CKC A;  2ION A;  4LRZ A;  3UMV A;  3ASF A;  3PH0 C;  2IQC A;  2PL2 A;  2V8S E;  3EHN A;  3CVX A;  3ESK A;  3C98 A;  2X6F A;  3FUF A;  2NSZ A;  3B7U X;  4PS8 A;  3GW4 A;  2VGY A;  3SFZ A;  1PAQ A;  3CHM A;  5G04 J;  4J8S A;  3GZS A;  1VDY A;  4EZL A;  4A3V A;  3PEU B;  5CMY A;  3KEZ A;  4A55 A;  4XX5 A;  2IOL A;  1UW4 B;  4C0E A;  4ANV A;  5HQ8 A;  3SBT B;  3PUK A;  4FJZ A;  5G05 J;  3ZEF A;  4BX9 A;  3EIJ A;  4IYP A;  3G2T A;  3Q47 B;  5DIZ A;  4ILG A;  4KVM A;  3QNK A;  2KCL A;  5G04 C;  3FEX A;  3FEY A;  2KCV A;  3FUH A;  2VSX E;  4AXH A;  4GA1 A;  5LCW C;  5CMW A;  1EPU A;  3PNT B;  4Q94 A;  2XPY A;  3GZ2 A;  3I3N A;  4WAF A;  4E85 A;  4URK A;  2YHC A;  1KT1 A;  3SBS A;  5A7D B;  5E76 A;  5KJL A;  1H2V C;  2V0P A;  2WXO A;  2BUG A;  4GYY A;  5JJ7 A;  4D10 C;  1H6K A;  3QDN A;  4AJW A;  3KD7 A;  4JZY A;  3L17 A;  2ILR A;  5G2N A;  4MRU A;  1E96 B;  2FF4 A;  2XGM A;  1PC2 A;  4GYO A;  3B7R L;  3RK6 A;  1NP7 A;  3RU0 A;  3CHR A;  5AEN A;  4LCT A;  1FVF A;  1HXI A;  1E7U A;  3FH5 A;  3G2U A;  3ZYL A;  4CT4 A;  2X3M A;  3MV3 B;  1H19 A;  2JEK A;  2E2E A;  4FAD A;  4CDN A;  1OWL A;  4L2Y A;  3TAX A;  1H2U A;  5ENN A;  3SF4 A;  4JXT A;  3D3M A;  4PDX A;  4I1O B;  3O48 A;  2AVP A;  4ABN A;  4N3C A;  3RJV A;  4KZC A;  4TV3 A;  4G25 A;  1XNF A;  3CVY A;  3OXL A;  2JLB A;  2DCP A;  4I2W A;  3ZYK A;  2L6J A;  2YNQ A;  2Y4U A;  4G24 A;  3SD5 A;  3ZRH A;  2MHK A;  3Q4A B;  5FJY A;  3ZYM A;  4FC8 A;  2LNI A;  2R59 A;  2DIW A;  2XCB A;  3CVN A;  1TJF A;  4U07 A;  2AW6 A;  2YQ8 A;  3LEW A;  2J4B A;  3FTY A;  3ONL A;  3QB2 A;  3QWP A;  3CEQ A;  4N3B A;  2BTD A;  4Q96 A;  4Y6W A;  2WXF A;  2LSU A;  3AU5 A;  1HH8 A;  2HR2 A;  2XCC A;  4I43 A;  2XHE A;  4BX8 A;  3QKY A;  4GA2 A;  4B94 A;  4EZK A;  5BUZ A;  1NZN A;  5DBK A;  3ULQ A;  3CVU A;  3LY8 A;  4OVV A;  4GZC A;  4EBA G;  4DPR A;  4HOS A;  4JVS A;  3FUN A;  2CHZ A;  4GCO A;  1WY6 A;  4JL0 A;  5FQ8 A;  4KZ0 A;  5FWQ A;  4DLQ A;  3D9M A;  3NF1 A;  4ACK A;  4EEC A;  4MS6 A;  2J09 A;  3CKB A;  4J8D A;  4J6I A;  3T8M A;  4LEU A;  1HG5 A;  4KBQ A;  2WXG A;  4M3O A;  1HU3 A;  5FTP A;  2VSO E;  2BF0 X;  3ENE A;  3GZ1 A;  3R7R A;  4A1S A;  3NZS A;  2NC9 A;  4UI9 C;  4H7Y A;  3UUX A;  4GAA A;  3TG5 A;  5E75 A;  1HO8 A;  5G05 C;  2AXU A;  3FTU A;  3CHO A;  4RG9 A;  4Q69 A;  4FLH A;  3S7F A;  3ASD A;  4AY5 A;  4N3A A;  3APD A;  4JEH A;  3PDN A;  4L23 A;  4Y6C A;  3RIB A;  1WAO 1;  2QY7 A;  1XGW A;  3FP3 A;  4I17 A;  4AV7 A;  3B13 A;  4UWF A;  2EQX A;  5HI7 A;  3D9K A;  2KZT A;  4GZ6 A;  1ZU2 A;  1ELK A;  4B8C B;  3CK8 A;  4MKT A;  4RG6 A;  4AP2 A;  4FLB A;  3UQ3 A;  3CST A;  3QOU A;  4G2V A;  3GYZ A;  3TGO A;  3O4Z A;  4BFR A;  2WXR A;  2X38 A;  5JJ6 A;  1JWG A;  3Q49 B;  4ME2 A;  1DVP A;  2GW1 A;  4JW1 A;  4FA6 A;  4A1G A;  4WWP A;  2WQ7 A;  2KAT A;  1Y8M A;  2CFZ A;  3LVQ E;  4CT0 A;  4CCA A;  3EDT B;  4FHK A;  1X5B A;  5KCM A;  2WB2 A;  3FY4 A;  2MOW A;  1E7V A;  1HS6 A;  4APF A;  3VLF A;  4BT9 A;  4F1S A;  3RKV A;  4ATG A;  3HIZ A;  4NAC A;  2AXV A;  4UQX A;  2MRI A;  3CR3 A;  3IEG A;  5T4Y A;  3APF A;  1FCH A;  2VQ2 A;  4UWH A;  4BY6 A;  2OV8 A;  3ZVV A;  2WXM A;  3PRE A;  2Y4T A;  5AIJ A;  2PM7 A;  2KCK A;  3L08 A;  3LYA A;  4B0Z A;  2I9C A;  4ANU A;  4BWR A;  4EQF A;  4WND A;  1JPL A;  4V3I A;  4B8A A;  3MX3 A;  1U3D A;  3G2S A;  3S7B A;  2WXP A;  1QZ2 A;  4J0U A;  2L0I A;  3FTX A;  3MEK A;  4XZ4 A;  4GU5 A;  2I1J A;  5D0O D;  3JQ0 A;  1IYG A;  2C2L A;  3K9I A;  3MYV A;  5FZS A;  3QWW A;  1FVH A;  3EJN A;  2YIN A;  5BV0 A;  1QQE A;  1P5Q A;  3AU4 A;  4HLE A;  3FH8 A;  5M72 A;  2VJ8 A;  4FHJ A;  2CFU A;  4UWG A;  4IN3 B;  4AM9 A;  4GZD A;  3U4T A;  2I2O A;  4UI9 J;  2HM8 A;  1EYH A;  3L54 A;  3FUE A;  3UT4 A;  5EX3 A;  4N2S A;  2PQN A;  3I4G A;  2XRZ A;  1DNP A;  4J8E A;  3MV2 B;  5FZQ A;  3G2V A;  4DK5 A;  3CV0 A;  3R7Q A;  3CVV A;  3MCX A;  3ASG A;  3MZL B;  4U8H A;  4AOF A;  1ELW A;  3U3W A;  3URZ A;  5ARG A;  1TJC A;  2XQ0 A;  3FU5 A;  2J07 A;  4GB9 A;  4CGV A;  2OND A;  1NA0 A;  3FU6 A;  2IF4 A;  4CDM A;  4J8F A;  5C1D A;  3ML9 A;  3RO3 A;  4BTB A;  4O6F A;  3I5P A;  2FUL A;  3E4B A;  2R5S A;  4UWL A;  1HX8 A;  2UWJ G;  4GMJ A;  1MQS A;  2WPV A;  3FUL A;  4PS3 A;  1UJJ A;  3RO2 A;  3HVE A;  4U63 A;  4XI9 A;  4AEZ C;  4YND A;  5BT1 A;  4QFV A;  2AXZ A;  2UY1 B;  3VLD A;  3CHS A;  4MLP A;  4NUR A;  2FO7 A;  3APC A;  5AJD A;  2X6J A;  3CHP A;  4ACL A;  3CQC B;  4L2L A;  4W9R A;  2PZI A;  3R9A B;  2C0M A;  2WXI A;  5LOZ A;  3PRZ A;  2YHE A;  2X6H A;  3ZFW A;  3IV0 A;  4I6E A;  2C0L A;  4G26 A;  3ESL A;  3FUD A;  4AY6 A;  5FQ4 A;  3UPV A;  5AYW D;  2P58 C;  3TXN A;  3DBS A;  3LY9 A;  4JPS A;  2XEV A;  3SGH A;  4GPK A;  4GZ5 A;  3CVL A;  4FJY A;  1OWM A;  4E6H A;  3CVW A;  2M63 A;  2WMO A;  2WXQ A;  4U0S A;  1BPO A;  3FUJ A;  1MHQ A;  4EBA A;  2WXK A;  3RRU A;  3SI5 A;  3BG0 B;  3Q15 A;  2VYI A;  5EDS A;  4PUC A;  4ILI A;  5BW8 C;  2CG3 A;  3DPD A;  3EHM A;  4DLO A;  2Y3A A;  3PVL A;  2OOE A;  3FU0 A;  4YVO A;  2IU1 A;  1E90 A;  3BG1 B;  4AIF A;  4IUL A;  2V4L A;  4OVU A;  3FUM A;  4WNF A;  2UY1 A;  4R7L A;  3MKR A;  1E8Z A;  3PEV B;  3ZN3 A;  5BV1 A;  2KC7 A;  3FU3 A;  1UJK A;  3IHY A;  3L16 A;  3QJZ A;  2FEZ A;  3QAR A;  3FH7 A;  2DBA A;  3FUK A;  3LXU X;  3UX4 A;  1L5J A;  3CVP A;  3AS8 A;  3LPZ A;  2RD0 A;  1Z3X A;  4GZ3 A;  1HE8 A;  5ANR A;  4I9C A;  3CLJ A;  3RRM B;  3IHV A;  1IQU A;  4A3T A;  1IQR A;  2LSV A;  4BT8 A;  3SNX A;  1QNF A;  4I6J A;  3G2W A;  3B7T A;  3ZIM A;  1OWN A;  3IBE A;  3MJW A;  3S2A A;  3QC1 A;  4NQ0 A;  2R17 C;  4HOT A;  3B7S A;  1LF8 A;  4JA7 A;  3JYS A;  4L7T A;  4JC8 A;  2HYZ A;  3TXM A;  4UI9 K;  5T3R A;  4ANW A;  1N52 A;  2ZU6 B;  3D9O A;  3P2B A;  5KJM A;  3PE3 A;  1EF1 C;  4N39 A;  1NA3 A;  3CQG B;  1SZA A;  3JQ1 A;  3QAQ A;  5BNW A;  5AJL A;  5G55 A;  3P1U A;  5ANL A;  4L1B A;  3ZXS A;  3LVR E;  1TEZ A;  3CVQ A;  3TL5 A;  4CRW A;  3D9P A;  4HOQ A;  2XRY A;  4F53 A;  3PUJ A;  2CG2 A;  5JHA A;  2OVB A;  3I4R B;  4G11 A;  1OUV A;  1ZBP A;  4I1A A;  3WXX A;  3ML8 A;  5FZR A;  1N54 A;  4UWK A;  1KT0 A;  3FTZ A;  2XPI A;  4CGW A;  4I6G A;  3UT8 A;  3IKO B;  4FP7 A;  4NRH B;  1OWP A;  1E8X A;  3LKU A;  3PE4 A;  5A23 A;  4KT6 B;  4DJA A;  2VTB B;  1PY1 A;  3LCA A;  1IHG A;  1EDU A;  3HHM A;  4G1T A;  4ANX A;  4GYW A;  3NZU A;  3ZHE B;  5KJN A;  3CHQ A;  2GRM A;  4XE0 A;  2J08 A;  2A5U A;  5FQ6 A;  2VGX B;  3RRN B;  3U9W A;  3OAW A;  2J9Q A;  3HYM B;  5D0Q D;  5J08 A;  4I9E A;  2XGS A;  3SZ7 A;  3PS6 A;  2VSY A;  1HG2 A;  1HF8 A;  1JUQ A;  3NQP A;  4APO A;  4N2Q A;  2IOS A;  3D9J A;  3KS2 A;  3FDH A;  4XKC A;  2IFU A;  4KVO A;  3QK0 A;  5LX8 A;  1HFA A;  2XGO A;  3LY7 A;  4UQY A;  5EKQ D;  5C2Y A;  1KLX A;  2X6I A;  5LFA A;  2KM4 A;  4XIF A;  1U3C A;  2WXJ A;  5A6C A;  4XI0 A;  1OWO A;  2LO6 A;  3CSF A;  2V5F A;  4LER A;  5BPP A;  1ELR A;  3D9L A;  4UQZ A;  2WM9 A;  5CCL A;  4U0U A;  3N71 A;  4WWN A;  3LDZ A;  3MA5 A;  4BTA A;  4HOR A;  3OXG A;  4JHJ A;  2GRL A;  2WXH A;  2A4Z A;  4EPZ A;  4JA9 A;  3SHF A;  1A17 A;  3AS4 A;  2L9B A;  3L6A A;  4HOU A;  3S7D A;  2VSN A;  2AWI A;  4WNG A;  4LUN U;  3MKQ A;  4ILH B;  3OTN A;  4N5C A;  1UN9 A;  3L13 A;  4I1M A;  4C9B B;  3PNL B;  2WQ6 A;  3VTX A;  3CIA A;  3FTS A;  3ONK A;  4GA0 A;  2LAH A;  4B89 A;  2RG8 A;  1B89 A;  4RSY A;  3T5X A;  5ARF A;  2QFC A;  1SZ9 A;  1Z6T A;  3HDX A;  4KXK B;  4AVX A;  1UN8 A;  4K03 A;  1JWF A;  4GCN A;  3FHE A;  4TRQ A;  2PM6 A;  3L22 A;  3FTV A;  2IJG X;  4BSX A;  4JEU A;  2CHX A;  3OXF A;  1YA0 A;  4HXI A;  2VGX A;  3EIQ C;  1H0A A;  1Y6I A;  3JCK C;  4WUY A;  4GML A;  3D9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...