3VTYA

Crystal structure of mama
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
175
structure length
175
Chain Sequence
b'ETTTIYMDIGDKKRTKGDFDGAIRAYKKVLKADPNNVETLLKLGKTYMDIGLPNDAIESLKKFVVLDTTSAEAYYILGSANFMIDEKQAAIDALQRAIALNTVYADAYYKLGLVYDSMGEHDKAIEAYEKTISIKPGFIRAYQSIGLAYEGKGLRDEAVKYFKKALEKEEKKAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamA
publication title Inter-phylum structural conservation of the magnetosome-associated TPR-containing protein, MamA
pubmed doi rcsb
source organism Candidatus magnetobacterium bavaricum
molecule tags Protein binding
total genus 76
structure length 175
sequence length 175
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13414 TPR_11 TPR repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3vtyA00
2Y4TA 2YQ8A 2Q7FA 1ZU2A 2UY1B 3PE3A 4BT8A 3RJVA 2VSNA 1ZBPA 3QWVA 2WQHA 5FZSA 2GW1A 4GPKA 1IHGA 1IYGA 4KBQA 2LNIA 3MKRA 3ZFWA 3CVPA 4BT9A 5DBKA 4JHRA 5JJ7A 4CGVA 5JJTA 3UPVA 3R9AB 3K9IA 1A17A 4N2QA 4H7XA 2C0MA 2NC9A 2VYIA 2VSYA 3S7BA 1E96B 3TG5A 3WXXA 4HOQA 2C0LA 3S7JA 2L6JA 5G04C 1FCHA 5FJYA 5FT9A 3S7FA 2PZIA 3FFLA 3TGOA 1Y8MA 5LCWC 5ARFA 3RU0A 4GYOA 2UY1A 3LPZA 1HH8A 4N5CA 3MV2B 5BW8C 2C2LA 3PDNA 2IFUA 4NQ0A 3MV3B 3LY7A 4GA0A 4N3CA 2KC7A 3SZ7A 4U0ZA 2HR2A 4N3BA 1YA0A 4W9RA 5FTPA 3URZA 3UQ3A 3LKUA 4LEUA 4APOA 5G05C 4O6FA 2PQNA 4XI0A 1XNFA 3GZ2A 5M72A 3KD7A 4U0UA 4UQYA 5HI7A 5G04J 3FWVA 5A6CA 2KATA 2FEZA 4I1AA 3SF4A 3AS5A 5ARGA 2KCVA 3Q5MA 4G2VA 5KJLA 5D0QD 3FP3A 4G23A 4RG6A 4JA9A 3RO2A 2XGOA 3CVNA 3VTXA 2I6HA 4U0SA 4GZ6A 2KCKA 1KT0A 4BWRA 4CDRA 3CEQA 5HQ8A 4YVQC 4JA7A 4G24A 4N3AA 2YHCA 3QDNA 2UWJG 4ABNA 5KJMA 2XPIA 1NZNA 4I9EA 2LSUA 4WNDA 3ASGA 5KJNA 5EX0A 4GZ3A 3ZGQA 5C1DA 4JL0A 3U3WA 2VGYA 3Q49B 1ELWA 3EDTB 3QWPA 3ULQA 3OXGA 3ASFA 3ZHEB 1KT1A 1QZ2A 1PC2A 4J8DA 3CKCA 5A7DB 4J8FA 4GYYA 4BTAA 4UQXA 4J8EA 3VTYA 3UUXA 2VGXB 3U4TA 4NRHB 3AS4A 4AM9A 3CK9A 2HYZA 4XI9A 1HZ4A 3PE4A 5JJ6A 5D0OD 5EKQD 4Y6CA 5BNWA 4N2SA 5BT1A 1WAO1 4G26A 3LY8A 5EX3A 4G25A 3GYZA 4AIFA 3HYMB 2R5SA 4GZ5A 1NA3A 3LCAA 4WNFA 4XIFA 4GCNA 4AY5A 4HOSA 2XCBA 5LCWJ 2PQRA 4GYWA 3ZHEA 1WM5A 3ZPJA 4H7YA 3KAEA 5KJKA 2P58C 3IEGA 3RO3A 4U04A 2MHKA 2KCLA 4WNGA 4WNEA 4YVOA 1HXIA 2VGXA 3BEEA 4N39A 3GZ1A 2XEVA 4UI9C 2BUGA 3QKYA 4WUYA 3CK7A 3N71A 2FI7A 1P5QA 4HOTA 4HOUA 2LSVA 3O48A 5AYWD 2IF4A 3GW4A 4U07A 4AY6A 3Q4AB 2AVPA 4KXKB 1KLXA 3ASHA 3QWWA 4YNDA 5G05J 2E2EA 4B94A 1ELRA 4EQFA 2V5FA 3TG4A 2VQ2A 3E4BA 1QQEA 4I9CA 5CHEE 4CGWA 4F3VA 2FBNA 4I17A 2JLBA 2DBAA 2ONDA 5FZQA 3CK8A 5DIZA 3MEKA 3OXFA 2FO7A 3LYAA 4GA1A 2WPVA 3Q15A 4I2ZA 1B89A 3MA5A 4GCOA 4UI9K 4Y6WA 3NF1A 1W3BA 4RG9A 4J0UA 4UI9J 2XGMA 4GA2A 2FF4A 1OUVA 3ESKA 2QFCA 4IN3B 4I2WA 3QOUA 3S7DA 3TAXA 2XCCA 2XGSA 3ASDA 4ME2A 3LY9A 3RIBA 3ZN3A 2J9QA 3CVLA 4HORA 4A1SA 2HO1A 3AS8A 3CVQA 3KS2A 3CKBA 5FZRA 3JYSA 4G1TA 3OXLA 4KYOB 2OOEA 3RKVA 4UQZA 2Y4UA 4BTBA 3Q47B 5CCLA 1NA0A 1TJCA 3CV0A 2PL2A 5CCMA
chains in the Genus database with same CATH superfamily
1ZU2A 3D9PA 3TL5A 3T9KA 3DSWA 4OVVA 2RFMA 2XENA 1IQRA 3JUIA 2LXMA 3FEXA 2AW6A 1IYGA 4KBQA 1LD7A 2I2OA 3MKRA 1Y6IA 5AQ9A 4FHJA 4JHRA 3PH0C 3QNKA 3UPVA 3R9AB 3K9IA 4N2QA 4CZ2D 3S7BA 3FH7A 2WXOA 4EZLA 5HS0A 3TG5A 3LS8A 3AG3E 2C0LA 4GAAA 3S7JA 2L6JA 1FPPA 1IKND 3CVVA 3PZDA 4YDWA 2V4HC 5JMND 3PZ3A 1MJ0A 3FFLA 1Y8MA 5LCWC 1HS6A 3V31A 4GYOA 4GTRA 4YDEA 4LERA 3FH5A 5AIJA 3MV2B 3B95A 3DSTA 2IFUA 3L82A 3ULEG 3MV3B 4GA0A 1TR4A 2KC7A 3SZ7A 5CMWA 1TYQG 4WWNA 2F8YA 2RG8A 5ENRD 3URZA 1D8EA 4FU3A 3LDZA 3HXEA 3LKUA 1O5MA 4O6FA 4X8QA 2X6HA 4I6GA 1EPUA 4G11A 4CT0A 1OCZE 3C5RA 4ANXA 3DSUA 4BY6A 4GPMA 2KATA 3AS5A 1Q2ZA 3RAUA 4L2LA 2IOSA 2A4ZA 3ZKJA 2WXGA 3RRNB 1XGWA 3VLFA 2Y3AA 1O1SA 2X6KA 2AXVA 4L1BA 3TWSA 4JA9A 3LJ3A 3RO2A 3RSEG 3PEUB 2VSXE 2WQ6A 3CVNA 2GRRB 2XQ0A 4U0SA 2E0IA 1Z6TA 1D8DA 5JA4D 5HRYA 4N3AA 2YHCA 5BV0A 1NZNA 1VDYA 4I9EA 2LSUA 2WXMA 3PUJA 5IY5E 4JL0A 4L2YA 3DXKG 2VGYA 3EHMA 3EDTB 3ULQA 3ULYA 1KT1A 3ZHEB 3Q7AA 3KSQA 3QARA 4XE0A 2EIKE 3L17A 3CKCA 3SI5A 4AP2A 1V54E 3BU8A 3LJNA 3APCA 2XHEA 3UUXA 2PM6A 3U4TA 3IV0A 4AM9A 3W9GA 1HZ4A 5D2MC 3PNTB 3T8MA 1MHQA 3D3MA 3L54A 4O1PA 1K3ZD 3JQ1A 4N2SA 4FHKA 1QNFA 3EUVA 1L5JA 1X81A 3LY8A 5EX3A 4PDXA 3CR3A 4G25A 3T5VA 3HYMB 2Y0BG 2DVWA 4GZ5A 1KZOA 4GMLA 1AWCB 5LCWJ 1WDYA 4GTSA 1WM5A 3UM0A 1NI1A 2P58C 2I1JA 4WNEA 3O4ZA 3RRMB 3Q78A 2VGXA 2GRMA 4F6RD 2IU1A 1O1TA 4KZCA 5T3RA 4N5QA 1H19A 1K1BA 3FU0A 2BUGA 3EU9A 2LUHA 4YDYA 3E30A 2I1KA 1P5QA 4HOUA 4RLYA 1BD8A 1NFIE 2IF4A 5ENNA 3NB2A 3UTMA 1H2VC 2AVPA 4KXKB 1GW6A 2KZTA 3ZYKA 3L9TA 4M3OA 3CIAA 5LX8A 3G2VA 4CGWA 4DPRA 2FBNA 3G2WA 2FO1E 2JLBA 2WMOA 2DBAA 3R7RA 2P2CP 1Z3XA 2FO7A 3AU4A 4B89A 4F1SA 3Q15A 2P9LG 2DIWA 2DZNA 4FA6A 3CSFA 4JPSA 4JD2G 4FULA 4RG9A 2DCPA 3ML9A 4BX8A 3FUNA 1OUVA 3ESKA 2IQCA 1DC2A 2ZXWE 3QOUA 1E8WA 1HE8A 5BV1A 3TAXA 2XGSA 4ILHB 2OV8A 4ANWA 4CYMD 3CVXA 2CHXA 3FUFA 4PS8A 1HO8A 3ZN3A 4HFGA 3OTNA 4DX5D 2F37A 1FT1A 3CVQA 1OWNA 3KS2A 3CKBA 5E76A 5FZRA 3JYSA 5EYLA 2OOEA 3RKVA 2HE0A 2WMNA 2RKKA 3CV0A 1JUQA 3CQGB 2YQ8A 3UMVA 4DLOA 4TXPA 3KSLA 2YHEA 3PE3A 4BT8A 2NSZA 5CMYA 2MOWA 3B7UX 4A63B 3FUDA 3RJVA 4PS7A 1UN9A 2R59A 2J4DA 3D9MA 3RRUA 2WQHA 3HDXA 4XZ4A 1IHGA 5E75A 1AP7A 4APFA 5LP0A 3AJIA 4KVOA 5FQ6A 5EDSA 5DBKA 5J08A 4HRLA 3E34A 1OCCE 2DWZA 2XEEA 1K8KG 5JJTA 2OEWA 5J90A 1X5BA 3PZ4A 4H7XA 1Z3YA 2NC9A 4FADA 4MKTA 1EYHA 2IO3C 1U3CA 4HLLA 4GTQA 1FCHA 5FJYA 4Q69A 4ILIA 5FT9A 5ANRA 3S7FA 4EECA 2PZIA 5ARFA 3CLJA 2WXIA 3FTSA 3EJNA 4P29A 1U2VG 4N5CA 4NQ0A 4AEZC 5AQAA 2H6FA 4N3CA 4ACLA 4U0ZA 2HR2A 1U3DA 4JEHA 3SFZA 1YA0A 4JHKA 3L16A 5FTPA 4JHJA 4JB8P 3UM2A 3ZYLA 1BU9A 3SFXA 4LEUA 2XS1A 4APOA 3HVEA 4XI0A 2CG3A 5M72A 1KPSB 3KD7A 1S64A 2VSOE 2XEHA 4A1GA 4JVSA 3SF4A 3JXJA 3JXIA 5ARGA 3DXMG 3U9WA 4JEUA 2KCVA 4ANUA 3WG7E 4HRNA 3SNXA 1UOHA 1LD8A 2XZDG 3UT8A 3TWTA 5D0QD 4A3TA 1RZ4A 3FP3A 3PUKA 4OAVB 3UM1A 3X2QE 5C2YA 3BG1B 3ZUVB 4RSYA 5AJLA 2L9BA 3VTXA 1MX4A 4GZ6A 2KCKA 3MX3A 3DEOA 1E7VA 3CEQA 5AJDA 5ANLA 4J7WA 3R9MA 2CHWA 3QDNA 3VLDA 2ZGGA 2B6CA 2AXUA 2RD0A 2NYJA 3HXCA 3PZ1A 3ASGA 4K0RA 4NIKA 4XKCA 3C3OA 3IXEA 4GB9A 3Q49B 4LSZE 3UKUG 2R05A 3QWPA 1YYHA 3ASFA 3FU5A 1RW2A 1QZ2A 4KMOA 3JUEA 2GRQB 5A7DB 3TWUA 3ZEFA 4GYYA 4QFVA 5EILA 4UQXA 2P9UG 3CSTA 2VGXB 1O1RA 2X3MA 3FUMA 5ENQD 5KWDA 4JW1A 2VGEA 4BSZB 3NBNB 4UWGA 3HG0D 3ZU7B 4Y6CA 4I6EA 3QAQA 5BT1A 4U95D 1H6OA 1DCEA 4BERA 4U7EB 2KZTB 2X6IA 4CEMA 3MZLB 1SVXA 2R5SA 2J07A 4KT6B 4GCNA 4GMJA 3LXUX 2NXPA 1ZB1A 3ZPJA 4B8CB 4H7YA 3NZSA 4WAFA 5CBOA 5KJKA 3IEGA 4U04A 4MBGA 1PAQA 2WM9A 3S2AA 4WNGA 4K5AB 1Z5SC 2VTBA 3D9NA 1G3NB 1H2UA 1HXIA 2BEDA 3B7RL 3BEEA 4RQIA 3FTZA 2H6GA 2X6FA 4WWPA 5G55A 2LXLA 2GROB 1HX8A 1TNOA 2FI7A 4TV3A 4HOTA 4HB5A 2LSVA 3GW4A 3ASNE 3V79K 4K5BA 1HG2A 2LAHA 3EHQA 2E2EA 1ELRA 4IRUA 4IULA 1PY1A 4U8YD 2V5FA 3E4BA 2QZAA 5HKPA 1OY3D 5T4YA 3EHNA 4F3VA 2XS8A 4I17A 4OVUA 3CK8A 4R7LA 4HI8A 3B7BA 4JZYA 2XPZA 3MEKA 3SBSA 5LOZA 4GA1A 3CHOA 4I2ZA 1B89A 2F8XK 5ENPD 3MA5A 2P9PG 2DYSE 3P2BA 1DCQA 3UXGA 3QK0A 2MYOA 2XGMA 5CCMA 2XZTG 2FF4A 1DVPA 1E90A 1K1AA 4I2WA 2IO2C 4DI4A 3L13A 3S7DA 1E7UA 3HHMA 4WWOA 1S0PA 3RIBA 2WXJA 3HXDA 4HORA 3C72A 3C3QA 2R2LA 1FT2A 3FU3A 1H6PA 4G1TA 3OXLA 3CVWA 2WB2A 4UWHA 4KYOB 4UQZA 1EF1C 3Q9NC 3Q47B 1NA0A 3J5QB 3QB2A 4NURA 5CRVA 3GZSA 1H2TC 4YDOA 3EHRA 5H7PA 1SQMA 2BTDA 4K03A 5FZSA 2GW1A 1OCRE 4AJWA 4CT4A 1E8ZA 3FTUA 2LNIA 2BKGA 5EN5D 1N54A 3ZFWA 3E32A 3AAAC 4ATZD 3UI2A 3L08A 4BT9A 2V4LA 1A17A 3PREA 2C0MA 2X6JA 1UJJA 2VSYA 3ZYMA 3CQCB 4O1OA 3HVEB 4HOQA 4L23A 1WY6A 3EIJA 2ETBA 3BQOA 3DEPA 1TNZA 5AQ7A 1BI7B 4EBAG 3NAWA 4MRUA 1OWOA 5AAOA 3B7SA 3RU0A 2CG2A 4GTVA 5AN8A 3VLEA 5JHBA 2UY1A 4EZKA 1INZA 1UN8A 1HH8A 4FJZA 5BW8C 3P1UA 3PDNA 2AXZA 3FUIA 3LVRE 5D66A 4D10C 1HFAA 2OCCE 4DK5A 1NP7A 4AOFA 4W9RA 2X38A 3U64A 1MX2A 4O60A 1OCOE 2CHZA 1TJFA 2AWIA 2PQNA 4DLQA 1TN7A 4HLEA 4EPZA 4I43A 4U0UA 4BFRA 3IHYA 2IOLA 4FLBA 4UQYA 5HI7A 5G04J 3FWVA 1MYOA 3J5PA 5CEAA 4LNGA 4MS6A 4I1AA 3DSXA 4AV7A 3TJPA 1YMPA 2IONA 2IJGX 3U66A 3Q5MA 4G2VA 2EQXA 4UWKA 3EIQC 3FHEA 4J8SA 4E85A 2XRZA 3CHMA 3L6AA 2WXLA 1N95A 2WXFA 4RG6A 2WXQA 3I3NA 3ABME 4PS3A 1E8YA 1MZCA 3ML8A 5A23A 1SZAA 4U8HA 3MKQA 5FWQA 4F1PA 4BWRA 4I1OB 5HQ8A 4JA7A 3PEVB 3C98A 5KJMA 2XPIA 2P9SG 1ELKA 4C0MA 4E6HA 4EZJA 4GZ3A 3ZGQA 4XX5A 5JHAA 4DI3A 4DX2A 5CEDB 3TWRA 1PC2A 2DZOA 5G2NA 2GRLA 4ZFHA 4J8DA 3L22A 3SBTB 1BI8B 1N4QA 2P9NG 4J8EA 1OT8A 1OWLA 3PNLB 3VTYA 2VTBB 3BUAA 4J6IA 2XPYA 4GTTA 3AS4A 3SGHA 2EILE 3CK9A 2HYZA 3ZVVA 4TUMA 1HU3A 3UIPC 4KVMA 2QC9A 3KEAA 3FUKA 3I4RB 2I9CA 3PE4A 5JJ6A 5D0OD 5EKQD 5BNWA 3FTWA 3UT7A 2L0IA 5AENA 2VJ8A 4G26A 3FUHA 3D9IA 4HBDA 1N9AA 1OWMA 3Q7FA 3NQPA 4AIFA 1WG0A 3DPDA 1SA4A 1N94A 2JABA 3LCAA 4WNFA 5CECB 2XCBA 5LFAA 2EINE 4GYWA 3TWQA 2GRPB 1LF8A 3KAEA 3RO3A 4GTMA 2MHKA 2KCLA 3CHQA 4A3VA 4J8YA 2R03A 2B0OE 4Q96A 3T5XA 2XEVA 3SHFA 2KBXA 4AXHA 1JCSA 3QKYA 3N71A 4UWLA 5BXUA 3O48A 3AG1E 4U07A 1FVHA 3Q4AB 3APDA 4LG6A 2JEKA 1KLXA 3ASHA 5FQ4A 2OVBA 5EYPF 3TG4A 2VQ2A 3DRAA 4ZHBA 2H6HA 2WXNA 4I9CA 5CHEE 1IHBA 2ONDA 4CDNA 1HG5A 4A55A 5DIZA 3AG4E 3DSVA 4KZ0A 3PRZA 4L9PA 4C48B 2QY7A 4CCAA 2WPVA 3I4GA 3ENEA 4AVXA 4UI9K 3TWXA 3NF1A 1N4SA 2BKKB 2WXHA 2WXPA 4J0UA 4UI9J 3SO8A 2ETCA 4BETA 2QFCA 3JQ0A 1N4RA 2ZU6B 4DRXE 1NL4A 1OXJA 2ZISA 2Y1LE 2XCCA 3UINC 3UX4A 2BF0X 2GRNB 4Q94A 4ME2A 3TWVA 3LY9A 4DX6D 2ETAA 2J9QA 4HXIA 4FLHA 3AG2E 4A1SA 1LTXA 4XEIG 2FULA 3MJWA 1OWPA 4BX9A 2WXKA 4U96D 3FTVA 4U8VD 4M7CA 4JC8A 4F53A 2Y4UA 2YINA 5ENTD 3D9LA 4TXQA 3ABLE 1BLXB 5CCLA 2KXPC 3V30A 2A5UA 2Y4TA 4OYSA 2L0TB 5FINA 1JPLA 2Q7FA 4TXRA 2UY1B 4F7AA 2J49A 1TNUA 1JWFA 2VSNA 1ZBPA 3QWVA 1YCSB 2CFUA 4GU5A 4HQDA 4GPKA 3DSSA 3ZXPA 3F6QA 2LAIA 3FU6A 3CVPA 2H6IA 1TN8A 5JJ7A 4LUNU 3RK6A 3LEWA 4CGVA 3CHRA 4EBAA 3FDHA 3HIZA 3EU5A 2VYIA 4GMRA 1SA5A 2QYUA 1E96B 3QJZA 3WXXA 5FQ7A 5G04C 3FTXA 3ZYQA 4LNUD 1UJKA 3ABKE 4U63A 3TGOA 3PS6A 1TNYA 3LPZA 2EIJE 4LRZA 2C2LA 3SD5A 2QYJA 1QYMA 3UM3A 2YNQA 3LY7A 4FP7A 3ISMC 2KM4A 3FEYA 4GZCA 4CRWA 4UWFA 4DUIA 1JCRA 4N3BA 1HF8A 3HXFA 4OAUC 3TXMA 3NZUA 2P9KG 3CVUA 4BESA 4CDMA 4B8AA 1N4PA 3UQ3A 1DNPA 4EHMA 1H0AA 3IBEA 3Q79A 5CRUA 3MKQB 2R17C 4L7TA 5G05C 3TWWA 4HS2A 4FC8A 2GGFA 3SFYA 5AQBA 1XNFA 4HVBA 3ONKA 2R02A 3GZ2A 4ATGA 2MRIA 3T8KA 1S70B 3UIOC 3D9JA 4LNBA 5A6CA 2HM8A 3JCKC 2FEZA 4MLPA 3SY2A 5BUZA 3E37A 5ENSD 2AJAA 5BXOA 4HRMB 3Q75A 3C3RA 4V3IA 5B3SE 4C0EA 3ZRHA 4K5CA 5KJLA 1EDUA 3UT4A 4G23A 3ZXSA 4NACA 3ZIMA 2XGOA 2V5QC 5B1AE 2I6HA 1E8XA 4LCTA 3HXBA 1N52A 3Q73A 1KT0A 4CDRA 4C9BB 2WVIA 4YVQC 4QQIA 4G24A 1UW4B 2UWJG 4ABNA 4JXTA 5KNGA 1S63A 1SZ9A 3MGBA 4B93B 2ZGDA 4WNDA 1JCQA 3DPYA 5KJNA 5EX0A 5C1DA 3U3WA 4DX7D 4URKA 4GZDA 2F0YA 1ELWA 4ILGA 3CGHA 4I1MA 3OXGA 2IY0C 2RFAA 2ILRA 1TEZA 2ZIRA 5EIDA 4J8FA 3PZ2A 4BTAA 4G8LA 3ZW3A 5CERB 2J8SD 2WQ7A 1UG3A 4GTOA 2OEVA 3NOCD 4NRHB 3G2TA 4HI9A 1H6KA 4XI9A 3B13A 3MCXA 4FJYA 4TRQA 5BPPA 3FUJA 2L6BA 5ENOD 2A5EA 1N11A 3I5PA 1V55E 1WAO1 4B0ZA 3GYZA 5KNHD 3SQVA 4UUCA 4IYPA 3CHPA 2PNNA 3OAWA 1NA3A 3D9HA 1BPOA 4XIFA 5KBAA 4AY5A 4HOSA 3APFA 2PQRA 3ZHEA 5B1BE 3BG0B 3FH8A 3CVYA 3QC1A 3NOGD 5AARA 1JWGA 3FY4A 3KEZA 5FQ8A 4YVOA 4N39A 3GZ1A 5FIOA 3AU5A 4XKBA 1MQSA 3Q9UC 4UI9C 3HRAA 3IHVA 4PH4B 5KCMA 3ESLA 3V2XA 2PM7A 3CK7A 4WUYA 4ANVA 3CHSA 5AYWD 5CBNA 4AY6A 2DYRE 1IQUA 3QWWA 4YNDA 5G05J 1TN6A 4B94A 2WXRA 4TUUA 3W9FA 4EQFA 2P9IG 1N0RA 3ZNGA 3UKRG 1QQEA 2J09A 3V2OA 3ASOE 5FZQA 2J4BA 1KZPA 3OXFA 1TNBA 3TXNA 4BEPA 3G2SA 3DBSA 3LYAA 3R7QA 4G8KA 4RVBA 4GCOA 4Y6WA 2EIME 1N0QA 1W3BA 1D9SA 5EIBE 5T8IA 4BSXA 3FUEA 4GA2A 4DX1A 1MX6A 5ITZF 3B7TA 2OVFA 1FVFA 4IN3B 3ONLA 2Y69E 3MYVA 3IKOB 3G2UA 4GTPA 1A5EA 2CFZA 3FTYA 3DWLG 1QBQA 3ASDA 4PUCA 4I6JA 4DJAA 2J08A 3CVLA 3D9KA 2V0PA 3LVQE 2HO1A 3D9OA 3AS8A 4ACKA 4HNAD 2V8SE 2M63A 1SW6A 4Z68A 4BTBA 3FULA 2IEJA 3PVLA 3E33A 1IXVA 1TJCA 2XRYA 2PL2A 2LO6A
chains in the Genus database with same CATH topology
2Y4TA 2YQ8A 4OYSA 2L0TB 1JPLA 1ZU2A 2Q7FA 3D9PA 3TL5A 3GZSA 3UMVA 2UY1B 4DLOA 2YHEA 1H2TC 3PE3A 4OVVA 4F7AA 4BT8A 2J49A 2NSZA 5CMYA 2MOWA 3B7UX 3FUDA 3RJVA 4PS7A 1UN9A 1JWFA 2VSNA 1IQRA 1ZBPA 3QWVA 2R59A 3JUIA 1SQMA 2J4DA 2BTDA 3D9MA 3FEXA 2AW6A 2CFUA 2WQHA 4K03A 5FZSA 2GW1A 3HDXA 4GU5A 4XZ4A 3RRUA 4GPKA 1IHGA 5E75A 4AJWA 1IYGA 4KBQA 4APFA 4CT4A 1E8ZA 3FTUA 2I2OA 2LNIA 5LP0A 3MKRA 2LAIA 1Y6IA 3FU6A 1N54A 3CVPA 4KVOA 3ZFWA 5FQ6A 4FHJA 5EDSA 3L08A 5DBKA 4BT9A 4JHRA 2V4LA 5J08A 5JJ7A 4LUNU 3PH0C 3RK6A 3QNKA 3LEWA 4CGVA 5JJTA 3CHRA 3UPVA 3R9AB 3K9IA 5J90A 4EBAA 1A17A 1X5BA 4N2QA 3PREA 3FDHA 4H7XA 1Z3YA 3HIZA 2C0MA 2X6JA 1UJJA 2NC9A 2VYIA 2VSYA 3ZYMA 3S7BA 3FH7A 2WXOA 3CQCB 1E96B 4EZLA 3QJZA 4MKTA 4FADA 1EYHA 3TG5A 3WXXA 3HVEB 3LS8A 4HOQA 4L23A 2C0LA 1WY6A 4GAAA 3S7JA 2L6JA 3EIJA 5FQ7A 5G04C 1U3CA 3FTXA 3ZYQA 3CVVA 3PZDA 1FCHA 5FJYA 4Q69A 4ILIA 5FT9A 1UJKA 5ANRA 3S7FA 4EECA 4EBAG 4MRUA 2PZIA 1OWOA 3FFLA 3B7SA 4U63A 3TGOA 1Y8MA 5LCWC 5ARFA 3RU0A 2CG2A 1HS6A 3CLJA 4GYOA 3VLEA 5JHBA 2UY1A 3PS6A 2WXIA 4LERA 3FH5A 3FTSA 3LPZA 3EJNA 4EZKA 1INZA 1UN8A 1HH8A 4LRZA 4P29A 5AIJA 4FJZA 4N5CA 3MV2B 3P1UA 5BW8C 2C2LA 3SD5A 3PDNA 2AXZA 2IFUA 4NQ0A 4AEZC 3FUIA 3MV3B 2YNQA 3LVRE 3LY7A 4FP7A 4GA0A 4N3CA 2KM4A 3FEYA 4ACLA 4D10C 2KC7A 4GZCA 4U0ZA 2HR2A 1HFAA 4UWFA 3SZ7A 4CRWA 4DK5A 1U3DA 5CMWA 4JEHA 4N3BA 4WWNA 3SFZA 1YA0A 1NP7A 1HF8A 4AOFA 4W9RA 3TXMA 4JHKA 2RG8A 3NZUA 2X38A 3L16A 3U64A 3CVUA 5FTPA 3URZA 4JHJA 4CDMA 4FU3A 4B8AA 3UQ3A 3LDZA 3ZYLA 1DNPA 1H0AA 3IBEA 3LKUA 4LEUA 3MKQB 4APOA 2R17C 4L7TA 2CHZA 1TJFA 5G05C 4HS2A 2AWIA 3HVEA 4FC8A 2GGFA 2PQNA 4O6FA 4DLQA 4XI0A 4HLEA 2X6HA 4EPZA 1XNFA 4I6GA 4HVBA 3ONKA 4ATGA 1EPUA 2CG3A 3GZ2A 5M72A 3KD7A 4I43A 4U0UA 4BFRA 3IHYA 4G11A 2IOLA 4FLBA 4CT0A 4UQYA 2MRIA 5G04J 5HI7A 2VSOE 3FWVA 3D9JA 4A1GA 4ANXA 5A6CA 2HM8A 4JVSA 4BY6A 3JCKC 4MS6A 2KATA 2FEZA 4I1AA 3SF4A 3AS5A 4MLPA 5ARGA 4AV7A 3TJPA 3U9WA 4L2LA 5BUZA 2IONA 4JEUA 2IOSA 2KCVA 4ANUA 2IJGX 3U66A 3SNXA 3Q5MA 4G2VA 2A4ZA 2EQXA 4V3IA 4UWKA 3EIQC 3FHEA 4C0EA 4J8SA 3ZRHA 4E85A 2WXGA 3UT8A 2XRZA 3RRNB 3CHMA 5KJLA 1EDUA 1XGWA 3UT4A 5D0QD 3L6AA 4A3TA 2WXLA 2Y3AA 3FP3A 3VLFA 4G23A 2X6KA 2WXFA 3PUKA 3ZXSA 4NACA 2AXVA 4RG6A 2WXQA 3I3NA 4L1BA 4PS3A 4JA9A 3LJ3A 5C2YA 1E8YA 3ZIMA 3ML8A 3BG1B 5A23A 3RO2A 2XGOA 4RSYA 5AJLA 3PEUB 2VSXE 2L9BA 2WQ6A 3CVNA 1SZAA 3VTXA 4U8HA 2XQ0A 2I6HA 1E8XA 4LCTA 3MKQA 4U0SA 2E0IA 4GZ6A 2KCKA 1N52A 3MX3A 1Z6TA 5FWQA 1KT0A 1E7VA 4BWRA 4CDRA 3CEQA 4C9BB 4I1OB 5HQ8A 2WVIA 5AJDA 5ANLA 4YVQC 4JA7A 4G24A 4N3AA 2YHCA 1UW4B 2CHWA 5BV0A 3QDNA 3PEVB 2UWJG 4ABNA 3C98A 4JXTA 5KJMA 2XPIA 1NZNA 1SZ9A 3VLDA 3MGBA 1VDYA 4I9EA 2LSUA 2AXUA 2RD0A 1ELKA 2WXMA 4C0MA 4E6HA 4WNDA 3PUJA 4K0RA 3ASGA 4XKCA 4EZJA 5KJNA 5EX0A 4GZ3A 3ZGQA 5C1DA 4XX5A 4JL0A 4L2YA 5JHAA 4DI3A 3U3WA 2VGYA 4GB9A 3Q49B 3EHMA 4URKA 4GZDA 1ELWA 3EDTB 4ILGA 3QWPA 3CGHA 3ULQA 4I1MA 3OXGA 3ASFA 2ILRA 3FU5A 1QZ2A 1KT1A 4KMOA 3ZHEB 1PC2A 5G2NA 3QARA 2GRLA 4XE0A 1TEZA 3L17A 4J8DA 3L22A 3SBTB 3CKCA 5A7DB 4J8FA 3SI5A 4AP2A 3ZEFA 4GYYA 4QFVA 4BTAA 4UQXA 4J8EA 1OWLA 3PNLB 3VTYA 3ZW3A 3APCA 2XHEA 3CSTA 2VTBB 3UUXA 2PM6A 2VGXB 2WQ7A 4J6IA 1UG3A 2X3MA 2XPYA 3FUMA 3U4TA 4NRHB 3G2TA 3AS4A 3SGHA 3IV0A 1H6KA 4JW1A 4AM9A 3CK9A 2HYZA 4XI9A 3ZVVA 1HZ4A 3B13A 3MCXA 1HU3A 4KVMA 3PNTB 4FJYA 4TRQA 3T8MA 5BPPA 3FUJA 1MHQA 3D3MA 3FUKA 3I4RB 3L54A 4UWGA 2I9CA 3I5PA 3PE4A 5JJ6A 5D0OD 5EKQD 4Y6CA 5BNWA 3FTWA 3JQ1A 3UT7A 4N2SA 4FHKA 4I6EA 3QAQA 5BT1A 1QNFA 2L0IA 5AENA 1WAO1 2VJ8A 4G26A 1L5JA 3FUHA 3D9IA 3LY8A 5EX3A 4B0ZA 4PDXA 2KZTB 3CR3A 4G25A 2X6IA 3GYZA 3T5VA 1OWMA 3MZLB 4CEMA 3NQPA 4AIFA 3HYMB 4IYPA 3CHPA 3OAWA 2R5SA 2J07A 3DPDA 4GZ5A 1NA3A 4KT6B 1BPOA 3LCAA 4WNFA 4XIFA 4GMLA 4GCNA 4AY5A 1JUQA 4GMJA 2XCBA 5LCWJ 5LFAA 4HOSA 3APFA 2PQRA 3LXUX 4GYWA 2NXPA 3ZHEA 1WM5A 3BG0B 3FH8A 3ZPJA 3CVYA 4B8CB 4H7YA 1LF8A 3NZSA 3KAEA 4WAFA 3QC1A 5KJKA 2P58C 2I1JA 3IEGA 3RO3A 1JWGA 4U04A 2MHKA 2KCLA 3CHQA 4A3VA 3FY4A 1PAQA 2WM9A 3S2AA 4WNGA 3KEZA 4Q96A 5FQ8A 4WNEA 3O4ZA 2VTBA 3RRMB 3D9NA 4YVOA 1H2UA 1HXIA 2VGXA 3BEEA 2GRMA 3B7RL 3GZ1A 2XEVA 4N39A 3T5XA 3AU5A 3FTZA 2IU1A 1MQSA 4XKBA 3SHFA 4UI9C 2X6FA 4AXHA 4KZCA 4WWPA 5T3RA 3IHVA 4PH4B 5KCMA 1H19A 5G55A 3FU0A 3ESLA 2BUGA 3QKYA 2PM7A 3CK7A 1HX8A 3N71A 2FI7A 4UWLA 4WUYA 2I1KA 4TV3A 1P5QA 4ANVA 4HOTA 4HOUA 2LSVA 3O48A 3CHSA 5AYWD 2IF4A 3GW4A 4U07A 5ENNA 1FVHA 4AY6A 1H2VC 3Q4AB 3APDA 1HG2A 2LAHA 2AVPA 2JEKA 4KXKB 1KLXA 1IQUA 3ASHA 3QWWA 4YNDA 5G05J 5FQ4A 2E2EA 2OVBA 4B94A 2WXRA 1ELRA 4IRUA 4TUUA 4IULA 1GW6A 1PY1A 4EQFA 2V5FA 2KZTA 3TG4A 2VQ2A 3E4BA 3ZYKA 1QQEA 2J09A 2WXNA 4M3OA 3CIAA 5T4YA 5LX8A 4I9CA 3EHNA 3G2VA 5CHEE 4CGWA 4DPRA 2FBNA 3G2WA 4F3VA 4I17A 2JLBA 2WMOA 2DBAA 2ONDA 4OVUA 3CK8A 1HG5A 4R7LA 5FZQA 5DIZA 3R7RA 4A55A 4CDNA 2J4BA 2XPZA 3QB2A 3MEKA 4JZYA 4KZ0A 3PRZA 1Z3XA 3OXFA 2FO7A 3TXNA 2QY7A 3AU4A 3G2SA 4CCAA 3SBSA 3DBSA 5LOZA 3LYAA 3CHOA 4GA1A 4B89A 4F1SA 2WPVA 3I4GA 3Q15A 3ENEA 4I2ZA 3R7QA 1B89A 2DIWA 4AVXA 3MA5A 4RVBA 4GCOA 4UI9K 4Y6WA 4FA6A 3NF1A 1W3BA 3CSFA 3P2BA 4JPSA 5T8IA 2WXHA 4FULA 2WXPA 4RG9A 4BSXA 4J0UA 2DCPA 4UI9J 3QK0A 2XGMA 3FUEA 5CCMA 3ML9A 4GA2A 2FF4A 4BX8A 3FUNA 1OUVA 3ESKA 1DVPA 1E90A 2IQCA 2QFCA 3B7TA 2OVFA 3JQ0A 1FVFA 4IN3B 4I2WA 3ONLA 3QOUA 4DI4A 2ZU6B 1E8WA 1HE8A 3L13A 3S7DA 5BV1A 3MYVA 3IKOB 1E7UA 3G2UA 3TAXA 3HHMA 2XCCA 2XGSA 2CFZA 3UX4A 3FTYA 2BF0X 4ILHB 2OV8A 4ANWA 4Q94A 4WWOA 3ASDA 3CVXA 2CHXA 4ME2A 3FUFA 3LY9A 4I6JA 1S0PA 4PUCA 4PS8A 1HO8A 3RIBA 4DJAA 3ZN3A 2WXJA 2J9QA 4HXIA 2J08A 3CVLA 4FLHA 4HFGA 3OTNA 4HORA 3D9KA 2V0PA 4A1SA 3LVQE 2FULA 3MJWA 2HO1A 1OWPA 3D9OA 4BX9A 3AS8A 4ACKA 3CVQA 1OWNA 2WXKA 3FU3A 3FTVA 3KS2A 3CKBA 5E76A 5FZRA 3JYSA 4G1TA 3OXLA 4JC8A 3CVWA 2WB2A 4UWHA 4F53A 2V8SE 4KYOB 2OOEA 3RKVA 2M63A 4UQZA 2WMNA 1EF1C 2Y4UA 2YINA 4BTBA 3FULA 3D9LA 3PVLA 3Q47B 5CCLA 1NA0A 1TJCA 3CV0A 2A5UA 2XRYA 2PL2A 3CQGB 2LO6A 4NURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4T A;  2YQ8 A;  2Q7F A;  1ZU2 A;  2UY1 B;  3PE3 A;  4BT8 A;  3RJV A;  2VSN A;  1ZBP A;  3QWV A;  2WQH A;  5FZS A;  2GW1 A;  4GPK A;  1IHG A;  1IYG A;  4KBQ A;  2LNI A;  3MKR A;  3ZFW A;  3CVP A;  4BT9 A;  5DBK A;  4JHR A;  5JJ7 A;  4CGV A;  5JJT A;  3UPV A;  3R9A B;  3K9I A;  1A17 A;  4N2Q A;  4H7X A;  2C0M A;  2NC9 A;  2VYI A;  2VSY A;  3S7B A;  1E96 B;  3TG5 A;  3WXX A;  4HOQ A;  2C0L A;  3S7J A;  2L6J A;  5G04 C;  1FCH A;  5FJY A;  5FT9 A;  3S7F A;  2PZI A;  3FFL A;  3TGO A;  1Y8M A;  5LCW C;  5ARF A;  3RU0 A;  4GYO A;  2UY1 A;  3LPZ A;  1HH8 A;  4N5C A;  3MV2 B;  5BW8 C;  2C2L A;  3PDN A;  2IFU A;  4NQ0 A;  3MV3 B;  3LY7 A;  4GA0 A;  4N3C A;  2KC7 A;  3SZ7 A;  4U0Z A;  2HR2 A;  4N3B A;  1YA0 A;  4W9R A;  5FTP A;  3URZ A;  3UQ3 A;  3LKU A;  4LEU A;  4APO A;  5G05 C;  4O6F A;  2PQN A;  4XI0 A;  1XNF A;  3GZ2 A;  5M72 A;  3KD7 A;  4U0U A;  4UQY A;  5HI7 A;  5G04 J;  3FWV A;  5A6C A;  2KAT A;  2FEZ A;  4I1A A;  3SF4 A;  3AS5 A;  5ARG A;  2KCV A;  3Q5M A;  4G2V A;  5KJL A;  5D0Q D;  3FP3 A;  4G23 A;  4RG6 A;  4JA9 A;  3RO2 A;  2XGO A;  3CVN A;  3VTX A;  2I6H A;  4U0S A;  4GZ6 A;  2KCK A;  1KT0 A;  4BWR A;  4CDR A;  3CEQ A;  5HQ8 A;  4YVQ C;  4JA7 A;  4G24 A;  4N3A A;  2YHC A;  3QDN A;  2UWJ G;  4ABN A;  5KJM A;  2XPI A;  1NZN A;  4I9E A;  2LSU A;  4WND A;  3ASG A;  5KJN A;  5EX0 A;  4GZ3 A;  3ZGQ A;  5C1D A;  4JL0 A;  3U3W A;  2VGY A;  3Q49 B;  1ELW A;  3EDT B;  3QWP A;  3ULQ A;  3OXG A;  3ASF A;  3ZHE B;  1KT1 A;  1QZ2 A;  1PC2 A;  4J8D A;  3CKC A;  5A7D B;  4J8F A;  4GYY A;  4BTA A;  4UQX A;  4J8E A;  3VTY A;  3UUX A;  2VGX B;  3U4T A;  4NRH B;  3AS4 A;  4AM9 A;  3CK9 A;  2HYZ A;  4XI9 A;  1HZ4 A;  3PE4 A;  5JJ6 A;  5D0O D;  5EKQ D;  4Y6C A;  5BNW A;  4N2S A;  5BT1 A;  1WAO 1;  4G26 A;  3LY8 A;  5EX3 A;  4G25 A;  3GYZ A;  4AIF A;  3HYM B;  2R5S A;  4GZ5 A;  1NA3 A;  3LCA A;  4WNF A;  4XIF A;  4GCN A;  4AY5 A;  4HOS A;  2XCB A;  5LCW J;  2PQR A;  4GYW A;  3ZHE A;  1WM5 A;  3ZPJ A;  4H7Y A;  3KAE A;  5KJK A;  2P58 C;  3IEG A;  3RO3 A;  4U04 A;  2MHK A;  2KCL A;  4WNG A;  4WNE A;  4YVO A;  1HXI A;  2VGX A;  3BEE A;  4N39 A;  3GZ1 A;  2XEV A;  4UI9 C;  2BUG A;  3QKY A;  4WUY A;  3CK7 A;  3N71 A;  2FI7 A;  1P5Q A;  4HOT A;  4HOU A;  2LSV A;  3O48 A;  5AYW D;  2IF4 A;  3GW4 A;  4U07 A;  4AY6 A;  3Q4A B;  2AVP A;  4KXK B;  1KLX A;  3ASH A;  3QWW A;  4YND A;  5G05 J;  2E2E A;  4B94 A;  1ELR A;  4EQF A;  2V5F A;  3TG4 A;  2VQ2 A;  3E4B A;  1QQE A;  4I9C A;  5CHE E;  4CGW A;  4F3V A;  2FBN A;  4I17 A;  2JLB A;  2DBA A;  2OND A;  5FZQ A;  3CK8 A;  5DIZ A;  3MEK A;  3OXF A;  2FO7 A;  3LYA A;  4GA1 A;  2WPV A;  3Q15 A;  4I2Z A;  1B89 A;  3MA5 A;  4GCO A;  4UI9 K;  4Y6W A;  3NF1 A;  1W3B A;  4RG9 A;  4J0U A;  4UI9 J;  2XGM A;  4GA2 A;  2FF4 A;  1OUV A;  3ESK A;  2QFC A;  4IN3 B;  4I2W A;  3QOU A;  3S7D A;  3TAX A;  2XCC A;  2XGS A;  3ASD A;  4ME2 A;  3LY9 A;  3RIB A;  3ZN3 A;  2J9Q A;  3CVL A;  4HOR A;  4A1S A;  2HO1 A;  3AS8 A;  3CVQ A;  3KS2 A;  3CKB A;  5FZR A;  3JYS A;  4G1T A;  3OXL A;  4KYO B;  2OOE A;  3RKV A;  4UQZ A;  2Y4U A;  4BTB A;  3Q47 B;  5CCL A;  1NA0 A;  1TJC A;  3CV0 A;  2PL2 A;  5CCM A; 
#chains in the Genus database with same CATH topology
 1ZU2 A;  3D9P A;  3TL5 A;  3T9K A;  3DSW A;  4OVV A;  2RFM A;  2XEN A;  1IQR A;  3JUI A;  2LXM A;  3FEX A;  2AW6 A;  1IYG A;  4KBQ A;  1LD7 A;  2I2O A;  3MKR A;  1Y6I A;  5AQ9 A;  4FHJ A;  4JHR A;  3PH0 C;  3QNK A;  3UPV A;  3R9A B;  3K9I A;  4N2Q A;  4CZ2 D;  3S7B A;  3FH7 A;  2WXO A;  4EZL A;  5HS0 A;  3TG5 A;  3LS8 A;  3AG3 E;  2C0L A;  4GAA A;  3S7J A;  2L6J A;  1FPP A;  1IKN D;  3CVV A;  3PZD A;  4YDW A;  2V4H C;  5JMN D;  3PZ3 A;  1MJ0 A;  3FFL A;  1Y8M A;  5LCW C;  1HS6 A;  3V31 A;  4GYO A;  4GTR A;  4YDE A;  4LER A;  3FH5 A;  5AIJ A;  3MV2 B;  3B95 A;  3DST A;  2IFU A;  3L82 A;  3ULE G;  3MV3 B;  4GA0 A;  1TR4 A;  2KC7 A;  3SZ7 A;  5CMW A;  1TYQ G;  4WWN A;  2F8Y A;  2RG8 A;  5ENR D;  3URZ A;  1D8E A;  4FU3 A;  3LDZ A;  3HXE A;  3LKU A;  1O5M A;  4O6F A;  4X8Q A;  2X6H A;  4I6G A;  1EPU A;  4G11 A;  4CT0 A;  1OCZ E;  3C5R A;  4ANX A;  3DSU A;  4BY6 A;  4GPM A;  2KAT A;  3AS5 A;  1Q2Z A;  3RAU A;  4L2L A;  2IOS A;  2A4Z A;  3ZKJ A;  2WXG A;  3RRN B;  1XGW A;  3VLF A;  2Y3A A;  1O1S A;  2X6K A;  2AXV A;  4L1B A;  3TWS A;  4JA9 A;  3LJ3 A;  3RO2 A;  3RSE G;  3PEU B;  2VSX E;  2WQ6 A;  3CVN A;  2GRR B;  2XQ0 A;  4U0S A;  2E0I A;  1Z6T A;  1D8D A;  5JA4 D;  5HRY A;  4N3A A;  2YHC A;  5BV0 A;  1NZN A;  1VDY A;  4I9E A;  2LSU A;  2WXM A;  3PUJ A;  5IY5 E;  4JL0 A;  4L2Y A;  3DXK G;  2VGY A;  3EHM A;  3EDT B;  3ULQ A;  3ULY A;  1KT1 A;  3ZHE B;  3Q7A A;  3KSQ A;  3QAR A;  4XE0 A;  2EIK E;  3L17 A;  3CKC A;  3SI5 A;  4AP2 A;  1V54 E;  3BU8 A;  3LJN A;  3APC A;  2XHE A;  3UUX A;  2PM6 A;  3U4T A;  3IV0 A;  4AM9 A;  3W9G A;  1HZ4 A;  5D2M C;  3PNT B;  3T8M A;  1MHQ A;  3D3M A;  3L54 A;  4O1P A;  1K3Z D;  3JQ1 A;  4N2S A;  4FHK A;  1QNF A;  3EUV A;  1L5J A;  1X81 A;  3LY8 A;  5EX3 A;  4PDX A;  3CR3 A;  4G25 A;  3T5V A;  3HYM B;  2Y0B G;  2DVW A;  4GZ5 A;  1KZO A;  4GML A;  1AWC B;  5LCW J;  1WDY A;  4GTS A;  1WM5 A;  3UM0 A;  1NI1 A;  2P58 C;  2I1J A;  4WNE A;  3O4Z A;  3RRM B;  3Q78 A;  2VGX A;  2GRM A;  4F6R D;  2IU1 A;  1O1T A;  4KZC A;  5T3R A;  4N5Q A;  1H19 A;  1K1B A;  3FU0 A;  2BUG A;  3EU9 A;  2LUH A;  4YDY A;  3E30 A;  2I1K A;  1P5Q A;  4HOU A;  4RLY A;  1BD8 A;  1NFI E;  2IF4 A;  5ENN A;  3NB2 A;  3UTM A;  1H2V C;  2AVP A;  4KXK B;  1GW6 A;  2KZT A;  3ZYK A;  3L9T A;  4M3O A;  3CIA A;  5LX8 A;  3G2V A;  4CGW A;  4DPR A;  2FBN A;  3G2W A;  2FO1 E;  2JLB A;  2WMO A;  2DBA A;  3R7R A;  2P2C P;  1Z3X A;  2FO7 A;  3AU4 A;  4B89 A;  4F1S A;  3Q15 A;  2P9L G;  2DIW A;  2DZN A;  4FA6 A;  3CSF A;  4JPS A;  4JD2 G;  4FUL A;  4RG9 A;  2DCP A;  3ML9 A;  4BX8 A;  3FUN A;  1OUV A;  3ESK A;  2IQC A;  1DC2 A;  2ZXW E;  3QOU A;  1E8W A;  1HE8 A;  5BV1 A;  3TAX A;  2XGS A;  4ILH B;  2OV8 A;  4ANW A;  4CYM D;  3CVX A;  2CHX A;  3FUF A;  4PS8 A;  1HO8 A;  3ZN3 A;  4HFG A;  3OTN A;  4DX5 D;  2F37 A;  1FT1 A;  3CVQ A;  1OWN A;  3KS2 A;  3CKB A;  5E76 A;  5FZR A;  3JYS A;  5EYL A;  2OOE A;  3RKV A;  2HE0 A;  2WMN A;  2RKK A;  3CV0 A;  1JUQ A;  3CQG B;  2YQ8 A;  3UMV A;  4DLO A;  4TXP A;  3KSL A;  2YHE A;  3PE3 A;  4BT8 A;  2NSZ A;  5CMY A;  2MOW A;  3B7U X;  4A63 B;  3FUD A;  3RJV A;  4PS7 A;  1UN9 A;  2R59 A;  2J4D A;  3D9M A;  3RRU A;  2WQH A;  3HDX A;  4XZ4 A;  1IHG A;  5E75 A;  1AP7 A;  4APF A;  5LP0 A;  3AJI A;  4KVO A;  5FQ6 A;  5EDS A;  5DBK A;  5J08 A;  4HRL A;  3E34 A;  1OCC E;  2DWZ A;  2XEE A;  1K8K G;  5JJT A;  2OEW A;  5J90 A;  1X5B A;  3PZ4 A;  4H7X A;  1Z3Y A;  2NC9 A;  4FAD A;  4MKT A;  1EYH A;  2IO3 C;  1U3C A;  4HLL A;  4GTQ A;  1FCH A;  5FJY A;  4Q69 A;  4ILI A;  5FT9 A;  5ANR A;  3S7F A;  4EEC A;  2PZI A;  5ARF A;  3CLJ A;  2WXI A;  3FTS A;  3EJN A;  4P29 A;  1U2V G;  4N5C A;  4NQ0 A;  4AEZ C;  5AQA A;  2H6F A;  4N3C A;  4ACL A;  4U0Z A;  2HR2 A;  1U3D A;  4JEH A;  3SFZ A;  1YA0 A;  4JHK A;  3L16 A;  5FTP A;  4JHJ A;  4JB8 P;  3UM2 A;  3ZYL A;  1BU9 A;  3SFX A;  4LEU A;  2XS1 A;  4APO A;  3HVE A;  4XI0 A;  2CG3 A;  5M72 A;  1KPS B;  3KD7 A;  1S64 A;  2VSO E;  2XEH A;  4A1G A;  4JVS A;  3SF4 A;  3JXJ A;  3JXI A;  5ARG A;  3DXM G;  3U9W A;  4JEU A;  2KCV A;  4ANU A;  3WG7 E;  4HRN A;  3SNX A;  1UOH A;  1LD8 A;  2XZD G;  3UT8 A;  3TWT A;  5D0Q D;  4A3T A;  1RZ4 A;  3FP3 A;  3PUK A;  4OAV B;  3UM1 A;  3X2Q E;  5C2Y A;  3BG1 B;  3ZUV B;  4RSY A;  5AJL A;  2L9B A;  3VTX A;  1MX4 A;  4GZ6 A;  2KCK A;  3MX3 A;  3DEO A;  1E7V A;  3CEQ A;  5AJD A;  5ANL A;  4J7W A;  3R9M A;  2CHW A;  3QDN A;  3VLD A;  2ZGG A;  2B6C A;  2AXU A;  2RD0 A;  2NYJ A;  3HXC A;  3PZ1 A;  3ASG A;  4K0R A;  4NIK A;  4XKC A;  3C3O A;  3IXE A;  4GB9 A;  3Q49 B;  4LSZ E;  3UKU G;  2R05 A;  3QWP A;  1YYH A;  3ASF A;  3FU5 A;  1RW2 A;  1QZ2 A;  4KMO A;  3JUE A;  2GRQ B;  5A7D B;  3TWU A;  3ZEF A;  4GYY A;  4QFV A;  5EIL A;  4UQX A;  2P9U G;  3CST A;  2VGX B;  1O1R A;  2X3M A;  3FUM A;  5ENQ D;  5KWD A;  4JW1 A;  2VGE A;  4BSZ B;  3NBN B;  4UWG A;  3HG0 D;  3ZU7 B;  4Y6C A;  4I6E A;  3QAQ A;  5BT1 A;  4U95 D;  1H6O A;  1DCE A;  4BER A;  4U7E B;  2KZT B;  2X6I A;  4CEM A;  3MZL B;  1SVX A;  2R5S A;  2J07 A;  4KT6 B;  4GCN A;  4GMJ A;  3LXU X;  2NXP A;  1ZB1 A;  3ZPJ A;  4B8C B;  4H7Y A;  3NZS A;  4WAF A;  5CBO A;  5KJK A;  3IEG A;  4U04 A;  4MBG A;  1PAQ A;  2WM9 A;  3S2A A;  4WNG A;  4K5A B;  1Z5S C;  2VTB A;  3D9N A;  1G3N B;  1H2U A;  1HXI A;  2BED A;  3B7R L;  3BEE A;  4RQI A;  3FTZ A;  2H6G A;  2X6F A;  4WWP A;  5G55 A;  2LXL A;  2GRO B;  1HX8 A;  1TNO A;  2FI7 A;  4TV3 A;  4HOT A;  4HB5 A;  2LSV A;  3GW4 A;  3ASN E;  3V79 K;  4K5B A;  1HG2 A;  2LAH A;  3EHQ A;  2E2E A;  1ELR A;  4IRU A;  4IUL A;  1PY1 A;  4U8Y D;  2V5F A;  3E4B A;  2QZA A;  5HKP A;  1OY3 D;  5T4Y A;  3EHN A;  4F3V A;  2XS8 A;  4I17 A;  4OVU A;  3CK8 A;  4R7L A;  4HI8 A;  3B7B A;  4JZY A;  2XPZ A;  3MEK A;  3SBS A;  5LOZ A;  4GA1 A;  3CHO A;  4I2Z A;  1B89 A;  2F8X K;  5ENP D;  3MA5 A;  2P9P G;  2DYS E;  3P2B A;  1DCQ A;  3UXG A;  3QK0 A;  2MYO A;  2XGM A;  5CCM A;  2XZT G;  2FF4 A;  1DVP A;  1E90 A;  1K1A A;  4I2W A;  2IO2 C;  4DI4 A;  3L13 A;  3S7D A;  1E7U A;  3HHM A;  4WWO A;  1S0P A;  3RIB A;  2WXJ A;  3HXD A;  4HOR A;  3C72 A;  3C3Q A;  2R2L A;  1FT2 A;  3FU3 A;  1H6P A;  4G1T A;  3OXL A;  3CVW A;  2WB2 A;  4UWH A;  4KYO B;  4UQZ A;  1EF1 C;  3Q9N C;  3Q47 B;  1NA0 A;  3J5Q B;  3QB2 A;  4NUR A;  5CRV A;  3GZS A;  1H2T C;  4YDO A;  3EHR A;  5H7P A;  1SQM A;  2BTD A;  4K03 A;  5FZS A;  2GW1 A;  1OCR E;  4AJW A;  4CT4 A;  1E8Z A;  3FTU A;  2LNI A;  2BKG A;  5EN5 D;  1N54 A;  3ZFW A;  3E32 A;  3AAA C;  4ATZ D;  3UI2 A;  3L08 A;  4BT9 A;  2V4L A;  1A17 A;  3PRE A;  2C0M A;  2X6J A;  1UJJ A;  2VSY A;  3ZYM A;  3CQC B;  4O1O A;  3HVE B;  4HOQ A;  4L23 A;  1WY6 A;  3EIJ A;  2ETB A;  3BQO A;  3DEP A;  1TNZ A;  5AQ7 A;  1BI7 B;  4EBA G;  3NAW A;  4MRU A;  1OWO A;  5AAO A;  3B7S A;  3RU0 A;  2CG2 A;  4GTV A;  5AN8 A;  3VLE A;  5JHB A;  2UY1 A;  4EZK A;  1INZ A;  1UN8 A;  1HH8 A;  4FJZ A;  5BW8 C;  3P1U A;  3PDN A;  2AXZ A;  3FUI A;  3LVR E;  5D66 A;  4D10 C;  1HFA A;  2OCC E;  4DK5 A;  1NP7 A;  4AOF A;  4W9R A;  2X38 A;  3U64 A;  1MX2 A;  4O60 A;  1OCO E;  2CHZ A;  1TJF A;  2AWI A;  2PQN A;  4DLQ A;  1TN7 A;  4HLE A;  4EPZ A;  4I43 A;  4U0U A;  4BFR A;  3IHY A;  2IOL A;  4FLB A;  4UQY A;  5HI7 A;  5G04 J;  3FWV A;  1MYO A;  3J5P A;  5CEA A;  4LNG A;  4MS6 A;  4I1A A;  3DSX A;  4AV7 A;  3TJP A;  1YMP A;  2ION A;  2IJG X;  3U66 A;  3Q5M A;  4G2V A;  2EQX A;  4UWK A;  3EIQ C;  3FHE A;  4J8S A;  4E85 A;  2XRZ A;  3CHM A;  3L6A A;  2WXL A;  1N95 A;  2WXF A;  4RG6 A;  2WXQ A;  3I3N A;  3ABM E;  4PS3 A;  1E8Y A;  1MZC A;  3ML8 A;  5A23 A;  1SZA A;  4U8H A;  3MKQ A;  5FWQ A;  4F1P A;  4BWR A;  4I1O B;  5HQ8 A;  4JA7 A;  3PEV B;  3C98 A;  5KJM A;  2XPI A;  2P9S G;  1ELK A;  4C0M A;  4E6H A;  4EZJ A;  4GZ3 A;  3ZGQ A;  4XX5 A;  5JHA A;  4DI3 A;  4DX2 A;  5CED B;  3TWR A;  1PC2 A;  2DZO A;  5G2N A;  2GRL A;  4ZFH A;  4J8D A;  3L22 A;  3SBT B;  1BI8 B;  1N4Q A;  2P9N G;  4J8E A;  1OT8 A;  1OWL A;  3PNL B;  3VTY A;  2VTB B;  3BUA A;  4J6I A;  2XPY A;  4GTT A;  3AS4 A;  3SGH A;  2EIL E;  3CK9 A;  2HYZ A;  3ZVV A;  4TUM A;  1HU3 A;  3UIP C;  4KVM A;  2QC9 A;  3KEA A;  3FUK A;  3I4R B;  2I9C A;  3PE4 A;  5JJ6 A;  5D0O D;  5EKQ D;  5BNW A;  3FTW A;  3UT7 A;  2L0I A;  5AEN A;  2VJ8 A;  4G26 A;  3FUH A;  3D9I A;  4HBD A;  1N9A A;  1OWM A;  3Q7F A;  3NQP A;  4AIF A;  1WG0 A;  3DPD A;  1SA4 A;  1N94 A;  2JAB A;  3LCA A;  4WNF A;  5CEC B;  2XCB A;  5LFA A;  2EIN E;  4GYW A;  3TWQ A;  2GRP B;  1LF8 A;  3KAE A;  3RO3 A;  4GTM A;  2MHK A;  2KCL A;  3CHQ A;  4A3V A;  4J8Y A;  2R03 A;  2B0O E;  4Q96 A;  3T5X A;  2XEV A;  3SHF A;  2KBX A;  4AXH A;  1JCS A;  3QKY A;  3N71 A;  4UWL A;  5BXU A;  3O48 A;  3AG1 E;  4U07 A;  1FVH A;  3Q4A B;  3APD A;  4LG6 A;  2JEK A;  1KLX A;  3ASH A;  5FQ4 A;  2OVB A;  5EYP F;  3TG4 A;  2VQ2 A;  3DRA A;  4ZHB A;  2H6H A;  2WXN A;  4I9C A;  5CHE E;  1IHB A;  2OND A;  4CDN A;  1HG5 A;  4A55 A;  5DIZ A;  3AG4 E;  3DSV A;  4KZ0 A;  3PRZ A;  4L9P A;  4C48 B;  2QY7 A;  4CCA A;  2WPV A;  3I4G A;  3ENE A;  4AVX A;  4UI9 K;  3TWX A;  3NF1 A;  1N4S A;  2BKK B;  2WXH A;  2WXP A;  4J0U A;  4UI9 J;  3SO8 A;  2ETC A;  4BET A;  2QFC A;  3JQ0 A;  1N4R A;  2ZU6 B;  4DRX E;  1NL4 A;  1OXJ A;  2ZIS A;  2Y1L E;  2XCC A;  3UIN C;  3UX4 A;  2BF0 X;  2GRN B;  4Q94 A;  4ME2 A;  3TWV A;  3LY9 A;  4DX6 D;  2ETA A;  2J9Q A;  4HXI A;  4FLH A;  3AG2 E;  4A1S A;  1LTX A;  4XEI G;  2FUL A;  3MJW A;  1OWP A;  4BX9 A;  2WXK A;  4U96 D;  3FTV A;  4U8V D;  4M7C A;  4JC8 A;  4F53 A;  2Y4U A;  2YIN A;  5ENT D;  3D9L A;  4TXQ A;  3ABL E;  1BLX B;  5CCL A;  2KXP C;  3V30 A;  2A5U A;  2Y4T A;  4OYS A;  2L0T B;  5FIN A;  1JPL A;  2Q7F A;  4TXR A;  2UY1 B;  4F7A A;  2J49 A;  1TNU A;  1JWF A;  2VSN A;  1ZBP A;  3QWV A;  1YCS B;  2CFU A;  4GU5 A;  4HQD A;  4GPK A;  3DSS A;  3ZXP A;  3F6Q A;  2LAI A;  3FU6 A;  3CVP A;  2H6I A;  1TN8 A;  5JJ7 A;  4LUN U;  3RK6 A;  3LEW A;  4CGV A;  3CHR A;  4EBA A;  3FDH A;  3HIZ A;  3EU5 A;  2VYI A;  4GMR A;  1SA5 A;  2QYU A;  1E96 B;  3QJZ A;  3WXX A;  5FQ7 A;  5G04 C;  3FTX A;  3ZYQ A;  4LNU D;  1UJK A;  3ABK E;  4U63 A;  3TGO A;  3PS6 A;  1TNY A;  3LPZ A;  2EIJ E;  4LRZ A;  2C2L A;  3SD5 A;  2QYJ A;  1QYM A;  3UM3 A;  2YNQ A;  3LY7 A;  4FP7 A;  3ISM C;  2KM4 A;  3FEY A;  4GZC A;  4CRW A;  4UWF A;  4DUI A;  1JCR A;  4N3B A;  1HF8 A;  3HXF A;  4OAU C;  3TXM A;  3NZU A;  2P9K G;  3CVU A;  4BES A;  4CDM A;  4B8A A;  1N4P A;  3UQ3 A;  1DNP A;  4EHM A;  1H0A A;  3IBE A;  3Q79 A;  5CRU A;  3MKQ B;  2R17 C;  4L7T A;  5G05 C;  3TWW A;  4HS2 A;  4FC8 A;  2GGF A;  3SFY A;  5AQB A;  1XNF A;  4HVB A;  3ONK A;  2R02 A;  3GZ2 A;  4ATG A;  2MRI A;  3T8K A;  1S70 B;  3UIO C;  3D9J A;  4LNB A;  5A6C A;  2HM8 A;  3JCK C;  2FEZ A;  4MLP A;  3SY2 A;  5BUZ A;  3E37 A;  5ENS D;  2AJA A;  5BXO A;  4HRM B;  3Q75 A;  3C3R A;  4V3I A;  5B3S E;  4C0E A;  3ZRH A;  4K5C A;  5KJL A;  1EDU A;  3UT4 A;  4G23 A;  3ZXS A;  4NAC A;  3ZIM A;  2XGO A;  2V5Q C;  5B1A E;  2I6H A;  1E8X A;  4LCT A;  3HXB A;  1N52 A;  3Q73 A;  1KT0 A;  4CDR A;  4C9B B;  2WVI A;  4YVQ C;  4QQI A;  4G24 A;  1UW4 B;  2UWJ G;  4ABN A;  4JXT A;  5KNG A;  1S63 A;  1SZ9 A;  3MGB A;  4B93 B;  2ZGD A;  4WND A;  1JCQ A;  3DPY A;  5KJN A;  5EX0 A;  5C1D A;  3U3W A;  4DX7 D;  4URK A;  4GZD A;  2F0Y A;  1ELW A;  4ILG A;  3CGH A;  4I1M A;  3OXG A;  2IY0 C;  2RFA A;  2ILR A;  1TEZ A;  2ZIR A;  5EID A;  4J8F A;  3PZ2 A;  4BTA A;  4G8L A;  3ZW3 A;  5CER B;  2J8S D;  2WQ7 A;  1UG3 A;  4GTO A;  2OEV A;  3NOC D;  4NRH B;  3G2T A;  4HI9 A;  1H6K A;  4XI9 A;  3B13 A;  3MCX A;  4FJY A;  4TRQ A;  5BPP A;  3FUJ A;  2L6B A;  5ENO D;  2A5E A;  1N11 A;  3I5P A;  1V55 E;  1WAO 1;  4B0Z A;  3GYZ A;  5KNH D;  3SQV A;  4UUC A;  4IYP A;  3CHP A;  2PNN A;  3OAW A;  1NA3 A;  3D9H A;  1BPO A;  4XIF A;  5KBA A;  4AY5 A;  4HOS A;  3APF A;  2PQR A;  3ZHE A;  5B1B E;  3BG0 B;  3FH8 A;  3CVY A;  3QC1 A;  3NOG D;  5AAR A;  1JWG A;  3FY4 A;  3KEZ A;  5FQ8 A;  4YVO A;  4N39 A;  3GZ1 A;  5FIO A;  3AU5 A;  4XKB A;  1MQS A;  3Q9U C;  4UI9 C;  3HRA A;  3IHV A;  4PH4 B;  5KCM A;  3ESL A;  3V2X A;  2PM7 A;  3CK7 A;  4WUY A;  4ANV A;  3CHS A;  5AYW D;  5CBN A;  4AY6 A;  2DYR E;  1IQU A;  3QWW A;  4YND A;  5G05 J;  1TN6 A;  4B94 A;  2WXR A;  4TUU A;  3W9F A;  4EQF A;  2P9I G;  1N0R A;  3ZNG A;  3UKR G;  1QQE A;  2J09 A;  3V2O A;  3ASO E;  5FZQ A;  2J4B A;  1KZP A;  3OXF A;  1TNB A;  3TXN A;  4BEP A;  3G2S A;  3DBS A;  3LYA A;  3R7Q A;  4G8K A;  4RVB A;  4GCO A;  4Y6W A;  2EIM E;  1N0Q A;  1W3B A;  1D9S A;  5EIB E;  5T8I A;  4BSX A;  3FUE A;  4GA2 A;  4DX1 A;  1MX6 A;  5ITZ F;  3B7T A;  2OVF A;  1FVF A;  4IN3 B;  3ONL A;  2Y69 E;  3MYV A;  3IKO B;  3G2U A;  4GTP A;  1A5E A;  2CFZ A;  3FTY A;  3DWL G;  1QBQ A;  3ASD A;  4PUC A;  4I6J A;  4DJA A;  2J08 A;  3CVL A;  3D9K A;  2V0P A;  3LVQ E;  2HO1 A;  3D9O A;  3AS8 A;  4ACK A;  4HNA D;  2V8S E;  2M63 A;  1SW6 A;  4Z68 A;  4BTB A;  3FUL A;  2IEJ A;  3PVL A;  3E33 A;  1IXV A;  1TJC A;  2XRY A;  2PL2 A;  2LO6 A; 
#chains in the Genus database with same CATH homology
 2Y4T A;  2YQ8 A;  4OYS A;  2L0T B;  1JPL A;  1ZU2 A;  2Q7F A;  3D9P A;  3TL5 A;  3GZS A;  3UMV A;  2UY1 B;  4DLO A;  2YHE A;  1H2T C;  3PE3 A;  4OVV A;  4F7A A;  4BT8 A;  2J49 A;  2NSZ A;  5CMY A;  2MOW A;  3B7U X;  3FUD A;  3RJV A;  4PS7 A;  1UN9 A;  1JWF A;  2VSN A;  1IQR A;  1ZBP A;  3QWV A;  2R59 A;  3JUI A;  1SQM A;  2J4D A;  2BTD A;  3D9M A;  3FEX A;  2AW6 A;  2CFU A;  2WQH A;  4K03 A;  5FZS A;  2GW1 A;  3HDX A;  4GU5 A;  4XZ4 A;  3RRU A;  4GPK A;  1IHG A;  5E75 A;  4AJW A;  1IYG A;  4KBQ A;  4APF A;  4CT4 A;  1E8Z A;  3FTU A;  2I2O A;  2LNI A;  5LP0 A;  3MKR A;  2LAI A;  1Y6I A;  3FU6 A;  1N54 A;  3CVP A;  4KVO A;  3ZFW A;  5FQ6 A;  4FHJ A;  5EDS A;  3L08 A;  5DBK A;  4BT9 A;  4JHR A;  2V4L A;  5J08 A;  5JJ7 A;  4LUN U;  3PH0 C;  3RK6 A;  3QNK A;  3LEW A;  4CGV A;  5JJT A;  3CHR A;  3UPV A;  3R9A B;  3K9I A;  5J90 A;  4EBA A;  1A17 A;  1X5B A;  4N2Q A;  3PRE A;  3FDH A;  4H7X A;  1Z3Y A;  3HIZ A;  2C0M A;  2X6J A;  1UJJ A;  2NC9 A;  2VYI A;  2VSY A;  3ZYM A;  3S7B A;  3FH7 A;  2WXO A;  3CQC B;  1E96 B;  4EZL A;  3QJZ A;  4MKT A;  4FAD A;  1EYH A;  3TG5 A;  3WXX A;  3HVE B;  3LS8 A;  4HOQ A;  4L23 A;  2C0L A;  1WY6 A;  4GAA A;  3S7J A;  2L6J A;  3EIJ A;  5FQ7 A;  5G04 C;  1U3C A;  3FTX A;  3ZYQ A;  3CVV A;  3PZD A;  1FCH A;  5FJY A;  4Q69 A;  4ILI A;  5FT9 A;  1UJK A;  5ANR A;  3S7F A;  4EEC A;  4EBA G;  4MRU A;  2PZI A;  1OWO A;  3FFL A;  3B7S A;  4U63 A;  3TGO A;  1Y8M A;  5LCW C;  5ARF A;  3RU0 A;  2CG2 A;  1HS6 A;  3CLJ A;  4GYO A;  3VLE A;  5JHB A;  2UY1 A;  3PS6 A;  2WXI A;  4LER A;  3FH5 A;  3FTS A;  3LPZ A;  3EJN A;  4EZK A;  1INZ A;  1UN8 A;  1HH8 A;  4LRZ A;  4P29 A;  5AIJ A;  4FJZ A;  4N5C A;  3MV2 B;  3P1U A;  5BW8 C;  2C2L A;  3SD5 A;  3PDN A;  2AXZ A;  2IFU A;  4NQ0 A;  4AEZ C;  3FUI A;  3MV3 B;  2YNQ A;  3LVR E;  3LY7 A;  4FP7 A;  4GA0 A;  4N3C A;  2KM4 A;  3FEY A;  4ACL A;  4D10 C;  2KC7 A;  4GZC A;  4U0Z A;  2HR2 A;  1HFA A;  4UWF A;  3SZ7 A;  4CRW A;  4DK5 A;  1U3D A;  5CMW A;  4JEH A;  4N3B A;  4WWN A;  3SFZ A;  1YA0 A;  1NP7 A;  1HF8 A;  4AOF A;  4W9R A;  3TXM A;  4JHK A;  2RG8 A;  3NZU A;  2X38 A;  3L16 A;  3U64 A;  3CVU A;  5FTP A;  3URZ A;  4JHJ A;  4CDM A;  4FU3 A;  4B8A A;  3UQ3 A;  3LDZ A;  3ZYL A;  1DNP A;  1H0A A;  3IBE A;  3LKU A;  4LEU A;  3MKQ B;  4APO A;  2R17 C;  4L7T A;  2CHZ A;  1TJF A;  5G05 C;  4HS2 A;  2AWI A;  3HVE A;  4FC8 A;  2GGF A;  2PQN A;  4O6F A;  4DLQ A;  4XI0 A;  4HLE A;  2X6H A;  4EPZ A;  1XNF A;  4I6G A;  4HVB A;  3ONK A;  4ATG A;  1EPU A;  2CG3 A;  3GZ2 A;  5M72 A;  3KD7 A;  4I43 A;  4U0U A;  4BFR A;  3IHY A;  4G11 A;  2IOL A;  4FLB A;  4CT0 A;  4UQY A;  2MRI A;  5G04 J;  5HI7 A;  2VSO E;  3FWV A;  3D9J A;  4A1G A;  4ANX A;  5A6C A;  2HM8 A;  4JVS A;  4BY6 A;  3JCK C;  4MS6 A;  2KAT A;  2FEZ A;  4I1A A;  3SF4 A;  3AS5 A;  4MLP A;  5ARG A;  4AV7 A;  3TJP A;  3U9W A;  4L2L A;  5BUZ A;  2ION A;  4JEU A;  2IOS A;  2KCV A;  4ANU A;  2IJG X;  3U66 A;  3SNX A;  3Q5M A;  4G2V A;  2A4Z A;  2EQX A;  4V3I A;  4UWK A;  3EIQ C;  3FHE A;  4C0E A;  4J8S A;  3ZRH A;  4E85 A;  2WXG A;  3UT8 A;  2XRZ A;  3RRN B;  3CHM A;  5KJL A;  1EDU A;  1XGW A;  3UT4 A;  5D0Q D;  3L6A A;  4A3T A;  2WXL A;  2Y3A A;  3FP3 A;  3VLF A;  4G23 A;  2X6K A;  2WXF A;  3PUK A;  3ZXS A;  4NAC A;  2AXV A;  4RG6 A;  2WXQ A;  3I3N A;  4L1B A;  4PS3 A;  4JA9 A;  3LJ3 A;  5C2Y A;  1E8Y A;  3ZIM A;  3ML8 A;  3BG1 B;  5A23 A;  3RO2 A;  2XGO A;  4RSY A;  5AJL A;  3PEU B;  2VSX E;  2L9B A;  2WQ6 A;  3CVN A;  1SZA A;  3VTX A;  4U8H A;  2XQ0 A;  2I6H A;  1E8X A;  4LCT A;  3MKQ A;  4U0S A;  2E0I A;  4GZ6 A;  2KCK A;  1N52 A;  3MX3 A;  1Z6T A;  5FWQ A;  1KT0 A;  1E7V A;  4BWR A;  4CDR A;  3CEQ A;  4C9B B;  4I1O B;  5HQ8 A;  2WVI A;  5AJD A;  5ANL A;  4YVQ C;  4JA7 A;  4G24 A;  4N3A A;  2YHC A;  1UW4 B;  2CHW A;  5BV0 A;  3QDN A;  3PEV B;  2UWJ G;  4ABN A;  3C98 A;  4JXT A;  5KJM A;  2XPI A;  1NZN A;  1SZ9 A;  3VLD A;  3MGB A;  1VDY A;  4I9E A;  2LSU A;  2AXU A;  2RD0 A;  1ELK A;  2WXM A;  4C0M A;  4E6H A;  4WND A;  3PUJ A;  4K0R A;  3ASG A;  4XKC A;  4EZJ A;  5KJN A;  5EX0 A;  4GZ3 A;  3ZGQ A;  5C1D A;  4XX5 A;  4JL0 A;  4L2Y A;  5JHA A;  4DI3 A;  3U3W A;  2VGY A;  4GB9 A;  3Q49 B;  3EHM A;  4URK A;  4GZD A;  1ELW A;  3EDT B;  4ILG A;  3QWP A;  3CGH A;  3ULQ A;  4I1M A;  3OXG A;  3ASF A;  2ILR A;  3FU5 A;  1QZ2 A;  1KT1 A;  4KMO A;  3ZHE B;  1PC2 A;  5G2N A;  3QAR A;  2GRL A;  4XE0 A;  1TEZ A;  3L17 A;  4J8D A;  3L22 A;  3SBT B;  3CKC A;  5A7D B;  4J8F A;  3SI5 A;  4AP2 A;  3ZEF A;  4GYY A;  4QFV A;  4BTA A;  4UQX A;  4J8E A;  1OWL A;  3PNL B;  3VTY A;  3ZW3 A;  3APC A;  2XHE A;  3CST A;  2VTB B;  3UUX A;  2PM6 A;  2VGX B;  2WQ7 A;  4J6I A;  1UG3 A;  2X3M A;  2XPY A;  3FUM A;  3U4T A;  4NRH B;  3G2T A;  3AS4 A;  3SGH A;  3IV0 A;  1H6K A;  4JW1 A;  4AM9 A;  3CK9 A;  2HYZ A;  4XI9 A;  3ZVV A;  1HZ4 A;  3B13 A;  3MCX A;  1HU3 A;  4KVM A;  3PNT B;  4FJY A;  4TRQ A;  3T8M A;  5BPP A;  3FUJ A;  1MHQ A;  3D3M A;  3FUK A;  3I4R B;  3L54 A;  4UWG A;  2I9C A;  3I5P A;  3PE4 A;  5JJ6 A;  5D0O D;  5EKQ D;  4Y6C A;  5BNW A;  3FTW A;  3JQ1 A;  3UT7 A;  4N2S A;  4FHK A;  4I6E A;  3QAQ A;  5BT1 A;  1QNF A;  2L0I A;  5AEN A;  1WAO 1;  2VJ8 A;  4G26 A;  1L5J A;  3FUH A;  3D9I A;  3LY8 A;  5EX3 A;  4B0Z A;  4PDX A;  2KZT B;  3CR3 A;  4G25 A;  2X6I A;  3GYZ A;  3T5V A;  1OWM A;  3MZL B;  4CEM A;  3NQP A;  4AIF A;  3HYM B;  4IYP A;  3CHP A;  3OAW A;  2R5S A;  2J07 A;  3DPD A;  4GZ5 A;  1NA3 A;  4KT6 B;  1BPO A;  3LCA A;  4WNF A;  4XIF A;  4GML A;  4GCN A;  4AY5 A;  1JUQ A;  4GMJ A;  2XCB A;  5LCW J;  5LFA A;  4HOS A;  3APF A;  2PQR A;  3LXU X;  4GYW A;  2NXP A;  3ZHE A;  1WM5 A;  3BG0 B;  3FH8 A;  3ZPJ A;  3CVY A;  4B8C B;  4H7Y A;  1LF8 A;  3NZS A;  3KAE A;  4WAF A;  3QC1 A;  5KJK A;  2P58 C;  2I1J A;  3IEG A;  3RO3 A;  1JWG A;  4U04 A;  2MHK A;  2KCL A;  3CHQ A;  4A3V A;  3FY4 A;  1PAQ A;  2WM9 A;  3S2A A;  4WNG A;  3KEZ A;  4Q96 A;  5FQ8 A;  4WNE A;  3O4Z A;  2VTB A;  3RRM B;  3D9N A;  4YVO A;  1H2U A;  1HXI A;  2VGX A;  3BEE A;  2GRM A;  3B7R L;  3GZ1 A;  2XEV A;  4N39 A;  3T5X A;  3AU5 A;  3FTZ A;  2IU1 A;  1MQS A;  4XKB A;  3SHF A;  4UI9 C;  2X6F A;  4AXH A;  4KZC A;  4WWP A;  5T3R A;  3IHV A;  4PH4 B;  5KCM A;  1H19 A;  5G55 A;  3FU0 A;  3ESL A;  2BUG A;  3QKY A;  2PM7 A;  3CK7 A;  1HX8 A;  3N71 A;  2FI7 A;  4UWL A;  4WUY A;  2I1K A;  4TV3 A;  1P5Q A;  4ANV A;  4HOT A;  4HOU A;  2LSV A;  3O48 A;  3CHS A;  5AYW D;  2IF4 A;  3GW4 A;  4U07 A;  5ENN A;  1FVH A;  4AY6 A;  1H2V C;  3Q4A B;  3APD A;  1HG2 A;  2LAH A;  2AVP A;  2JEK A;  4KXK B;  1KLX A;  1IQU A;  3ASH A;  3QWW A;  4YND A;  5G05 J;  5FQ4 A;  2E2E A;  2OVB A;  4B94 A;  2WXR A;  1ELR A;  4IRU A;  4TUU A;  4IUL A;  1GW6 A;  1PY1 A;  4EQF A;  2V5F A;  2KZT A;  3TG4 A;  2VQ2 A;  3E4B A;  3ZYK A;  1QQE A;  2J09 A;  2WXN A;  4M3O A;  3CIA A;  5T4Y A;  5LX8 A;  4I9C A;  3EHN A;  3G2V A;  5CHE E;  4CGW A;  4DPR A;  2FBN A;  3G2W A;  4F3V A;  4I17 A;  2JLB A;  2WMO A;  2DBA A;  2OND A;  4OVU A;  3CK8 A;  1HG5 A;  4R7L A;  5FZQ A;  5DIZ A;  3R7R A;  4A55 A;  4CDN A;  2J4B A;  2XPZ A;  3QB2 A;  3MEK A;  4JZY A;  4KZ0 A;  3PRZ A;  1Z3X A;  3OXF A;  2FO7 A;  3TXN A;  2QY7 A;  3AU4 A;  3G2S A;  4CCA A;  3SBS A;  3DBS A;  5LOZ A;  3LYA A;  3CHO A;  4GA1 A;  4B89 A;  4F1S A;  2WPV A;  3I4G A;  3Q15 A;  3ENE A;  4I2Z A;  3R7Q A;  1B89 A;  2DIW A;  4AVX A;  3MA5 A;  4RVB A;  4GCO A;  4UI9 K;  4Y6W A;  4FA6 A;  3NF1 A;  1W3B A;  3CSF A;  3P2B A;  4JPS A;  5T8I A;  2WXH A;  4FUL A;  2WXP A;  4RG9 A;  4BSX A;  4J0U A;  2DCP A;  4UI9 J;  3QK0 A;  2XGM A;  3FUE A;  5CCM A;  3ML9 A;  4GA2 A;  2FF4 A;  4BX8 A;  3FUN A;  1OUV A;  3ESK A;  1DVP A;  1E90 A;  2IQC A;  2QFC A;  3B7T A;  2OVF A;  3JQ0 A;  1FVF A;  4IN3 B;  4I2W A;  3ONL A;  3QOU A;  4DI4 A;  2ZU6 B;  1E8W A;  1HE8 A;  3L13 A;  3S7D A;  5BV1 A;  3MYV A;  3IKO B;  1E7U A;  3G2U A;  3TAX A;  3HHM A;  2XCC A;  2XGS A;  2CFZ A;  3UX4 A;  3FTY A;  2BF0 X;  4ILH B;  2OV8 A;  4ANW A;  4Q94 A;  4WWO A;  3ASD A;  3CVX A;  2CHX A;  4ME2 A;  3FUF A;  3LY9 A;  4I6J A;  1S0P A;  4PUC A;  4PS8 A;  1HO8 A;  3RIB A;  4DJA A;  3ZN3 A;  2WXJ A;  2J9Q A;  4HXI A;  2J08 A;  3CVL A;  4FLH A;  4HFG A;  3OTN A;  4HOR A;  3D9K A;  2V0P A;  4A1S A;  3LVQ E;  2FUL A;  3MJW A;  2HO1 A;  1OWP A;  3D9O A;  4BX9 A;  3AS8 A;  4ACK A;  3CVQ A;  1OWN A;  2WXK A;  3FU3 A;  3FTV A;  3KS2 A;  3CKB A;  5E76 A;  5FZR A;  3JYS A;  4G1T A;  3OXL A;  4JC8 A;  3CVW A;  2WB2 A;  4UWH A;  4F53 A;  2V8S E;  4KYO B;  2OOE A;  3RKV A;  2M63 A;  4UQZ A;  2WMN A;  1EF1 C;  2Y4U A;  2YIN A;  4BTB A;  3FUL A;  3D9L A;  3PVL A;  3Q47 B;  5CCL A;  1NA0 A;  1TJC A;  3CV0 A;  2A5U A;  2XRY A;  2PL2 A;  3CQG B;  2LO6 A;  4NUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...