3VU0A

Crystal structure of the c-terminal globular domain of oligosaccharyltransferase (afaglb-s2, af_0040, o30195_arcfu) from archaeoglobus fulgidus
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
162
structure length
153
Chain Sequence
MEMTMDWKEALNWMKENLEAQDYAVLSWWDYGNWILYVAKKAVVCNNFQAGADDAAKFFTAQSEEEAMKIVEKRKVRYVVTVEELTVKPETNKTKFIPIMQIAGYSPEYMKNKEIIDFFNKTMLYKLHVENATNLTHFRLLKNFGTVKIFEVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystallographic and NMR Evidence for Flexibility in Oligosaccharyltransferases and Its Catalytic Significance
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Transferase
molecule keywords Putative uncharacterized protein
total genus 39
structure length 153
sequence length 162
chains with identical sequence B, C
ec nomenclature ec 2.4.99.21: Dolichyl-phosphooligosaccharide-protein glycotransferase.
pdb deposition date 2012-06-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12610 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vu0A00
2ZAIA 3VGPA 3WAKA 2ZAGA 3VU1A 3WOVA 3VU0A 3WAJA
chains in the Genus database with same CATH superfamily
4C3ZA 4P4LA 2DPMA 2FWIA 4QYMA 4PNZA 4GQIA 1MRZA 4M1MA 1VYTA 3ELBA 4UQPA 3KT8A 4EY3A 2FK7A 2RGUA 2VDVE 4DC0A 3BWYA 7REQA 3QJGA 5FOWA 4JP2A 2VTEA 1Q15A 5JJKA 5DHUA 2FR8C 1YB2A 3NW9A 1XL1A 4DM3A 1A4RA 3F2IA 3IT2A 4DREA 1PGNA 3RQIA 3QBEA 3OY2A 4ZDIA 3R4CA 5L45A 1E2FA 1TJ5A 2NN3C 5A0VA 1ZM2A 3LNTA 3HCBA 4HEA6 2BMFA 2FEWB 2HCTA 4OXRA 4E88A 4X92A 1KZ9A 1Y7LA 4YPOA 3FBGA 1XZNA 2DJIA 3MJFA 4UVEA 3R40A 2H51A 4RTLA 5LOVA 2OLEA 5C7IO 4ER3A 1JDJA 2CZQA 3H5TA 4OREX 1W34A 1G5RA 2JFVA 2WB4A 4L6CA 2O0JA 2Y67A 4HQKA 1P61B 1QHFA 3DQQA 4NH0A 4G81A 3O3CA 3UCXA 5IVIA 1T6ZA 3S8YA 2BUCA 3FPBA 4GI2A 2H1WA 4YJKA 4NY1A 1T5LA 2GPTA 5CFNA 3B6MA 3VOSA 2O59A 2O8DA 3GJZA 1PT5A 3WNCA 4YCJA 1FYVA 3ENVA 3G2NA 3GHHA 4U2FA 4Z3DA 2IV7A 3W4KA 4QVIA 4JELA 4DEXA 1HV8A 4IX9A 1KA9H 3MD0A 1M1UA 1ZLXA 2PLFA 5LXTA 1TVCA 1B1CA 2B9EA 1C8VB 1NOJA 2ZRNA 3IQEA 3N8GA 3U7FB 4QPJC 4OHPA 1AURA 4Q7EA 1EWTA 3HFJA 1FU4A 4LC1A 4UZSA 5LWQA 2ZUSA 3CX3A 3O4FA 4HDSA 2G6TA 4FBMA 4LF4B 2P40A 3PX2A 3RS5A 2DWCA 1NNUA 1HM5A 1MRNA 4ZAVA 3TD2A 3KAPA 2VDNB 3NANA 2WU1A 2AKEA 3TDMA 2Q2NA 1UBTS 2R44A 4N8EA 5KVQA 3ROQA 3GPLA 3THXB 1GL6A 2IIPA 2I03A 3CURA 3LHKA 3ROEA 2UVDA 4HZUA 6Q21A 4NCAA 5CX1B 2F8SA 5DV9A 2EG9A 2PD4A 2JFPA 2VQ6A 2D1TA 1U0GA 2G0NA 3DYVA 3U1BA 5SZJA 1DWOA 5KVCA 4OXXA 2HCJB 3RSGA 4CU2A 4P6VF 1M2GA 2RHHA 3E1KA 4DCJA 1E2DA 3HKCB 2Q41A 4PAMA 3SZRA 3EXFA 3A6JA 4OG2A 1XCPA 4PLGA 2EZ9A 2ZBDA 3CYFA 3ZV3A 3COSA 1XZAA 1NUQA 4LNAA 2PJUA 3ERCA 1ZH8A 3C3CA 3CGWA 1WHSB 2Q46A 5JXHA 2W2TA 4C2UA 1K4KA 2QAGC 2VDOB 1RRGA 2TMYA 4FR5A 3QEKA 1E69A 2FPGB 1B7GO 4M1YA 4NAVA 4EG7A 1Q74A 4O1MA 2XQVA 4B2LA 4F9EA 5JSHA 4PIMA 3E84A 2A2ZA 2SBTA 2IYNA 3FRHA 3AFHA 3HKEB 3EYWA 2P8JA 3NBYC 4RCVA 4EARA 2E89A 2WU8A 2E4WA 1XC7A 2EV9A 3D6AA 4KBYA 2AHOA 4AUMA 1WCIA 4C89A 5I9LA 2C2KA 3KXLA 4DDKA 1VPEA 4AY2A 1S6YA 1T2AA 1UAYA 2HO5A 1V5FA 3HL0A 4WXPA 3UAVA 3V7UA 3TLGA 2O8BA 3BERA 5ESDA 2ZUTA 1W5BA 3IVGA 5AOBA 3TPFA 4XEHA 2PBZA 1XRRA 5IDVA 1H4SA 4WY8A 4KJZA 1B3RA 4KDRA 4EG8A 5HIMA 1NVGA 4TTRA 2JIDA 4NU8X 1ZPDA 2GTHA 3KJZA 3HGMA 5HKKA 2RH4A 3A2LA 2B8EA 4I1VA 4J7UA 1B1AA 2PX3A 3DT6A 4EDFA 3TLBA 2Y6VA 2O8FA 5BOSA 2HADA 1Z22A 3ZX5A 2WAAA 4BLUA 1EZZA 1GTVA 4MX8A 4X00A 4E5YA 3PFBA 3PFKA 1KYQA 3UXEA 3CEJA 3QXHA 4D80A 1HNWB 1IK4A 1P4SA 4YRTA 4C4ZA 1DWPA 3L8EA 4OAQA 4XQ9A 1IVYA 1P4RA 4FKBA 2WSYB 1OTHA 1YCHA 3GPIA 221PA 1YBAA 2PMCA 4RNDB 2ZJ1A 5AVKA 4WBNB 3U4QA 3BWVA 3GXBA 5TS3A 1KEWA 3SC4A 3NJRA 3BX1A 3W3AD 2WYVA 3CLRC 3AHGA 3OCVA 4P7JA 3ZDCA 2Z8ZA 1CIVA 2BFWA 2J9XB 4B4DA 5ULLA 5G41A 4KPEC 4J1TC 4DIEA 2XJ9A 3GLGB 1YGPA 3GP8A 3LCVB 4UHDA 3MCTA 2GO1A 3ITDA 4ZV9A 3KHUA 3NCTA 4HG2A 3GMSA 2QHXA 2XVMA 5DZSA 4AMYA 2QT0A 3LY9A 2UUBB 2P9QA 2ZZKA 5EJAA 5A9SB 4C7OA 3PEEA 4GKBA 5K01A 1WZNA 2YW2A 1BVHA 2RGEA 3CRVA 1AO0A 3UT0A 1QHHB 2W5UA 1X7YA 3ZIDA 1YS7A 2VXYA 2A1TS 3LXRA 1M1XB 4MHOA 4XJXA 3FOEC 1CVRA 5FBKA 2JJMA 3RWMB 2RIPA 2VT2A 4D4JA 2DLNA 3AB7A 5K4AA 3R9KA 3DWGA 1R37A 4F92B 2BF7A 5AM4A 2GM3A 2BSAA 2BGLA 2FN9A 3M33A 1N9KA 5DMHA 2E3JA 1T8SA 4G0PA 1QB7A 2IU0A 1ZSVA 5EWLB 4AXBA 3I92A 3FW1A 4MQ4A 1P1KA 1WD7A 5CVJA 3HRIA 4XIGS 2CDRA 2WG0A 4BX8A 2RGWA 4R6WA 3T3MB 1RD4A 4RHTA 4ECAA 5LN1A 3VHXA 2QENA 4B4VA 4F4IA 1MZPA 2R62A 5JD5A 4P98A 3DHNA 4CM9A 3G1WA 4BKMA 1W4BA 1Z56C 2FJ0A 2NXNA 4QNRA 5CLJA 1UXGA 2QTGA 1CB0A 4MI3A 1O08A 5LB4A 1PQ4A 1VKNA 2A9JA 3KX2A 3MJDA 3TPZA 1CDEA 2RCNA 5M34A 4NBRA 5AJVB 5SZHB 1C3LA 2VHWA 4LMBA 3VH1A 4D2IA 5MFPA 3O7WA 4CLOA 1PGJA 2CT8A 3RQSA 4K81B 2P62A 5BNFA 5JFTA 1LI7A 3COYA 4X6YA 1X9IA 2X41A 2I3ZA 4MRSA 4XGKA 5JD6A 2Q99A 2PBLA 4OAPA 1DX6A 3NBQA 1N25A 2EATA 1JDZA 3DBHB 1MIOB 4LRYA 3DGEC 1PJLA 1UDXA 2X2FA 2R97A 2XNJA 2R00C 3ZNPA 1TYAE 1QLHA 2IU6A 5HIIA 3MQ2A 4A2WA 5JQWA 4MPJA 1N2HA 3J81A 1ISPA 1R0YA 1RAFA 1XLUA 2PUJA 1AUXA 3BTVA 3DXFA 2RGNA 4UCFA 5A5DA 4KWIA 4ETWA 3GBVA 4ZJPA 1L5HB 4UEOA 1CZLA 1KAHA 4L3OA 3N2NA 3PXEA 1IQPA 4GP6A 1M3SA 4V0ME 2JLQA 4OQZA 2ZB4A 3U3JA 5DWDA 3C41J 3UMRA 1OZGA 1PSZA 4LMPA 4PC7A 3VH2A 1MX1A 2FUKA 3NRJA 3PRYA 1QMGA 4QO7A 2G25A 4XLZA 4EMBA 2FRDA 4EUFA 2AX4A 1X19A 4LOHA 4ASUA 4CKXA 4E46A 3DZFA 2AG1A 4NBWA 1UWLA 3DAHA 1H69A 5H82A 1J2RA 1U04A 4HGQA 2GESA 4QRHA 4WMLA 3GLFB 2NYAA 2XSZD 3B1ZA 4HLUA 4UXHA 1OLUA 1VECA 1VG0B 1ZN8A 3F46A 3P0JA 4HSEA 2NO5A 1FUIA 4Q37A 5TGDA 4CQLA 1C9EA 2ZIVB 1YB6A 3I2IA 4YUYA 1U0BB 1NFFA 5ELMA 4WCFB 1JIQA 4GM0A 3GQVA 1PD0A 1LEHA 2GYWA 3GRRA 1ZH0A 4XIJA 3CPSA 4BFCA 2UZ3A 2H9IA 4G09A 4LBZA 2PFSA 4Q4AB 2PMFA 3RIGA 1Y8RB 3UJHA 3OZWA 3DL2A 4YVFA 2WUDA 5ALVA 2AOTB 2IITA 1PK7A 2JFNA 4GDMA 1KP2A 4UM5A 1L5KA 5B58C 4XB6B 1NRWA 2AVNA 1JQEA 1NQ5A 3HV2A 5KREA 4HMOA 4C22A 2PTGA 4HAYA 4BB9A 2XXJA 5DN6A 1XTQA 4URYR 1M8KA 3VVMA 3OTQA 2R00A 2OGSA 4EABA 3C3EA 1WHTB 3QFFA 1HKUA 2HSGA 2B8NA 4PF1A 4Q9JA 3OKPA 1E63A 3JYNA 3UA3A 2C9BA 2I33A 3BMNB 4MKFA 5F21A 3LHDA 2NUPA 4P4TA 4BX9A 4KK4A 3RABA 3H1PA 4H1TA 3WIDA 1FNSA 3ZWDA 4UVHA 3O0DA 2XUQA 2J5RA 2RSLA 2AFIB 5A6SB 1ZM7A 4BP3A 5ALRA 1QGOA 3OPYI 4D3FA 4YCMA 2FR1A 1T6BY 3GJ3A 3GWZA 1O94D 1IUKA 2P27A 4I1UA 2GXUA 3U0VA 2DECA 5GMOA 2VJBA 3G5AA 3K16A 1YQEA 4BBJA 2WQ7A 4DLUA 2I4NA 1SB9A 1L4GA 1NRJB 4K9KA 4IIYA 4LYJA 5I7EA 3A3PA 1H2AS 3H16A 3RJ5A 4ZGWA 1DMSA 2VDMB 3BE5A 3V2GA 4D9KA 2Q0SA 2VPQA 2F17A 2PZ8A 2IRWA 3QG1A 1T2NA 4NFLA 2Z2IA 3MZ0A 1Z35A 1GZ4A 1UAGA 1U1DA 1W25A 3D1VA 1KFKB 1NKVA 4DGQA 2O9JA 3FN4A 3U4HA 1IXRC 2DC1A 1E3DA 2P3LA 4JVMA 3W5UA 2ZUDA 1L5SA 2JGIA 3QFSA 4M87A 5ENDA 3X3HA 4BKQA 4DGSA 4ZOEA 1QP0A 3OZ7A 4A8HA 4MGZR 1A2QA 1I2MA 5EMHA 2XH8A 5DTJA 1V9CA 3IO5A 1KFBB 3T1OA 3VQTA 2OWEA 4OMDA 3G5TA 3M6VA 3QWHA 2QTLA 1H94A 2GZ2A 3BDAA 3CMMA 4HK4A 4J1QA 5CPBA 3IEMA 5FUXA 1E2GA 2X0DA 1QQAA 2JD0A 4XD7D 1R6AA 1RM3A 4S1NA 5BYBA 4AM8A 5KNDA 1OBHA 4WZAA 1ZRHA 3ZH2A 4EJFA 3SYLA 3FWYA 3G2QA 1G6OA 3JQGB 1DG3A 2NAPA 1X7XA 4JOQA 3M34A 4XIIA 2Z1DA 4NCHA 3PNYA 4JFAA 1IWPB 4PPNA 3VXKA 3FCXA 3ZQJA 4WEQA 1L5LA 4XSHA 4DUYB 4KNWA 4D1YA 4GKVA 1KU6A 4YJFA 1D07A 4LDAA 1D7OA 4YP7A 2E85A 1VJCA 4K05A 1CKEA 2FPRA 3A28A 3CRQA 4FCCA 4ABYA 2CCKA 4KUGA 3W8NA 2G1PA 4F7DA 1RWQA 4LMAA 1I7QB 1I1OA 4E5NA 1JHUA 2RARA 3KZXA 4FKZA 5BW5A 2WJAA 2VJQA 1Z5UA 4FWBA 4F3KA 3L0CA 1AN0A 3ESCA 3PVCA 3ZHOA 1GU1A 1FFYA 3WGMA 1E0AA 4J3JA 3SPXA 4CCYA 2Q9BA 4EPRA 3UG6A 4GECA 4MVJI 4GP9A 1GQ2A 5KWSA 3HBMA 1NTRA 1G6Q1 4XTCS 2FGJA 5IJ0B 2VRWA 3D43A 1E2HA 4AZTA 1M0EA 4LPKA 4R51A 1V8DA 1ZITA 2AMYA 4DQXA 1KPIA 2ZBGA 2V98A 3W6PA 4B6QA 3F71A 3D0KA 4RX1A 4EJ2A 4EF6A 3DLCA 4B8WA 3Q8MA 3EZXA 4IIHA 5GJVC 1WSDA 2IYQA 1XRPA 2JLWA 4HMQA 1Y1SA 5KNBD 3QVGA 4JASB 2B1GA 2WPDD 2WWXA 4JR0A 3MFQA 2CUKA 4JVNA 1GZ7A 3UMVA 3Q2KA 4S0XA 3RC3A 4PONA 2V6GA 1ISRA 1F2VA 3EEYA 2E4UA 4DR7B 3N53A 4J3FA 2C92A 1RE0A 1IE3A 4GD3Q 3OLQA 1D8TA 3FYUA 4DIKA 1WXDA 2Z8XA 4YNBA 3INNA 3RS3A 4XDYA 5EHQA 1KF0A 2PZGA 5EIBC 4E4TA 2A1IA 2K87A 1T0IA 2JGNA 3MWEA 3OCCA 4OIMA 3DXYA 4M6WA 3PQ3A 5EXPA 3RFTA 4Q1DA 3VRHA 5K8IA 4TSFD 4CLRB 2G9RA 3MLAA 3GLTA 4HQ0A 2GEKA 3EDCA 4K8OA 1MVNA 1KY2A 2HRBA 3WGJA 4CYMA 3H2IA 5FI1B 5LJIA 3R6DA 1Z4OA 2KPOA 4GR5A 3ZTTA 3KKQA 1X74A 2BKUA 2XMSA 3N8DA 3CNBA 4L5BA 4MROA 3UANA 3EXEB 4H0CA 1V96A 1U0SY 4P0QB 3V8PA 1EP2B 5EYPB 1H2WA 4BO9A 3R0VA 3JVVA 4GMHA 5M7EA 1M54A 3TUZC 4ME6A 1G0OA 3OFVA 3DR3A 4FIZA 2OB2A 1CC1S 1UWVA 4Q12A 4WN9A 3UH0A 4UQLA 2EYUA 5JCXA 2F1OA 1NJ8A 1G18A 1BJTA 2WV9A 1QPGA 3A04A 4FILA 3IKLA 4UUBA 4HWPA 1A8IA 2ZYTX 2RH5A 2JS7A 3C3DA 1UANA 2ZRJA 4WSOA 1O9BA 2G36A 3O4JA 3PJRA 4BWYA 1ZICA 4KE6A 3G13A 3EARA 4M1OA 2GBCA 2OESA 4QQKA 2JZCA 4ZARA 1HEIA 1PZGA 5IK2A 3ECAA 5LNK1 1Z37A 1YFJA 1I2ZA 3D2BA 1FXSA 3DV9A 2C4WA 3GT0A 3DMTA 3HA3A 3PA6A 5ESWA 2OFFA 3TRHA 1QX3A 4BZWA 3L5OA 2G09A 1T4MA 2I1VB 2YINC 3PDCA 4KOAA 4O0LA 4WLUA 3OIDA 3HN6A 5LDHA 3G2IA 3K9NA 4DUGA 4Y1RB 4MUFA 5MGBA 1YAJA 4GLLA 3BIOA 1TZKA 1QAQA 3IRUA 3L8GA 3S8MA 3NDBB 5FOXA 5KJFA 1XZGA 2OBMA 3B5IA 4WN3A 2FZGA 4UNSA 3PFNA 4B7AA 2C3YA 4A7PA 2B94A 2Y76A 4PRKA 4TXNA 1R74A 2FTKE 2FP4B 3LW8A 2GAIA 3KSAC 1E9SA 2R1TA 1OIVA 2ZB3A 3SBOA 1ML4A 4JI1B 2P6UA 4Q7MB 1LPSA 2ZTMA 1R50A 3Q4GA 2YXEA 1TRHA 2Z08A 3AY6A 3I9V1 1DMRA 1GR0A 2V45A 3QNMA 4R1LA 5DLDA 3JQDA 3HR8A 3QFRA 4RK4A 3F78A 3Q0IA 4M1TA 5BYJA 1ST3A 3S2IA 3ELYA 1PQPA 4PYJA 4X1OA 3HZHA 2XA1A 1M1ZA 4DW8A 3IT3A 5K0GA 4QXAA 2OVFA 3H5LA 2Z1NA 4NF2A 4R2JA 4YDSA 3GCGA 4YRFA 3R7WA 4AKIA 1SWWA 5FNVF 2OM6A 3PIDA 4X71A 4Z86A 3ZEIA 3ZIAD 1T1GA 3F67A 4B31A 3CLTD 5EQTA 1PHRA 2Z3WA 2PLNA 3AEUA 2VR1A 3G2KA 1RI2A 1Y1RA 4L8LA 4R8SA 4AMZA 4JA2A 2XMRA 3ZYZA 3QKWA 4B9EA 2FYTA 4Q3DA 3U9SA 1CY8A 5F51A 4G5FA 2BE7A 1KVTA 1VLMA 1JPUA 2PT6A 3WSTA 1A50B 2J87A 3E2PA 3FDJA 4I3FA 1KJNA 1M2JA 3I2FA 3MWKA 5EHGA 5GIPE 2PKCA 3DTTA 4HYYA 5CVCA 1E6EA 1SPBS 3K72B 1DO2A 3VNRA 1ZCAA 1L4MA 1U3GA 1YVUA 2JH8A 3I1JA 3ME5A 4R8LA 3GAMA 3C5VA 4HDQB 5KU7A 1X1SA 1CEEA 4F93B 3V9AA 2QRLA 1XP5A 1FSFA 4PG6A 3JZIA 2H1OA 5BWLA 1RWXA 3IOYA 5DWVA 4YY3B 1Q1ZA 4F5WA 5FA6A 2J41A 2JEOA 3G0IA 3P9XA 2CXSA 3ER6A 4FOSA 3SU8A 3FMVA 4A6EA 3U49A 5AW6A 3U4DA 1JP7A 4LTNA 4CEIA 5AYVA 2Q0QA 3R7FA 4NRDA 3AK4A 3T0FA 2OOSA 4JYZA 1D09A 3QPUA 4GOJA 1D1SA 2NV6A 5DXFA 3EXFB 2MT9A 1EPUA 4HSGA 1ZC3A 2RHBA 1T8UA 2WWHA 4YMIA 5F5XA 4GZLA 1NW4A 4JSTA 4YRGA 1YRQA 1UM9B 2Q0XA 3K70C 3Q2IA 2HV9A 1S3FA 3KT6A 5AKXA 4B4UA 4EKYA 1JMKC 5K8UA 3SXUB 4Y1EA 5TC4A 3TVTA 2GILA 5BSTA 7ABPA 2DBQA 3EGVA 1CFZA 3BSFA 4ATNA 4Z6KA 1L8AA 3F8SA 4ZOLF 4B6GA 2ZDHA 2BFAA 3QTLA 1POXA 3D7KA 3K5PA 3KAJA 2IODA 4RANA 2EFYA 3MUFA 4B34A 4E2XA 4IVRA 1TQ4A 4DPLA 1YRAA 4YUZA 5J1SB 1P31A 2UDPA 4FCWA 1CWUA 5FFNA 2IOHA 3O8NA 1JEEA 1YVEI 1ZUD1 2NO9A 1P5JA 2VPTA 2F9MA 3HP4A 2QUIA 1GRCA 1K6IA 2OV6A 2ZETA 3FA2A 3CH6A 5CB4B 4X6UA 1XEFA 2GPBA 4R6XA 4X1IB 3WGUA 3JQ9A 3A1NA 2RJOA 3IHKA 1JA1A 5IKOA 5SICE 4ER7A 5KOJB 4FQ8A 1A0OA 1WCYA 3VZRA 3A3KA 3D81A 3O3OB 5LKRA 4MR7B 1GG9A 3O6VA 5K1ZA 4GX5A 1N92A 3LTEA 4W6ZA 4XPZA 4NCJA 5ALKA 3PEYA 1OY1A 4LZNA 3UJ9A 1HYHA 1N1EA 1OYYA 2NVUA 3KR2A 4BKOA 2SICE 4QULA 5KWJA 1A04A 4ZO8A 2VUIB 2VKTA 4LJ4A 5EMLA 3QU9A 5IAJA 3INRA 5GJWC 5LQAA 3L8MA 2OA0A 4C3OB 1G60A 4NYMQ 4TX1A 1K7YA 2QVBA 2BLLA 3ZDFA 1NF2A 4NQZA 5EWMB 4RKQA 4UHHA 5EIAA 2QROA 4PCLA 1V4NA 4Z1MD 2FPUA 3HB9A 2X22A 2QTAA 5B6IA 5TMBA 5HQ3B 1G9XA 3A58B 3K5HA 1P39A 3MMSA 1Z5OA 1VKHA 3MUOA 2Z8YA 2DFVA 4UAGA 3ZWWA 1YZYA 1M2NA 4XD7A 4PFSA 1X15A 1Z36A 4R1OA 1K97A 4WUTA 5AKKA 5HE9A 4BUJA 4V0KA 4DR6B 1NOKA 1HGXA 1I6KA 5JZBA 2C9OA 4PNEA 5JO0A 1VCHA 3CKKA 2O8FB 3L02A 2I99A 4M8KA 3VDRA 5H02A 4QAQA 2GO7A 1USUA 1WL8A 5TT0A 1E2UA 5FUQA 4JX9A 1YRWA 1F8GA 1NASA 4ZJZA 2FPPB 1P74A 5BMVA 4GRDA 4D8UA 2OORA 1IUPA 5C3MA 2FRVA 1J7JA 2GMWA 2NU7B 3MS7A 4HQRA 1RE1A 3M6XA 1IVSA 4M8SA 4B5KA 5D6OA 4I9UA 2FSUA 3HJHA 2PPLA 4C2BA 4OP2A 3KKKA 3F9CA 1FTNA 4OI2A 5B5SA 5HR5A 1NWHA 2HQSA 4EG3A 2VATA 1KORA 1SCNE 3N5CA 4N7MA 2XCQA 1JAXA 1VP3A 4G63A 2ZJOA 1WEKA 1HF3A 3HNPA 3I1IA 3OT1A 3W8RA 1H2RS 1Z4IA 2AFHE 4CF3A 5JCJA 4PPQA 1NQAO 5TNXA 2C57A 2AN3A 1DX9A 1PUIA 2ZIXB 1R8QA 3K0EA 4A8JB 5K6RA 1ACLA 2C1XA 3BAZA 3EMVA 3F5MA 3JQFA 4XVCA 1MH1A 2EYQA 3BMNA 4YMTA 4D4LA 1GPH1 1Y8QA 2FNAA 2JCSA 4B2PA 5H9VA 4Q0MA 4JI8B 2P75A 3NHUA 1YR1A 4HDOB 3M6IA 3DE2X 1JE0A 2XODA 2VPWA 1RZ3A 4F5DA 2AKAB 1LLFA 2V96A 4JC5A 2QN8A 3ZTWA 4YROA 5DK4A 3SICE 1OILA 1Z2CA 4FU0A 1L7QA 3GC6A 1HTBA 4BNDB 1G9SA 1NMQA 4F45A 4CKZA 4TKVA 4WLEA 1OXBB 1AUPA 1M7HA 1GCAA 1M8JA 2WE8A 3FPEA 3L46A 4G24A 2VHTA 1O6CA 3N9IA 4XPIA 2EW1A 1GQOA 2GYUA 5EIFA 1OT5A 2NT3A 1I3OA 2PSFA 4Q9KA 3REQB 3MB8A 5IF9A 4EX7A 1VG1A 1Z5WA 2F3SA 2XZLA 2CN1A 4OFXA 4DCGA 3ONNA 4PGMA 2HJGA 1IN8A 2C61A 3T4PA 3HXOA 1FNDA 3EGIA 3O31A 3N59A 3NPAA 3HUTA 4KL8S 4LHVA 5AI0A 1N5RA 1Z63A 1HBJA 1X7HA 3KL4A 1BX0A 2HB6A 2V3WA 2YMQA 3GK3A 3QYFA 4K7JA 4N03A 3FD8A 4E07A 5C51B 1Y48E 1SRQA 1SIUA 1Z7GA 1ZLYA 1DKLA 1L5QA 3IHLA 1GNRA 4L7VA 4XARA 4BNWA 2OZLB 3PDJA 1RJ9B 1I0ZA 1A27A 3VPAA 5JH7A 3T5BA 1XMJA 4TV8B 1YCFA 4M89A 3TZLA 1N8KA 3EG9A 4DLWA 4YRKA 2BHNA 2PUBA 1ZA2A 3NHSA 4N5MA 3Q2OA 2OQIA 3PNPA 1X2BA 3WQSB 2VHQA 4A91A 4XVQA 3JATA 5ILOA 4BFZA 4NOKA 4YCNA 1UBFA 4DQLA 3FOBA 3HPQA 1GZ6A 4BN5A 1JX6A 1CVLA 3BTOA 4X1YA 2R60A 5K7SA 1QP7A 3VR6A 1Y5IA 4DJ5X 4G1MB 3Q0EA 1SXJA 3R7DA 3ZD8A 4ZCTA 2GXAA 3E2IA 1JDVA 3LL7A 2AOUA 2AN5A 4FC6A 1DBQA 4CG1A 2UYHA 1OBOA 4MDYA 1F7VA 4CIDA 3G8YA 5LVAA 4CMIB 1Y6GA 3WJAA 5A4KA 5BWMA 1EVJA 2EKZA 2IOFA 1NJFA 3GZNB 1Z6AA 5JY6A 1XYGA 2YDXA 3BHMA 1AKYA 3NPMA 4LE0A 4HLQB 2HOQA 3LKZA 1PZEA 1A97A 1E1KA 2RGCA 4YRBA 5JR3A 2IV2X 3SJZA 5IKMA 3AR8A 1RWVA 2HF2A 4Q15A 5GV8A 3LE8A 2O2YA 4FFBB 1BMFD 2QE7D 2G82A 1XMIA 2ETVA 3C5CA 3UCEA 3FLBA 4UBJA 1FDWA 1WRBA 5B1DA 4XUEA 2QAGB 4F9FA 2AG5A 2Q3BA 3BMCA 3IJEB 2JLAA 1ANKA 2JFOA 3QIAA 4RIGA 4X95A 3Q7QA 1XZKA 4HUQA 4TMXA 4HP8A 1KZ4A 5T6BA 3VR5D 3WRXA 1IBSA 4HDAA 1GKIA 1M7BA 4HGNA 5T4FA 2MHCA 3QV1A 5D3ZA 4PE5B 4KEAA 3V8QA 2DCMA 1A9RA 4NJMA 1JLKA 1SD1A 4FR2A 2I7TA 4MKGA 4V0MA 2F59A 3AHIA 4FN5A 1YA4A 3JWIA 1NVVR 3HO6A 1XTRA 4N8SA 2A5YB 4OH1A 1AA6A 3EWIA 4QUGA 3WGIA 10MHA 2Q2VA 1DBRA 2J0EA 3AEUB 3IQXA 4QU0A 2QYSA 1H6BA 4QHTA 2B1QA 4HPWA 4L5JA 2B4KA 4JU9A 4EW6A 2H8GA 5KWEA 1EJ2A 4D7AA 2P4EA 4LG1A 3GCWA 3ONDA 3GLQA 2GD0A 2QZPA 3PQ2A 4WV3A 2F62A 2QBYB 1Z4PX 2ZRFA 1BHO1 5DBGA 1TJYA 2M6SA 1NSTA 3EIEA 4CEHA 3CRRA 2QRZA 1WXGA 4O2BB 3EXIB 4WACA 4YRMA 5CFZA 2YXNA 4K40A 2DFKB 3PFIA 4NYIR 1Z8NA 3I8XA 5TMEA 2IYZA 2X14A 5DKFA 3GEEA 4P0PB 4HAZA 1GPJA 1KK3A 1U1EA 1YAHA 2G28A 3QUCA 1QHSA 5JNTA 3KXKA 3MTGA 1KH1A 5FWXA 1DC4A 1XSEA 1GVHA 2B20A 2FH5B 2PL5A 3MCZA 1EFRD 2X42A 3HA7A 4RPKA 4CKEA 2RJ3A 3A06A 3DFUA 4FN4A 3QSGA 4RMNA 4MW9A 1V5IA 1OU0A 3I30X 2ZOSA 3HKEA 2JJ1D 1EJBA 2Y68A 3TRKA 2B7CA 1LRJA 4IL5A 4JD5A 1EFTA 5D5PA 1F5NA 4ALIA 4Q19A 1KDYA 4DNXA 1D6MA 3OVMA 3MRVA 1AXEA 1G3IA 4AYWA 4HAXA 2IPNA 2WIDA 4C6SA 5AVXA 1W46A 2IUFA 1PZMA 3DO6A 4QDZA 4BLOA 3ZIUA 4WI1A 2NZXA 1B43A 1H6AA 3AI7A 4LZAA 4RKFA 4CCYB 3OTWA 4RD4A 3EA5A 3R74A 4PY2A 5AHOA 2BPOA 1ETHA 5TPWB 1ISSA 3BQNB 4G65A 1RDFA 2AMJA 4L07A 1ZK2A 1QGYA 4R7ZA 2L17A 5E6RB 1WXWA 4HVLA 3WICA 4FINA 3SYTA 3CVWA 4L8WB 3QE2A 5CAEB 1P3DA 1Q83A 3ETHA 5EGNA 4F4DA 5SV2A 1MRSA 2BY4A 1LPOA 5AESA 4ZOQI 1YE3A 1ZXLA 2J3DA 1VL2A 5B4UA 4JJGA 4ZRNA 3V9PA 4MVJD 2LXNA 3C15C 1U7XA 2NXJA 4KDFA 2C4TA 2ZXFA 2ATCA 3HB7A 1RHUA 2OUKA 1E6UA 3TEMA 3M3HA 4AYTA 3MWYW 4I1PA 2BH9A 4F4CA 4IIJB 4NABA 3CE9A 1J5EB 1L9XA 3CZ5A 1DB3A 1FP4A 1J09A 1C3OA 4M9XA 5G3ZA 3THSA 3LVQE 1G21E 3Q6NA 4KH1A 1OE0A 3AC0A 5DHAA 4CCSA 1BXKA 1KAOA 4Q1BA 2GUGA 3IERA 4JL6A 1YR3A 3OJCA 3AVUA 1LFDB 1T2DA 3RUEA 3LQQA 2NPIA 1TQ6A 2CUNA 5FQOA 3STTA 1HT2E 3I01A 2H4WA 4IM7A 1JJIA 2GCOA 4OSOA 1E8NA 3VPXA 2WTXA 4MPRA 4YR9A 1Y1TA 1OC4A 1YVRA 2EIXA 2JI4A 5DYTA 3EFEA 4XSVA 2JAXA 1ID1A 1V8PA 3BEDA 3JRNA 2CJPA 3NHZA 4IGFA 3RVNA 3AF5A 1K75A 1XA3A 2FN8A 4K3VA 5IBRA 3GOQA 2VF8A 1LI5A 3T41A 4EI9A 4PQEA 3V4PB 4G2NA 4IBOA 3KUCA 3L6CA 3JY6A 2XAUA 1LGYA 3A32A 4Z3OA 3ZE6A 1GL7A 3IPYA 2RB4A 4BLRA 3FYDA 1CQJA 4Q9HA 2AT1A 3ASZA 4LHXA 2YVAA 1KJIA 3KQLA 3LC2O 2ATIA 1GA6A 3OSUA 5E9QA 4LJ8A 1YIAA 2X2OA 1DLIA 1HE8B 2SHKA 4YK7A 3LK7A 3NNSA 3JQCA 4JYMA 4WADA 5CGZA 1IDN1 5HKOA 4LI3X 1P1IA 5ECWA 5IHXA 2FVXA 4B3GA 3N2GA 2VUHB 4TYWA 4MLDA 4BV2A 3UJNA 4RZSA 1W2GA 1K98A 4L28A 1YBFA 3U7RA 3A8TA 2KI5A 3TTTA 5ITSA 3W6ZA 3NDIA 2VO1A 3HVHA 3Q5EA 4R71A 4U7TB 4EFKA 1JYSA 4D9MA 5JVDB 4QG3A 2Q21A 4GXTA 1TIBA 1ZJYA 2OEPA 3WA6A 4D4IA 5FNZA 3VSEA 5FKJA 2H1RA 2VT3A 3HFSA 3I05A 3L0DA 2RAFA 1QIMA 4W5JA 3WOVA 2BRUA 5IAAA 1P8AA 2C7GA 2HJWA 3ABIA 1J7KA 3G2OA 1OJ7A 3H5WA 1TKAA 1QK3A 4JT8A 2PUVA 4AWXA 2QM0A 5LNK6 1Z33A 1JDBC 2NSYA 3MCWA 2H4HA 2QVZX 3NGLA 2I80A 1V25A 4G25A 1C4KA 3D54D 3F6RA 4V2IA 4B3RB 3H8VA 2VYFA 2LKDA 1OD6A 3AJAA 4Q4HA 3BL5A 2W8ZA 5EUQB 2R2GA 2AZXA 4WE3A 3LP6A 1LSOA 3KKNA 4RVHA 1PDOA 3DFIA 3AEZA 5E1OA 1T1SA 2FXVA 5CH3A 2PJZA 1H9BA 2IYWA 2GK3A 1YKGA 1K86A 2CMHA 3IS3A 5COQA 2HA6A 5B1IA 1Z17A 4NONA 1N9GA 3R8CA 4X64B 1U0NA 2BUBA 4C88A 5KJ1A 4NMHA 2QPTA 3W0LB 4ESEA 1PNTA 2PAAA 2XKAA 4NI5A 3Q9LA 5BUQA 1W2WB 5EJ5A 5GY7A 4RF4A 5DYNA 1GCUA 1M2VA 1W36D 2AA3A 4FZJA 1V7ZA 1M0SA 3RVRA 3FKSD 3CCCA 1RMQA 5DHPA 4TM7A 3BCHA 4C3UA 3W1EA 3IULA 4ZYZA 3AL3A 3VGJA 3WLQA 1W0KD 1Q0ZA 3QXGA 2CNWA 4L4XA 1AKRA 3H1AA 5GJCA 3OU2A 1X8LA 4IDDA 1BHJA 1N57A 1PT7A 3DMDA 3IDFA 5CFMA 1PNOA 3V1UA 6ABPA 3TOXA 1R7RA 2OILA 3CBQA 5K3AA 3W7BA 1YO6A 2X19A 1HDCA 2O2JA 4TXJA 2LVBA 3L4JA 2CJWA 2XUGA 3ABOB 1JG4A 1MGPA 1UP4A 2G17A 4I5DA 2RAPA 2J0VA 5F52A 1C9YA 5JAQA 3OKCA 3AOEC 3NALA 4Q02A 4CLXA 4BNXA 2AMLA 4UBNA 1X39A 3OEEA 2YW9A 2V9CA 1D2MA 5HG0A 4MQLA 2H57A 5CB8A 1R8JA 3QGMA 5CR9A 4ZT3A 1TL7C 2XUOA 2FFHA 2HU7A 3FETA 1FFSA 1B76A 3I53A 4B43A 2QZ4A 3N2KB 5G4KA 5BR4A 3K0AA 3DBVO 2X7XA 3H5AA 4OBEA 2JLBA 5AKEA 3TM5A 4RADA 3E27A 1ZMOA 3KQVA 3PPYA 2ACKA 5E2BA 3PKJA 4I36A 1UOEA 1A4UA 2AN1A 2XY4A 3AVQA 3RASA 4GI3A 1BFDA 1S2IA 1UDCA 2PGNA 3ZZ1A 5KTSA 2O5CA 1LC3A 4UNIA 4UFPA 2BEWA 1JIXA 1Y3AA 2QZZA 5FJJA 4JYPA 4IXMA 2BHTA 2LCIA 2D8MA 2I54A 4F6CA 5KOHA 3OZVA 5EXSA 4EI8A 1CXZA 7ADHA 5CB4A 1P6XA 4OJNA 4JJ4A 3KR0A 3NVMB 5A3QA 1J8FA 4O8ZA 4Q7QA 2K4MA 3LWZA 3QVKA 4UEKA 3X1ZA 2OR3A 4C7KA 1KPHA 1XG5A 5FULA 1KWKA 4IZHA 3O38A 1GSOA 4EMUA 3RTCA 2JZNA 5TT1A 5CCXA 1FRZA 2J07A 1QVRA 2EEPA 4U7JA 1A7JA 5HUHA 1MPXA 2D00A 4K88A 4YCSA 3GNLA 1JUDA 3MVEA 4GOMD 5CT4A 1UFQA 3RC7A 1CE8B 1E77A 3LUHA 4RVGA 1NT4A 2I2FA 3BFKA 3IIJA 3M4ZA 4MLCA 3T5GA 1B6SA 1GCGA 2WJIA 1DIHA 3L7NA 3T7TA 4BATA 2NO7A 2PKWA 4D82A 1FMCA 1KR2A 1NOIA 4V24A 2A86A 4Z7OB 3THWB 1D0IA 1D5CA 4G23A 1CRQA 1EUDA 3S55A 1SXJB 4WKOA 3H6HA 2VC2B 5C34B 2CJYA 3U5TA 1BVYF 5EJ4A 1V8ZA 4FMPA 3I28A 1SG0A 1Z26A 2VBFA 3TW6A 2OO5A 2X4IA 4E4YA 1T8PA 1E59A 3UJCA 2FZ4A 1ZD2P 3WB1A 1H4TA 1Y9JA 1A8HA 2V7TA 4BLTA 3G2PA 4ZYVA 3L43A 1P18A 2F43A 4RFLA 2EHJA 2QRPA 3UWSA 4S2UA 1GRQA 2BTQA 4F5EA 4N3AA 5ED0A 3EG9B 4AJ9A 2CXRA 1G16A 1YKSA 2P1DA 3P4XA 3V6LA 1EUCA 2A9OA 3IDAA 4ZHQA 2ZI7A 1DBVO 2DQYA 2R6DA 5BY2A 2CBZA 1BSVA 5DI3B 1U6IA 1XVTA 3MEQA 4RDXA 4NCBA 3FFWA 4OU5A 3OIGA 5HMLA 1VE1A 3HE3A 2P9JA 3NC0C 2YV2A 2ZB2A 3F73A 5FOQA 3FCUB 4PQFA 1NMZA 5K6AA 3B38A 4YJFB 4HNGA 3PTLA 5CXUA 5FX2A 4QU5A 2QW1A 4RZ2A 3CLUC 1T5HX 3OKAA 1GIAA 4P7GA 4NNJA 4K03A 3ULKA 3VYRB 4QVKA 4K6MA 4U4AA 4QQRA 1P19A 4C29A 1Q20A 2AB0A 2OCPA 4QG7A 1FFWA 2C4KA 1CDZA 2O3JA 3G49A 4WZAE 4I5EA 1MKYA 4FYPA 4TRRA 1CJKC 2A5JA 2GD2A 2YUIA 1E9BA 4UARA 3ZBTA 3OX4A 1O6GA 5JZ9A 3KWJA 3D59A 3H2JA 1RKXA 2KBEA 4K6KA 4MWBA 5AO9A 3EZLA 1MJFA 2M6RA 1U2EA 3JQAA 3RSLA 1L5YA 3LLSA 3GNTA 3DBRB 4M6WB 3C3PA 4NNPA 4OKIA 5I5GA 5EAIA 1C7EA 2PEYA 1U65A 5JHHB 2HCRA 4F11A 3O8LA 1M72A 2ZYHA 4RVUA 4WT7A 3TF5A 4X65B 5JWRA 4LDPA 1MQAA 1V0JA 1PS8A 1V6CA 2AF4C 1EDEA 4EFNA 3IE2A 5DN6D 3GJSA 3RH0A 4C0WA 2YR0A 1BC5A 3ZDRA 2F6RA 3K35A 1XTJA 1ZCJA 2RB5A 2VAXA 1NVMB 3KR1A 4YCDA 3KSDO 3RTAA 4BFWA 5JZVA 3EHEA 1TNDA 3F4BA 3I5XA 1NT2A 3L7JA 4RCZA 5BVHA 1DXQA 4Q3CA 4RHCA 1OXSC 4FW9A 1GUBA 3CCBA 2B1IA 5EUMA 5AD1A 3ZVMA 3ER8A 4PYQA 1XE3A 2BEVA 2QKYA 3L1KA 4Q5IA 1F6DA 1I36A 1L1QA 2FW8A 2DQSA 3IOBA 2GBLA 1KYIA 2YHAA 4RS4A 1P6QA 2J09A 2W98A 5DO9A 4PYOA 5KX5A 3AOEA 3PDHA 5COAA 3FHTA 4F4HA 3OETA 2FMFA 4CKYA 1OZ0A 2VDUE 3A6DA 2FZEA 1KEVA 1SQSA 3PFCA 3CG4A 3QELA 5BN3B 3TJMA 2WU0A 2XZPA 2GDJA 1P4GA 1ZGHA 3VPDA 3DEYX 5BSRA 4FS3A 2N3ZA 1YOVA 3ICEA 3TKYA 4YRRA 1EK5A 4FDMA 2C3MA 2QN7A 1KL7A 2P8SA 4G0UA 4EHHA 2M2IA 2GM9A 2QMZA 4RPLA 1OZHA 3TQTA 1VYVA 4LYHA 1J2YA 1OH6A 3MW8A 1ZW6A 4PZ9A 4P5PA 2WHXA 3GJQA 3EVAA 4P3XA 1QHYA 1RIFA 1F2UA 5JMWA 2N47A 2DTXA 2ARKA 5J4KA 4UNQA 1E8DA 2C4HA 2VP2A 3FMOB 3GYBA 3HCRA 3HDHA 3L4SO 4KYVA 3SCZA 1YL7A 3H5RA 2HNBA 4KXYA 5JSUA 4OHFA 2GN1A 3PENA 5TE9A 4RVOA 3TW8B 2VFAA 1TGVA 1FP4B 4KZKA 1OA0A 4ZO4A 5DIZA 4P2BA 5DTQA 1XTZA 1U4SA 2BR5A 2P65A 3H17A 1O8BA 2VRNA 1WDTA 5LC1A 1S4QA 3KS9A 1AJEA 3GDOA 5EP3A 5EIBD 1II8B 3IB6A 3JCZA 1QHIA 3KV1A 2YJGA 4OLHA 2ISCA 1YDHA 2SKDA 2J33A 4DBZA 3TBKA 3N0TA 4QL3A 4BFYA 4M4SA 2YH2A 2OCKA 2QMYA 3KLMX 4MKHA 3TNJA 1UKBA 3AB8A 3NBUA 2ZSIA 3U39A 1Q5PA 3FNGA 3KU1A 3U7HB 1G291 4BZXA 3KYDA 1AQJA 4RULA 4AS2A 2W2PA 5KVVA 1CX9B 1A9PA 1S8AA 1EWYA 1TDJA 2XF2A 3BFVA 5DN9A 1ZISA 3DMGA 3DF7A 5F78A 3LBYA 2BZSA 5DASA 1EFRA 1JEAA 1XZ8A 1OKKA 1JEQB 1UXHA 3HABA 1A9QA 3LV8A 4HR7A 2P2GA 2ZPAA 4F8YA 2Y77A 1T1JA 3OU6A 1XJ0A 3G2JA 5CGQB 1G5FA 4NZ9A 1QLWA 1MO3A 1GPKA 1DPFA 2VF5X 3U4AA 3W5HA 3M6MD 4FNOA 5LQRA 1P2TA 5DEIA 3SEQA 3C5EA 2CWWA 4RZIA 3M49A 2X5KO 2XYHA 1JWBB 2AIRA 3LF1A 2Q2OA 2Z9CA 3T1NA 4B44A 4XWKA 3MWDA 1R4NB 1JEJA 3RUCA 4DM4A 6CHYA 2WPDA 1EBBA 3WRYA 2P0EA 3AM3A 4NATA 3GVXA 3AH8A 2XUJA 3CX8A 2GD1O 3RREA 5KDOA 1WETA 5F3RA 4RY2A 2WWVD 1SD2A 2PX2A 5SYAA 2X9LA 5ITZA 5CK4A 1LNZA 5A2QA 5JMOA 1SUAA 2QEQA 2H5LA 4HDNA 1PJSA 5H81A 4ENPA 2WIJA 3C7CB 2EU8A 1Z6YA 2EERA 2VOJA 5TQVA 5CEEA 1EK2A 5HZHA 2DHEA 2WTEA 3NC4A 2Q2QA 4RF2A 5U9CA 4YMUA 1WJGA 2JIRA 1KMNA 1A95A 2GOYA 5AKJA 4YFVA 3ZJ5A 5HGXA 4DR1B 3L7IA 2ZRMA 3GFGA 3VVCA 1XYYA 5E7IA 1WSBA 2E2WA 3TOZA 5HCNA 3NOOA 4MUKA 5CA0F 2OORC 1OAOC 4TM8A 3WAJA 4ZD6A 1V4VA 1F0PA 2OP0A 4DRXB 3HJAA 3TG2A 1KQGA 3EIFA 1F20A 4MS1A 1Z0SA 3W2TA 1XXHE 3SSMA 1Z88A 4WERA 5K4HA 1F1BA 3FUVA 4V0QA 1Q1NA 5DNEA 1OIWA 1G63A 1K1EA 4URFA 1DQRA 1K6EA 2IIQA 3CRZA 1J00A 4Y2TA 2HWXA 3TOCA 1Q2UA 5JXJA 1G4HA 1L5FA 3D0RA 3R0ZA 2O2CA 2P79A 2REQA 3H2YA 4IUYA 5CUQA 1A4XA 2ZRPA 2Y93A 1DUSA 3L92A 2V55B 5AMXA 3IR5A 721PA 3OOEA 3EGDA 3MAGA 4LY3A 1TXGA 2WTUA 2QLLA 3NWJA 4ALLA 4JCOA 4B6JA 2CVZA 5JCJD 2C8VA 2JHGA 2Q45A 1VLVA 4IAOA 1JMYA 4NEHB 2YFHA 4U2GA 2OD7A 4UMFA 4MA4A 2HXGA 2PH1A 4WZ6A 3CUWA 3B1VA 2MR5A 3Q10A 1V16B 4J0KA 1I3LA 3AR5A 3C6MA 3PCXA 1JJBA 3KTFA 2BVNA 3VZSA 5DM1A 1GNPA 3PXDA 2QUJA 2CLHB 2ZSKA 2FSIA 2VRCA 2YQZA 3OFKA 1OGYA 3BG5A 3HA2A 3GUUA 1TF7A 3N0VA 5CURA 2C9ZA 3VISA 5GADl 5H8WA 2AG8A 2OECA 2RKWA 1V1MB 4MVXA 3WDKA 1VE7A 1TM7E 3NOVA 4GYJA 4R4JA 4RLQA 4TMZA 3KLPX 5CPFA 3WJ7A 1SU8A 3HO8A 6ADHA 1B23P 2I8AA 5AVWA 1YTLA 2XOXA 2HSWA 3FNRA 3H13A 2IYAA 2PD6A 2Z2YA 4X93A 4DSNA 2JGDB 1XIVA 3T6KA 3LW7A 1GRRA 1OGIA 4K6FA 4MWZA 1EUDB 2AS0A 2J08A 3JQEA 3AY0A 3LFTA 3M2TA 4ML3A 1WQ1R 1HT1E 1PYGA 3E22B 1Z0UA 3GLVA 4WVLA 1H3NA 3WYGA 3S8EA 3KSUA 2H54A 4RZXA 3FRIA 2JKZA 2AJTA 3HNOA 4U39A 2Z6QA 1WF6A 3KJIA 2P7HA 1CQWA 1ODFA 2IYUA 1Q3KA 3MT0A 2CL6X 1ODIA 1GG2A 2Q6LA 4MUNA 4LF5B 1OXVA 4LYDA 2F67A 3SZOA 1D2EA 4ZCQA 4QDJA 1B6TA 4PSCA 1JQDA 3KVNA 1O97D 1OC2A 4WESA 3DDOA 4LXTA 5JCPA 2J6CA 3OX2A 4NMLA 4DL9A 5EJ7A 2BJHA 2P2YA 1NBIA 4ZPXA 3SYNA 1GPNA 4OIFA 4HNHA 2FZ5A 4Y9DA 3TQCA 2HIGA 4OM7A 1SHJA 1SBHA 1XF1A 4MIEA 5GM2A 4Y1GA 2WKWA 1Y98A 2QD5A 1LRLA 4TROA 3JD3A 4QPDA 5E7MA 1ZFNA 1QIHA 2EFJA 5FPPA 4H59A 1E2MA 5KYUB 4IKEA 2FQYA 3AF1A 1Q0PA 4PCAA 2VP3A 5ALTA 5A0TA 3FOFC 3L0ZA 4X20B 4NTZA 3UMFA 3A6HA 1XTVA 4C43A 4NHEA 3DKKA 4AJNA 2E0IA 4LCJA 2OO7A 3NI2A 1ECCA 4U7DA 3KKMA 1RC0A 1FL9A 2ZTVA 3ZWNA 1N1DA 3O93A 5B58T 2C5AA 3AMVA 4KR6A 2W6NA 5I9TA 1U3TA 1NQUA 4R0MA 4L74A 4A8JA 2AMVA 4DWJA 5HGJA 1NXSA 2J59A 4TN5A 2Z8YM 4NE9A 4E30A 1JQ3A 1XQ6A 3G9ZA 3O83A 4IVQA 5CU7A 4M53A 1XVLA 3B1FA 1QP8A 3KXPA 1D6SA 2ZBVA 1UZLA 4LJAA 4C0XA 1SEVA 4P4SA 4RGBA 3VVLA 4TQAA 4JYBA 4Y2GA 4XDHA 1AD2A 3GGDA 3I2KA 3F3KA 5FBWB 3P9CA 2Y0EA 5FAXA 4LF6B 2BV3A 2W0SA 3GMTA 2C5HA 2PRZA 2WHQA 4RVNA 4M38A 1R8XA 2ZRIA 4MW6A 2FETA 1PT8A 2HWUA 2Z4RA 3VTAA 2HXSA 1V6AA 2G72A 5FPQA 4BP9A 4EGQA 1GAWA 1R5OA 1T9BA 3I23A 1QE0A 1JAZA 3UF0A 5AW7A 4L76A 2JLXA 1RAGA 3BMXA 2C1ZA 2YVKA 3NTQA 4EB8A 4DDTA 4L95C 2CVHA 2FKNA 1CZNA 2O8DB 2C77A 1YE5A 2IHBA 2J85A 4DT1B 3OM9A 5D85A 1LPMA 4KQXA 3D2CA 4WXEA 2K7FA 4G8JA 5H4HA 1Z68A 1OLSA 2W2OA 2XECA 3DTVA 3VNBA 2PTHA 3EH1A 2IXBA 2I2CA 2R84A 2TRSB 2COKA 1Y42X 4LJKA 1W47A 4OHCA 4ZI3A 5C7OO 1I30A 3KYBA 3LGSA 2R7KA 4OUDA 2VF4X 3I34X 3SJUA 2P2SA 4J1SA 4QYTA 2A4MA 4DJDC 1KAEA 4H1WA 4XFDA 3PYXA 2DVMA 2YQ4A 3UCFA 5KMGB 2XSZA 2IHUA 1J8MF 2O6HA 1W0JA 3OQJA 4N3BA 5KINB 1KHHA 4UDYX 4P7BA 2ENWA 1UC9A 2BTOA 2NZWA 1Z9BA 3EGEA 2QN6A 3JPYA 3KDSE 1PR1A 5C4MA 1LBHA 4DCOA 3DKVA 2BBTA 1N5OX 5EL0A 4M9ZA 4EBFA 3QFCA 4BYGA 3AERB 3A6GA 1IHDA 4R7TA 4FXPA 3OQIA 2BFEA 3QE3A 4RPIA 4XWYA 3TR5A 4Z3KA 5I47A 3EPLA 4GHWA 4MYSA 5A9TA 4DPKA 3KPVA 4NE2A 1R0KA 1J0EA 2WZQA 4CMAA 2C04A 5KSPA 3CEPB 1K27A 3CHYA 3OU7A 1D0SA 5KHAA 1VHLA 3TD6A 4EY7A 3A4YA 1B0UA 4GE0A 2YC2C 4OHVA 1AUOA 2ZT8A 5IDXA 3B1XA 3V4RA 4LE2A 4OYRA 4V1CB 2OLKA 5I8WA 4RY8A 1AKWA 2D5CA 1JB1A 2D59A 2FW6A 3HV0A 1ZMTA 1C50A 2ZWAA 2Q9CA 1S8OA 1XPJA 1ZOOA 2YXBA 4J03A 4V0LA 3ETCA 1KO5A 1ONPA 2B7BA 3ZV5A 2XKKA 1KJWA 1DVRA 3EG5A 5K8LA 1SRRA 3B6JA 2LKCA 1JECA 3HB1A 5LPNA 4DZZA 1D4AA 1ZD8A 3M82A 4ZI5A 1GNTA 1RXIA 2O4CA 4AJJA 4ZEXA 1PBTA 3ESDA 3QLVA 4HLDA 4TS3A 1UJNA 1DRVA 4AWAA 4H31A 4DSTA 4IVPA 2VSNA 4Y9RA 2R6GA 3W5BA 1VL0A 1ZR4A 3KUXA 4XWGA 2YRFA 1BTOA 2XWSA 3INGA 4H7FA 4J0FA 3I42A 3WAKA 4D8XA 2D1FA 3B8EA 3TQIA 3OJXA 4L5YA 5EA2A 3AGPA 5TRTA 1P33A 2WKSA 1GGMA 4QPZA 2GBFA 3A14A 1DE0A 1EXNA 4WNCA 3UA4A 4EG0A 4G2TA 3K6SB 2YZ2A 3E18A 5JSFA 4QFCA 4CUJA 2EP7A 3ICQB 1JFVA 5JALA 1ZWKA 3ZHRA 1C1DA 3G6KA 3M9WA 1W0KA 4TLMB 1G98A 4CCAA 3K09A 5BMOA 5DNUA 3IMCA 2HJHA 2XTAA 4WLOA 4ZOCA 3BMQB 3WMXA 3HP1A 5JEDA 1FIUA 3NR2A 4XLTA 2R751 1BCRB 3TSYA 3GLSA 3AUUA 1X13A 3SE0A 5A71A 2EOAA 4H7DA 4ILKA 1IZ0A 4ZMBA 1FUUA 5IUJC 1IONA 2HU2A 4D9GA 5JDCA 1VFPA 5I9SA 1J1IA 2IYOA 1AS3A 1PZHA 4B35A 1M1YA 4IOKA 4CEHB 1SBCA 1WS6A 4I8XA 1X38A 2PU7A 2YJ3A 3E9YA 4PZYA 2NP7A 4PPYA 3K2IA 1DJQA 4L0QA 4NYJR 2AFRA 1BRMA 3RHFA 1RJGA 1ZCBA 3TR0A 3LP5A 1EUCB 1BG6A 4B82A 4RXUA 7REQB 2PL1A 3GNSA 2O48X 5HPYB 1I7DA 3K1ZA 3OT4A 5ARBA 2A7XA 4UBIA 1D03A 2W11A 3NYWA 5DTMA 1RNLA 3OJEA 2O1WA 1KOGA 1UDAA 1X1RA 1UBJS 4KBFA 1BGVA 1GD1O 2CGEA 3IOMA 5CT5A 4BNYA 4D5EA 2IX3A 2EX1A 2VUUA 4PHHA 2HT6A 2B9VA 3H42B 5CHYA 5CA1A 4GX1A 5AW9A 4X1IA 2I0FA 4HH1A 4BBZA 2N9UA 1OXUA 3ED5A 4IF4A 4YJ2B 5HJ2A 4JQSA 1LVGA 1N3IA 3EZYA 3GG2A 4NWIA 4EW2A 1WNFA 1E7YA 1ZK4A 2G0TA 3QKUA 1QCZA 1S5PA 3LQ4A 2ZSDA 3O1IC 5KTRA 2I71A 2ORIA 3QTBA 3FJYA 3HY3A 4RK0A 3SX4A 1I0IA 1QG4A 1PE0A 3X1XA 1F38A 1SBQA 2RCYA 1GFZA 3OZXA 2D62A 2JIQA 2CF5A 2DBRA 5E6RA 5K6TA 3ENZA 2JL1A 2EBUA 4EGAA 2NXEA 4CEJA 4BEBA 2VSXA 3HU5A 4QGHA 2B5VA 4Q18A 1U3VA 4IGAA 3TJRA 4LF8B 3ZU3A 1P2VA 4BJ6A 1CUHA 2DFNA 2CNOA 3BB1A 5JS6A 4N0MA 1C9MA 1E96A 1CDOA 2H3EA 2WMOB 3MRTA 4OJMX 2WOOA 4E22A 1P2FA 5BNZA 5JAHA 4GLJA 4A03A 1T9KA 3FBTA 2BWJA 4I4LA 4BKUA 3EW9A 3RUIA 1KDZA 4YAIA 3RVMA 2AOWA 3ICWA 3KZMA 1OF1A 1Y1KE 1QDLB 3WLLA 3WLSA 3G1TA 2BF4A 2HSDA 2VZ0A 5ALZA 3OTGA 3Q7TA 1V3VA 2BEVB 4U9IS 5AHRA 2GF0A 3IPLA 2R4UA 3TIXB 1HE2A 4IFTA 3FJ1A 2V1UA 1E94E 3K70B 2UVPB 2J8ZA 3OLZA 3Q7RA 5IC5A 1XDUA 4A2CA 1J99A 4H18A 1U9JA 2PX8A 4YBRA 1Z5ZA 2O05A 3QXCA 1OSNA 4IV5A 3LZDA 2ID7A 1EVZA 1G5IA 4MXDA 4UM7A 4ENUA 1K7SN 1U7ZA 2WD7B 3G68A 3P2IA 3WRXC 4RA9B 1GV1A 1LBEA 2RHWA 2G06A 4FMCB 4NZPA 1BDJA 4HYTA 2BR4A 3LA8A 1L5HA 3R7NA 1WV0A 5FUWA 4CR6A 1N3BA 3NM5A 2GSDA 3DEFA 1IXZA 3QYJA 3MINA 5D5QA 4LXXA 1UJBA 4M8LA 3RVDA 3RWBA 3PRKE 4M0CA 1UFOA 4GVXA 1E58A 4L3VA 4RK6A 3LBAA 2MSCB 1FU7A 4ZO6A 3OCXA 2B4YA 5LA6A 4ARSA 1KK2A 2GF2A 2HA3A 3EK2A 4CTOA 4B3MB 3HCEA 3UUWA 1ZJ6A 3U7IA 2E4YA 2GS9A 3EGDB 5GINE 3CRW1 1COWA 1U0FA 1OUMA 2O8CB 3PC7A 3CWCA 4EHBA 3FDFA 3HSKA 3ILYA 4RD1A 1VIAA 2E21A 3BGWA 4LZWA 5KNBA 5TMPA 4ZODA 5IM5A 4YT2A 1N2CB 3PUZA 1CJBA 1MA3A 4L6IA 3WE7A 2NU6A 2ZROA 4KXFB 2C9MA 3KDPA 1II0A 3TB6A 4LJRA 2X2PA 1T4GA 4MS1B 1QOZA 1A5TA 2BFFB 1QTQA 2W4MA 4G1BA 4OL0A 3U13A 4MP6A 3RUPA 1GL3A 4DYHA 4C2TA 4XDZA 4Z0PA 3OTOB 4FSXA 3V8BA 3CMCO 5EE3A 4CLEA 1NBWB 4KQHA 4A92A 2QR2A 1MW9X 2NU8A 1PR4A 2WU4A 3H75A 1U81A 3JASB 3MLBA 2DHDA 4IDGA 4MUBA 2QTNA 3GGGA 1AQUA 2HF7A 1THGA 2O3SA 2Y1LA 5HDBB 4YRPA 4D56A 4CIYA 1CUJA 5C53B 1BH2A 4LOLA 3LY5A 3REQA 4L85A 3T5AA 1N3YA 4RIIA 2XEDA 4JHLA 3I9KA 3DEZA 2FW9A 4RAQA 2HCFA 3KOUA 3O1JC 3EVGA 4J07A 4G5YA 1G20A 4ZTZB 2XVZA 2F1IA 3KZ1E 3PLNA 4RTJA 1O94C 1JBEA 2HDNB 4A0RA 4ZIRA 3F8TA 2WVGA 2A0XA 4NICA 4EEKA 1SXJE 1G5QA 3E7XA 3MA0A 5HBGA 4IGIA 4QTXA 4W9RA 1AHIA 3UV3A 2PXXA 3P2EA 4ONEA 5AK3A 4C6HA 4JBXA 1ILWA 1V5EA 1KYZA 2D7JA 4NJEB 3GRAA 4R31A 5LQJA 5L6LB 2GNPA 3NWOA 2PR2A 3IBFA 4E3ZA 5CTJA 1E2NA 1E8MA 1F2DA 1J90A 4CM6A 2I66A 3A25A 5F7XA 3ANSA 5FBRB 4EZBA 3HYSA 2I8CA 3K1AB 1DJLA 3K6KA 3P9KA 4Q4DA 4D0GA 3BHIA 4PIPA 4FOPA 3ADBA 3FFBA 3ZBPA 3ZWXA 4OEHA 1ENOA 3PUKA 5U4XA 2PSEA 3JTMA 2CLLB 2WSLA 2FI1A 3FZEA 5LQKA 1XQYA 3F5QA 4U5XA 1DKRA 3D4IA 3VBEA 3DM5A 1M74A 8AT1A 4JI7B 1E2EA 2ZVDA 3AWIA 3KUUA 3LUAA 2WFLA 4PANA 5SY6A 4D8TA 5KYGA 5FTJA 4YJDA 5GZ3A 2Q49A 1TAQA 4JXXA 3AV3A 1UMBB 3LQFA 2XTJA 3UKDA 4MRVA 1HFKA 4OA5A 4P3KA 1D04A 4HY3A 3K05A 2GN4A 4CZ2A 4QSHA 2RGXA 1FSZA 3NHJA 3PYMA 4MCAA 5ILGA 1YZLA 1COZA 4AZWA 4CM8A 3WK7A 2AFVA 3G1UA 4IIGA 4WNAB 1CS0B 5AM1A 4AI6A 5LUAA 3B1WA 4B6EA 3PC3A 1MR3F 1XEXB 1YI8A 4ZGGA 3LU1A 2ZKIA 3RG8A 1LCIA 1OREA 2RHCA 2ZJ4A 1W75A 2BRUC 1J20A 2KLBA 4KW7A 4NECA 1FRFS 4OSEA 3CR3C 1GJRA 4HGRA 5K45A 1CZKA 2MIIA 4LQCA 4PFKA 2YHIB 4L02A 3ZVRA 4K9NA 1G2OA 5A6SA 4X60A 2K6GA 1ISHA 2HLDD 4O4LB 4WL0A 2AR9A 3HM2A 3EODA 3NT5A 4BX0A 5LLDA 2GM4A 5GJBA 1XD8A 1JR4A 1DRUA 3NBZC 2EW8A 3LPNA 3LUGA 5IKEA 5T64A 4FHDA 1X7XB 3R9WA 3NDPA 1XU4A 3BM5A 3PRHA 2XXAA 1FVFA 2OC4A 1E6CA 3LAWA 1MVLA 5E0OA 3T5CA 1XZPA 2OXIA 3D3EA 4PAQA 3TNFA 1O2DA 1T3HA 2HWYA 3S44A 5HQ3A 5EXEA 5DNCA 2FOIA 2JBAB 3SLKA 4A8PA 4CHGA 3DBLB 1LQ2A 3OTIA 4INAA 1ID8A 1SHLA 4G8DA 4BVEA 4HZGA 4C3VA 1PSDA 1XCLA 2ETXA 1ODSA 5E4FA 2J3KA 3FUUA 1ZIOA 4HXGA 1XZIA 1ND6A 2WM9B 4KV9A 4REQB 8GPBA 1R4MB 3VGPA 5JLJA 1ABFA 1G7CA 5H3LA 4BAGA 4S24A 5AOCA 4ROSA 4GEKA 4QBGB 1C30A 5KTPA 4JI4B 4OX9B 4M0MA 2GJSA 2OCLA 2EF0A 1FC0A 1AS2A 2O8NA 2OV2A 4EY6A 2J6IA 2BE9A 1E9RA 3KJGA 3M9LA 1DGQA 3M4XA 1BHQ1 3CT4A 3HC7A 3L05A 4LDZA 1NDHA 1ODCA 3OF5A 3PI7A 1XMQB 2QLMA 5CNJA 1N0VC 1T2UA 2W2KB 3VNSA 1VPTA 5D3KA 4BTLA 3MHTA 2NSDA 1X80A 1DTEA 2NSHA 2FWJA 3GCZA 4WTOA 5GVSA 2DWPA 4MR8B 5ELXA 3C8DA 2IOQA 3EOZA 3PQ5A 4R1TA 1STOA 4DWVA 1HURA 3DL4A 1NFQA 4MQ6A 2IYEA 4JH0A 4EZEA 2HPZA 4KR7A 1C0EA 4TPKA 4U2KA 3GGPA 4YAFA 3SBEA 5L3QA 1E0JA 2PZEA 1E9DA 2I1LA 1I3NA 3LT5A 4KPUB 3ZCPA 5HRAA 3GLIA 1J4AA 1TKRA 3AEXA 1AXGA 1G17A 1XHLA 4KYTA 2QNIA 1G19A 1YR8A 5CCDA 5JS1A 2EHDA 2PO7A 2OCDA 3IUQA 4DR5B 4CRWB 3L77A 1GY8A 4NP6A 5KVAA 2ZT5A 1TZCA 3KQPA 2C7PA 4B3IA 4A26A 2BFDB 3V2IA 3GJ8A 3D8NA 3T5PA 2Q9AA 3P5SA 2J6BA 4HTAA 4NPCA 4S1OA 2QMEA 4I5GA 5A4DA 1WXIA 1AY0A 3LCJA 4O2LA 4P1ZA 2DUMA 4Q34A 5PGMA 4FEYA 3GAFA 7YASA 2B78A 1Y5NA 3WVNA 2ACWA 3VSBA 5B7NA 2XDYA 5FI3A 4KIJA 2PU5A 3OAAD 2GAJA 1QFYA 3LGAA 3QWIA 4P5EA 4TLEA 5EHXA 5KQMA 1NYRA 2P6PA 4AJ2A 5TIIA 3IP9A 4RY9A 2ZAIA 1USWA 4IJQA 4Y6LA 5HMMA 3IXMA 4LF7B 5JIBA 1J0XO 3TBFA 3TL2A 3Q6MA 5ALLA 4BX2A 2QYOA 4RTKA 1EFVA 3G89A 3AU8A 4QJ5A 1P2UA 4YI3A 2AC7A 2I3BA 3G9QA 4D0LB 2I2XB 1W4AA 2ZYIA 4B7ZA 2AF3C 1U8EA 3QKIA 4B48A 2VL7A 1O9GA 1RRVA 2IBMA 2ZBRA 3LCCA 2AV6A 1KJYA 1FFBA 2WMNB 2COEA 1W5AA 1E3SA 3FOWA 3QFHA 5B1SA 4MV5A 4KQJA 3HMQA 5EEGA 2P6NA 5J9FA 5AIAA 1W1IA 4PGGA 1CY4A 1ZQ1A 4CE6A 4BAZA 3TCNA 2YJNA 4QX6A 1MAUA 1IPFA 2IKSA 3OQPA 5BR7A 2QLBA 4J2OA 4LBYA 1P9WA 4KXNA 1OWNA 5ECDA 3BL6A 1Z62A 1E99A 3U1VA 4QJIA 1XI2A 3OHMA 1RRMA 5E6SA 4Q4JA 4BNVA 3RIHA 3SVTA 4B85A 4JL8A 1TAUA 1RYNA 4B6SA 3OOWA 3O95A 1VRCA 1N6HA 3GJXC 3TO5A 1E3QA 4AS3A 2WIGA 3U19A 3PV0A 1JR6A 2AOUB 4FFOA 4Y7CA 4HFNA 5HCUA 2E5LB 2CNNA 3LXXA 2C5SA 4JUBA 4PLVA 4F97A 2J5XA 2JAUA 5DLYA 1Z0FA 3OFSA 2YUTA 5IEJA 3A1UA 2IU3A 3CLUD 1O8CA 4UULA 2O7VA 4BECA 1EHCA 3C74A 3QOFA 4TUYB 2I34A 4N9QA 4KOEC 3RJMA 3T7DA 1UEIA 4F12A 2F9LA 4MNTA 2I62A 4ZT2A 1LBTA 1CK4A 3BT7A 4KREA 4EG6A 1LDNA 4FFBA 3TFQA 2QY9A 3FLEA 4TV9A 3OZBA 1ZJ4A 1BDBA 2RAVA 3N70A 1IMOA 2WZCA 5I45A 2I6GA 3QITA 3CLSC 1TUBA 3OO1A 3WWDA 3K9FC 2PWPA 1LDEA 3LTNC 2FA9A 4G85A 2J9RA 1C7RA 2HHCA 4HPJB 1QONA 3NH6A 3JQ7B 2F1JA 4HD8A 4RMGA 5JFGA 4EPYA 1U2RA 3EZNA 4EA8A 3RSQA 4N65A 1TGYA 2G1UA 1DXOA 2GJ4A 3IP3A 3Q5DA 4G97A 4DRXA 1AB5A 5ADUS 2DB3A 5IBQA 4KMMA 5BNWA 1QRTA 4INJA 2JEZA 4I8IA 3IEKA 5CT6A 1WTAA 4N3GA 4P38A 5ENVA 1KXZA 1W1UA 1Z4MA 4YJGA 3J80A 1T3SA 1DAIA 1SBNE 3SHOA 1YRLA 2VSOA 3ZV4A 4GOND 3WLTA 4EHNA 3AYZB 2NXCA 3E9NA 4IEEA 3ZIAA 2F48A 5HTOA 3SXPA 1I7SB 3DDCA 3OZDA 3UGJA 1SG6A 2R1UA 4DNQA 2PWZA 8OHMA 4UU0A 4PTZA 4UHBA 4TZ6A 4NXMB 1XN4A 4HFRA 4HNAA 4PLZA 1J22A 1VL5A 5K3DA 3IR6A 3NVAA 2Z9DA 3OFND 4EB0A 2A0YA 4EVQA 2CMGA 3H0EA 4HH0A 4L0CA 2GD6A 1PL0A 2YYAA 4G41A 3COVA 4O4JA 3SR4A 1LWNA 5C4IA 1X1BA 1JVSA 5K0EA 2QL5A 2QQGA 3U3RA 2GBGA 3N2EA 2QRJA 3WRWA 3B60A 3ZTYA 4EG5A 3QYPA 6GPBA 5KSYA 4RBNA 2DHCA 1FOEB 1GT6A 2R87A 2W6ID 3VR5A 2QRVA 1TJ4A 5E6UB 1HR0B 2J0SA 5HF6A 1TU0A 1KVRA 4R84A 3SZMA 3ZPXA 1QH9A 3N0XA 4M9SA 2IQ5A 2V74B 4AULA 2IDZA 2PUTA 3GJRA 1U8AA 4MVJF 1D6NA 3PK0A 5AKYA 3ORQA 3GV0A 3TINA 3KFVA 3L18A 4KRXA 1XWWA 4D6YA 1JHOA 5GQSA 5EJEA 1JHDA 1PR6A 5EJFA 1H85A 2JLUA 1NBHA 2VPXA 4G26A 4HB0A 4KQ2A 4IH1A 4OHOA 4CKBB 2VVTA 2P9TA 2JCGA 1K7FB 5AI6A 2X6QA 4PYMA 2VNHA 3AW8A 1O4WA 2OBYA 1JQBA 1IY1A 3L7KA 2GRUA 2VPYA 2FV8A 2ZIFA 1A2KC 4WCFC 1KSJA 3V4SA 4F5ZA 1IRXA 1K08A 3IODA 3RVOA 1AM4D 4II2A 3K0BA 5KZMB 2GAAA 3RVKA 4X97A 1CZRA 3NHRA 1PEAA 5BR8B 3OG9A 3BSSA 4M86A 2FOXA 2UUPA 4PN3A 2KWIA 3RC9A 5A6VA 2P2DA 4K1LA 3MINB 4GZ5A 3PIIA 1MB2A 1R0CA 4MR9A 3H5OA 4Q1AA 4UPDA 2C5LA 3E5MA 3O8QA 3TZ6A 3ZNOA 2RBKA 3NHWA 3GRVA 5IXSA 3KPYA 1OV6A 4JUCA 3P0FA 3Q9SA 2QYTA 4DLBA 3W5DA 3RFCA 4YI5A 1IPHA 3L8HA 2PIDA 1BROA 1NQVA 1EFHA 2E6KA 2IK8A 3L0BA 1IG0A 2QUBA 1U3CA 1ZXXA 2W2XA 4BO8A 3T0IA 1XPUA 4BJ5A 2QR5A 1SB8A 2B36A 2HH9A 3N7TA 3BC1A 5J4YA 2IF0A 5CIYA 5EJ2A 2QP9X 4ENVA 1KFJB 3DFKA 3BH6A 2VZ8A 5BVGB 1KO7A 4FGUA 1RIIA 2O0LA 3C1UA 4MJ3A 4AZ3A 3Q8LA 1WDMA 4DRZA 2LWIA 1AKTA 2FMUA 2ORED 3FGOA 3DDUA 2FEPA 2AYYA 3I3SR 4FYYA 4BUZA 4W8HA 2G5TA 1DV1A 4FEGA 1IWOA 1ES9A 4YQFA 1ND5A 1BMFA 2A6PA 2HIMA 2QX7A 3CKMA 3WYDA 2ZG6A 3WIVA 3IBTA 1WKBA 2BGNA 4RYDA 4TKVB 3N8KA 5BW4A 2PKEA 5LQUA 2GEJA 1W36C 2Q8QA 3GDFA 3K3PA 3QPDA 4OUKX 4P22A 3LO5A 5B7PA 4PAGA 5E8JA 3K9LA 2BI7A 3AUAA 4EPVA 1CUYA 3QA9A 4W5NA 3IGFA 1GGFA 1GNSA 4CLHA 3DBLA 2ZITA 3IV6A 1FPQA 1AMNA 4LE1A 5FT9A 4GPTA 4NYMR 1XP8A 5A9RA 2PUEA 1TRKA 4ZRDA 3HYRA 2GCNA 1W581 4J0QA 4HQLA 4Z7JA 1D4OA 1TO6A 2VWGA 4D41A 4D79A 5DM70 4X3PA 3SHFA 4MRAA 3AZPA 1DIRA 2DUWA 1W88A 1PG2A 2XRMA 3D6UA 3P9RA 4XI9A 1UMCA 3T9FA 2NO0A 3WC4A 2IJGX 5D84A 4DR2B 4NV3A 4YP0A 1SM4A 2Z98A 4KE9A 5J2TB 4JJ7A 3NJ8A 3KNZA 2G04A 4XZ3A 4CKWA 5KNCA 2GPAA 2YFKA 2IT1A 1XNJA 2Z57A 1CRWG 1CZHA 1R0LA 1MGOA 1QYIA 2GN8A 3VU3A 3VDMA 4JQCA 4NPAA 3HUUA 3G17A 1WZCA 1AT1A 3W5JA 4K86A 4L16A 5K3FB 5KYKA 3H7IA 2BN4A 2HYDA 4H3KB 5IC6A 2X5XA 4PSAA 3RCBA 4J4HA 4CF5A 3IRVA 1NI5A 1P0FA 2B3TA 1MG0A 3EVFA 3SM3A 3UMGA 1CP2A 3RO7A 5EWJB 4YIKA 2HGZA 3AETA 2F2TA 4NULA 4EKNB 4DLYA 1ABEA 1OFUA 1NDUA 5H9WA 5TQ0B 1EUQA 5GWXA 2D0OB 4OP3A 3D4BA 1A5AB 3VH4A 2EJTA 2JHFA 3DL0A 3GW8A 3SNHA 2OO5C 4XE5A 4RVDA 4D5GA 4EAQA 1DS6A 3UK7A 3Q11A 1C14A 1UMKA 4W6QA 5T57A 3F90A 3TQHA 3UGKA 4EYEA 4UTVA 2ZRKA 1EJ6A 4IJKA 4YEDA 2YHIA 4MLZA 3AEKA 4WOBA 2HWKA 1F5SA 1KBOA 4ITRC 1G3MA 1UZUA 5JATA 3UBMA 2AJ8A 1O95A 4CG2A 1RBZA 5EKTA 4D97A 3AIOA 4J4BA 1PX2A 1W30A 4HVTA 5BT8A 3AVYA 1VOTA 4FXOA 2BFCB 2QU7A 2OXTA 1QBGA 1R66A 2NOAA 1HSOA 4TMVA 3KBOA 1XU7A 1Z0KA 3H87A 3WQRA 2YXDA 3LPLA 5BSFA 1U8XX 1WB4A 2V7GA 4G0NA 5E2IA 2BMEA 3P9QA 1I3KA 1TFUA 1QM5A 1N2GA 5GOZA 1NI3A 4FTWA 3A4MA 3CLSD 3NIBA 5KX5B 5HFNA 1V37A 5AJWA 1JB9A 4MEJA 3EISA 4MV6A 4NKRA 2JA2A 3HCAA 1LV8A 3FHCB 5JPIA 3UJ7A 3STUA 3ZV6A 3BHNA 1H8HA 2VCEA 4D8WA 4D57A 4ZA2A 3DZGA 1VHJA 2IPLA 1WMEA 3PUWA 1VMDA 4A0FA 5AP9A 4WFKA 2Y1KA 4RYLA 2OHFA 3DWFA 4PXSA 4V38A 2J3JA 2BBOA 4F46A 5DXJA 3W9UA 3WNQA 1GKLA 4LQ4A 4OH7A 1D4ZA 2WJ3A 1Y6JA 1DT3A 1I14A 2ASVA 4HGYA 4NZMA 5G1OA 4DA7A 5C32A 2IEDA 1Z38A 3JD1A 4UOQA 1XL0A 4DG5A 2AQKA 4EDHA 5JRDS 4TZ0A 3FVWA 3N2LA 2VKQA 1SD5A 2P35A 3FYTA 3VR4A 4OPMA 3WGTA 3DD5A 1RXVA 4L9RA 1C0PA 4OHYA 2G77B 3E61A 4BGEA 4ZN6A 1LBSA 2FG5A 4QFBA 4X1YB 3EQ9A 4HUQB 3TLEA 2NUAA 5JTUA 2A30A 4AJHA 3FWHA 2ZZNA 3UUFA 5KNDD 4BNNA 1G2PA 4ZZ2A 1FVOA 1V26A 4W1RA 4HAWA 3DMYA 3BCUA 2LCQA 3C45A 4H7IA 5AUQA 1DRKA 2EZ4A 2ZJ8A 1SOVA 3SNKA 4D99A 4RTOA 4N41A 3EF3A 3ZLBA 3ZR4B 1Y5LA 1O54A 1EESA 1P1HA 2QVCA 2IXGA 5KOHB 4DB2A 5IYZA 1F9EA 4DY6A 4JJIA 4BV8A 1ZGGA 5JECA 3TE7A 1OWOA 2ECQA 4FYHA 3SIXA 5TPWA 1TYCA 1CRLA 3SQMA 2GKGA 2JIMA 1PNRA 3EVCA 4AICA 3Q7IA 5JDCC 3V80A 2OV8A 2A9PA 3QPVA 1XELA 2I91A 4C4SA 1YQTA 3QXSA 1X1TA 1REQB 3AG6A 1AUVA 1NBME 2PYZA 4PCVA 3UUGA 3MQ4A 4YJGB 3OE4A 4HMPA 3UN1A 5A0FA 1OWPA 3O47A 1GTJ1 4Q6BA 1PL8A 1RLTA 2NIPA 1XHEA 2QD3A 4PS1A 4XPIB 3D64A 4DSUA 4EPWA 3T3OA 3ZGZA 2PO5A 3QVTA 4JODA 3BZBA 3VVBA 4DNPA 4QC2A 1RYFA 3MOIA 3FYUB 2QRNA 1NVVQ 3QLTA 1F6WA 1Q50A 4D9CA 2E4XA 3DR5A 4GPD1 1P45A 1ACJA 2YY5A 4IH4A 1JG2A 4AJ1A 1EINA 2CUTA 2NVBA 3CR7A 3QVVA 3ZJ4A 2ZR0A 1YJ5A 3ESBA 2JATA 3WZLA 4XCXA 5C9ZA 1IOLA 3A9WA 1TYZA 4Y7DA 3RF7A 4HN4B 1O77A 4GP7A 4LRXA 3NCHA 1CJMA 1U02A 3SQLA 1LK7A 3LKDA 5HS4A 2RGRA 3N8IA 1E5DA 4CI0B 3F5DA 1A77A 5JBNA 1UJ5A 4QYIA 3ZWVA 1CQPA 3RYFB 4CIAA 3K4HA 2EGUA 4NZNA 4XOIA 1DV2A 1JLRA 2HQOA 1QG2A 3CG0A 4N0PA 1SU7A 4FD3A 4LQDA 5TGZA 1A9ZA 1L8XA 1F8XA 3OF3A 4QGSA 5GV7A 4MS3A 4GDFA 2HPVA 2VNKA 5EZYF 4R2HA 4CM4A 3UJBA 3VH3A 5EHNA 5JRZA 2IHVA 3CRNA 3OQHA 1ZD9A 1QHHA 2EVWX 4JJZA 1BZYA 1V8OA 3DMFA 1ZVVA 4R1PA 3CR8A 3PFWO 4OOEA 5L3QB 1QRDA 3ZD7A 5FWAA 4WQMA 1Z15A 3CX4A 3K0KA 1M5UA 3F74A 3PUVA 4PGFA 5DSXA 4BNUA 3U16A 1CP3A 3GRCA 4MWCA 4CQNA 5CNKA 2GBPA 1KQ3A 1QUEA 1GAJA 2ZJFA 3DTYA 1QHEA 3MIIA 2YZGA 3NIDB 3O4HA 2VJOA 3PD7A 3HJFA 2GEFA 4ZT5A 4L75A 1NVFA 1QO0D 2GJ8A 3TX2A 1NJ1A 1OX4A 2E4VA 4OL9A 1Z0DA 4Q7LA 3SK0A 1ZSNA 2FCAA 2I7DA 1DINA 1JDNA 1IOVA 3EULA 4RIHA 2HQ1A 4TLAA 5J58A 5JCZA 2ATVA 1E7MA 1F14A 3TX6A 4ND8A 1P7ZA 2NTVA 2WJWA 3GFTA 2JFGA 1FYXA 3MCUA 4G8CA 4BE7B 4ZYUA 3JAKB 5LD2C 3WADA 4H77A 1LX6A 4DXDA 2PFGA 4BMZA 2JGLA 1ZKMA 4JLOA 2CYAA 1N34B 2JHPA 2PN1A 3ROTA 5JWHA 4LFCB 1KH2A 4MAMA 1K3FA 3AJDA 3B89A 5LZ7A 5I3CA 1M75A 3KQKA 1ZMXA 1JYEA 1ORWA 3HKDB 3IE0A 4TSFA 4LZOA 2ZIEA 1OH5A 1EFVB 1D2AA 2REOA 3W34A 3AVWA 2XXBA 3BJEA 1HLFA 2PY6A 5FP0A 2AXEA 2B8WA 4BYMA 2G40A 3KLBA 1S3IA 2AEMA 2P7IA 1G3RA 2WU3A 1IAVA 1L3IA 4IDEA 3TL3A 1Z7EA 4YFYA 5L40A 2H1IA 4MQFA 3ZDDA 4AKSA 1VG8A 5JADA 1WHSA 4BVKA 1XN1A 1WW8A 1GTRA 4KH0A 1I4TD 2PQ2A 4ZVTA 5IF3A 2OY0A 4QGFA 4RUKA 3PR2B 1KNQA 3L8FA 3TBHA 4ZXPA 4G5HA 4X63A 2OXRA 1XK6A 1UPAA 4UAVA 1YFKA 5HOEA 1ECJA 2FEXA 3FDZB 2CSXA 4QUEA 1QP4A 3DVRX 3G9UA 1DJMA 1W4ZA 2FQ1A 1JLHA 3GFOA 4YMGA 3DDSA 3HACA 1R15A 3G5LA 3R5XA 4CTKA 1FDSA 3EAGA 2RHDA 2YS7A 4PRYA 4YHBA 3F6PA 4HYQA 1LTKA 1DAGA 2DERA 2QW8A 3ECCA 1SC4A 4PVDA 4WNYA 4KXMA 3CH7A 3QYAA 3NYQA 3NIFB 1WHTA 3O3NB 4DCNA 1MV5A 4JYCA 4AU1A 1I6LA 5AVOA 2DWQA 1OHHD 2E4ZA 1KJZA 1P9RA 1RLOA 1K5PA 1OXKB 1U8CB 2ZYRA 3HEAA 4IDNA 1HYGA 2X9GA 3F6CA 4AB1A 3CW8X 5C1DA 4BLQA 2X0NA 2HRRA 1CUVA 1XJWA 2EBWA 4MO2A 3QVUA 1II8A 4QOFA 4ZCRA 1BHSA 2VP5A 4JLPA 3T99A 1KMMA 2XJ4A 1FJGB 1JQKA 3W90A 3WMRA 3HR4A 2D54A 2NPOA 4KXUA 3ZNNA 4WJLA 1DJOA 3H4TA 4KDEA 3IIEA 4BRUA 4M0FA 1YZ3A 2G83A 2P9CA 5C8XA 6REQA 2ZUFA 1W94A 2PLRA 4P0TA 3P2YA 3PC6A 1GZHB 1SMKA 3G7NA 4CV3A 2VXBA 3QF4B 2YWBA 2X0EA 4BP1A 3KWMA 5EVCA 5DCYA 5AM0A 1MD9A 1UBLS 2QZSA 2XTZA 3H2BA 9ABPA 5JSQA 1W6RA 2OCYC 5CJ2A 3BEOA 3RS8A 3ABRB 4MAFA 1JAIA 1EGMB 1XBTA 3BXOA 3PWSA 1AKNA 2J9GA 1EK1A 3EXG2 4TKLA 5AICA 2BYTA 4JFRA 2WZBA 1SKMA 3PHLA 4TQ9A 4C21A 2NU6B 4KR9A 5AI8A 1T2EA 3AUYA 4XX1A 1XVUA 1KARA 4WJKB 2EP5A 3K1JA 1Z0AA 3F7MA 4IDPA 4UC0A 3QE9Y 5IM4A 1JDTA 2Z95A 1EFAA 1N75A 2ERCA 2QQEA 1NULA 2QXYA 3IMKA 3PYLA 4PWYA 2ZRLA 3P32A 3LLMA 5A62A 2BMVA 4QDUA 1JHMA 1QB8A 4J7AA 1MDFA 4ZHQF 3S7TA 4RHXA 4F2WA 2XQIA 5FTWA 3DXXA 2FWNA 2JFBA 2R6HA 4JT9A 2V7QD 1J25A 3L1UA 3LYAA 4COKA 1YMVA 3ZY2A 1MOQA 3PSAA 4H4EA 4ZTBA 4HFMA 2I2AA 2W37A 3T7EA 4DQDA 2MINA 2YWRA 1YL5A 3T7JA 3TSOA 5AKGA 3H11A 3SKYA 1EXDA 3EQZA 4KACA 1QK5A 2X0JA 4M83A 3GVPA 2Z6UA 2VJAA 1JLSA 2QJOA 3TLKA 3VR0A 2P9GA 3LUBA 1A2OA 3OZTA 4RC9A 4URZR 4UM8B 4IDBA 1G66A 1HZZA 1ONNA 1EDBA 3O8OA 3DEKA 3QLEA 4MAAA 3USZA 1E1QA 3G2HA 3MFYA 5TY0A 2N1MA 1EQAA 1F1JA 4V0SA 3KJNA 2GHQA 2H2IA 1T1IA 3BE6A 1AV7A 2DSNA 4PV7A 2P41A 2J3MA 4G9GA 1I1QB 3DLAA 3IIIA 1VBNA 2OKGA 2A1TR 4IWYA 4JI5B 5JNLA 5NLLA 3W2HA 3I9V6 3DWEX 4XYBA 4F85A 2J67A 1LJ8A 1X92A 1FRQA 1S8NA 4KO1S 3AHCA 2CMKA 2QM8A 4DV6B 4G0WA 2JK0A 4OHRA 1XQ1A 5JNWA 3NRBA 3A7EA 3HS3A 5D86A 2QTFA 1J8QA 1I01A 2G4CA 4M37A 4WK4B 3ZZ0A 3BFXA 2DCUA 2SNIE 5E9JA 821PA 3KZKA 2EZUA 3C3WA 1ZJWA 3NZEA 1B42A