3VV1A

Crystal structure of caenorhabditis elegans galectin lec-6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
141
Chain Sequence
IGISFRNEFFNPQTPVNIPVQGFSNGARLRLVLLPTSADSRFHINLRTPDDIVLHFNARFDEGAVVNNSTSGGGWQSEDRHANPFQQNKIYTLEFVSNGGIISIFVNGAHFADFVERTPSHGVHLIEIEGGVHVHSAHVSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Sugar binding protein
molecule keywords Protein LEC-6
total genus 33
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vv1A00
2A3XA 1HQWA 1LEDA 3VKNA 1W6OB 4YM3A 2H0BA 2R1BA 4K20A 4UW6A 2NMOA 1ENRA 3AP5A 1SLTA 1EPWA 1QOOA 3UJOA 1S0CA 2EAKA 3BTAA 2DWRA 1WW4A 1KDKA 2ZMLA 3AK0A 2UWAA 5FREA 3IPVA 4RL7A 3RSJA 2D6LX 4XJZA 1N1SA 1QMJA 3KM5A 3LSEA 1DLLA 2G4IA 1RITA 5E8AA 1W6PB 1JXNA 2R49A 1KJLA 2ZGQA 2AENA 4HL0A 1WLDA 2ZGKA 1JHNA 1OFSA 4LBNA 3INAA 1IS4A 3WHUA 1SCRA 2A70A 1ENSA 1AX1A 3DGTA 1OQ1A 2ZHKA 2GNBA 4LBMA 1JBCA 2E53A 5GJ6A 4P9WA 3WG2A 2ZMKA 4ISRA 1PZ7A 2WJSA 1W6OA 4GWNA 3VUOA 3WG4A 3FFZA 1Q8QA 2DVDA 1W0OA 3NV3A 3APBA 1SBEA 3NV1A 4XJWA 5CA6A 4FPEA 3M3OA 3JUUA 4SLIA 1IKQA 2GN3A 1N47A 2R1DA 1F5FA 1GSLA 2YZ4A 4UW5A 3VKFC 5T55A 1BJQA 1Q56A 1YXWA 3ILNA 4YGBA 4AVVA 2AR6A 2Q5TA 4XJUA 5JOXA 2NM1A 5GLTA 2UURA 4Q1RA 4Q26A 4R9DA 4FP3A 1N3OA 4XTMA 4YG6A 4KBBA 1ULCA 4FPKA 1LHNA 4FOYA 5GZCA 4CZSA 4Y20B 3MEPA 4FPJA 1GZCA 2A6ZA 1Z0HA 2W52A 5H9SA 2GALA 1VALA 2D3RA 3MW2A 5T52A 4YFZA 4GKYA 1LTEA 1V6JA 3VKOA 4PBOA 3IKWA 5F9TA 3SNMA 3N7KA 1YRZA 1UPSA 1PZ9A 1AXZA 2EALA 1WLCA 4M01A 4HANA 4PQ9A 4XBQA 3O0VA 2ARXA 2GDFA 1VIWB 3A4UA 4Q27A 2ERFA 4AVSA 1JUIA 3OBRA 4D69A 1AXYA 2A75A 5T5JA 2D6KA 3PVNA 3WV6A 2XB6C 5GLVA 2NZ9A 3ZVXA 1LOAA 4Y26A 1C57A 2VW0A 4I30A 4LBJA 2W08A 4P14A 3WOGA 1IS3A 1RIRA 1MS5A 1QF3A 2ZHLA 1S0DA 4P9XA 1S0JA 2D3PA 4DPNA 1G9CA 1MS1A 4PF5A 1O4ZA 2DV9A 1MS3A 1N1TA 5DUXA 3WUDA 1X50A 5JMCA 1FNYA 1QOSA 1W6MB 4FP2A 1AX2A 4YW3A 1G9BA 4C1XA 1URXA 2ENRA 5CB7A 4YZ2A 3WUCA 4BMEA 4NO4A 1CN1A 3WNXA 1LHVA 2AYHA 1F31A 1MVQA 3N36A 1DHKB 1JN2P 3OGGA 2P3JA 1H9PA 1Q8OA 2ZGSA 3M3CA 1MZ5A 3NWKA 1S1AA 1GLHA 1SLBA 3T2TA 1BZWA 2PHUA 3IPVB 4WZFA 5IK5A 4GWMA 1HDKA 1ULFA 1W6QB 2DUOA 3AP6A 1A8DA 2ZGRA 4XXPA 2ES3A 1IKPA 1LENA 2HYKA 4CTEA 1LJ7A 3AX4A 5IK4A 5GZDA 3MW4A 4LBKA 2DYCA 1CPNA 4YW5A 1N1YA 2ZMNA 5E88A 1AX0A 1WBLA 3UJQA 4MYEA 1DBNA 1MR5A 2E7QA 4PCRA 5DUUA 1AF9A 1LESA 1V6KA 4M3CE 5FRAA 3TAYA 3HMYA 3LSDA 1ENQA 3A0KA 2ZGPA 4AWDA 5EYXA 1N3PA 5KXBA 2RHPA 2ZBJA 1GICA 1UMZA 4UW4A 5GZFA 4XHBA 2VH9A 1LOEA 4JC1A 5F5QA 1LULA 2ZZJA 2TEPA 2YY1A 1F9KA 1DQ0A 3FLTA 3IN9A 4FPFA 3AZVA 1W6QA 5GLZA 5IUQA 2P2KA 3OYWB 1LU2A 4Y22B 3FLRA 4Y1UA 2D3SA 4YGDA 3GNEA 1WBFA 1Q8PA 1CESA 3ASIA 4YW2A 4FQ4A 1DQ5A 5IK8A 1LHWA 3VKLA 1JYIA 3GALA 3OPZA 1H30A 1DQ2A 1PZ8A 5T5LA 3I8TA 1JYCA 2DUQA 1Q8VA 4LBOA 4BM8A 2GNTA 2V5YA 3N35A 1O4YA 2CNAA 3OBTA 2WLQA 5CAZA 4XJ9A 3B9CA 5H9PA 1UZYA 4FOQA 5GLUA 1I1EA 2ZGUA 5CNAA 4XYXA 2OW4A 4XBLA 1CONA 2W39A 3M3QA 3QCWA 2EF6A 4XILA 4Q8KA 2PHRA 1SBDA 3O12A 5JVVA 5GLWA 4YZ1A 3ILRA 1JW6A 4YZ5A 3B00A 1G9FA 4JCKA 4DRVA 2I2SA 5H9RA 4BQ1A 1MACA 4Z8BA 1R1ZA 1BXHA 1AJKA 1W6NB 1WD3A 2P3IA 4GA9A 3W58A 3ZXJA 5AVAA 3V0BA 2VW2A 3AYAA 4FPLA 1AJOA 1AXKA 1DFQA 2E7TA 4TZDA 2WT2A 2WT1A 2GMMA 2A6WA 4XDQA 4AGRA 2YXSA 1QU0A 4ZXKA 2PHWA 4XJAA 3ZSMA 2AREA 1MZ6A 1LODA 2NYYA 2DU1A 2JE7A 4BOWA 3RRDA 1H9WA 5DUVA 3WCRA 1LCLA 1LOFC 2JKBA 1FV3A 2BQPA 1MS9A 2A5ZA 4FPGA 5DZGA 2PHXA 1DQ1A 4XIOA 2WSVA 4YGEA 3A0NA 3ATGA 4AGGA 4BLJA 1IS5A 4XXAA 2YMZA 1LECA 3WLUA 5DG2A 2EXJA 3AXEA 2LALA 1SACA 5HCAA 4YFWA 1SLCA 4CRQA 3WDUA 3N7JA 1W6NA 3O0XA 4K1YA 3WVJA 3NV2A 1JOJA 4GALA 1BKZA 3V64A 1QKQA 1VLNA 2EIGA 3PVEA 4ATEA 3ZXKA 1CIWA 1NLSA 2ZGMA 1QDOA 4H55A 4WVVA 4YM1A 4DS0A 3JU9A 2JJ6A 2DVBA 2AUYA 2D43A 1UAIA 2VY0A 4M3CA 4R9AA 1KITA 2CWSA 1V6MA 3AYCA 1SCSA 3AZWA 4YM2A 3PJQA 1A3KA 3RG0A 4R9BA 4TYSA 5T5PA 1V6NA 2UU8A 1UZZA 1MS4A 3I4IA 3WZ1A 3SISA 4BLIA 1LOFA 4FVVA 3QLQA 4XMAA 2GMPA 4FPHA 1S0BA 2D6NA 4BPZA 2A6YA 2NMNA 1S0EA 2V73A 4JRAA 2DVFA 3FBYA 4LBQD 2WSUA 1UN1A 1CVNA 4XJ8A 4Y1VA 1DZQA 4ISQA 5IK7A 4Q8LA 1CJPA 4Y1ZA 3RMXA 2E51A 5EXOA 3OYWA 3B69A 4Y22A 2YROA 3AZXA 3WG1A 4W65A 1SBFA 3AXDA 3L2YA 3O0WA 2A6XA 3M1HA 1WD4A 3R05A 5L73A 4XBNA 3V0BB 1QDCA 3ILFA 1GZ9A 4F83A 2WQZC 4BMBA 1HKDA 2YV8A 3WDWA 5JOZA 5KXEA 1D2SA 3WDYA 3D6EA 1MS8A 1MS0A 1RINA 2FMDA 3AZZA 3AZYA 5HCFA 2CTVA 4AVTA 1LHOA 3WHTA 1DIWA 1AZDA 4XMIA 3SLIA 4ITCA 2ZHMA 1FNZA 2R0FA 4FOWA 1WW7A 4FQZA 3D4KA 1FX5A 1V6IA 2OVUA 3IMNA 4YGCA 3AP7A 1YIFA 5DUWA 1GNZA 3DUIA 4AGVA 2D6MA 4YG0A 5HCBA 5CBLA 3UK9A 2WNEA 1HLCA 1C1FA 1ONAA 1UKGA 1WUVA 1LOCA 3ENRA 3KQRA 2WT0A 5LK5A 3SITA 5KXCA 3U4XA 1G9AA 4XE9A 3N3HA 2DVGA 1CQ9A 3WDTA 1B09A 3AJZA 3W59A 3BODA 4Y20A 1KRIA 2VXRA 1APNA 1SLLA 2P34A 5GZGA 2A3WA 2C5DA 5DZFA 4Q2FA 4LBQB 1WW6A 2ZGTA 4M3CB 2KM2A 1Z78A 1GANA 1ULDA 2EXIA 3FUQA 3BIWE 5JOYA 2VU9A 4DRRA 1UL9A 4AYUA 1GBGA 3POWA 2AGSA 1CR7A 3POYA 3OJBA 5E89A 1ULGA 2GNDA 2JDZA 1FV2A 2AH2A 2VUAA 1U0AA 2GNMA 2OUHA 4K21A 4YW4A 3WDVA 1QNWA 1LGCA 1QGLA 2W68A 2DUPA 5GALA 2DURA 1YO8A 1GZWB 4XHXA 5JLVA 3PMEA 1W0PA 2ZAAA 3UL2A 3SH4A 1FATA 1HQLA 1LHUA 2JD4A 5GM0A 3MPPG 5T50A 2D7FA 1VAVA 3AJYA 3CNAA 2VW1A 3VKMA 1UX6A 3AP4A 4M3CF 3ZXFA 3O5SA 4LBQA 1GNHA 1GKBA 1DYKA 1FYUA 4DQAA 1A78A 1V6OA 5BYNA 4GXLA 2JECA 1DYPA 1N3QA 3V0AB 2R0HA 1NXD1 2XG3A 4L8QA 3C2UA 3B3QE 5IT6A 5DG1A 5GZEA 1Y7BA 1N1VA 4XTPA 1QNYA 2ZKNA 3B01A 1D0HA 1YI7A 3USUA 2C9AA 1DGLA 3LCPA 3FLPA 3WG3A 1GZWA 3RS6A 2D6OX 1CPMA 1LOGA 3AYDA 4YLZA 1FAYA 3RMYA 1AVBA 2ZGNA 2E6VA 1SLIA 3R4SA 4R9CA 5JDBA 2ZA9A 3T1MA 1LU1A 1TEIA 1C4RA 4YW1A 2A7AA 4P9YA 1IS6A 5EYYA 3M3EA 4LBLA 2EXKA 4FPYA 1YYNA 4ATFA 1ZA4A 1S0IA 2GN7A 2WKKA 2PHTA 4UW3A 3ZSKA 3V0AA 1DQ4A 4Y1XA 1LEMA 1ZM1A 1J1TA 2SBAA 2CY6A 5T54A 5JOWA 3ZYRA 4XOGA 3TB0A 1G7YA 3MW3A 2CL2A 2PELA 4XZPA 1LOBA 2UWCA 1Q8SA 1G86A 2ZABA 2ZACA 2B7YA 2D6PA 3AYEA 3ZXLA 4YG3A 3SH5A 2ZGLA 3HN1A 1IOAA 3R4UA 2P3KA 4IQPA 2R16A 2A3YA 2ARBA 3RQ0A 4XIKA 4FPOB 2A6VA 1LGBA 3BOPA 3ZXEA 4Q1PA 2DU0A 4NOTA 2SLIA 5SV8A 3HR9A 4FPCA 1KDMA 1W6PA 3AP9A 4RA0A 5DXDA 4YZ4A 2A71A 1BQPA 1V00A 1XQNA 2EXHA 2UWBA 3WCSA 2GMEA 2NP0A 2PHFA 4FOVA 4C1WA 4YZ3A 4OZXA 2DVAA 1SLAA 4Y1YA 1VAMA 1WCSA 1G8WA 2D44A 2JE9A 2Z42A 1S0GA 5T5OA 4M00A 3OY8B 4U2AA 3AFKA 3H0OA 4PBPA 1MVEA 2P37A 1WW5A 3IM0A 1G9DA 1GV9A 1I3HA 3ZPYA 5DZEA 3SH3A 3ZYPA 5H9QA 2ZHNA 3WDXA 2ZGOA 1KJRA 1C1LA 2DTWA 4U36A 3D5OA 3ZSLA 1S0FA 4DFSA 4GKXA 1BYHA 4Y24A 3N7MA 1DQ6A 1SFYA 2CWMA 3NV4A 4YM0A 3T1LA 3USUB 2LTNA 4ZKTB 2OUJA 4ASMB 3POSA 3PVOA 2DTYA 5KXDA 4K1ZA 3FUOA 3N7LA 3ZSJA 2CYFA 1QOTA 3M2MA 1LGNA 2FHRA 2NN8A 1GYKA 5EWSA 1OKQA 3V65A 1KQRA 4WV8A 3VV1A 1V6LA 3Q9OA 1WLWA 4WVWA 1ULEA 1W6MA 3OY8A
chains in the Genus database with same CATH superfamily
4RS5B 1HQWA 1LEDA 2VZOA 3MUZ1 4UFIA 4EN0A 2W1SA 2VBPA 1OLMA 2R1BA 2WC2A 4N9HA 1ENRA 4K40A 1EPWA 5LRSA 1S0CA 1YHFA 4ZZ8A 3KSCA 1MQTA 1ND2A 3CL1A 4EE2A 2CSGA 2GC1A 2BU9A 5AC93 3RJRA 4ASKA 3I2JA 4AEKA 3AK0A 1RUC1 5BNPB 1EYBA 1UQXA 5IVVA 1CAXA 3NW4A 4RL7A 3RSJA 5LEKA 2D6LX 3R6SA 5JAXA 3GYDA 3KM5A 1DLLA 2G4IA 4XFGA 5E16A 3TWIA 1AR91 1S2KA 2ZEWA 2Y6LA 1RITA 4CDUA 4FFGA 1ND3B 3NNLA 1BCXA 2IUWA 2ZGQA 5C9AC 5IVBA 3VDBA 3O1OA 2WZR1 4LXLA 4J1WA 2PMWB 4NE9A 4QXCA 4DXZA 2D5FA 5ANQA 1JBCA 4N43C 1TQ5A 3K3OA 5FZ3A 3N9OA 4JX0A 1SDWA 5D2AA 2RG4A 4Y33A 4JGZA 3VBFB 1VBC2 3VHRA 2DVDA 1AR63 2WQ8A 4LO7A 2XUEA 2ZEXA 3APBA 5FIXA 3ZFGB 1SBEA 4Q29A 4ZONA 3TN93 4Z1VA 5F37A 3PJYA 1B35C 2GN3A 4UW5A 1GFF2 3BALA 1POQA 1Q56A 5T55A 1NLRA 2Q5TA 2YGMA 4LUMA 4NAOA 4Q0QA 1RUNA 2NM1A 4NVPA 4UXAA 4L2NA 1WMEA 4Q1RA 4R9DA 4N43B 2VQUA 4XTMA 1W8FA 2O1QA 2WWJA 2OZJA 3FC0A 1ULCA 4KBBA 4EQVA 2FDFA 4XPVA 2C1FA 2PAMA 1ENXA 3J7HA 4A4AA 4CZSA 2RS33 1GZCA 3RGBA 4KGGA 1Z0HA 2W52A 2D3RA 2OYZA 2B46X 1F8VA 4RHV2 1UF2C 4CEWB 1RUJ2 3IT8A 1XRUA 2YYOA 3JZVA 3UKNA 3ZOIA 4Y3OA 4AI2A 3VZMA 1V6JA 4BISA 2XLGA 5EIYB 2B5HA 5HXMA 5C3RA 1PZ9A 1AXZA 4M01A 5KBFA 3THTA 5A1AA 1F35A 1GOHA 2QTWB 3JBG1 4AVAA 1VIWB 1C8NA 3WSOA 5A3MA 1GQPA 1UMIA 5CB7A 2WYSA 4XFIA 2CDPA 5DAXA 1FI2A 1OF4A 1AXYA 4YNIA 2PAKA 3IWZA 3TEYA 3KV4A 5GLVA 1W8ZA 2W1QA 1RMU2 1C57A 2VW0A 1RHI2 4LBJA 4Q4V2 3VBUB 1JYXA 3KCXA 3ECQA 3QOPA 4NIDA 2KA3A 3DECA 3I97A 1S0DA 3NL1A 4P9XA 5FYHA 3WF3A 1G9CA 1O4ZA 3B93A 1H8TC 1RJ7A 5A7QA 4NIHA 2VVFA 1JS9A 4QKBA 4CU8A 5C3OA 1J3QA 1JZ3A 3KGZA 2XBO1 1GR3A 5JI9A 3WW1A 4D3WA 1R64A 5C4WC 1W6MB 2YC4A 2Z4FA 1RHI3 4C1XA 1G9BA 2VNOA 4OULA 4LE4A 1VR3A 1R1A1 3OUJA 4MV2A 4IE0A 5FLHA 3I2OA 4NO4A 2R7EB 3RZHA 3OG2A 1F31A 4DO0A 5AC92 2P3JA 1NE4A 2WO7A 1GLHA 3ZN4A 4BA6A 5C3SA 1NZCA 4GWMA 1J3RA 3G6JB 1UYPA 4BIFA 1W6QB 1PM7A 1A8DA 2ZGRA 3MV11 2JDAA 4WM7B 4RQPA 2XLAA 1G6NA 1H1IA 1W9FA 1EV11 2VM9A 5LZ6A 4QWNA 1CPNA 1F4HA 4CCKA 2ZMNA 3POEA 4Y4RA 3CLPA 4JQRA 1AR61 2YBSA 1NQJA 2HWC2 4PDWC 3ZLIA 2BJSA 1MR5A 3OGRA 4R8HA 5JSRA 2QQOA 5DUUA 1AF9A 2JXAA 5FRAA 2J1TA 3HVDA 4BK5A 1OOPB 2BOJA 4XF3A 3HMYA 2IXKA 3A0KA 3N9NA 3ACGA 2RHPA 1UMZA 5GZFA 2IVJA 5IVCA 2G1MA 2ZZJA 3EYPA 3K4DA 3VDAA 4FPFA 4QGMA 4PJYA 2W2IA 3OYWB 4XUOA 3AMNA 4W6YA 5FZ4A 2XUMA 4FQ4A 4L11A 3VKLA 1JI6A 4H14A 4BQ2A 3VBSA 4QQHA 1PZ8A 3Q8EA 2Z5WA 2DUQA 5D8AA 2BGOA 5A6ZA 2CU5A 3ETPA 4AXOA 3AVSA 2RJKA 3JBG3 1OBNA 4QGLA 3UGFA 1IG3A 4XCAA 4E8CA 1U5XA 5IVFA 1QJY1 3OBTA 4OYUA 4XJ9A 3R4DB 3AKQA 4JGYB 1JUHA 4IE4A 2ZX3A 1YWKA 2HEWF 5CNAA 2VO5A 1UOBA 2W39A 1ZBE3 1AR71 5FP9A 4NHXA 2EVXA 4KMQA 5JVVA 5GLWA 4MO3M 2G19A 2X5IB 2J1UA 3B00A 5FPAA 4YZ5A 1G9FA 3MIHA 4Z92B 3H8UA 3WP5A 4DRVA 5CG9A 2BEOA 3KHBA 4Z8BA 2P3IA 4QPGC 3W58A 5BNNC 5HCHA 2F4LA 1AXKA 2C24A 2WT1A 3AMPA 1W05A 3NNMA 1OI6A 4ORFA 4Q4Y2 3W21A 2JB4A 1MZ6A 1LODA 4NHLA 1W99A 1ZBA1 4HKWA 1OQEA 1UY0A 3ZYFA 1IZ3A 4PLMA 1OOPA 3E97A 3RRDA 4GWJA 4AFCA 4BOWA 3MHZA 2RS11 4D7SA 3WCRA 1OLRA 2OKXA 5LRRA 2JKBA 1FV3A 4FPGA 1MS9A 4JZRA 4QB6A 1P8JA 4QPIC 5DZGA 4CEYB 1VRBA 4GH4C 4P08A 3HQRA 3ATGA 5I0SA 4GB33 1IS5A 1W2NA 1AL22 3WLUA 1CZTA 2LALA 4YFWA 5CFCA 1FOD2 3WVJA 2CHHA 1SPPB 3NV2A 1JOJA 4GALA 4X6RB 4XFBA 1QKQA 1VLNA 3V64A 4AI9A 1JZ2A 1BMV2 2W91A 3IDAA 5KWRA 3NJYA 2BPA2 1VBE3 1TME3 3CZJA 3CHXA 2HWF2 1OFNA 1W39A 3CJIC 3JU9A 5CYYA 2AUYA 2P1BA 1UAIA 2VY0A 4M3CA 4R9AA 1W8OA 3VBRB 4YYOA 5L9VA 4IETA 3AZWA 2XOMA 3RG0A 3UT0A 1A3KA 2HBUA 5FV3A 3L2HA 2UU8A 1UZZA 1MS4A 3I4IA 3SISA 4AI3A 4KWKA 4JV4A 4LO8A 3P3NA 4N53A 1VB2A 1RUE2 2ORXA 1NG0A 3BTYA 4BPZA 5DABA 2WNUB 1K45A 2V73A 3FBYA 2ADDA 2WSUA 4LBQD 1UN1A 1CVNA 3UETA 1WGPA 4QX2A 4Y1VA 5IK7A 2JD9A 1XU1A 2VCBA 5LWBA 5J1XA 3AXDA 5F3IA 3SCHA 2A6XA 3LF7A 3T3YA 2QFEA 5I0DA 1XOYA 3HD8B 4RGGA 4IE7A 4EWAA 4DOUA 2BV4A 1OF3A 1UKRA 5B4XA 2PQQA 1JZ7A 4FTSA 4P5HA 3LGRA 4QQ2A 4DUVA 3NMBA 3WDWA 2ET1A 1J84A 5F5CA 1W8HA 1MS8A 2ZKLA 3WF1A 2FMDA 1AR73 2QQWA 2D93A 3AZYA 1UY2A 3EXUA 3GM8A 4AHZA 4AVTA 4LITA 1DIWA 5FFOC 1Z7S3 2IXJA 2XJSA 4YWAA 1V6IA 4KG0A 2JDHA 1NCQB 4HSLA 4MUVA 5F8PA 3DUIA 4D6SA 3RI9A 2D6MA 1CAUB 5KR7A 3UK9A 3VBHB 4LEJA 5B4NA 3BPZA 5C4WA 1UKGA 4NN0A 1LOCA 3ENRA 3KQRA 3SITA 4AG4A 4JDMA 4QPWA 2GZWA 2DVGA 2RS31 1RUG3 3W59A 3LFMA 3QBQA 1KRIA 1QHDA 2Q8OA 1RUI3 1D2QA 1COV1 2VXRA 2XJUA 3PURA 4MGYE 1QJEA 4NPRA 2HBTA 1VBB2 3Q8AA 1XNAA 4Q4V1 4LBQB 4OFGA 1Z78A 1GANA 2XL7A 1ULDA 4ZPIA 3FUQA 1OD5A 3BIWE 4JKMA 3RFRA 3UV9A 2XJPA 2WBKA 2E32A 4QHBA 3O1TA 3CBNA 2C4XA 1DZRA 3NAPA 1POV3 1UL9A 3C7HA 4RR3B 5T3NA 4FXGB 2ORZA 4KWJA 4EWEA 1FT9A 1IQDC 4B29A 1GU3A 4GZ9A 3K2OA 4K21A 3ZYGA 1QNWA 1NY72 4MLOA 1NE6A 1EUUA 4LT5A 2RR11 4BK4A 1GZWB 2WNVB 5IAVA 4DB5A 3PMEA 3MBWA 4DIQA 5JWPA 3SH4A 4O9GA 3WF4A 2JD4A 1STMA 5T50A 4DNYA 1XU2A 4N8MA 3AP4A 4M3CF 4CDQC 1OA4A 3DPRC 5FDBA 3BU7A 3LIGA 5A3LA 1V9U1 2QUOA 3O5SA 1EAH2 2YFZA 3O1RA 4O7XA 4NR1A 1DYKA 4R4XA 3OUIA 1W2TA 4FXKB 4GXLA 5E1RA 4NIAA 1CZSA 3URFA 2JECA 3VZJA 1QY4A 3WNMA 3MV01 5KC5A 1NXD1 2WO1A 3TEXA 1QJU1 3W20A 3ME2A 1BVVA 5FZMA 2W47A 1EV12 4E2GA 3KV5A 3B3QE 2DCZA 1PO23 2RDNA 5GZEA 3ZSEA 1HJFA 4HG6B 5A70A 1PO13 1JZ6A 1CIYA 4LE3A 1NT0A 3WEZA 5J3UA 4IL7A 4BQ3A 4IEYA 3VBHA 1W0NA 3OGSA 4Z82A 4RD7A 5FMOL 3WQ0A 3N9LA 3NSTA 4GMP3 1CPMA 4DXRA 5HV0A 3MO4A 3TN92 5L7OA 4TN7A 1EV13 5JDBA 1RUD2 2ZA9A 4D0QA 4MZUA 1LU1A 1O3SA 3FZ3A 1IS6A 1C5IA 1X36A 3RYPA 1W2UA 1ZA4A 1XE8A 4UW3A 2PHTA 2HWB2 2B9UA 2HWE2 3V0AA 1DQ4A 4AEDC 5FWEA 1LEMA 1ZM1A 1J1TA 2RV9A 4COUA 4QPIB 2IZWA 2WO2A 4XOGA 4WVZA 4MGIE 1OT5A 2RMU3 4CP1A 4H3WA 1W90A 2BVVA 1WMXA 2ZACA 2D40A 1IOAA 1T6BX 1CAWB 2P3KA 4IQPA 2ARBA 3VBHC 2X5IA 3K46A 1RUG1 4NAMA 1J1LA 1NCQC 1NA1C 3POIA 3ZPOA 4A7ZA 4HVQA 3I2KA 2DU0A 4LORA 1NQDA 3HR9A 1W6PA 1E57A 2A71A 1V00A 2EXHA 4WM8B 2UWBA 4HOOA 5FYBA 5FTTC 3RPQA 3AL6A 4C1WA 2VCMA 5C9AB 4AL9A 3PIGA 2DVAA 3OF1A 3PUQA 2OT7A 4AE2A 1R092 5EV7A 5A7PA 4Y1YA 2XPJA 4HZFA 2LRPA 1OD3A 1VAMA 1WCSA 3ORJA 2EIDA 3H50A 1ALYA 4WVMB 1HN0A 4M00A 3ZIWA 1M4WA 2K9ZA 1UY3A 1MVEA 2P37A 2NQYA 5EP9A 4L97A 1ODNA 3E6CC 3MFCA 1I3HA 3ZPYA 2WN2A 1QJX1 1WWYA 2BBAA 3NNGA 1H8VA 1S0FA 3T08A 3ZSLA 4DFSA 1JYVA 2XWJB 2EIBA 4YM0A 1VBC1 1ZBE2 2P6HA 4UBGA 4LNVA 1W9WA 2HYXA 2LM3A 2OUJA 2LW8A 2YBPA 3K51A 4UF0A 2WABA 3UGGA 1US2A 4CU6A 1F15A 4K1ZA 2MNGA 1ZA7A 1YQ6A 2QQUA 1VBD2 2Q1ZB 2BBVA 4Q0SA 3BUCA 2VMHA 2VOVA 1LGNA 2Y6JA 5FLJA 1AR62 1GYKA 4IEOA 5FPVA 5CFCC 1F4AA 1HRV1 4HBNA 2RJ2A 4H2AA 2R071 5JI7A 3RJ2X 3ZR6A 1I9RA 1W6MA 4JDOA 5I93A 4BU2A 3OY8A 1HB1A 2XR4A 1PO21 2C0ZA 5FLIA 4EN9B 1DGWX 2Y33A 5I8YA 2W3JA 3KQ4B 4UW6A 3AP5A 3LA2A 1QOOA 5LA9A 2EAKA 5JIAA 3JD73 1LAJA 2EIEA 4JQTA 3AKRA 1WW4A 3BVCA 4XQWA 2WZR3 4MXWB 3KWVA 3IPVA 4MH0E 1UMHA 1DGWA 1N1SA 3KVAA 2Y6KA 3W5NA 2XJQA 1HRI3 1YFYA 5FZOB 1XE7A 1WCQA 1AYN1 4Q4W2 4N43A 3IBMA 5E8AA 1UNBA 2VMEA 3OCPA 3I49A 4BCUA 4COZA 4HL0A 2ZGKA 1GQGA 1HB3A 1IS4A 4YVWA 1AX1A 1ENSA 1VBE1 5FZDA 3N4MA 2GNBA 3OBZA 4A7KA 1H4HA 3SKVA 4LBMA 3O7OA 2E53A 1YFWA 2VOTA 3T0BA 5GJ6A 4P9WA 4AOCA 3C8XA 4ISRA 4Y5Z0 1PZ7A 2WJSA 3KHCA 1I6XA 4GWNA 3VUOA 1SHWB 1UXZA 5FJHA 4K3UA 1W0OA 3NV3A 2OX0A 5CA6A 1JYWA 4FPEA 1J58A 3P6BA 3E5XA 3SMHA 3VKFC 3IDEA 1F5FA 2YZ4A 3ACLA 2B42B 2FBEA 4P00B 1BJQA 5JZGB 2D98A 3C7OA 4EWDA 4XJUA 2WZPP 5JOXA 3ZN5A 4UF0B 5I8SA 4FP3A 4XAEA 4NWWA 3OTFA 4YRDA 4FPKA 3BCWA 1LHNA 4FOYA 1UIKA 1W2AX 4MG2A 1VMFA 4Y20B 3MF9A 3FMGA 3H8OA 2TBVA 1K5JA 1EY2A 2VULA 4F3JA 3D0JA 1H8TA 3U14A 4XVHA 4GKYA 3S5QA 3SEPA 5IYYA 3I3BA 2JDYA 1HXS3 4LKSA 1YRZA 3RWNA 4UFMA 1BHGA 4E4SA 4URAA 2RS12 2PN5A 2EALA 3GBWA 4HANA 4BJ0A 4XBQA 3O0VA 2ARXA 5BNQA 3QH6A 2L9LA 1C8M1 4E9KA 2WNVC 4XFHA 2ERFA 1JUIA 3OBRA 3LKJA 4D69A 4R52A 5T5JA 2D6KA 1ASJ3 4QDSA 2YC0A 4R4ZA 1LNSA 2O8QA 3KLSA 2QJVA 4AFDA 3O1SA 2WZR2 2HEYF 3AL5A 4I30A 2DFCA 2W08A 3OEBA 4MOAA 4DUXA 1M06G 3FHIB 2W0XA 1RUJ1 1MS5A 3PIJA 5LB6A 2ZHLA 4FO9A 3VBOC 4CP0A 4XACA 4AHXA 3MLLA 1I5ZA 3GCXA 1SFPA 1RUI1 2JDKA 4PF5A 4UAPA 3LOIA 1H1AA 4YVWB 5J09A 1MS3A 1UYYA 4LHNA 1BK0A 1X50A 1TVGA 5A6YA 4B4RA 4LR4A 4YW7A 4FP2A 3CDZB 2FDHA 1AR82 1URXA 1VMHA 1Y9QA 5F2SA 5FMDA 3X29B 3FWEA 3GDBA 1W8WA 1X33A 4YZ2A 4D6RA 4HXCA 1US3A 1HV0A 3VBUC 5KHGA 1RHI1 3LDBA 4IESA 3WX5A 3ZIXA 2V4AA 1LHVA 1WKYA 5EZWA 4YVSB 1SQ4A 1CZVA 1D4M3 3GCWA 1BBT3 2VUCA 1MZ5A 2ZGSA 1S1AA 3PUIA 3WP6A 4QKNA 1BZWA 2O8OA 2Y38A 4WZFA 3WINE 4CPBD 1DF0A 4HONA 2ZX4A 1RYYA 2W95A 3K48A 1ULFA 3UESA 2K2SA 4C8DA 2DUOA 4IEPA 5K4LA 4OQ9A 4BQYA 4CDUB 1LENA 2HYKA 3TYJA 4P5YA 4AVCA 1LJ7A 4UFHA 2D97A 2ZEYA 3AX4A 1L7RA 1UPIA 3CJIB 4IGOA 5LBEA 4BH9A 3MW4A 4WM8C 4XUPA 4E2SA 4O61A 4QX3A 3RZKA 1H4GA 3MIEA 3JBG2 4YW5A 3EB7A 5E88A 3T2PA 1TMF2 1FMD2 4GD4A 1D4VB 1PIV3 1WBLA 3UJQA 5AC91 3PTYA 3H8RA 4MYEA 1DBNA 5J7MA 1VMJA 1HB4A 2QBXA 3LEKA 5C71A 1UY1A 1LESA 4JGZB 5HPOA 4QU1A 3ZFGA 4NHMA 5HBAA 1ENQA 2ZGPA 1DU3D 1JODA 5EYXA 1QJY2 4KU7A 4XHBA 4COWA 1LOEA 1UZ0A 5F5QA 1LULA 2MEV3 3ST7A 4MHRA 2TEPA 5F39A 1DQ0A 3AZVA 2E33A 1U5ZA 2P2KA 4Y22B 2VZQA 2D3SA 4B1MA 3GNEA 1PMIA 4YW2A 3UYJA 1CESA 1AYM1 1DQ5A 2AACA 2R30A 1JYIA 2V4VA 3OPZA 1ZREA 2HWC1 4V2WA 4QMAA 4CDWA 4HK8A 3I8TA 1JYCA 5A3UA 5CKQA 2VNGA 4LBOA 4TSVA 2GNTA 5FQ0B 2AEYA 3N35A 2EICA 2WWUA 2VC9A 4X8PA 1DGRN 3HQUA 3OD0A 1W28A 3JQXA 5CAZA 2NPIA 4BQ5A 3U1XA 4CCOA 4YARA 4FOQA 1AL0G 3A21A 1JZ8A 1I1EA 3B9IA 1GP6A 3H7JA 1YI9A 5F1RA 3M3QA 4LUKA 3O1VA 1NCQA 2WA3A 4AFMA 4LIUA 1ZBA2 2LROA 3ZKYA 1Q43A 2P6CA 2Q1FA 4CEYC 2WFF2 5FYVA 5IJRA 2YPDA 5DAPA 2ZAHA 3VDDA 5G04L 1RTVA 4Q5OA 3NJZA 3GJBA 5A1LA 3BU0A 1R1ZA 1IQAA 1W6NB 1WD3A 2RS51 2UYAA 1WMDA 1UXXX 4ONUA 4D94A 3V0BA 3LFIA 3AYAA 4QX0A 1AJOA 2HWF3 3HJRA 4KL1A 4TZDA 4A44A 3POBA 3THPA 4XFFA 3DL3A 4AGRA 2YXSA 4ZXKA 2Q8DA 4CP9B 3LPGA 1BVP1 3E1F1 3LD8A 3VD7A 4WBBA 1H9WA 2J1VA 1BEV1 4CDUC 5C6CA 1XNTA 4NRMA 1QXPA 1LCLA 2BQPA 3D82A 2A5ZA 4AHYA 5A1FA 2PHXA 2G9ZA 4IGQA 1OOPC 2XXZA 3PU3A 4MX3A 3ALQA 5A6QA 1LECA 3D3AA 3AXEA 3VHPA 4CRQA 4HLTA 2K0GA 4C0BA 1BKZA 3OSDA 5DPNA 4AR2A 2EIGA 1D4M1 3Q8BA 5FY1A 3ZXKA 1CIWA 3U37A 2ZPXA 1I5PA 1QDOA 4H55A 4Q0PA 4WVVA 2XLFA 1W8TA 2JJ6A 2WRAA 1RUD3 3MICA 4RHV3 4KI5M 3HPNA 4YVWC 1EP0A 1RC6A 3I3QA 4PQQA 2Q8EA 5T5PA 1V6NA 5C5UA 5L9BA 1E5SA 1XXNA 3U75A 1FPN3 1LOFA 2MEV1 3GHNA 3RVHA 2WDBA 3I3EA 5L9RA 3IZOA 3NNJA 3PUHA 5DAQA 5JPNB 1S0BA 2D6NA 3L9JT 2QDRA 4JRAA 2Q0AA 1VE0A 5A7SA 1AYM3 2RDRA 5FZAA 1BMV1 5C5TA 2IC1A 4Y1ZA 2DF7A 2E51A 4TLGA 3Q8CA 5ACA2 3NJXA 4W65A 4EN6B 5J48A 5J96B 5L73A 3U07A 4XBNA 1O3RA 3VBSB 3FHQA 4A2UA 4IEWA 4OI0A 3MFAA 3RYKA 1J59A 1EUTA 5IFTA 1VJ2A 2DDUA 4BMBA 3S7EA 1CJDA 3RWKX 1HKDA 1OUSA 2YV8A 3ZDSA 5C8CB 5FYYA 4GAZA 4JKKA 5JOZA 2UYBA 3OEAA 1LRHA 4G4FA 5FP3A 1RINA 4CU7A 5HCFA 1DGRA 2CTVA 1CAVA 5IWFA 1VAKA 4XQDA 1LHOA 1Y3TA 3WHTA 2BWAA 2V5DA 2XMLA 3CU7A 4ITCA 2ZHMA 3SLIA 1FNZA 1KFUL 2G9FA 3PHMA 1WW7A 4FOWA 1KS5A 3D4KA 2OVUA 2WNUA 3FBMA 4YGCA 3AP7A 1YIFA 3A22A 5DUWA 3BTXA 3CJXA 2DBNA 5CBLA 5HCBA 3SXWA 1SDDB 4K6BA 4XQ4A 5FZ0A 5FZLA 1ONAA 2HWF1 1DLCA 5FZIA 3WP4A 1UOFA 5F3GA 5FPLA 4CXWA 5BY5A 2HWD1 3BODA 4P9LA 1MZEA 4JHZA 3J8F3 1H2KA 2GP3A 3MPBA 4ZZ5A 2FZ2A 4HPKB 3MUY1 1PGW2 3NAPC 4XUNA 1O6UA 3VB9A 5L19A 2C5DA 1WMFA 5DZFA 4XCBA 3TBDA 1AUYA 2KM2A 2Y6GA 5LA0A 1XPWA 2EXIA 1DG6A 4AQSA 4LTAA 2VU9A 1C8M3 3C3VA 1WCDJ 4AYUA 1GBGA 3POWA 4YPJA 2AGSA 3GZUC 3POYA 2XBO3 1ULGA 4GULA 2VUAA 4IEQA 2ETEA 2GNMA 1V9U3 2PLV3 1AYN2 1PK6C 1ZZ7A 4Q4W1 4FSJA 1LGCA 2W68A 4QT6A 3OB8A 2OA2A 4MGZE 1YIPA 2V09A 5DDJ3 2VTXA 4IUGA 4XF1A 1YJLA 2B8MA 2WUHA 3PVBB 2ZAAA 2YUEA 3KF3A 5GM0A 3JD72 3BIEA 3MPPG 3ITQA 1W06A 1JOPA 4IEZA 3D0SA 2BNOA 1OHFA 1NOVA 4QKFA 4LBQA 1OKOA 3PMSA 2HWE3 4X8NA 4FTEA 1FPN1 1YUDA 1VBA1 4NUBA 4ZS2A 1DYPA 4CCLA 2WQ4A 1DDLA 1E5IA 4FFHA 2XG3A 3WNOA 3P1IA 1BLZA 3J7LA 2RR12 5DG1A 4B4QA 2Y34A 3LDKA 4MVTA 1TE1B 4QPYA 5FOJB 1TMF1 4JGYC 2JICA 1EPZA 3I7DA 1PM4A 2C9AA 5F7UA 1GZWA 4QDRA 1IPSA 2D6OX 5FZOA 3B5LB 3NJVA 2YBKA 3WNLA 1LOGA 1VBB1 3AYDA 1ZX5A 2PTMA 3LPFA 4YLZA 1FAYA 1VP6A 3WW3A 4CCNA 1AVBA 5SV5A 2ZGNA 2E6VA 1SLIA 3R4SA 4FT8A 4OLLA 4R9CA 4AEDA 2BWCA 3B94A 3T4HB 1C4RA 1U12A 3KMHA 4P9YA 1QJU2 4LBLA 1YYNA 5FY7A 3VBRC 4ATFA 3VBSC 2VZ1A 4BE3A 4RN5A 3ZSKA 3KT7A 4NHYA 5FKBA 5L7OC 2CY6A 5FOBB 4IV1C 1ZZ9A 5CVRA 4DINB 1G7YA 4GMP0 3DF0A 1BBT2 2CL2A 2PELA 4UWDA 3NVCA 1LOBA 2UWCA 5FY4A 3ZXLA 4M0NA 3AYEA 4Q4X1 4YG3A 2ZGLA 2J1RA 4KWUA 2R16A 1GNYA 1RUE1 1Y9MA 5L36A 4CYDA 2XWBB 4LO6B 4FPOB 2A6VA 1CAUA 1LGBA 2LUWA 5LBCA 3BOPA 3H1MA 4IE6A 2ZTNA 3I2IA 2F6BA 4Q1PA 3ZX7A 4N7IA 4NOTA 4SBVA 2Q8CA 3R0RA 1ZBE1 3MDPA 4L0PA 2RJLA 2OS2A 2R063 4IDZA 3WCSA 3I59B 3CZUA 2NP0A 1QJX3 2Y64A 1WCKA 1OH4A 2WAAA 3MIDA 4HK9A 4OZXA 1JU4A 3LOBA 1SLAA 3GBGA 1Z7S1 3VBFC 2VNRA 2Z42A 4ES8A 1S0GA 1UU6A 4IV1A 5KHJA 2RS52 2DBIA 3AFKA 1UU5A 4PBPA 2HWD3 3KVBA 3POGA 4AI8A 1UU4A 1NYWA 4EZ4A 3AB0A 5BNNB 2PLV1 1RUG2 4PHZA 2F17A 1KJRA 1C1LA 3S7IA 2WINB 3SKJE 1YLLA 4Y24A 1SFYA 3T1LA 3QD6A 4UFLA 1ZBA3 1CD3G 3ZFEA 3PVOA 1K42A 5KXDA 3EQEA 4CCJA 4Y5SA 4FBFA 5LK7B 2XH6A 3FUOA 3N7LA 2YB7A 2XJRA 5FMBA 5FR3A 5HI0A 1REEA 2HWE1 2XONA 1KGYA 2C9KA 2NN8A 1OKQA 1VBA3 4QXBA 4XC9A 5C9AA 4GWIA 4AEMA 2RS32 1KQRA 4WV8A 1V6LA 3Q9OA 5A7WA 1WLWA 4OHXA 4WVWA 1ULEA 5DDJ1 5JPMB 4W4ZA 1UD1A 2ZZQA 2A3XA 3VD3A 4LHLA 3VKNA 3KV9A 1W6OB 3GBFA 4LLFA 2H0BA 4URTA 4YM3A 4LO5B 3UJOA 4C90A 1TME1 3BTAA 4GH4A 4QX7A 4AI0A 4EV0A 1O3QA 2DWRA 2ZXQA 5CG8A 2HLEA 3EMRA 5ANNA 5JXHA 4HKLA 2XDVA 4OMDA 2OIIA 1HN1A 1RVF2 2UWAA 1PMJX 5FREA 3H3ZA 3ZDVA 3SCFA 2VL4A 3MIGA 4A7YA 1ZZ6A 1GP4A 3LQCA 1H0BA 3LSEA 5JCTA 4G9SB 4OI1A 3LE0A 4IE5A 4ARXA 4CA9A 2B4KA 1JXNA 2R49A 3CJIA 3DKWA 2HKXA 2AENA 1WLDA 4LKFA 4D7TA 2PA7A 2Q4SA 3INAA 2QQNA 4LK7A 1XNCA 3QACA 5A3WA 2VQ0A 4FFFA 1QJX2 2ZMKA 1NXMA 1PO11 1VBB3 1L7LA 5FZ9A 4QQPA 1NCRC 1EAH1 3AKSA 2BERA 3WG4A 3KGLA 4BXSV 1MQTC 1ND2C 3OD4A 4ET7A 2WYFA 4K8RB 3HWJA 1HB2A 2ZX1A 3M3OA 3JUUA 2X09A 4SLIA 3CEWA 1IKQA 3H42B 3IB3A 2R1DA 3WNKA 4CCEA 5A3OA 4YGBA 3ILNA 3T2OA 3WD5A 3BYWA 1S2EA 3E6BA 3CO2A 3ZFEB 3AMMA 2XVKA 2XGXA 3IIIA 4QB1A 3OPWA 4UFJA 4XDOA 5FYTA 5GLTA 2DFBA 4Q26A 1PNFA 5AFEA 3WY6A 1N3OA 2OQ6A 2J1SA 2R072 5CADA 4RQPB 3VBOA 5GZCA 3AKTA 3MEPA 2VZ3A 4D7YA 1PMHX 2QDNA 2GALA 4Y4YA 2YDEA 4B4PA 3WNPA 4NRPA 2YFUA 5T52A 4YFZA 1H6YA 2JG9A 2XQRA 4LIVA 3S6PA 3ZN6A 2FDJA 2H6BA 2VZSA 3OGJA 4PBOA 2P4EA 3IKWA 3VKOA 3SNMA 4E4HA 5F9TA 1RUI2 3MZHA 1TG7A 2BUKA 5LEJA 4PQ9A 3U10A 2GDFA 3MLJA 3VL8A 3IAPA 1PNGA 4M4PA 1B35A 4COVA 4M4RA 1QH7A 1RMU3 1Y9GA 2F4PA 3QH7A 2K46A 3CIHA 4Q27A 4Q4V3 5FYUA 3WQ7A 1YFXA 3IMMA 4QM8A 2YG0A 1CAXB 1XYPA 4QHOA 5HV4A 2NZ9A 1UX7A 3JB8A 1HJGA 5IVEA 2JDMA 4KGQA 1H6XA 2PHLA 4G3YC 1IS3A 3P5BA 4CUCA 5C8CC 2OZ6A 4MXVA 1QF3A 1A6CA 2WIIB 2ET7A 2Y26A 3NO8A 2D3PA 4DPNA 4I01A 3W9AA 1OH3A 2WNUC 4I0WB 2DV9A 1YJKA 3I2DA 3WQBA 1N1TA 5DUXA 5FZ7A 3WUDA 5JMCA 5FO7B 4W6XA 1FNYA 4H7MA 3PNAA 3T0AA 1QOSA 1AX2A 1W8UA 4YW3A 3ZFFA 2VZVA 5JMOA 2X29A 4A42A 3WUCA 5BNOB 1U5IA 1CN1A 4RR3A 3TNPB 1JMUB 2AYHA 3N36A 4RFT0 4ZS3A 2R042 1JN2P 3OGGA 3M3CA 1H9PA 3NWKA 5FPBA 5ABJB 4AZZA 3KV6A 3T2TA 1REFA 2PHUA 3IPVB 4AAPA 5J37A 1HDKA 4XXPA 2EA7A 3BB6A 1IKPA 2X05A 5FY5A 4CTEA 1NKGA 1OC1A 5FWJA 4BQ4A 5IK4A 5DN2A 3E5UA 3KB5A 2WFF1 1QJZA 4I09A 4MGKE 1JZ5A 1IGOA 2FDKA 2OPWA 4CDWC 1N1YA 4IGPA 2JG9B 1ULOA 3E6DA 3DYPA 4LLOA 5D8AC 5F2WA 2Y6HA 3ZN6B 5A3PA 2W1WA 2XVLA 2X8KA 4UT5A 1AHSA 5CZKA 2ATFA 1O8SA 4M3CE 3H8XA 3FHAA 1CWPA 5EHDA 3DKQA 3SQOA 2VOKA 3TAYA 5FCCA 1O59A 4QX8A 1H1MA 1N3PA 5KXBA 4ZY9A 2ZBJA 1GICA 3A23A 3TN91 2JEMA 1RXFA 1UCXA 4AW7A 1HRI2 1KD7A 1RUH1 2UY9A 1ST8A 3A7QA 5ISLA 1W04A 1C3HA 1IPKA 1C5HA 2YPJA 2YY1A 1F9KA 4PI0A 5J36A 5BNOC 3VD4A 5CISA 2BW8A 2W87A 1LU2A 2HWD2 3FLRA 4S2DA 1MPXA 1OLQA 2NLRA 3THDA 3FX3A 4QQOA 4NIGA 1WBFA 1Q8PA 3J4UH 5IK8A 2X5IC 4OCTA 1LHWA 4GQ7A 1DQ2A 4XAAA 2QZ3A 5BPXA 4EN8B 2H0VA 1KS4A 5LBBA 4BM8A 5JXGA 3I2GA 2V5YA 4S2GA 2BNMA 2QQJA 3H9AA 5LBFA 5EFUA 1VBE2 5ERLA 5D1IA 2WLQA 3AMQA 3N9PA 3B9CA 5EPAA 5H9PA 1LR5A 3HNBM 3F95A 4PIXA 3DPRB 4A41A 4DZGA 3ROUA 2VR4A 2JIJA 3HBZA 4XYXA 2BOIA 3RI8A 4XILA 3QCWA 4Q8KA 2GC2A 4ES9A 2PHRA 2WS91 3O12A 4A6SA 1RUE3 4YZ1A 1KEXA 2WZ8A 4W8JA 4K8FA 1QIQA 2MEV2 2P3YA 1JW6A 2RVAA 4JCKA 2XL9A 4OI4A 5H9RA 4BQ1A 2VBBA 4KU8A 1AJKA 3T4VA 4GA9A 1UIJA 3ZXJA 3H3UA 5AVAA 3H7YA 3VLBB 3I54A 4MADA 1GQHA 2RS53 3NNFA 3VZKA 1XSQA 5A80A 2WT2A 5APAA 1O4TA 4CPBA 1R082 2GMMA 4XDQA 5KHHA 4IW3A 2E26A 1HV1A 4XJAA 2AREA 4KG8A 3RNSA 1ASJ1 1DYOA 2NYYA 2DU1A 3LA3A 1POV1 1RJ8A 2JE7A 3DXUA 3AMHA 3ZYBA 5C7GA 1HRV3 3UNPA 4GH4B 2JIGA 1MQTB 1ND2B 1VPHA 3JQWA 4RFRB 3ZFEC 1LOFC 4ZXEA 2ARCA 4META 4N53C 1AYM2 4O9EA 1RXGA 1DQ1A 1UO9A 1W9SA 2WSVA 4OMCA 1HRV2 2RR13 3A0NA 3HQXA 4KBZA 4XFAA 4YGEA 4FAGA 4ZU7A 1W9YA 3S5AA 3VDDB 4XXAA 4L9BA 2YMZA 3DEMA 3PUSA 4P9IA 5HCAA 2RMU2 2CGNA 4HSJA 1Q3EA 3WDUA 1W6NA 1QJFA 3O0XA 1RUOA 3IDBB 2VD7A 3JB4C 4Q0VA 4XEZA 5FUIA 4FFIA 4NRQA 4YM1A 3PU8A 1WZXA 1BEV2 5F6LB 5JXJA 3U4SA 2DVBA 4ASLA 4CP9A 2JG8B 1AR92 1KITA 2WO3A 1V6MA 1NZIA 1QJU3 3AYCA 1O3TA 1BBT1 5EJ1B 5AFBA 5FYMA 4R9BA 3TEZA 4XZUG 3E5QA 3POFA 3CQOA 3LEIA 3LEGA 1RB8G 1YNAA 4FVVA 1TNRA 4LOSA 1ODMA 4XMAA 2CDOA 2WA4A 2JWPA 2J22A 4FPHA 4KQ7A 5K0UA 2GSYA 4DY3A 5A32A 1K5MC 5JR2A 5K7PA 2VZRA 3T30A 3HNYM 3Q8FA 4XJ8A 4Q8LA 4EROA 4F7ZA 1CJPA 3LIHA 3BPSA 4Y22A 3B69A 4LMFA 2YROA 5EXOA 1SMVA 1SBFA 2I07B 2RE9A 3L2YA 1PIV1 3M1HA 2VMIA 4NPLA 1WD4A 3R05A 1HX6A 3J7MA 1IG0A 1JYTA 4XDPA 4CEWA 2Z2SB 3BGAA 4LKDA 4X6QB 1GZ9A 2CAVA 1ZVFA 2VCCA 3AM2A 4ZHNA 5FZGA 5D21A 3KT4A 3WDYA 2O14A 3D6EA 4ZU4A 2Y0IA 2IVIB 4XMIA 1X8MA 3VD9A 3M7AA 1HXS1 4FQZA 1GUIA 1FX5A 2BP6A 2RM21 1PGSA 1UOJA 2IFWA 2PYTA 1OA2A 1OQDA 1D4M2 2WNEA 3GZAA 4B8EA 2QZ2A 1FXZA 2P5BA 5LK5A 2YHJA 4XE9A 1SPPA 3N3HA 4INDA 2JG9C 1B09A 4PT6A 2JDUA 3O14A 4Y20A 1DP0A 3M4FA 1APNA 4JTNA 2PFWA 1QXJA 5FBJA 4GIQA 3WQ1A 3DYMA 5GZGA 1RUJ3 4Q2FA 4AQTA 1YQ2A 1WW6A 1UWWA 2ZGTA 3CKHA 4M3CB 4J25A 4Q4W3 3KT1A 3JCIA 1RUF1 1UZVA 3PTRB 3ZFFB 1TME2 2J1AA 3HNMA 4E2QA 5JOYA 2GP5A 2VQTA 2B9VA 5JR7B 2A73B 4QD2A 3T2QA 4UYBA 1ZYBA 2C6SA 3I2FA 4HMZA 3UGHA 3S0MA 2GNDA 2JDZA 2AH2A 5AVPA 3WDVA 4YW4A 5LCWL 2DCKA 2VXJA 5FXVA 3VZOA 3ZXDA 1OVSA 1DCSA 4XHXA 1W8NA 2HJIA 4UOJA 3DXTA 5FMOS 5JLVA 1XNBA 4GB31 5JXIA 3UL2A 3WF2A 3JXSA 1C28A 4Y5TA 2KD7A 5CFDA 2R041 2D5HA 1OSGA 4HN0A 1UX6A 3H1YA 4QXKA 5F5AA 3ZYJB 3ZXFA 2ZX0A 1TMF3 2QE3A 1GNHA 1GKBA 1FYUA 1QQP3 5I8TA 1A78A 1V6OA 4Z07A 5IHRA 1N3QA 3HT1A 2R0HA 4DEVA 1XC6A 4RS5C 1O7FA 3J8F2 5BUVA 3C2UA 5JSPA 3UKVA 2VBDA 1W2OA 1Y7BA 1N1VA 4XTPA 1YQCA 5FPUA 4N90A 1UW8A 2ZKNA 1YI7A 1QH6A 1MEC2 2CAUA 5JZGC 3LCPA 1DGLA 2QQMA 3FLPA 2PLV2 4OUMA 4DY5A 4FAHA 2JX9A 4I3GA 1FMD1 3HOBA 5C3QA 3ZMNA 1PGW1 4OHVA 5KC6A 3LZZA 2Y6FA 4Q0UA 3MF6A 2BGPA 1PHMA 3G7DA 4QB2A 4RHV1 4RR3C 5LASA 2FMYA 3MYXA 1FPN2 3PUAA 3RMYA 2HWB3 1XBFA 5B2GB 3T1MA 5DAVA 4K7JA 4MSVA 4PDWA 4YW1A 4CDXA 2VJXA 4AHWA 4TXWA 2EXKA 1ZZCA 2GN7A 2WKKA 2BFUL 3J26N 2G9GA 3VBFA 4I0AA 1YC61 2SBAA 1RGSA 3LWCA 5JOWA 4UI9L 2YU1A 3MW3A 4CCCA 1NA1A 2R061 4QPGA 4HVRA 4XZPA 4Z2WA 1G86A 2ZABA 2D6PA 3LB9A 2VTXJ 3SH5A 3R4UA 3ES1A 5ACA3 2A3YA 3SEEA 2VE1A 1HQNA 2R6QA 4JRLA 3ZO0B 3CF6E 4XF4A 1CX1A 5I0TA 2SLIA 5SV8A 4TTGA 4FPCA 2VMCA 1KDMA 3AP9A 1VRH2 4YZ4A 1XQNA 2RDQA 4B3NA 2RM23 4JKLA 1VBA2 5IVJA 3WW4A 2O0OA 4FOVA 2BZDA 2JE8A 1QQP2 3VDCA 4N7UA 1COV3 1ZRRA 2W94A 3HBKA 4EJRA 3VL9A 1G8WA 3FFQA 2JE9A 1NLQA 1O8PA 5FYZA 3MIBA 2VQAA 5T5OA 4RGKA 2Z69A 4U2AA 1UYXA 5FPZA 4LQRA 5LA2A 1WW5A 4I02A 3IM0A 1G9DA 2WR9A 2VCAA 2XHKA 4LOTA 2QNKA 5DZEA 2AZ5A 2ZHNA 5DDJ2 5H9QA 2ZGOA 4U36A 4CEYA 4KWLA 5FYCA 4GKXA 4F8AA 1WA6X 5BNPA 5JIUA 2LTNA 4NHKA 3POSA 2DTYA 2R043 3RZJA 5FZHA 3U11A 3FL7A 2ZJCA 1RUC2 3ZSJA 4IV3B 1R083 1QOTA 4DMIA 3VHNA 1OLME 3M2MA 4XFCA 4B7EA 2WN3A 3V65A 3VV1A 1K5MA 2OQ7A 5FYIA 3DYOA 3I3MA 1T2XA 5FZ8A 4Q4X2 4K20A 4V2VA 2JDNA 2NMOA 4QPIA 5LATA 1SLTA 2FCUA 5FJKA 5BNNA 3U0ZA 5A7NA 1RUH2 5F32A 1NA1B 4ARYA 1KDKA 2ZMLA 1PO12 1XE0A 2PQSA 4HKOA 4HT1T 5EJ3A 4A3ZA 1D7PM 5K0UB 2VMFA 1XYNA 5FO8B 2FCVA 5FZ6A 4OUEA 4XJZA 4EZHA 1QMJA 1W9TA 3EO6A 2ZOEB 3HT2A 5CU1A 2FDIA 1MZFA 4PI2A 1W6PB 1ZRIA 3TNQA 1KJLA 4A3XA 4CUGA 3ZXAC 4GMP1 3WF0A 4QHZA 4KH9A 1JHNA 1OFSA 4LBNA 2IXLA 3U78A 3WHUA 1SCRA 2A70A 2QQKA 1X7NA 3DGTA 1OQ1A 2VZPA 2ZHKA 3RZLA 5A7WB 4BZ4A 2VZUA 4CUBA 5C3PA 2P17A 4B7KA 1FMD3 4QKDA 2GH2A 3WG2A 4L99A 1W6OA 2E9QA 3SCGA 1JYNA 2TNFA 3FFZA 1Q8QA 1JHJA 3GHMA 4UBHA 5ACA1 3LAGA 4GJYA 2YC2A 4HVOA 2WS92 3D8CA 3NV1A 4XJWA 1OPOA 5KHIA 5F3EA 1X9TA 1QJY3 2EAAA 1A8MA 1N47A 2VZTA 5FZBA 1GSLA 3BN6A 1A34A 1YXWA 4L92A 4AVVA 4W50A 2AR6A 2QKDA 3HN3A 3ZYIB 1BK1A 4FTBA 2UURA 3MLKA 4CUAA 2BNNA 1UYZA 2PAEA 2ZCWA 1OURA 4IEUA 4YG6A 1ACCA 1PVC2 2ADEA 4E4ZA 4XW3A 3C7EA 2IXHA 4OI2A 1HXS2 1K12A 4P9GA 4FPJA 3ACHA 2A6ZA 1RMU1 5H9SA 1Q5OA 1VALA 3KZ4C 5D8AB 4AFBA 3WNNA 1YEWA 2VNVA 2ARAA 3MW2A 4CXXA 2E31A 1LTEA 1NX9A 1R093 4XF9A 4OHYA 4HFSA 1K5MB 5A6XA 1SFNA 3N7KA 4BWOA 1UPSA 3M8LA 4M0HA 5CKNA 2WZEA 1QEXA 1WLCA 5FO9B 1LB2A 3KD4A 2AC1A 2QVSB 1D0GA 2CGOA 3A4UA 2X53S 1KXGA 4AVSA 2VVDA 2XBO2 4XUTA 2WL1A 2A75A 4OQ8A 1OUXA 3LDRA 5TSWA 3NKGA 3PVNA 3WV6A 2XB6C 4OHZA 3ZVXA 2GC3A 1LOAA 5G05L 3ON7A 5FZ1A 1VBC3 4Y26A 4AEJA 1AR83 4P14A 3BTZA 2WNVA 2C26A 2WNOA 2XVGA 1RIRA 3F2ZA 3THCA 4OZOA 3WOGA 4DXSA 4N9IA 3WP3A 3ZXGA 1W03A 1S0JA 1MS1A 3ZFFC 1J3PA 4RQPC 1TNFA 4IV3C 1SG3A 5DQ0A 4HPKA 4NPMA 5FQ0A 5FXWA 3KCYA 1RUF3 2WLPA 4CCMA 1R1A3 4UFKA 3WXPA 4AK3A 2FD8A 2DCTA 3ZM8A 2ENRA 3GZTB 2ZS6B 3AFGA 2BTVC 3GXUA 4JDNA 1PK6B 1POV0 1B35B 5FBZA 2VOWA 4JHTA 2Q1MA 1REDA 4BMEA 2W92A 3VN4A 3H3LA 3WNXA 3ZFGC 1MVQA 2WFF3 1DHKB 3JD71 3UKTA 1Q8OA 1SLBA 3B02A 2A1XA 5IK5A 1U5YA 2V72A 3VBUA 1YFUA 4PLNA 5HXVA 5CFDC 3ZR5A 5A3NA 3AP6A 5C70A 5JSOA 2FDGA 2FCTA 2ES3A 4PIYA 4P9JA 1HRI1 5F3CA 1ND3A 4QQLA 5GZDA 4BHPA 1OA3A 2W9XA 1F5JA 4LBKA 1JTZX 2DYCA 5FZEA 1GMMA 3ACIA 3T09A 3AVRA 4I0BA 2JG8A 1SZBA 1AX0A 5CEHA 1VBD3 4IXLA 3GZEA 2E7QA 4PCRA 2XJVA 3IIAA 4W6WA 1V6KA 1VRH3 3VZLA 4AFAA 4JGYA 2RM22 3K75B 5BNOA 2E63A 3LSDA 4N53B 3DPRA 2WWSA 4AWDA 1XNKA 1ZZBA 5GKAC 4UW4A 5BXXA 1UOGA 5FP4A 3TOJA 2VH9A 3DCQA 4YVSC 4JC1A 4QGNA 3S57A 3GF6A 3H1WA 3NRUA 5DAWA 1VB4A 2VAUA 3FLTA 5GLZA 3IN9A 4WM7C 4Z2AA 1W6QA 2VOXA 1RUH3 4E27A 5IUQA 4YGDA 3K4AA 4Y1UA 2CGPA 4LO4B 1E5RA 1AR72 3ASIA 4AAXA 1NCRB 2JDPA 4WM8A 3MI8A 3GALA 4Q4X3 1H30A 3VBOB 4DUWA 3LEMA 1EAH3 4J1XA 5T5LA 5ABJC 3J9SA 3W5MA 2JG8C 1Q8VA 2RMU1 4XF0A 1L7QA 3TEWA 2GC0A 3GGLA 1O5LA 2VMDA 2Z79A 4WZCA 5FYSA 1O4YA 4BYYA 5J98B 2CNAA 3C7FA 3KCCA 1WLTA 3SC7X 5FPXA 1UZYA 5FZCA 5GLUA 2ZGUA 3VDDC 2OW4A 4Q4Y1 1CONA 4XBLA 1R091 2EF6A 2W46A 3AKPA 4K9SA 4JTOA 4YVSA 2VUDA 1SBDA 5K8SA 4C91A 5F5IA 4HN1A 1K3IA 4GB32 4LJHA 3ILRA 1JOBA 5FXZA 5A7OA 2WS93 3ETQA 1Z7S2 1KFXL 2WAOA 2IFRA 2I2SA 4I2OA 2QQVA 1MACA 2J1EA 5C33A 1BXHA 5FK8A 5FZFA 3I2HA 1O5UA 4IEVA 2UY8A 1LKNA 2VW2A 3I59A 4FPLA 1DFQA 2E7TA 3OPTA 1QXRA 2YGLA 3C7GA 4MGSA 4H7LA 2A6WA 1PVC3 1QU0A 3RYRA 2IXCA 3ACFA 2PHWA 1QWRA 3ZSMA 4AVBA 1J83A 5IAXA 2BRTA 4S2HA 3NAPB 4D6QA 5DUVA 2VPVA 2B39A 3ELNA 3USSA 3ZKUA 4DEQA 2FQPA 4MXWA 1H2MA 1XJAA 5A32B 4LPLA 5FY8A 5C8WA 4XIOA 1PO22 4AGGA 4BLJA 1YCIA 2B45X 4CSWA 5DG2A 2EXJA 5FZKA 3WW2A 1SACA 1PGL1 1SLCA 1R081 3N7JA 5FAXA 1NCRA 5CFDB 2RS13 1NUKA 4K1YA 4LK6A 1W3XA 1GWLA 1Y43B 3PVEA 4ATEA 4CDWB 3S30A 4B1LA 3SHRA 3VHOA 1NLSA 2ZGMA 4DS0A 3IAQA 4XUQA 2D43A 1RVF1 3NKTA 4I3PA 1OPMA 1OVPA 2CWSA 5K0UC 4C0HA 1SCSA 1ZNPA 3PJQA 4YM2A 4TYSA 3PDQA 1S55A 3WZ1A 4BLIA 3QLQA 1AYN3 1AL21 2FZ1A 1XB9A 2Y0OA 3K4ZA 4AQ6A 1GOFA 2GMPA 4ZU5A 2A6YA 2NMNA 1S0EA 2TUNA 2DVFA 4NJ4A 1DZQA 4ISQA 4CEWC 1VRH1 1UY4A 5IFPA 2JENA 4HETA 3RMXA 1WCUA 3WG1A 3OYWA 4DXTA 5CFCB 3AZXA 2ZEZA 5C4WB 3CMGA 2KXLA 2QQIA 3O0WA 3GJAA 2X10A 5FKCA 4BQXA 5L7OB 1X8EA 3V0BB 1QDCA 2HH9A 4PDWB 3ILFA 2HWC3 1H8TB 5KHKA 2I74A 4F83A 2WQZC 3BOWA 4J6GA 2ID4A 5IVYA 4CVUA 4XETA 3WR0A 3PLQA 2W5FA 5FY0A 3TRSB 1FOD3 5FK7A 5KXEA 5BV6A 1D2SA 5CIRA 5FY9A 3B7MA 4CDQB 1MS0A 1W3VA 3K77A 3AZZA 1XNDA 2BYVE 3OGVA 4AEDB 4QXHA 1GOGA 4EYUA 4CXYA 4CE8A 1AZDA 2R0FA 2GH8A 4QAWA 3IMNA 4FI9A 4TLFA 2XJTA 4LULA 1GNZA 1XYOA 1HIXA 3J7NA 4AGVA 4YG0A 4JGZC 4BIOA 2BVBA 3FN9A 1HLCA 1C1FA 5KXCA 1C8M2 1WUVA 4OHWA 3U4XA 2WT0A 2GU9A 2IWGB 5IATA 4V1PA 4YSFA 5JUVA 1G9AA 4Q4Y3 1CQ9A 4QM9A 3WDTA 2Q30A 3AJZA 3OOXA 4D8MA 3RZZA 4CU9A 2DCYA 1SLLA 2P34A 1GWKA 2JB8A 2A3WA 5EJZB 2QQLA 4JVAA 4QX5A 5FUNA 4WVMA 2VTFA 4NIIA 4CCDA 2H6CA 3I3DA 4A6OA 1JU3A 5IW0A 2J42A 1PK6A 4RSUA 4DRRA 3IDCB 2ZX2A 1V9U2 2R073 1IHMA 3HEIA 2QQPA 5A33A 5LY2A 4PIZA 1TZOA 2E7AA 5E89A 1CR7A 1GP5A 2Y8KA 3ABZA 3K3NA 1MEC3 1HW5A 3OJBA 1PX4A 1ZZ8A 3RDIA 1FV2A 4LA3A 1U0AA 2OUHA 4PF1A 3WT3A 3VGIA 3N9QA 1QGLA 1AR81 5GALA 2DUPA 2XHNA 3VZNA 5LY1A 3BKZA 5F6KA 1OXCA 1YO8A 2DURA 4QU2A 3BI3A 3RZMA 1F2NA 4KNCA 1W0PA 2XKPA 4IV3A 1PX3A 2XKOA 4AI1A 1FATA 5A3TA 1HQLA 1LHUA 1ZRCA 4XABA 3ZYHA 1RUF2 4JAAA 1VAVA 2D7FA 3AJYA 3CNAA 1R1A2 2VECA 2VW1A 2J7MA 3EBRA 3NQHA 4TWTA 3VKMA 1O91A 4BQWA 3T0DA 1JH5A 1YQ8A 5LW9A 4NROA 2JKXA 1RUC3 4DQAA 4XURA 5BYNA 5C8CA 5FMCA 3VBRA 3M3IA 4IV1B 1AL23 1RUD1 4BXFA 3V0AB 4CDQA 1QQP1 2IXIA 4L8QA 4P02B 1CAVB 5IT6A 1ASJ2 1OMIA 2HWB1 4YW6A 1ZRFA 4MGTA 1X82A 1QNYA 1RVF3 2WFPA 3B01A 1D0HA 1XSRA 5FUPA 4BDVB 5ABJA 5I91A 1ULPA 1GWMA 3USUA 5K9YA 1CAWA 2LS6A 3FJSA 3WG3A 3RS6A 1H2NA 4BB3A 4CDXC 3O1PA 1T6GC 3MGUA 4WM7A 1X9PA 1AR93 4RGAA 1TEIA 2CV6A 4EN7B 1FOD1 2A7AA 5FXXA 5EYYA 3M3EA 4GJZA 4LKEA 5I0RA 3O1MA 4FPYA 1VBD1 3RZGA 1S0IA 3DV8A 2I45A 3FE5A 5I0UA 1IPJA 5LA1A 4A45A 4CP2A 4RS5A 4Y1XA 4IEXA 4PLOA 1ND3C 5T54A 1H2LA 1ZRDA 3ZYRA 3TB0A 5M0TA 2VVEA 1NY71 5A33B 1RL3A 3KF5A 1Y4WA 1Q8SA 2AEZA 1S2BA 5JZGA 1DZTA 2B7YA 1E5HA 2W1UA 3HN1A 1SEFA 1V0AA 4QDQA 3RQ0A 2VG9A 4XIKA 3O1UA 2GAUA 4NWVA 1CGPA 2VGDA 3ZXEA 2OXBA 2VMGA 4RA0A 5DXDA 3EJKA 3VD5A 2PHDA 1BQPA 4IERA 5DMYA 4OUSA 1WA4A 2GMEA 2PHFA 2ILMA 2BGCA 3ZMOA 4AQ2A 4LHKA 4CDXB 3P3PA 1PIV2 5E6HA 3EHKA 2HEVF 3ES4A 2YU2A 3J8F1 4YZ3A 1V70A 2MHFA 3KS7A 4NMIA 4RYDA 3DN7A 1JZ4A 4LHSA 2D44A 2R062 4S2FA 1YQ5A 3N9MA 2R32A 3POJA 3OY8B 2MPFA 5CKMA 3H0OA 2OPKA 5EQUA 1MEC1 3HAGA 1NAEA 4MHUA 1GV9A 3SH3A 4QPGB 3ZYPA 3WDXA 2VUJA 2DTWA 2DCJA 3D5OA 3MIFA 4LA2A 4O65A 2BDRA 3OUHA 4OVEA 1BYHA 3N7MA 1DQ6A 4AF9A 2CWMA 1GZTA 3NV4A 4FCAA 3USUB 4ZKTB 3PL0A 2PXJA 2BFUS 3OBAA 4ASMB 1CX4A 4COYA 1PVXA 5FP7A 4MGQA 4QX1A 2CYFA 5BNPC 3V56A 1UZWA 2RDSA 3HIFA 4E8DA 2FHRA 2Y60A 1S4CA 5EWSA 4E4DX 2N7GA 1BEV3 5FP8A 1L3JA 1PVC1 3AC0A 3LA7A 3M70A 2KR2A 1COV2 1PGL2 2XQXA 2QCSB
chains in the Genus database with same CATH topology
4RS5B 1HQWA 1LEDA 4EN0A 2R1BA 2WC2A 4N9HA 1ENRA 4K40A 1EPWA 5LRSA 1S0CA 1YHFA 3KSCA 1MQTA 1ND2A 3CL1A 2GC1A 5AC93 3RJRA 4AEKA 3AK0A 1RUC1 5BNPB 1EYBA 1CAXA 3NW4A 4RL7A 3RSJA 5LEKA 2D6LX 3R6SA 5JAXA 3GYDA 3KM5A 1DLLA 2G4IA 4XFGA 5E16A 3TWIA 1AR91 1S2KA 1RITA 4CDUA 1ND3B 1BCXA 2ZGQA 5C9AC 2WZR1 4J1WA 4DXZA 2D5FA 1JBCA 4N43C 1TQ5A 1SDWA 4JGZA 3VBFB 1VBC2 3VHRA 2DVDA 1AR63 4LO7A 3ZFGB 3APBA 1SBEA 4Q29A 3TN93 4Z1VA 3PJYA 1B35C 2GN3A 4UW5A 1GFF2 3BALA 1Q56A 5T55A 1NLRA 2Q5TA 2YGMA 4LUMA 1RUNA 4Q0QA 2NM1A 4NVPA 4UXAA 4L2NA 1WMEA 4Q1RA 4R9DA 4N43B 4XTMA 2O1QA 2OZJA 3FC0A 1ULCA 4KBBA 4XPVA 2C1FA 2PAMA 1ENXA 4CZSA 2RS33 1GZCA 4KGGA 1Z0HA 2W52A 2D3RA 2OYZA 2B46X 1F8VA 4RHV2 1UF2C 4CEWB 1RUJ2 3IT8A 1XRUA 2YYOA 3JZVA 3UKNA 4AI2A 3VZMA 1V6JA 2XLGA 2B5HA 1PZ9A 1AXZA 4M01A 5KBFA 3THTA 3JBG1 4AVAA 1VIWB 1C8NA 5A3MA 4XFIA 1FI2A 1AXYA 4YNIA 2PAKA 3IWZA 5GLVA 1RMU2 1C57A 2VW0A 1RHI2 4LBJA 4Q4V2 3VBUB 3KCXA 3ECQA 3QOPA 2KA3A 3NL1A 1S0DA 4P9XA 1G9CA 1O4ZA 3B93A 1H8TC 1RJ7A 2VVFA 1J3QA 3KGZA 2XBO1 1GR3A 5JI9A 3WW1A 4D3WA 5C4WC 1W6MB 1G9BA 4C1XA 1RHI3 2VNOA 4OULA 4LE4A 1VR3A 1R1A1 4MV2A 5FLHA 4NO4A 1F31A 5AC92 1NE4A 2P3JA 1GLHA 3ZN4A 4BA6A 1NZCA 4GWMA 1J3RA 3G6JB 4BIFA 1W6QB 1PM7A 1A8DA 2ZGRA 4WM7B 4RQPA 2XLAA 1G6NA 1H1IA 1EV11 1CPNA 2ZMNA 3CLPA 4JQRA 1AR61 1NQJA 2HWC2 4PDWC 1MR5A 4R8HA 5JSRA 5DUUA 1AF9A 2JXAA 5FRAA 1OOPB 4XF3A 3HMYA 2IXKA 3A0KA 2RHPA 1UMZA 5GZFA 2ZZJA 4FPFA 4QGMA 4PJYA 3OYWB 3AMNA 4W6YA 2XUMA 4FQ4A 4L11A 3VKLA 4H14A 3VBSA 4QQHA 1PZ8A 2Z5WA 2DUQA 5D8AA 4AXOA 2RJKA 3JBG3 4QGLA 1U5XA 1QJY1 3OBTA 4XJ9A 3R4DB 3AKQA 4JGYB 1JUHA 2ZX3A 1YWKA 2HEWF 5CNAA 2W39A 1ZBE3 1AR71 2EVXA 5JVVA 5GLWA 2X5IB 4YZ5A 3B00A 1G9FA 3MIHA 4Z92B 3H8UA 3WP5A 4DRVA 5CG9A 2BEOA 4Z8BA 2P3IA 4QPGC 3W58A 5BNNC 1AXKA 2WT1A 3AMPA 1OI6A 4ORFA 4Q4Y2 1MZ6A 1LODA 4NHLA 1ZBA1 4HKWA 1OQEA 4AFCA 1IZ3A 4PLMA 1OOPA 3E97A 3RRDA 4BOWA 2RS11 4D7SA 3WCRA 1OLRA 5LRRA 2JKBA 1FV3A 4FPGA 1MS9A 5DZGA 4QPIC 4CEYB 4GH4C 3ATGA 5I0SA 4GB33 1IS5A 1AL22 3WLUA 2LALA 4YFWA 5CFCA 1FOD2 3WVJA 3NV2A 1JOJA 4GALA 4X6RB 4XFBA 1QKQA 1VLNA 3V64A 1BMV2 5KWRA 2BPA2 1VBE3 1TME3 5I0TA 2HWF2 1OFNA 1W39A 3CJIC 3JU9A 2AUYA 1UAIA 2VY0A 4M3CA 4R9AA 3VBRB 4YYOA 4IETA 3AZWA 3RG0A 1A3KA 3L2HA 2UU8A 1UZZA 1MS4A 3I4IA 3SISA 4AI3A 4KWKA 4JV4A 4LO8A 3P3NA 4N53A 1VB2A 1RUE2 1NG0A 4BPZA 2WNUB 2V73A 3FBYA 4LBQD 2WSUA 1UN1A 1CVNA 1WGPA 4Y1VA 5IK7A 1XU1A 3AXDA 3SCHA 2A6XA 2QFEA 4RGGA 3HD8B 4EWAA 4DOUA 1UKRA 2PQQA 4FTSA 4P5HA 3LGRA 4QQ2A 3WDWA 2ET1A 1MS8A 2ZKLA 2FMDA 1AR73 2D93A 3AZYA 3EXUA 4AHZA 4AVTA 5FFOC 1DIWA 1Z7S3 2IXJA 2XJSA 1V6IA 4KG0A 1NCQB 4HSLA 4MUVA 3DUIA 3RI9A 2D6MA 1CAUB 3UK9A 3VBHB 4LEJA 3BPZA 5C4WA 1UKGA 4NN0A 1LOCA 3ENRA 3KQRA 3SITA 4AG4A 4JDMA 2GZWA 2DVGA 2RS31 1RUG3 3W59A 3QBQA 1KRIA 1QHDA 2Q8OA 1RUI3 1D2QA 1COV1 2VXRA 2XJUA 4MGYE 4NPRA 1VBB2 4Q4V1 4LBQB 4OFGA 1Z78A 1GANA 2XL7A 1ULDA 3FUQA 1OD5A 3BIWE 3UV9A 2XJPA 4QHBA 3NAPA 1DZRA 1POV3 1UL9A 4RR3B 5T3NA 4FXGB 4KWJA 4EWEA 1FT9A 4B29A 4K21A 3ZYGA 1QNWA 1NY72 4MLOA 1NE6A 4LT5A 2RR11 1GZWB 2WNVB 4DB5A 3PMEA 5JWPA 3SH4A 4O9GA 2JD4A 5T50A 4DNYA 1XU2A 3AP4A 4M3CF 4CDQC 1OA4A 3DPRC 5FDBA 3BU7A 5A3LA 1V9U1 2QUOA 3O5SA 1EAH2 4NR1A 1DYKA 4R4XA 4FXKB 4GXLA 5E1RA 3VZJA 3URFA 2JECA 1QY4A 5KC5A 1NXD1 1QJU1 3ME2A 1BVVA 4E2GA 1EV12 3B3QE 2DCZA 1PO23 5GZEA 3ZSEA 1PO13 4LE3A 5J3UA 4IL7A 4IEYA 3VBHA 4Z82A 5FMOL 4RD7A 3WQ0A 3NSTA 4GMP3 1CPMA 3TN92 5L7OA 1EV13 5JDBA 1RUD2 2ZA9A 4MZUA 1LU1A 1O3SA 3FZ3A 1IS6A 1C5IA 1X36A 3RYPA 1W2UA 1ZA4A 1XE8A 4UW3A 2PHTA 2HWB2 2B9UA 2HWE2 3V0AA 1DQ4A 4AEDC 1LEMA 1ZM1A 1J1TA 4COUA 4QPIB 2IZWA 4XOGA 4WVZA 4MGIE 2RMU3 4CP1A 4H3WA 2BVVA 2ZACA 2D40A 1IOAA 2P3KA 1CAWB 4IQPA 3VBHC 2ARBA 2X5IA 1RUG1 1J1LA 1NCQC 1NA1C 4A7ZA 4HVQA 2DU0A 1NQDA 3HR9A 1W6PA 1E57A 2A71A 1V00A 2EXHA 4WM8B 2UWBA 3RPQA 5FTTC 4C1WA 5C9AB 2DVAA 3OF1A 4AE2A 1R092 5EV7A 4Y1YA 2XPJA 4HZFA 1VAMA 1WCSA 3H50A 1ALYA 4WVMB 4M00A 3ZIWA 1M4WA 2K9ZA 1MVEA 2P37A 2NQYA 4L97A 3E6CC 3MFCA 1I3HA 3ZPYA 1QJX1 3ZSLA 1H8VA 1S0FA 4DFSA 2XWJB 4YM0A 1VBC1 1ZBE2 4UBGA 4LNVA 2LM3A 2OUJA 3K51A 4K1ZA 2MNGA 1VBD2 2Q1ZB 2BBVA 4Q0SA 2VMHA 2VOVA 1LGNA 5FLJA 1AR62 1GYKA 4IEOA 5CFCC 1HRV1 4HBNA 2R071 5JI7A 3RJ2X 1I9RA 1W6MA 4JDOA 5I93A 3OY8A 1PO21 2C0ZA 5FLIA 4EN9B 1DGWX 5I8YA 4UW6A 3AP5A 3LA2A 1QOOA 2EAKA 5JIAA 3JD73 3AKRA 1WW4A 4XQWA 2WZR3 4MXWB 3IPVA 4MH0E 1DGWA 1N1SA 2XJQA 1HRI3 1YFYA 1XE7A 1AYN1 4Q4W2 4N43A 3IBMA 5E8AA 3OCPA 4BCUA 4COZA 4HL0A 2ZGKA 1GQGA 1IS4A 4YVWA 1AX1A 1ENSA 1VBE1 3N4MA 2GNBA 4A7KA 1H4HA 4LBMA 3O7OA 2E53A 1YFWA 5GJ6A 4P9WA 4ISRA 4Y5Z0 1PZ7A 2WJSA 1I6XA 4GWNA 3VUOA 4K3UA 1W0OA 3NV3A 5CA6A 4FPEA 1J58A 3E5XA 3SMHA 3VKFC 3IDEA 1F5FA 2YZ4A 3ACLA 2B42B 2FBEA 5JZGB 1BJQA 2D98A 4EWDA 4XJUA 2WZPP 5JOXA 3ZN5A 5I8SA 4FP3A 4NWWA 3OTFA 4YRDA 4FPKA 3BCWA 1LHNA 4FOYA 1UIKA 4Y20B 3MF9A 3FMGA 2TBVA 1EY2A 2VULA 4F3JA 3D0JA 1H8TA 4GKYA 1HXS3 1YRZA 3RWNA 4E4SA 2RS12 2PN5A 2EALA 3GBWA 4HANA 4XBQA 3O0VA 2ARXA 3QH6A 1C8M1 4E9KA 2WNVC 4XFHA 2ERFA 1JUIA 3OBRA 3LKJA 4D69A 4R52A 5T5JA 2D6KA 1ASJ3 2YC0A 4R4ZA 2O8QA 3KLSA 2QJVA 2WZR2 2HEYF 4I30A 1M06G 2DFCA 2W08A 3FHIB 2W0XA 1RUJ1 1MS5A 3VBOC 2ZHLA 4FO9A 4CP0A 4AHXA 3MLLA 1I5ZA 1RUI1 4PF5A 3LOIA 1H1AA 4YVWB 5J09A 1MS3A 4LHNA 1X50A 4B4RA 4LR4A 4FP2A 1AR82 1URXA 3X29B 1Y9QA 3FWEA 1X33A 4YZ2A 1HV0A 3VBUC 5KHGA 1RHI1 3WX5A 4IESA 3ZIXA 1LHVA 5EZWA 4YVSB 1SQ4A 4AFDA 1D4M3 1BBT3 2ZGSA 1MZ5A 3WP6A 1S1AA 1BZWA 2O8OA 2Y38A 4WZFA 3WINE 1DF0A 2ZX4A 3K48A 1ULFA 2K2SA 2DUOA 4IEPA 4CDUB 1LENA 2HYKA 3TYJA 4AVCA 1LJ7A 2D97A 3AX4A 3CJIB 1UPIA 4BH9A 4E2SA 3MW4A 4WM8C 1H4GA 3MIEA 3JBG2 4YW5A 5E88A 1TMF2 1FMD2 1D4VB 1PIV3 1WBLA 3UJQA 5AC91 3PTYA 4MYEA 1DBNA 5J7MA 1LESA 4JGZB 3ZFGA 4NHMA 5HBAA 1ENQA 2ZGPA 1DU3D 5EYXA 1QJY2 4KU7A 4XHBA 4COWA 1LOEA 5F5QA 1LULA 2MEV3 3ST7A 2TEPA 1DQ0A 3AZVA 1U5ZA 2P2KA 4Y22B 2D3SA 3GNEA 1PMIA 4YW2A 1CESA 1AYM1 1DQ5A 2R30A 1JYIA 1ZREA 3OPZA 2HWC1 4QMAA 4CDWA 4HK8A 3I8TA 1JYCA 2VNGA 4LBOA 4TSVA 2GNTA 5FQ0B 3N35A 4X8PA 1DGRN 3OD0A 3JQXA 5CAZA 2NPIA 4FOQA 1AL0G 1I1EA 3B9IA 3H7JA 1YI9A 5F1RA 3M3QA 4LUKA 1NCQA 2WA3A 4AFMA 1ZBA2 1Q43A 4CEYC 2WFF2 2ZAHA 3VDDA 1RTVA 3NJZA 1R1ZA 1IQAA 1W6NB 1WD3A 2RS51 2UYAA 1WMDA 4ONUA 4D94A 3V0BA 3AYAA 1AJOA 2HWF3 4KL1A 4TZDA 3THPA 4XFFA 3DL3A 4AGRA 2YXSA 4ZXKA 1BVP1 4WBBA 1H9WA 4CDUC 1BEV1 5C6CA 1QXPA 1LCLA 2BQPA 3D82A 2A5ZA 4AHYA 2PHXA 1OOPC 4MX3A 3ALQA 1LECA 3AXEA 3VHPA 4CRQA 4HLTA 2K0GA 4C0BA 1BKZA 2EIGA 1D4M1 3ZXKA 1CIWA 2ZPXA 1QDOA 4H55A 4Q0PA 4WVVA 2XLFA 2JJ6A 1RUD3 3MICA 4RHV3 4YVWC 1EP0A 1RC6A 5T5PA 1V6NA 1XXNA 1FPN3 1LOFA 2MEV1 3GHNA 5JPNB 1S0BA 2D6NA 3L9JT 2QDRA 4JRAA 2Q0AA 1AYM3 1BMV1 2IC1A 4Y1ZA 2DF7A 2E51A 5ACA2 4W65A 4EN6B 5J48A 5J96B 5L73A 3U07A 4XBNA 1O3RA 3VBSB 4A2UA 4OI0A 4IEWA 3MFAA 3RYKA 1J59A 1VJ2A 4BMBA 3S7EA 1CJDA 1HKDA 2YV8A 3ZDSA 5C8CB 5JOZA 2UYBA 1LRHA 4G4FA 1RINA 5HCFA 1DGRA 2CTVA 1CAVA 1VAKA 4XQDA 1LHOA 1Y3TA 3WHTA 2BWAA 3SLIA 3CU7A 4ITCA 2ZHMA 1FNZA 1KFUL 2G9FA 3PHMA 1WW7A 4FOWA 3D4KA 1KS5A 2OVUA 2WNUA 3FBMA 4YGCA 3AP7A 1YIFA 5DUWA 3CJXA 5CBLA 5HCBA 3SXWA 4K6BA 4XQ4A 1ONAA 2HWF1 5BY5A 2HWD1 3BODA 4P9LA 1MZEA 3J8F3 1H2KA 3MPBA 2FZ2A 4HPKB 1PGW2 3NAPC 5L19A 2C5DA 1WMFA 5DZFA 3TBDA 1AUYA 2KM2A 2EXIA 1DG6A 4AQSA 4LTAA 2VU9A 1C8M3 3C3VA 1WCDJ 4AYUA 1GBGA 3POWA 2AGSA 3GZUC 3POYA 2XBO3 1ULGA 4GULA 2VUAA 4IEQA 2ETEA 2PLV3 2GNMA 1V9U3 1AYN2 1PK6C 1ZZ7A 4Q4W1 4FSJA 1LGCA 2W68A 4QT6A 2OA2A 4MGZE 1YIPA 2V09A 5DDJ3 4XF1A 1YJLA 2B8MA 3PVBB 2ZAAA 2YUEA 5GM0A 3JD72 3MPPG 4IEZA 3D0SA 2BNOA 1OHFA 1NOVA 4LBQA 3PMSA 2HWE3 4X8NA 4FTEA 1FPN1 1YUDA 1VBA1 1DYPA 2WQ4A 1DDLA 2XG3A 4B4QA 2RR12 5DG1A 4QPYA 4MVTA 1TE1B 5FOJB 1TMF1 4JGYC 1EPZA 2JICA 3I7DA 2C9AA 1GZWA 2D6O