3VV1A

Crystal structure of caenorhabditis elegans galectin lec-6
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
141
structure length
141
Chain Sequence
b'IGISFRNEFFNPQTPVNIPVQGFSNGARLRLVLLPTSADSRFHINLRTPDDIVLHFNARFDEGAVVNNSTSGGGWQSEDRHANPFQQNKIYTLEFVSNGGIISIFVNGAHFADFVERTPSHGVHLIEIEGGVHVHSAHVSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein LEC-6
publication title Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Sugar binding protein
total genus 33
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00337 Gal-bind_lectin Galactoside-binding lectin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3vv1A00
4M3CB 1Q56A 2PHXA 4BMEA 3FBYA 4FQ4A 3V65A 1G7YA 2ZHKA 4FOWA 2E53A 1VAMA 5DG1A 1CQ9A 1Y7BA 3B01A 3QLQA 3RQ0A 1WW4A 4XJZA 2ZA9A 4ATFA 5GALA 3AYEA 2D6PA 3AP4A 3O0VA 1KQRA 1SBDA 2DV9A 1V6OA 4ZXKA 3AX4A 2EAKA 2P2KA 1AF9A 4R9DA 4FOVA 1Z0HA 3IMNA 1AJKA 1N3OA 4WV8A 4XE9A 3V0AA 1DYKA 3ZXFA 2B7YA 1AXYA 2GNMA 1LECA 3GNEA 3R05A 1V6NA 1XQNA 1LGBA 3USUB 1QOOA 2C9AA 3POWA 5IK4A 1G9AA 3O0XA 2E6VA 2DURA 3CNAA 5JOWA 2GN7A 2PHTA 1WBFA 1A8DA 3FFZA 3LSDA 1Q8SA 2DUPA 5JVVA 5LK5A 2W68A 2YY1A 3ENRA 1AX1A 1MS0A 1GZWB 2WSVA 4YW3A 4FP2A 3SH3A 1AZDA 3AP9A 3M1HA 2DUOA 1IS6A 3IKWA 2P3IA 2VXRA 3M3EA 3AYCA 3LCPA 3I4IA 1YO8A 4Y20B 1LU2A 5L73A 3SNMA 2GMEA 5CAZA 1X50A 2NYYA 3JUUA 1MS9A 1W6OA 1UKGA 3PVNA 4AWDA 2NZ9A 1N3PA 2GNDA 4YM2A 1H30A 5FRAA 4AGGA 1J1TA 3NV4A 1LHOA 2D7FA 3WNXA 1QF3A 4RA0A 4AGVA 1EPWA 4YZ4A 2A3YA 3OY8A 1S0EA 1S0DA 4PCRA 2ZABA 1VAVA 2YV8A 2R0FA 2GN3A 3BIWE 1W6MA 3N7MA 4JC1A 4YM0A 5DUWA 5H9QA 3N7JA 1LOEA 1CESA 4I30A 4YM1A 1LHUA 4BPZA 1S0BA 1G86A 1N1SA 4YZ1A 2W39A 1HDKA 4LBKA 1JUIA 4DPNA 4Y1YA 3ILNA 1MS5A 4FOYA 2WSUA 3OJBA 3O12A 4UW5A 2GNBA 4C1WA 4OZXA 4XIOA 1DQ4A 2JE7A 1MS8A 2PELA 3B3QE 1G9FA 1UZZA 4KBBA 4XJ8A 4M3CF 4FPHA 1FNYA 5IK8A 4YFWA 2ZHMA 3L2YA 2GNTA 5HCBA 3UJQA 4P9WA 3W58A 1DQ1A 1FV3A 3ZYPA 2ZGNA 1C57A 5JDBA 4YM3A 1MZ6A 2D3RA 1SFYA 1N3QA 2A3WA 2ES3A 3MW3A 4YW1A 5IUQA 4Y26A 3WOGA 4DRRA 4LBOA 1ENRA 3AJYA 1SLIA 2AENA 2PHWA 4K1YA 2P34A 3WZ1A 4MYEA 3VKFC 1LOGA 3R4UA 2ZGSA 3N3HA 2CY6A 3B69A 2EIGA 1SBEA 3RMXA 4YZ2A 3MPPG 3W59A 3AZVA 2EF6A 5H9SA 2UU8A 1QMJA 4LBQB 4UW4A 2VUAA 2DVGA 1LOFC 2XB6C 1CIWA 5EYYA 2G4IA 2JE9A 4YFZA 4FPOB 3M3OA 1BJQA 1ULFA 1IS4A 1YXWA 4WZFA 4XMAA 2LALA 3RSJA 1LULA 3ZSKA 1UN1A 3AFKA 3INAA 4Y1ZA 4W65A 2CWMA 2ARBA 1FYUA 1W6NB 5EWSA 1G9BA 5IK7A 1AX0A 1B09A 3D6EA 3LSEA 2D6KA 1LU1A 1GKBA 1MZ5A 3PJQA 2D3SA 3DUIA 2TEPA 5JMCA 1GZCA 5JOXA 4XJWA 4XXPA 2ZZJA 1QNYA 1DZQA 4PBOA 4BLJA 1S1AA 1JW6A 4FVVA 1LENA 2KM2A 3PVOA 1IS3A 5DZEA 1LOCA 1KJLA 2YZ4A 1BKZA 1DLLA 3ATGA 4YGDA 4RL7A 1QOTA 2E7TA 1H9WA 2ARXA 1WLDA 4IQPA 4XILA 4XHXA 4LBNA 5GLWA 3QCWA 1OFSA 1NXD1 1S0GA 5JLVA 1LHVA 1YI7A 2CNAA 3NV1A 1V6LA 1WW7A 2A5ZA 2PHUA 2ENRA 3AP7A 5EYXA 2R0HA 1MS4A 1ZA4A 4M01A 4YG6A 1URXA 4XXAA 3ZPYA 4BM8A 1CONA 3B00A 3AXDA 3WHTA 2NP0A 2AH2A 2E7QA 4YZ5A 4SLIA 5GLVA 3WLUA 2DTYA 2XG3A 4L8QA 3ZYRA 3C2UA 5CBLA 1NLSA 2NM1A 1GYKA 1DBNA 3UL2A 5CA6A 5AVAA 3WG1A 4K1ZA 1LHNA 2ZGMA 1W6PA 1UAIA 1CPNA 3FLTA 1YYNA 3UJOA 4Q2FA 3WCRA 3SH5A 2GDFA 2R1DA 2NMOA 1W6QA 2DU0A 4Y1XA 2D3PA 1HQLA 3OPZA 2DVBA 1I3HA 4JCKA 5CNAA 2RHPA 1SLBA 2AGSA 2PHRA 4ISRA 4M3CA 2DUQA 1UMZA 4YLZA 5F5QA 2ZGLA 2VW0A 3MW4A 1Q8QA 5IT6A 1LEMA 3ZXJA 3POSA 4Q8LA 1LGCA 3ZXKA 1WCSA 1S0FA 3AZXA 5DZFA 4WVWA 2CTVA 5GZFA 1WD3A 4HL0A 4NO4A 5SV8A 4FPLA 5E89A 5GLTA 3WCSA 4GWMA 4GWNA 3D5OA 3OGGA 2GALA 1A3KA 3JU9A 1RIRA 2A6ZA 3IPVB 4R9BA 1ENQA 2P37A 3OYWA 1FATA 1ULCA 2YMZA 2OVUA 5CB7A 2AREA 2ZHLA 1MS3A 1HQWA 1ONAA 4YGBA 2DU1A 4NOTA 3AJZA 3GALA 3ZXLA 1WD4A 2ERFA 3H0OA 1V6JA 3ASIA 1DQ5A 3ZSLA 4K20A 4R9AA 1F31A 1JN2P 1ENSA 2EXKA 2A75A 2EXJA 3HMYA 1GZWA 4LBJA 1JHNA 5DXDA 5T5LA 5GZCA 1OKQA 1S0JA 2EXIA 1MACA 1LEDA 4Z8BA 2FHRA 3AZZA 4ATEA 1GLHA 4Y1VA 1R1ZA 4Y20A 2D6MA 2ZGRA 1AJOA 3AP5A 3Q9OA 1IKQA 1LOFA 1JOJA 1WBLA 4DFSA 3RMYA 1WLWA 2ZAAA 3V64A 2A6YA 4F83A 1APNA 4PQ9A 2ZACA 3WV6A 3DGTA 4AVTA 1QKQA 2AR6A 5IK5A 3O0WA 3BOPA 3ZVXA 2LTNA 2DVAA 3APBA 2ZMNA 5T50A 3WDTA 3U4XA 1HLCA 4YG3A 3WHUA 1GZ9A 4XJ9A 5GZDA 1DYPA 2GMPA 4Y22A 1LHWA 4CTEA 3KM5A 3WG3A 2H0BA 1VIWB 3RRDA 4FPGA 3VV1A 1D2SA 1D0HA 2WQZC 2VY0A 1SCSA 3N7KA 3D4KA 4FPEA 1G9CA 3FLPA 4XBLA 1CN1A 3WVJA 2JJ6A 4UW6A 5T5JA 5FREA 5HCAA 2WT1A 2A6VA 4YZ3A 4Y1UA 1CVNA 3T1MA 4FPFA 1RINA 2Q5TA 4BMBA 2E51A 2V5YA 2CYFA 1BZWA 2W08A 4XJUA 5DUVA 2DWRA 2ZBJA 2D6OX 4Y24A 3WUDA 1SACA 1CJPA 2ZGPA 1QDOA 4GALA 2FMDA 3WG4A 3N36A 3A4UA 1QU0A 1N1TA 1YRZA 3A0NA 5HCFA 2A3XA 5T5PA 1ULDA 4FQZA 1DGLA 2UWAA 3PMEA 1SBFA 4JRAA 2SBAA 1LTEA 4D69A 1AX2A 2ZMLA 5F9TA 3POYA 2UURA 1GNHA 3V0BA 5JOZA 1UL9A 4GKYA 4U2AA 3ZSJA 5GLUA 5JOYA 4Q1RA 5GLZA 3V0AB 2VH9A 2WT0A 2VU9A 2DYCA 1W6NA 1S0IA 1ULEA 2DVFA 2ZGOA 5KXEA 4XHBA 4XTPA 1SCRA 5KXCA 2DVDA 4FPKA 4ISQA 4Q26A 1KDKA 1QDCA 1W6QB 4M00A 5GJ6A 1ULGA 1LGNA 1JXNA 4YW2A 4YGCA 4CZSA 2UWBA 1LCLA 2ZHNA 3A0KA 4ITCA 5DUXA 4XDQA 1N1VA 3AZWA 1S0CA 3NV3A 4P9XA 2R49A 1IKPA 5T52A 3TAYA 1LOAA 1GSLA 1IOAA 1PZ9A 1QOSA 1V00A 2WT2A 1V6KA 1KDMA 1ZM1A 5T55A 3SISA 5GZEA 1MVEA 1JYIA 1YIFA 4XOGA 1GV9A 1Q8OA 1U0AA 2EXHA 2GMMA 2OUHA 1AVBA 5BYNA 2UWCA 3SITA 3WDVA 4ASMB 2R1BA 4FP3A 3OYWB 4GKXA 4P14A 5H9PA 3SH4A 1O4YA 1W6OB 1A78A 1G9DA 2D44A 2V73A 2SLIA 4K21A 1FAYA 3FUQA 3M3CA 2JD4A 3USUA 2W52A 2BQPA 3KQRA 3I8TA 1N1YA 1IS5A 1AXKA 1FNZA 3OY8B 3VKOA 1DQ2A 1AXZA 2I2SA 5T5OA 1W6MB 3VKLA 4U36A 1QGLA 1FX5A 1LESA 3AZYA 4AVVA 1LJ7A 2PHFA 2D6LX 3ILRA 3SLIA 4PF5A 4BOWA 3AXEA 3ILFA 4WVVA 1GBGA 3R4SA 1TEIA 1Q8VA 3NV2A 1MS1A 5KXDA 3NWKA 3RG0A 3T1LA 1DQ6A 1KRIA 4YGEA 3WDXA 1F5FA 2P3JA 5DUUA 1PZ7A 3TB0A 1C1LA 4XTMA 4UW3A 2YROA 4C1XA 3IPVA 3N7LA 3AP6A 4ZKTB 3IM0A 5E8AA 3HN1A 2WKKA 2ZGUA 5E88A 1FV2A 1O4ZA 1OQ1A 1SLTA 2A71A 4FPCA 2AUYA 1I1EA 4YW4A 2VW1A 4TZDA 3N35A 1F9KA 3FLRA 3OBTA 1CPMA 1C1FA 3VUOA 1DFQA 4AVSA 1UPSA 4Y22B 2WNEA 1BQPA 1C4RA 1JYCA 2D43A 2OUJA 2VW2A 4PBPA 1RITA 4GXLA 2JECA 5GM0A 3HR9A 5EXOA 1VALA 1QNWA 4FPYA 1BYHA 1LOBA 3BTAA 1KITA 2A6XA 2DTWA 4XBQA 1DHKB 3FUOA 4H55A 4DRVA 4DQAA 4LBQD 1SLCA 2JDZA 1DQ0A 2OW4A 1V6IA 2ZGQA 3AK0A 4M3CE 4XZPA 1GANA 4Q8KA 1W0PA 2A6WA 2C5DA 2YXSA 1UX6A 3VKNA 1H9PA 1UZYA 2Z42A 2CL2A 3UK9A 2ZKNA 4YG0A 3WDWA 3O5SA 3WG2A 5DZGA 1GICA 2A70A 4Q1PA 1WUVA 1G8WA 2D6NA 3M3QA 2NN8A 4Q27A 3MW2A 4FOQA 1LODA 3ZSMA 5KXBA 4LBLA 4FPJA 3AYAA 1SLLA 2ZGTA 5DG2A 4BQ1A 1WW6A 4HANA 3RS6A 3WUCA 3ZXEA 3OBRA 1SLAA 4LBQA 1MR5A 3PVEA 4AGRA 3V0BB 4TYSA 1W0OA 2P3KA 2JKBA 4XBNA 1BXHA 3WDYA 3M2MA 4R9CA 2ZMKA 1WW5A 2ZGKA 1JBCA 1Q8PA 2CWSA 2NMNA 2EALA 2WJSA 1KJRA 4AYUA 4CRQA 3MEPA 1VLNA 2WLQA 4GA9A 4DS0A 4XYXA 2A7AA 3IN9A 1WLCA 3VKMA 1V6MA 1GNZA 1MVQA 1Z78A 2HYKA 3WDUA 2R16A 4LBMA 4XIKA 4XMIA 3BODA 1CR7A 4XJAA 1PZ8A 4YW5A 5GZGA 2AYHA 1N47A 1W6PB 3B9CA 1HKDA 1DIWA 4P9YA 5H9RA 3T2TA 5T54A 4BLIA 3AYDA
chains in the Genus database with same CATH superfamily
4BMEA 1Q56A 2PHXA 3FJSA 2XHNA 2WNVA 3OTFA 3VD5A 3GZTB 4LULA 2XJVA 1X33A 1Y7BA 2ARCA 3B01A 4NIHA 4D6QA 1YC61 1ND2A 2ZA9A 1UZVA 2XLFA 5GALA 3SCGA 4W6WA 4HN0A 1KQRA 2GSYA 2PN5A 4ZXKA 3RI8A 2P2KA 1AR93 1CAUB 1Z0HA 4XE9A 2WN3A 1WMXA 2IXJA 2JG8C 3FC0A 3GNEA 3EMRA 4XUPA 5ABJC 3WNLA 5C9AC 4Y4RA 3X29B 2C9AA 3POWA 4A6SA 1MEC2 2D5FA 4JKKA 3O0XA 4QM9A 5F5CA 3WNMA 2RR13 4BXFA 4DY5A 2GH2A 1DGRN 3D0SA 2ZX1A 5F6KA 4AEDA 1XE0A 5JOWA 1ASJ1 2GN7A 3IMMA 1ZA7A 4CP9A 1L7LA 3L2HA 3OBZA 5JVVA 2X5IA 4JGZB 2RM23 5FZHA 4EWDA 5IVVA 3ES1A 3ENRA 3W5NA 1MS0A 4DZGA 4YW3A 5FMOL 4IEXA 1D2QA 4QX2A 4BXSV 5LY2A 1B35A 1JZ6A 2XQRA 1I5ZA 3M1HA 2YC2A 1AR71 4QU1A 3ZYIB 3MO4A 1RUG1 4YPJA 3AVSA 4GH4B 5FP4A 4LO5B 4XFBA 4LT5A 4MOAA 4OHYA 4UFHA 1A6CA 1RUF3 4QWNA 1ASJ3 2Y60A 4EROA 4DB5A 2NYYA 4HKLA 1F8VA 3SHRA 1YQ2A 5C71A 1UKGA 2NZ9A 1N3PA 5FUPA 5FRAA 1BMV1 1JYNA 2QKDA 2O8OA 4GWJA 4UXAA 4AGVA 5BNNB 1EPWA 4OCTA 4XC9A 4BJ0A 5HCHA 2XL7A 1W2AX 2OA2A 2YU1A 1AR73 4PCRA 2ZABA 4QQLA 3HNMA 3HJRA 3HQXA 1W2NA 3THDA 4F3JA 2W91A 1P8JA 4WVMB 4CDUA 3PTRB 2MNGA 4BPZA 1UOBA 2IWGB 1N1SA 3IDAA 3HBZA 2C9KA 1IGOA 4IW3A 5JIAA 3UNPA 2P6HA 1OOPC 3ILNA 5IVYA 4FOYA 2WSUA 2JDAA 2VZOA 2WIIB 1TZOA 4Q5OA 4DXRA 1EUUA 1NX9A 2PELA 1UX7A 4XCAA 4IE0A 3B3QE 1G9FA 1UZZA 2OQ6A 4NHMA 5F39A 4AXOA 3DEMA 4Z1VA 1DYOA 3H50A 1FMD1 2WO2A 1BBT2 1H8TC 2ZHMA 3B94A 2WL1A 1U5XA 1DQ1A 1LR5A 3I59A 5JDBA 2HBTA 1TE1B 3PURA 4KU8A 3VBOB 2DDUA 1PHMA 4AFCA 3KWVA 2A3WA 1POV3 2PQSA 4RQPB 4DRRA 4K1YA 2YC4A 3K4AA 1RMU1 1NUKA 1YQ6A 2ZGSA 3MHZA 2R6QA 2CY6A 4Z07A 3M3IA 3OSDA 4META 4PIXA 4A44A 3RZZA 5KC6A 3AKPA 1HV1A 5IAVA 2X05A 3RPQA 4J1WA 2JDNA 4INDA 1FMD3 4UW4A 4MV2A 3E6BA 1H4HA 1W05A 2VNGA 4GMP3 4XFIA 4FPOB 5FYSA 1QXJA 1US2A 1BJQA 1ULFA 4JDMA 3PUQA 3KT7A 5FK8A 1LULA 3ZSKA 2QQLA 1QJZA 5A6XA 1VR3A 2YYOA 1AL0G 3AFGA 2ARBA 4ORFA 3E1F1 4NWWA 1W6NB 3TNQA 5IK7A 1OC1A 4CUGA 2BRTA 1BEV2 1D4VB 1MEC1 3LSEA 2V4VA 4E2QA 3T2QA 4LLOA 2XJQA 3LEMA 1MZ5A 3PJQA 2JIJA 4FO9A 4XUOA 1AR62 2XOMA 4CCJA 3R4DB 1NA1B 2VVFA 1ZZ6A 1S2BA 2GC3A 4HSJA 3O1MA 4LR4A 5D2AA 5ACA2 5FPXA 1JW6A 5K0UC 2WUHA 4AE2A 1Y43B 5FZ0A 1DLLA 1ND2B 4JZRA 3U0ZA 2E7TA 4BIOA 5JCTA 4CXYA 4IQPA 1SHWB 1WLDA 4QPIA 4PI0A 1XYNA 2YBPA 5FMDA 1MEC3 1NXD1 1S0GA 5JLVA 2YGLA 1YI7A 4JTOA 5FPAA 1R082 5FZCA 1WW7A 3EB7A 4LPLA 5EYXA 5GZCA 3VZNA 4BM8A 4M01A 3H8UA 3Q8CA 4XXAA 5D21A 3MIFA 2JD9A 3EYPA 3IIAA 4CUBA 2AH2A 4LKFA 1TNFA 2YPJA 4Q4W1 4V2VA 4YZ5A 3WW4A 2DTYA 3ZYRA 3C2UA 3SEEA 2NM1A 2VQUA 4AEDB 3UL2A 3WG1A 2HWF3 1OUSA 2ZGMA 3FLTA 1CPNA 5C5UA 4Q2FA 4CP9B 2L9LA 2R1DA 4F7ZA 5I8TA 5JR2A 2X5IB 1HQLA 3EBRA 5LEKA 2ZX4A 1RUC2 1VBD2 1WGPA 2DUQA 5BNPA 3ZO0B 1PO22 1PGL2 1NCRA 2VW0A 3MW4A 1B35B 3MIEA 1HRI1 4FFIA 4Z92B 1LEMA 5K9YA 4D8MA 3WF3A 3ZLIA 1NXMA 1S0FA 1HB4A 3ZFFB 3ZXKA 3JCIA 4I01A 4AVCA 5HV0A 5C3OA 3MFCA 5D8AA 1Y4WA 1JZ4A 5E89A 4GWMA 1YQ5A 4A3ZA 4K9SA 2ET1A 4GWNA 1BBT1 3D5OA 2ET7A 4IE4A 3WW1A 3MUZ1 5FY4A 5I91A 4R9BA 2P37A 1FPN2 1ULCA 5DMYA 1OQDA 5JXHA 4AHYA 4QB6A 1ND3C 2ZHLA 3U75A 2LS6A 1MS3A 1HQWA 3LD8A 4CDQC 4FFFA 1D7PM 1W8ZA 3CZUA 4RS5A 3J7LA 4MGTA 2ERFA 3H0OA 3ASIA 4IV1A 4CDUB 2N7GA 5T3NA 4R9AA 3B93A 4FXKB 4P9IA 1ENSA 2EXKA 3DPRB 1BBT3 4KWUA 1GZWA 4E8CA 4LE3A 5L7OA 3KT4A 1NLRA 5FTTC 1OKQA 3FWEA 1VB4A 4WBBA 3MIBA 4FFHA 4J25A 1UIJA 3AM2A 4MADA 3MGUA 4RGAA 1GLHA 1TMF2 4Y1VA 5EFUA 5FMBA 1KD7A 2I07B 3C7EA 5I0DA 3Q9OA 4BYYA 3LPGA 5AC91 1H1IA 2GC1A 2FBEA 3I59B 2DBIA 4DFSA 3RMYA 1OFNA 2OZJA 4CCEA 5A3LA 5J96B 4F83A 1BEV1 2OKXA 4AL9A 4PQ9A 2QUOA 2ZXQA 5I0UA 1NY71 4JGZC 2FDGA 5FO7B 3BOPA 4FI9A 1JYTA 1HB3A 2DVAA 4XDPA 1E57A 2WO7A 5ACA1 3U4XA 1GZ9A 1DYPA 4GH4C 2BVVA 3M4FA 1LHWA 3ZKUA 4L92A 2Z69A 1H4GA 2R072 1VIWB 3RRDA 1H2LA 2W0XA 1BEV3 3H3ZA 3VV1A 4FPEA 5HV4A 1SCSA 1TME1 4XETA 2E9QA 3VN4A 1AR63 4UW6A 4W6YA 3TEZA 2WT1A 3KV9A 2A6VA 4YZ3A 1RUI2 1XC6A 4EQVA 1CVNA 1T2XA 4QKBA 3S30A 3VD3A 4CXWA 5ACA3 1BLZA 1EUTA 1RINA 3PU3A 4BMBA 4OMDA 2V5YA 2ZKLA 2CYFA 4XJUA 1MPXA 1WA4A 4YSFA 1W3XA 2FMDA 1RUC1 1VBD1 5I93A 2VBDA 1R083 2XBO2 5HCFA 2HLEA 4BZ4A 3ACIA 2A3XA 2RS12 2FDIA 2WZR1 1ULDA 1GP6A 3VL8A 5FMOS 4CP0A 3RZGA 1UXXX 1ALYA 4BB3A 5A32A 3ZR6A 2O1QA 2ZMLA 2D40A 5GKAC 3T3YA 1D4M1 1YLLA 2GAUA 2VNRA 3GXUA 1J58A 1UL9A 2LROA 5C5TA 2DFBA 5GLUA 1JZ5A 4Q1RA 2BEOA 1YNAA 2BOIA 5GLZA 3ZN6A 2J1SA 2CGNA 1RUC3 1VBD3 2WAAA 4S2FA 5FY5A 1VP6A 4K40A 1PO23 1V9U3 4AI0A 3T0AA 4LA2A 5KXCA 2DVDA 5JI7A 1I6XA 3GGLA 4EN8B 1UY1A 2BERA 5C3SA 4AI9A 2D5HA 2WQ8A 4CZSA 1RTVA 4ITCA 1NCRB 5FZBA 5FUNA 4EZ4A 1VBA3 3AZWA 5FY1A 1DGWX 1S0CA 1QJEA 2R49A 4IETA 1MZFA 3WINE 4TLGA 4KBZA 4A41A 1IOAA 1V00A 3G6JB 1V6KA 3N9LA 1FPN3 1ZM1A 4KH9A 5D8AB 4QXHA 5C4WB 4XACA 1TMF1 3FBMA 2OXBA 1W8TA 5J09A 1PNGA 1Q8OA 3JXSA 4E2GA 2WINB 1AVBA 3L9JT 3EO6A 3SITA 4XF9A 2VQ0A 4P14A 5H9PA 3SH4A 1OA3A 2ETEA 2F4LA 3WDVA 5JZGC 1W99A 2RDQA 2B4KA 2V73A 1NA1C 2XVKA 4RD7A 3ZKYA 3AL5A 4P00B 5FZLA 1FAYA 3DECA 2VD7A 2WNVC 1GR3A 4UOJA 5FPZA 3CL1A 3USUA 5IWFA 1E5SA 3F2ZA 2Y6KA 3K4ZA 3O1TA 2P3YA 3OY8B 2Y0OA 4I3PA 1ND2C 3S5AA 1AXZA 5JAXA 1PMHX 2KA3A 2BWCA 3VKLA 4ZZ5A 2R7EB 1FX5A 1LESA 4IEPA 5FBJA 3AZYA 4AVVA 2XWJB 3BCWA 3ILRA 2VOTA 5FXWA 5C8WA 3ILFA 4WVVA 2R071 1UQXA 3T1LA 3POBA 3RG0A 5IVJA 3ZFGA 1CZTA 1DQ6A 3ST7A 4P5HA 5A3TA 1W9FA 2C0ZA 4YARA 3WDXA 2CAVA 2P3JA 3DCQA 2WWUA 3LIHA 1PZ7A 3M8LA 3N9MA 1C1LA 4PIZA 4XTMA 4CCLA 4AEDC 1JMUB 3WF1A 1Q43A 3VHPA 5A7QA 4C1XA 1E5HA 2W92A 3LA3A 4QX0A 3DL3A 2WKKA 5E8AA 2X5IC 3OD0A 5E88A 2A71A 1SLTA 2WZ8A 2OT7A 4RFT0 1I9RA 4BK5A 5JI9A 3CU7A 5G05L 2VW1A 4Z82A 1F9KA 1B35C 3OBTA 5DAQA 4AHXA 3K51A 4K7JA 3C7OA 1RUJ2 3SKJE 1HB1A 5FPVA 1DFQA 2XBO1 4ZS3A 1JYCA 3G7DA 1CIYA 1XNBA 1RUI3 2LW8A 4W50A 2Q8CA 1RITA 2B46X 2QCSB 4GXLA 4AEKA 5L9VA 2JDHA 5FZEA 1RUD2 1SEFA 4EJRA 2VOVA 3I2DA 1ZBE2 4PLOA 5LBFA 3BTAA 4IGPA 1KITA 2YU2A 1DHKB 3AKQA 3N9NA 4AI8A 3BB6A 5A7OA 4DRVA 2FDKA 2W1QA 1DQ0A 2YHJA 1GANA 4QHZA 1C8NA 2C5DA 2VZVA 2YG0A 3UKVA 3UT0A 1CAWB 4PLNA 4QM8A 3DXTA 2RS13 5FP8A 4DMIA 2DBNA 3NNLA 5FLIA 4XAEA 3RNSA 4CDUC 2A1XA 5CFCA 2LM3A 3SQOA 2WDBA 3WDWA 4V2WA 1NOVA 2JG8B 1VB2A 5FYIA 1REEA 1YUDA 2ZS6B 5LBEA 1WUVA 3RZKA 4H3WA 2NN8A 3MW2A 3USSA 1LODA 5ABJB 5DAVA 1RVF2 3OEAA 4D7SA 2X53S 3IWZA 3VZKA 1JI6A 4Q0PA 4HANA 4QQPA 3P3PA 3BI3A 2OX0A 3H42B 1SQ4A 3OBRA 4R4XA 2Q8EA 1VBC2 1E5RA 4XBNA 1WZXA 2RDNA 4YW6A 4AR2A 4CU6A 4G9SB 4DINB 1LNSA 1PIV1 4LKSA 2ZGKA 3DF0A 3DXUA 1JBCA 1QJY1 3GBFA 2WJSA 3I7DA 1KJRA 4AYUA 4CRQA 2FMYA 2RJLA 4GA9A 4LHNA 4TLFA 3IN9A 3VKMA 1WLCA 2IFRA 4CDWA 2Y34A 1Z78A 5FAXA 1J3PA 3HN3A 1IQAA 1PZ8A 5LB6A 5BNOA 2VZ1A 3GHNA 1W6PB 4FSJA 1DIWA 3GYDA 4BISA 3D82A 3CIHA 2GP3A 1W0NA 1K42A 1ZYBA 3AYDA 3RZMA 4M3CB 4IUGA 2F4PA 1VAKA 3BPSA 4FQ4A 2ZEXA 1S2KA 2W94A 2GC0A 3AMPA 3LGRA 1CQ9A 2QDRA 4XJZA 3BTZA 2Y6JA 2VVEA 1ZBA2 2W1WA 4ATFA 5I0SA 4PDWA 4B1LA 1GOGA 2RS32 2IVJA 3O0VA 4Q29A 1V6OA 5E16A 2VTFA 2VNVA 2WA3A 1O59A 4RN5A 5E6HA 5K4LA 4R9DA 1YEWA 2VL4A 3JB4C 3IMNA 4FOVA 4TXWA 4WV8A 4X6QB 1DYKA 5A3NA 3ZXFA 3V0AA 2GNMA 2ZX2A 2BDRA 4GAZA 3R05A 1VJ2A 4D0QA 1BVVA 1LGBA 3ZN4A 2ZJCA 3JQWA 4IEVA 3USUB 1SFNA 2WZEA 4OYUA 5LBBA 3PNAA 3TRSB 1H8TB 3PUIA 2XDVA 4QPIC 1NQJA 5DAPA 1O8PA 2CGOA 4EE2A 1EV12 2W68A 3VDAA 2YY1A 5BNQA 1HJGA 5A7WA 2VZSA 4FP2A 1XNKA 1IS6A 2DF7A 4HONA 1WCQA 2E31A 5FUIA 4RGKA 1MZEA 2CDOA 3I4IA 5EQUA 3O1RA 3H8XA 4Y20B 2CU5A 4GQ7A 5J7MA 5CAZA 2GMEA 4AFMA 1DZRA 1QH6A 3JUUA 1RUJ3 1U12A 3KB5A 5FCCA 1W6OA 2ZX3A 2YPDA 2GNDA 1H30A 1WMEA 3HT1A 5BNPC 1LHOA 2FQPA 2D7FA 4AVBA 1NCRC 2J42A 3WNXA 1PGW2 2FCTA 1RUD3 3ELNA 4GJZA 3THTA 4A6OA 1S0EA 1ZBE3 1DF0A 2R0FA 2GN3A 1W6MA 3CJIA 2UYAA 3F95A 4ZU5A 1OKOA 1CESA 3IZOA 1ZZ7A 1BVP1 2OIIA 1JUIA 5A1LA 3MDPA 3IAQA 3OJBA 3ZM8A 4A2UA 4E4DX 4URAA 3T0BA 1DQ4A 2AC1A 2JE7A 5K0UB 2JDMA 4COVA 4FPHA 3JBG2 3D8CA 4RS5C 4D6SA 3UJQA 1RVF3 4E4ZA 3W58A 1FV3A 2LRPA 2ZGNA 4ES8A 1EPZA 1MZ6A 4IV1C 2D3RA 2PHDA 2WABA 5CFCB 1SFYA 4N9HA 1PMJX 2ES3A 1GUIA 3MW3A 4HN1A 4LBOA 1ZREA 3AJYA 2PHWA 4CDXA 3PL0A 5L7OC 3E97A 5FZ4A 1VBC3 3VKFC 4QPGA 1O7FA 3IIIA 3ON7A 3R4UA 4Q4V2 1OSGA 5B4XA 3N3HA 3B69A 4LOTA 2YBSA 3DYMA 3OBAA 2VOKA 4NIGA 1SBEA 3RMXA 4YZ2A 1C8M1 3RVHA 3T09A 2EF6A 3PUAA 2K2SA 2VUAA 1WWYA 1ZBA1 3NKTA 1QQP1 2RS31 4JKMA 2WBKA 4YFZA 5F37A 1XU2A 3GZUC 1Z7S2 4AAXA 1YXWA 1W9YA 4WZFA 2DCTA 4QD2A 5CKNA 5L9BA 3KCCA 4AOCA 1UN1A 3INAA 1UYXA 2QQKA 4W65A 4K8RB 4XDOA 4CDWB 1DDLA 1HIXA 5FO8B 4COYA 5A1AA 1WMFA 1B09A 3J9SA 2D6KA 2XVGA 1LU1A 3O1VA 4GIQA 3LA2A 4QHBA 2BBAA 3WSOA 2D3SA 4NUBA 1JZ3A 1GP5A 2IZWA 2TEPA 5JMCA 1AR91 5C6CA 2RS33 4XJWA 5JOXA 4BQ4A 1QNYA 4PBOA 1S1AA 2JKXA 2W1UA 4FVVA 3TEYA 1LENA 1IS3A 4LKDA 5DZEA 4BHPA 3GJBA 5L36A 1ND3B 2YZ4A 3LFMA 3ATGA 4N9IA 5FPBA 1QOTA 4XF1A 2ZEWA 4CDQB 2ARXA 2WFPA 4N53A 2RR11 3LKJA 5CU1A 5ANNA 5GLWA 5F2SA 4BE3A 1OFSA 2VMIA 5M0TA 2Q1MA 1J3RA 1LHVA 2K0GA 2VZQA 4OUSA 5F3IA 4EWEA 2A5ZA 5LA0A 2ENRA 3NKGA 1RYYA 4LE4A 1U5IA 4Y33A 1URXA 3GM8A 2RM21 3ZPYA 4LK7A 2VTXJ 3WHTA 1EV13 2HWB2 2X8KA 3WLUA 2ZPXA 5EJ3A 4OMCA 3H3UA 1F4AA 4D6RA 3AMMA 5AVAA 1XB9A 1OPOA 5DN2A 1JOPA 2J1EA 1E5IA 1TQ5A 4COZA 4EZHA 1UU6A 1W6QA 4Y1XA 4EWAA 4JCKA 1RUF1 3KQ4B 2VZUA 2RHPA 1SLBA 2AGSA 3NAPA 4ISRA 1O6UA 3N9PA 4L9BA 2ZGLA 5F2WA 5A7WB 3AC0A 3BU0A 5CG8A 4ONUA 4P02B 1Q8QA 4XF3A 5F3GA 3DYOA 4W8JA 3ZXJA 4Q8LA 4BQ2A 1WCSA 2HWF2 1XU1A 2FDFA 5IVBA 2CTVA 5GZFA 3WW3A 2Y64A 4HL0A 4FBFA 4MHRA 5SV8A 1XYPA 2AEZA 4QX1A 1X9PA 1ZZCA 3OGVA 1RIRA 2A6ZA 4X6RB 5EJZB 4FAGA 2QZ3A 3WP3A 4QKDA 1FATA 5JSRA 2YMZA 5I0TA 4FTBA 2XONA 4UI9L 1OURA 1YFWA 2DU1A 1XNDA 1K5JA 1NCQA 2V72A 1ODNA 2FDJA 2ZEYA 3GALA 4Q4V1 3GCWA 3ZSLA 2RDSA 3C8XA 1POV0 3OF1A 4K20A 4NPLA 1W9SA 2JDKA 3HMYA 2A75A 1XOYA 3JBG3 3T2OA 3WP5A 5KHHA 2JG9A 4LO7A 2BYVE 2PQQA 4BQYA 5K8SA 1QJX2 1S0JA 2EXIA 5E1RA 1POV1 1UYZA 2Z5WA 2ILMA 3AZZA 5F3EA 1QJU2 1EAH2 3I97A 1R1ZA 1Z7S1 4CEWA 1IG0A 5ERLA 2EIEA 4DEQA 3VBHA 4XUNA 4Q4V3 3P1IA 1JS9A 4UT5A 4E4HA 1LOFA 1JOJA 1QXPA 1WBLA 4GMP0 4COWA 2QQMA 3KHBA 5FKBA 1SZBA 4MX3A 5IW0A 3J7NA 3BTYA 2Q8DA 1OQEA 4LITA 4GMP1 5IK5A 3O0WA 4QPGB 3U10A 5KHJA 3ZVXA 2H0VA 2QTWB 2LTNA 2B5HA 3IB3A 4IE5A 4OI0A 5FXVA 5T50A 3ZFGC 3ZYJB 4YG3A 1Z7S3 3D3AA 2PHLA 4HSLA 5A6YA 4Y22A 3MFAA 4XZUG 2IXHA 4FXGB 2RJKA 3WX5A 2VCCA 4KGGA 3ZXAC 3TN92 1IHMA 4QX7A 3ZMOA 3UV9A 4DXZA 4BCUA 3BALA 1PX3A 1LB2A 4KMQA 2VO5A 3D4KA 4XBLA 2RG4A 4FTEA 4LJHA 2R063 2JJ6A 5FZKA 2WA4A 5FREA 4Y3OA 1UOFA 3T1MA 1XSRA 4JDOA 2HWB1 3R0RA 1JOBA 2Q5TA 4FT8A 2E51A 3WQ7A 3OD4A 4QXCA 3NJZA 2XUMA 2ZBJA 4CU8A 3H3LA 1O4TA 1RGSA 1Y9QA 2ZGPA 3LAGA 1RUH2 4GALA 5KR7A 3BPZA 3CJXA 3WG4A 1IPSA 5FP9A 5FYTA 3N36A 5C7GA 5JZGB 1OD3A 3H1WA 3SMHA 2WNVB 2C6SA 3LEGA 3ZSEA 2Q1FA 2WC2A 1XBFA 1JYXA 3ZPOA 4N53B 3EXUA 4JRAA 2SBAA 1FXZA 2HWB3 4D69A 3K46A 2G9GA 2HWF1 3ME2A 2FD8A 3MBWA 5FZGA 5JMOA 1GNHA 5CZKA 5JOZA 4GKYA 4U2AA 1RXGA 4Q0SA 5G04L 3ZSJA 5CFCC 4OULA 1FOD2 1X9TA 1OXCA 3RYRA 1AHSA 2JEMA 1L7QA 1AYM3 4CPBA 1UOJA 2WT0A 2VU9A 2DVFA 1S0IA 4NHLA 1XE8A 2ZGOA 1CZSA 4D94A 4XTPA 1SCRA 4LXLA 5LATA 3LZZA 2W87A 4QKNA 2XMLA 4HKWA 2JXAA 2BGOA 4ISQA 1KDKA 1W6QB 1OH3A 4OHVA 5GJ6A 4A42A 2LUWA 3NAPB 3I2FA 1LCLA 3THPA 2ZHNA 3TEWA 1CJDA 1BK1A 2Z79A 4DIQA 3FHAA 3J4UH 4P9LA 4XDQA 1N1VA 5FYZA 1D0GA 4QX8A 2FCVA 1V9U2 2WN2A 1GSLA 4CYDA 2HWE2 1H0BA 1QJX1 3J26N 1PZ9A 1KDMA 1PVXA 3AKTA 3S6PA 2W9XA 1MVEA 1ENXA 1QJU1 1EAH1 2HKXA 3C7HA 3BGAA 4OLLA 4CDWC 1PNFA 1UPIA 2Y33A 4XOGA 1GV9A 1U0AA 4H7MA 4O65A 4A4AA 2GMMA 3E6DA 3IAPA 2XQXA 4CUCA 5BNOC 2JE8A 5BYNA 4E8DA 2UWCA 4ASMB 5JWPA 1G9DA 1VBA2 3ES4A 1A78A 3LEKA 2D44A 4FAHA 5BV6A 2SLIA 3LPFA 5I8YA 5A80A 4LA3A 5F1RA 1WLTA 2JD4A 3I2IA 5FPLA 4NIIA 1UWWA 1NCQB 2DCKA 1AL22 1QJX3 1YQ8A 2VMEA 3I8TA 3KQRA 4X8PA 2X10A 5FYUA 3M7AA 4PDWC 5SV5A 1QJU3 1EAH3 4HMZA 2GH8A 3I2GA 2P5BA 4IESA 2Y38A 1QGLA 2QZ2A 1GWMA 4NN0A 4YVSA 3RFRA 3W21A 2WFF2 2D6LX 2JG9B 4PF5A 4BOWA 3GDBA 1JZ8A 4RFRB 1W2UA 4GWIA 3MV01 4AVAA 3NV2A 5EIYB 3WY6A 5KXDA 2WAOA 2YFZA 4CEWB 2YUEA 2Z4FA 3RI9A 3VBHB 1RB8G 4BQXA 1RJ8A 2QVSB 5LK7B 3A21A 3ETPA 4CXXA 3QH7A 3PUHA 5HXMA 3IPVA 3PVBB 2MEV2 4XFGA 1JU3A 3IM0A 3U14A 2BFUS 3N4MA 1IG3A 3IT8A 5IATA 4P9GA 5FXXA 1VRH2 2AUYA 2VBBA 3H1MA 3TN93 2J7MA 2WQ4A 3HQRA 1VBE2 1RUH1 2BW8A 4CCKA 4AW7A 3FLRA 1AR61 2QQVA 1C1FA 1KS4A 4C0BA 3VUOA 4BK4A 3OUIA 1O3RA 4Y22B 3LDRA 1BQPA 1C4RA 4IE7A 1PVC2 4JKLA 4QU2A 2JWPA 2JECA 1UD1A 2JDPA 1RL3A 5B2GB 5EXOA 1H6YA 3PIJA 1VALA 1QNWA 4LO4B 1LOBA 3RDIA 3MIHA 3BOWA 2A6XA 2O14A 1F15A 3V56A 2FZ2A 3MIGA 1TG7A 1RC6A 1RUH3 4LUMA 1R081 1SLCA 1WMDA 3VHRA 4CP2A 1V6IA 3AK0A 2BWAA 5HI0A 5CFDA 1RUNA 4XFFA 3CJIC 4XABA 1UZYA 5FZAA 4OVEA 2G1MA 3POJA 5DZGA 4N43A 4MXWA 3I2KA 1G8WA 3VZMA 1AYN2 3ROUA 4LBLA 4UBGA 3AYAA 4UWDA 4F8AA 1FOD3 4B1MA 3U4SA 1WW6A 1PO21 1V9U1 2WZPP 1PGL1 2HWE1 3W5MA 4Q4X2 4XCBA 2XR4A 3HQUA 3PUSA 4LBQA 4YVWA 2OZ6A 3VBSA 5FWJA 4CSWA 1V70A 2XJPA 4QPIB 5FY9A 1GFF2 1UMHA 4TYSA 4XW3A 1H1MA 3MI8A 3K2OA 2JKBA 3O1SA 2VOWA 3WDYA 2RMU2 1NKGA 2ZMKA 4CCCA 4B7KA 4XPVA 2PAKA 4YWAA 4CDXC 1J84A 1R093 2CWSA 2NMNA 4UFLA 1VBA1 4QPGC 3DN7A 3MEPA 2B8MA 5JIUA 4AK3A 1L7RA 3ZFEA 2WNUA 2B42B 2QBXA 1QJFA 1MVQA 2HYKA 4AHZA 4XMIA 4YW5A 1FPN1 3KSCA 5GZGA 2HWE3 1AL21 2AYHA 2PTMA 3B9CA 4RSUA 3ZDVA 2E26A 3I54A 4HOOA 4AAPA 5DPNA 3ZMNA 4RYDA 5L9RA 2QNKA 3FBYA 5BNPB 1OLRA 3V65A 4FOWA 4A45A 3AMHA 5DG1A 5J3UA 5FKCA 5A7NA 1WW4A 1PO13 2XKOA 4O9GA 1YJKA 2AEYA 3AYEA 1F5JA 3AP4A 4XF4A 4Z2AA 1SBDA 2DV9A 3UGHA 1U5ZA 5LA1A 3A22A 3AX4A 4W4ZA 1AF9A 1AL23 1NLQA 5FY8A 4AQTA 1N3OA 4D7YA 4GULA 1AXYA 5LW9A 1RUE2 4A7ZA 1V6NA 1GQHA 2UYBA 3SC7X 2XJSA 4D3WA 2ZTNA 2WFF3 4XQDA 5IK4A 1JYWA 1VRH1 1G9AA 2E6VA 3NJVA 2DURA 3CNAA 2Y6FA 3LFIA 2PHTA 4N53C 4RS5B 2ZAHA 4QGNA 1O8SA 3FFZA 1Q8SA 2DUPA 3S57A 2W2IA 5LK5A 1PVC1 4IV1B 3LDBA 4KQ7A 1AX1A 5FYMA 4YRDA 5IVCA 1GZTA 2XLAA 1GZWB 2WSVA 4AEJA 3E5QA 2MEV3 2X09A 1HRV2 3AP9A 4L99A 4TN7A 3VZJA 5L7OB 1HXS2 4QDQA 5FPUA 2IUWA 3AYCA 1VRH3 2ARAA 1YO8A 3LCPA 3TBDA 3LA7A 2QDNA 2BNNA 1VBE3 1LU2A 4AI3A 3SNMA 4BQ3A 4SBVA 2FCUA 3WP4A 1MS9A 3UETA 1RUI1 2V5DA 5F3CA 4L97A 3NAPC 1PVC3 3HWJA 4NHXA 2VMGA 4EN9B 4LOSA 3O1OA 2VMDA 4RA0A 1I5PA 3NJXA 3ZYGA 2A3YA 3A23A 2J1UA 3HVDA 1S0DA 1VRBA 1AYN1 3PIGA 4OI4A 4CEYA 3N7MA 2YV8A 4YM0A 5DUWA 4JC1A 3WF0A 5FZDA 5H9QA 4DXSA 4R52A 3N7JA 4AZZA 1LOEA 4YM1A 4IEZA 1LHUA 4ZS2A 3KV4A 1G86A 4PI2A 2RS11 2VXJA 1HDKA 4P9JA 4UW5A 5FR3A 1ZRDA 1UF2C 4C1WA 4OZXA 3VBFA 4XIOA 4Y5Z0 2RMU1 5I0RA 1VMJA 4JGYA 3OEBA 2QQUA 4UAPA 4M3CF 3U11A 1FNYA 5FZ1A 4YFWA 1AYN3 1NCQC 1ODMA 2J22A 4PT6A 5HCBA 4I2OA 3FN9A 4P9WA 5JSPA 5EP9A 1WCDJ 3ZYPA 3DV8A 1S55A 5IUQA 1KS5A 2ADDA 4YW1A 4YW7A 4M0HA 4N43B 4Q4X3 4Y26A 1ENRA 4MXWB 2JG9C 2P34A 3WZ1A 4MYEA 1LOGA 2EIGA 4LO8A 2QQIA 2RMU3 5EJ1B 4CEWC 3BTXA 3K75B 3MPPG 3AZVA 3W59A 3WF4A 4BQ5A 4BWOA 1ACCA 1QMJA 4LBQB 1W8UA 4YVWB 3B7MA 3VBHC 3CHXA 4I0WB 1LOFC 5A32B 3MLKA 4LMFA 1CIWA 2B45X 1OH4A 5DQ0A 3U37A 3THCA 3MZHA 4H7LA 3K77A 1OLQA 3M3OA 1XNAA 2VZRA 5J1XA 2J1VA 5LASA 3RSJA 2JDYA 4XMAA 1LAJA 2HJIA 3ZN6B 5A3PA 5C8CA 1IQDC 1RUE1 3AFKA 4Y1ZA 5EZWA 5FV3A 3SXWA 2CWMA 1UY0A 2QQJA 2QE3A 2WNUB 3KGZA 4XUQA 4DUVA 5FQ0A 5EWSA 3ZYFA 4DOUA 4JQRA 5JUVA 1UZ0A 4TWTA 4CVUA 3POGA 1GKBA 3DUIA 4UFJA 1GZCA 1UYYA 1HQNA 2BPA2 1JZ7A 1QY4A 3KLSA 4XXPA 1W90A 1O91A 1DZQA 2ZZJA 4Z2WA 3H8RA 2UY8A 2PYTA 3PVOA 3WXPA 1LOCA 4MG2A 1BKZA 4YGDA 5LWBA 1RUE3 4QDRA 3VLBB 2KR2A 1H9WA 1GOHA 4MSVA 4XILA 1W28A 4XHXA 4AI2A 2IC1A 1CAVA 2P4EA 2YBKA 5FOJB 3S7IA 1SFPA 1JHJA 1OPMA 3O14A 2J1RA 3UGFA 4QX5A 1MS4A 5FY7A 5KHIA 3KV6A 1WCUA 1CONA 3B00A 2BJSA 2NP0A 2E7QA 4SLIA 2XG3A 1NLSA 1XXNA 5CA6A 2I74A 4K1ZA 4OHXA 3VBUA 1HRV3 3UJOA 4X8NA 3SH5A 1HXS3 5CADA 1PM7A 2NMOA 3A7QA 2D3PA 3IBMA 5CNAA 2DVBA 3ECQA 1RHI2 2WR9A 4HVRA 1GWLA 4YLZA 1RUJ1 4B3NA 3KHCA 3B02A 4NPRA 1OA4A 1O5LA 1UY3A 2VECA 3LF7A 5IT6A 5A70A 4PHZA 1M4WA 3T2PA 5FYYA 1LGCA 3GCXA 1JU4A 4ZHNA 5DZFA 1RUD1 4W6XA 3ZFGB 1J59A 1GMMA 4JTNA 1ZBE1 1CAUA 3WCSA 5GLTA 2EIBA 4HK9A 2GALA 1A3KA 1MQTA 1YI9A 1OF4A 4XFCA 1YHFA 3I2JA 3OYWA 4MH0E 4MGYE 3C7GA 4Y4YA 3VDBA 2WWJA 2OVUA 4WM8A 3VZOA 5CB7A 4YNIA 4ASKA 4UYBA 2VMHA 4QXBA 4NOTA 3AJZA 3ZXLA 1WD4A 4ARXA 1V0AA 4NRPA 3CO2A 1JYVA 1DQ5A 4EYUA 3LDKA 1GP4A 2KXLA 4TSVA 1OF3A 1JN2P 1RXFA 1RVF1 3VDDA 2EXJA 4BIFA 2VCBA 5DXDA 1JHNA 4BH9A 3E6CC 2K46A 2JX9A 1O3QA 3PTYA 1C5HA 1MACA 2XKPA 3UESA 1LEDA 3AMQA 2FHRA 3VBFB 2VZPA 2X29A 1VBC1 1REFA 1AJOA 4N7UA 3ORJA 1TVGA 2HWC2 4NROA 1IKQA 1WLWA 1KFXL 2XJUA 4M4PA 2ZAAA 1UO9A 1HX6A 4DUWA 2MHFA 3ABZA 1OMIA 4Q4Y2 3O7OA 1HN1A 2ZACA 1H2NA 2C1FA 3WEZA 4YVSC 1POQA 3WV6A 5APAA 1CWPA 4AVTA 5BNNA 2AR6A 4KNCA 3OPWA 2Q0AA 4NRMA 5LY1A 4RHV2 4I0BA 5DAXA 2BOJA 2VUCA 3CDZB 2ZMNA 3WDTA 1OT5A 1HLCA 4TTGA 2RS52 3T30A 5LBCA 5JXJA 2W3JA 2NPIA 4NIDA 2O0OA 1UIKA 3PLQA 2Y6HA 5CG9A 1ZRRA 3WG3A 2P17A 4FPGA 2EICA 3KT1A 2VTXA 2WQZC 1G9CA 2VY0A 3RJ2X 5FZIA 2A73B 3UKTA 3FLPA 3I3DA 5A3MA 3WVJA 5IVEA 5T5JA 4QDSA 5C8CB 5HCAA 3GF6A 4NMIA 2GP5A 5FQ0B 1PMIA 4ES9A 1KEXA 4CP1A 4JHTA 1RUOA 2EVXA 3VBOA 1KGYA 3TOJA 2W08A 1BZWA 4IGOA 2IXCA 2BFUL 4RQPA 2RVAA 5DUVA 2D6OX 3KGLA 1SACA 4CPBD 5BNOB 1CJPA 4OUEA 3FHIB 2R062 1RHI1 1SMVA 5LCWL 2K9ZA 4GD4A 4JVAA 4A7KA 1DLCA 4NWVA 4LQRA 1YRZA 4FCAA 1EV11 3BN6A 3CMGA 3LEIA 3VD9A 4BA6A 3O1PA 4JQTA 2XWBB 4LIUA 2UWAA 4P08A 1LTEA 3LE0A 3LOBA 1QH7A 5CFDC 1CAVB 3VB9A 4PDWB 4QB2A 3POYA 5JR7B 2VMFA 2UURA 5F32A 1W8NA 4LHSA 5J48A 2Y8KA 3KF3A 1Q3EA 5J36A 1NZCA 3JQXA 4OHZA 3V0AB 4N43C 2VH9A 4C0HA 1RHI3 1WCKA 2VC9A 2W5FA 1W6NA 1ULEA 5FYBA 1CGPA 4XHBA 4FPKA 1RMU2 1UNBA 4HZFA 3I2HA 3B5LB 1PGW1 3NRUA 5CKQA 5FXZA 1NAEA 4YVWC 2WS92 4YGCA 4YW2A 2YB7A 1W9WA 2UWBA 2R043 3VBSC 3GJAA 3A0KA 3P6BA 5DUXA 3W20A 1HW5A 2JB8A 3VHOA 2TNFA 1AYM2 5KBFA 2OYZA 3POIA 4B8EA 5T52A 3TAYA 4AFBA 3POEA 4RR3A 2E33A 3WQ1A 3BYWA 2WT2A 5FDBA 2TUNA 1DGRA 3SISA 3VBRA 5T55A 5GZEA 2VQAA 3ZFEC 2WNUC 4EV0A 1YIFA 2EXHA 4QAWA 5F8PA 2OUHA 2WWSA 2HWC1 1MQTB 2R1BA 3BVCA 3OYWB 3Q8AA 4GKXA 3OUHA 1O4YA 1W6OB 3JBG1 1K45A 4WM8B 4Q4Y1 4HVOA 4K21A 4EN0A 3FUQA 2HYXA 3CLPA 1LKNA 1OVSA 2BQPA 1O3TA 4RHV1 1BCXA 1IS5A 1AXKA 1FNZA 1DQ2A 1X7NA 2P1BA 3BU7A 4IEOA 5KWRA 4ZU7A 1W8OA 4QMAA 2RS51 2PAMA 4CCDA 5FY0A 1W6MB 3CJIB 2HWD2 1C5IA 3VDDB 1JUHA 4CU7A 1S2EA 2HWC3 1LJ7A 5FZ3A 1GBGA 3OG2A 2FZ1A 3R4SA 1Q8VA 2VJXA 1MS1A 3IDBB 3NWKA 4Q4Y3 3ZFFA 2CAUA 2CSGA 4HBNA 3T0DA 1KRIA 1OA2A 3QH6A 2IVIB 2Y0IA 4YGEA 5HXVA 3ZYHA 4K6BA 2WRAA 4AEMA 1NE6A 1ULPA 4XEZA 4RHV3 3NMBA 5BPXA 4JHZA 4GZ9A 4Q4W2 1XYOA 2Q1ZB 4ZKTB 2RS53 3AP6A 4CE8A 3HN1A 4KG8A 2ZGUA 1FV2A 1OQ1A 2E32A 4FPCA 3KF5A 4J6GA 3UYJA 3PHMA 3VD4A 4QX3A 3AVRA 4YW4A 1RUG3 4TZDA 4FFGA 4CDXB 3N35A 4NAOA 1K3IA 2Q30A 2R061 3C3VA 2QQPA 4DUXA 2R32A 1ZNPA 2IXLA 4G4FA 3HNBM 2ZCWA 1HRI2 2D98A 3OGJA 2OUJA 3DPRA 1YQCA 2ZOEB 4XQWA 2VMCA 3HR9A 3MLLA 5CYYA 4FPYA 4K8FA 1BYHA 1W03A 4IL7A 4KI5M 3T4HB 5FJKA 4XBQA 4LBQD 1WA6X 2CDPA 4XZPA 1DGWA 3KZ4C 4CEYC 1W9TA 1XNCA 2YFUA 4COUA 3M70A 4NIAA 4E2SA 1QXRA 2YDEA 1X8MA 3J7MA 2XXZA 1H9PA 5J98B 3VKNA 2CL2A 3U07A 3UK9A 5CEHA 2KD7A 2ZKNA 5IFPA 5KHKA 3O5SA 5AFBA 1GICA 2WS91 3HNYM 2D6NA 3JB8A 3M3QA 1VMHA 1ZX5A 4FOQA 3ZSMA 3SCHA 3VBFC 3KCYA 1AYM1 1IPJA 1SLLA 2F17A 4UFKA 3WQ0A 3J7HA 3K4DA 4JGYC 5DG2A 3WNKA 4CU9A 2GZWA 3ACLA 3SEPA 4AG4A 3LWCA 4KWLA 1SLAA 4IERA 1MR5A 1YJLA 4IEWA 4HVQA 1DP0A 3RGBA 3S5QA 2P3KA 1RMU3 1BXHA 4LKEA 1SPPA 3EJKA 3M2MA 2VE1A 5AC92 2JIGA 1WW5A 4OUMA 4LHKA 2DCYA 4R4ZA 3MV11 2WS93 5FIXA 2WO3A 3DYPA 2EALA 5HPOA 4GB32 1VLNA 2WLQA 3AL6A 2W95A 3QACA 1US3A 1PK6A 2A7AA 4Y5TA 1YCIA 1NY72 1V6MA 3MIDA 3WDUA 3B9IA 4XIKA 4K3UA 3BODA 1CR7A 1VE0A 4URTA 1UOGA 5A6ZA 1HKDA 3MUY1 4A3XA 2IXKA 1K12A 3AKRA 3T2TA 5T54A 3FHQA 5FP3A 3HPNA 4BLIA 2HWD1 2VVDA 2XPJA 3FE5A 4ARYA 1R092 2VZ3A 3OB8A 3RYKA 1G7YA 1XRUA 2XJRA 2ZHKA 2E53A 1VAMA 4RR3B 3I3MA 2WYSA 2VPVA 3QLQA 3RQ0A 5C8CC 3VBRB 4XF0A 2OPKA 2XUEA 4EN7B 1TME2 2YC0A 2D6PA 4ZONA 5FP7A 1K5MA 2EAKA 5DDJ2 4J1XA 1AJKA 3NO8A 4QQ2A 1W2TA 4UFIA 2B7YA 2PFWA 1LECA 3SKVA 2HWD3 4MUVA 1XQNA 5A1FA 1FT9A 2Q8OA 2VOXA 1QOOA 4B4PA 3ZIXA 1PO12 2BGCA 4N90A 3MYXA 5FZMA 3WNPA 4XQ4A 1F4HA 2VM9A 2PLV2 5IAXA 1OHFA 1WBFA 1A8DA 3LSDA 4XFAA 4MGKE 1EYBA 2JENA 2QQNA 4IXLA 4O61A 4JDNA 1JTZX 2H6CA 2WZR2 2B9VA 1OBNA 1W06A 4Q4W3 2W46A 4V1PA 5JSOA 5FZ7A 3SH3A 4B4QA 1AZDA 1GQPA 1YFUA 3NSTA 2DUOA 5C4WA 1D4M2 3IKWA 4LK6A 3CKHA 4PQQA 3TN91 2AZ5A 4MGIE 2P3IA 3JD72 2VXRA 3M3EA 3OCPA 4I09A 3KD4A 3PDQA 3I3EA 5L73A 3VBUC 3WR0A 3RWKX 1SDWA 1VPHA 1QEXA 1X50A 4B7EA 3PVNA 4BU2A 3ACHA 4AWDA 2VUJA 4YM2A 3KVBA 4AGGA 1J1TA 1HRI3 1AR82 1GQGA 3NV4A 4DO0A 4DNYA 4DY3A 2XL9A 3PJYA 3S7EA 2TBVA 1QF3A 3K3OA 1REDA 4WM7A 1IPKA 2GU9A 4YZ4A 3OY8A 3ITQA 1ZRCA 2C24A 4IE6A 4MGQA 1HN0A 1RJ7A 1HB2A 4ET7A 1VAVA 3BIWE 4IEQA 3OUJA 1GOFA 4GJYA 2VZTA 4IV3A 5F6LB 4I30A 3WNOA 1S0BA 5FYCA 5FZOA 4E4SA 4YZ1A 2W39A 5FYVA 1MQTC 1YIPA 2DCZA 4LBKA 1EY2A 4DPNA 4Y1YA 1MS5A 3O12A 3H8OA 4ASLA 2GNBA 2F6BA 3OPTA 2VBPA 4WM8C 1MS8A 4Q0VA 5FK7A 1Y3TA 1M06G 4XJ8A 4KBBA 1U5YA 3BIEA 5A33A 5IK8A 4GB31 3L2YA 1FOD1 2GNTA 3OOXA 1ZZBA 1COV2 3SCFA 1C57A 3ZXDA 4YM3A 3T4VA 1W8WA 3K3NA 3NNMA 5LZ6A 3Q8EA 1N3QA 1UZWA 5A7PA 5C3RA 3VDDC 3WOGA 2PXJA 1SLIA 2AENA 4NVPA 5C3QA 2RE9A 3E5XA 2Y26A 5IJRA 1J3QA 5C3PA 3VL9A 1R091 1SG3A 5AC93 1UCXA 1X8EA 4QPWA 5H9SA 5A3WA 2GC2A 2QFEA 2UU8A 4MHUA 4CCMA 4GB33 2DVGA 2XLGA 2PA7A 2XB6C 1UYPA 3VHNA 3FMGA 3P3NA 1CAXA 2G4IA 4PLMA 2JE9A 5EYYA 4AQ6A 1SPPB 2Z2SB 5C33A 5DDJ1 1T6BX 3WQBA 1R1A2 1IS4A 1H2MA 5BNNC 2LALA 5K7PA 5FLHA 3VDCA 1JH5A 2D97A 1DZTA 1PK6B 2IFWA 3NL1A 4JAAA 2JDUA 1CAWA 2WNOA 5LRRA 5A3UA 1FYUA 1DG6A 1G9BA 1AX0A 1PO11 4MGSA 3D6EA 3HT2A 1Y9GA 3ZDSA 4Y5SA 5AVPA 4HPKA 5CISA 4N7IA 3ZOIA 1W3VA 2JG8A 1NYWA 1PX4A 1TME3 2PLV1 2G9ZA 2CGPA 1UW8A 1SDDB 2YGMA 4LHLA 1VBB2 4O9EA 5ABJA 2RDRA 4KGQA 5C9AA 4BLJA 5DDJ3 5A6QA 5JXGA 4ZPIA 2KM2A 4M0NA 5FYHA 1KJLA 2E63A 2WFF1 4RL7A 3ALQA 3ACFA 3GZEA 2Y6LA 4CUAA 1K5MB 2G19A 4LBNA 3JD71 1W39A 2QQOA 1J83A 3QCWA 4IEYA 3VBOC 3NNFA 1QWRA 3FFQA 2CNAA 3NV1A 4L2NA 1V6LA 4RQPC 2PHUA 3NJYA 3AP7A 4H14A 2R0HA 4KWKA 1ZA4A 4YG6A 2XVLA 2PLV3 1YFYA 3FX3A 3AXDA 3MICA 2UY9A 4PJYA 2WZR3 2RV9A 4MXVA 1AR81 4L8QA 5GLVA 2MEV1 5CBLA 4QHOA 2QQWA 4HETA 1O3SA 1GYKA 4FTSA 1DBNA 1LHNA 1W6PA 1UAIA 1YYNA 3WCRA 2BBVA 1D4M3 1HV0A 2GDFA 2OQ7A 3OGRA 3ZR5A 3I49A 1ST8A 1VBE1 2DU0A 3HEIA 3JD73 2BVBA 2WYFA 3OPZA 1I3HA 1XSQA 4NJ4A 2VQTA 4M3CA 2PHRA 5F5QA 1UMZA 3PMSA 2P6CA 5D1IA 3MF6A 4YVSB 4H2AA 5TSWA 3POSA 4Q0UA 2WLPA 1AR83 3AZXA 3H7JA 5J37A 3BUCA 4WVWA 4C91A 1GNYA 4ZY9A 1PIV2 1WD3A 2H6BA 4NO4A 3K48A 1QJY2 1OLMA 1ZVFA 4FPLA 4S2HA 4XUTA 3AKSA 3OGGA 1COV1 2R30A 3JU9A 4KG0A 1GU3A 4LNVA 1OOPA 3IPVB 5ISLA 1ENQA 3GBWA 3Q8BA 4AFDA 5FLJA 4OQ9A 1H1AA 4QXKA 4WM7B 5F7UA 2AREA 1YWKA 4NRQA 5FZFA 1ONAA 4YGBA 1C28A 4NPMA 1TMF3 1JZ2A 4RR3C 1H8TA 1EP0A 2MPFA 2VCAA 1AUYA 3VBRC 1V6JA 2BZDA 3ETQA 4LO6B 4IV3B 1ZRIA 4QQHA 5C70A 1YFXA 1CZVA 1F31A 5FZOB 3S0MA 1CX4A 4LBJA 5T5LA 1COV3 3WP6A 2VULA 2VR4A 2C26A 4MO3M 4Q4X1 3EQEA 4WZCA 3CEWA 2BNMA 3VD7A 5LA9A 4Z8BA 4ATEA 1R1A1 4Y20A 2D6MA 3ZX7A 5A33B 2ATFA 2NQYA 1UKRA 2ZGRA 2XJTA 3AP5A 4QGMA 2B9UA 5BUVA 2ID4A 4I02A 1W8FA 2XGXA 3N9OA 2VAUA 4L11A 4RGGA 3N9QA 2EIDA 3IDCB 3ZN5A 3ZIWA 5CFDB 1OUXA 4QB1A 5F5IA 2A6YA 3V64A 2O8QA 1APNA 3O1UA 2R073 3EHKA 3DKWA 4G3YC 3DGTA 1QKQA 4HG6B 4MGZE 1UXZA 1F35A 1NE4A 1W2OA 2I45A 4XAAA 4ZZ8A 1VBB1 1R64A 3ZFFC 3APBA 3WHUA 1R1A3 3HAGA 1WKYA 2HEYF 3QD6A 4XJ9A 5GZDA 2GMPA 3NQHA 1NG0A 1UU5A 4QGLA 3RWNA 4CTEA 3KM5A 1CAXB 2D93A 1J1LA 1O5UA 2H0BA 1Y9MA 2CHHA 1CX1A 5I8SA 2IXIA 4I3GA 5BXXA 3VBSB 4UF0A 1STMA 1D2SA 1D0HA 1W8HA 3N7KA 4JV4A 3KV5A 5K0UA 1CN1A 3KMHA 5AFEA 4B29A 2VCMA 3NVCA 1IZ3A 1VBB3 1NQDA 1QHDA 2J1TA 2XBO3 4LUKA 4FPFA 4Y1UA 3U78A 5FZ6A 4QPYA 2C4XA 3H7YA 2VG9A 4NHYA 4S2GA 4OQ8A 4IDZA 3KVAA 4HPKB 3ZFEB 1OD5A 4HKOA 2DWRA 3DPRC 4Y24A 5DAWA 4AI1A 3WUDA 5IYYA 5IFTA 1QDOA 5C9AB 2BU9A 2Y6GA 2BGPA 3A4UA 5HBAA 5L19A 3J8F2 3TEXA 1C3HA 1QU0A 1N1TA 3A0NA 1XE7A 5F5AA 5T5PA 4FQZA 1DGLA 2ORXA 3PMEA 1SBFA 1ZZ9A 3HBKA 4A7YA 3D0JA 2JICA 2BV4A 1AX2A 1HRV1 1H2KA 4OFGA 1TNRA 5F9TA 4HXCA 1HXS1 4N8MA 3V0BA 3OGSA 4CCOA 4HFSA 5JOYA 5EPAA 4OI1A 1HJFA 2DFCA 4OI2A 2ZZQA 5JPMB 4C90A 4YYOA 2DYCA 5KXEA 3I3QA 5BY5A 3T08A 2DCJA 5LA2A 4AQ2A 5JXIA 2VNOA 4MVTA 5LRSA 4UBHA 4XURA 2VUDA 4KL1A 4LLFA 4Q26A 1QDCA 4M00A 1ULGA 3ACGA 2B39A 1LGNA 1JXNA 1OI6A 5A7SA 1Q5OA 4EN6B 2PAEA 3BKZA 1L3JA 2XH6A 5KHGA 1C8M2 1PGSA 1PIV3 5EV7A 2HEWF 1QJY3 3NNGA 3E5UA 3CBNA 4NE9A 4IGQA 1ND3A 1ULOA 3NV3A 1X82A 4P9XA 2HH9A 1IKPA 1KFUL 1LOAA 1QQP2 1XPWA 2XHKA 4CDQA 3MF9A 4LTAA 3WD5A 1QOSA 1S4CA 4HT1T 4S2DA 1JYIA 3JZVA 4HLTA 1PK6C 4NR1A 2FDHA 5FBZA 2HBUA 4XVHA 4I0AA 2Q4SA 4NAMA 3VZLA 2R042 3AMNA 3U1XA 4C8DA 3TWIA 1OOPB 4FP3A 5B4NA 4QQOA 2WO1A 1CD3G 3HIFA 4OHWA 2JB4A 3M3CA 3ZXGA 3RZLA 3IDEA 3H1YA 4JRLA 2W52A 2V4AA 3TYJA 1AR92 2RJ2A 5FMCA 5JPNB 3R6SA 3RYPA 1N1YA 3VKOA 4PF1A 1GWKA 5ANQA 2I2SA 3LIGA 3W9AA 2W1SA 3GHMA 4CEYB 3KS7A 3MPBA 5T5OA 4CCNA 1K5MC 2BP6A 4U36A 4XFHA 5FZ8A 4CA9A 3DKQA 4LORA 4JGZA 2PHFA 5FZ9A 3SLIA 4MLOA 3AXEA 1LRHA 2RR12 4R8HA 1TEIA 1UY4A 4L0PA 1X36A 3KCXA 3MLJA 5FOBB 2G9FA 3FZ3A 5CIRA 4E27A 5CVRA 3NNJA 3P5BA 1ZZ8A 1H6XA 4ZXEA 1F5FA 4AF9A 3CQOA 2ZEZA 4GH4A 5DUUA 2RM22 4ZU4A 3TB0A 4HK8A 4JGYB 4M4RA 5CKMA 2PMWB 4UW3A 3I2OA 2YROA 1QIQA 5FWEA 4OZOA 3N7LA 3RJRA 2OS2A 3Q8FA 3NW4A 3AB0A 4QT6A 3RZJA 1O4ZA 2HEVF 1UU4A 4KWJA 4B4RA 1UY2A 1A34A 3FL7A 1BHGA 1I1EA 2EA7A 1RUF2 1ASJ2 1CPMA 3I3BA 5C4WC 3H9AA 2AACA 5D8AC 3J8F1 4BDVB 4AVSA 4WVZA 1UPSA 1BK0A 4D7TA 2WNEA 4O7XA 2D43A 2VW2A 4PBPA 5FJHA 4NHKA 4WVMA 4UFMA 2V09A 4UF0B 5GM0A 4Q0QA 3WNNA 3QOPA 2J1AA 1AR72 1FI2A 2EAAA 4LIVA 3WW2A 3PU8A 1RUG2 3HOBA 1F2NA 2VGDA 2OPWA 2DTWA 5LEJA 3FUOA 4H55A 1NT0A 4WM7C 3GBGA 4DQAA 2JDZA 2OW4A 5EHDA 2ZGQA 2BTVC 4KU7A 4M3CE 4P5YA 1JODA 1W0PA 3J8F3 1PM4A 2A6WA 3POFA 4Q8KA 5IVFA 1ZRFA 3QBQA 2YXSA 1NZIA 1UX6A 4QKFA 4PIYA 3WT3A 1XNTA 1BMV2 2Z42A 4IV3C 4JX0A 3LOIA 2QJVA 4YG0A 1T6GC 3WG2A 1OVPA 2A70A 3CF6E 4Q1PA 1XJAA 2ADEA 4Q27A 3CZJA 3GZAA 1A8MA 4MZUA 5DABA 1OLME 2NLRA 4FPJA 3WF2A 2W47A 3ZYBA 5KXBA 1W04A 4E9KA 2ZGTA 4BQ1A 1H8VA 5IHRA 3RS6A 3WUCA 3ZXEA 5FO9B 3PVEA 3UKNA 4DXTA 4AGRA 3V0BB 2CV6A 2ZX0A 3C7FA 1W0OA 3VGIA 3TNPB 2R041 5FFOC 4R9CA 1KXGA 3LB9A 4BQWA 2E7AA 1Q8PA 4AFAA 1FMD2 3RZHA 1C8M3 4IEUA 4DS0A 1G6NA 4XYXA 4LEJA 1VMFA 1GNZA 3UGGA 2BUKA 1ZBA3 2R16A 4LBMA 1UMIA 4XJAA 1QQP3 4DEVA 3LQCA 1N47A 3VBUB 5A3OA 4AHWA 5KC5A 3HD8B 3URFA 4P9YA 5H9RA 1DU3D 5JZGA 1DCSA 2ORZA 2BNOA 4AQSA 1NA1A
chains in the Genus database with same CATH topology
4BMEA 1Q56A 2PHXA 3FJSA 2WNVA 3OTFA 3GZTB 4LULA 2XJVA 1X33A 1Y7BA 3B01A 1ND2A 2ZA9A 2XLFA 5GALA 3SCGA 4W6WA 4HN0A 1KQRA 2GSYA 2PN5A 4ZXKA 3RI8A 2P2KA 1AR93 1CAUB 1Z0HA 4XE9A 3FC0A 2IXJA 2JG8C 3GNEA 5ABJC 5C9AC 3X29B 2C9AA 3POWA 1MEC2 2D5FA 3O0XA 4QM9A 2RR13 4DY5A 2GH2A 1DGRN 3D0SA 2ZX1A 5F6KA 4AEDA 5JOWA 1ASJ1 2GN7A 3L2HA 5JVVA 2X5IA 4JGZB 2RM23 4EWDA 3ES1A 3ENRA 1MS0A 4DZGA 4YW3A 5FMOL 4IEXA 1D2QA 1B35A 1I5ZA 3M1HA 1AR71 3ZYIB 1RUG1 4GH4B 4LO5B 4XFBA 4LT5A 4OHYA 1A6CA 1RUF3 4EROA 1ASJ3 4DB5A 2NYYA 4HKLA 1F8VA 3SHRA 1UKGA 2NZ9A 1N3PA 5FRAA 1BMV1 2QKDA 2O8OA 4UXAA 4AGVA 5BNNB 1EPWA 2XL7A 2OA2A 1AR73 4PCRA 2ZABA 4QQLA 3HQXA 4F3JA 4WVMB 4CDUA 2MNGA 4BPZA 2IWGB 1N1SA 3HBZA 1IGOA 5JIAA 1OOPC 3ILNA 4FOYA 2WSUA 2WIIB 2PELA 3B3QE 1G9FA 1UZZA 4NHMA 4AXOA 4Z1VA 3H50A 1FMD1 1BBT2 1H8TC 2ZHMA 3B94A 2WL1A 1U5XA 1DQ1A 1LR5A 3I59A 5JDBA 4KU8A 1TE1B 3VBOB 1PHMA 4AFCA 2A3WA 1POV3 4RQPB 4DRRA 4K1YA 1RMU1 2ZGSA 2R6QA 2CY6A 4Z07A 3M3IA 4META 4PIXA 3RZZA 5KC6A 3AKPA 1HV1A 3RPQA 4J1WA 4INDA 1FMD3 4UW4A 4MV2A 3E6BA 1H4HA 2VNGA 4GMP3 4XFIA 4FPOB 1QXJA 1BJQA 1ULFA 4JDMA 3KT7A 1LULA 3ZSKA 1QJZA 1VR3A 2YYOA 1AL0G 3AFGA 2ARBA 4ORFA 4NWWA 1W6NB 3TNQA 5IK7A 1BEV2 1D4VB 1MEC1 3LSEA 4E2QA 4LLOA 2XJQA 1MZ5A 3PJQA 4FO9A 1AR62 3R4DB 1NA1B 2VVFA 1ZZ6A 1S2BA 2GC3A 4HSJA 4LR4A 5ACA2 5FPXA 1JW6A 5K0UC 4AE2A 1Y43B 1DLLA 1ND2B 3U0ZA 2E7TA 4BIOA 5JCTA 4IQPA 1WLDA 4QPIA 1XYNA 1MEC3 1NXD1 1S0GA 5JLVA 2YGLA 1YI7A 4JTOA 1R082 1WW7A 5EYXA 5GZCA 3VZNA 4BM8A 4M01A 3H8UA 4XXAA 3MIFA 3IIAA 2AH2A 1TNFA 2YPJA 4Q4W1 4YZ5A 3WW4A 2DTYA 3ZYRA 3C2UA 2NM1A 4AEDB 3UL2A 3WG1A 2HWF3 3FLTA 2ZGMA 1CPNA 4Q2FA 2R1DA 4F7ZA 5I8TA 2X5IB 1HQLA 3EBRA 5LEKA 2ZX4A 1RUC2 1VBD2 1WGPA 2DUQA 5BNPA 3ZO0B 1PO22 1PGL2 1NCRA 2VW0A 3MW4A 1B35B 3MIEA 1HRI1 4Z92B 1LEMA 5K9YA 3ZXKA 1NXMA 1S0FA 3ZFFB 3JCIA 4I01A 4AVCA 3MFCA 5D8AA 5E89A 4GWMA 4K9SA 2ET1A 4GWNA 1BBT1 3D5OA 2ET7A 3WW1A 5I91A 4R9BA 2P37A 1FPN2 1ULCA 1OQDA 4AHYA 1ND3C 2ZHLA 1MS3A 1HQWA 4CDQC 4RS5A 2ERFA 3H0OA 3ASIA 4IV1A 4CDUB 2N7GA 5T3NA 4R9AA 3B93A 4FXKB 4P9IA 1ENSA 2EXKA 3DPRB 1BBT3 1GZWA 4LE3A 5L7OA 3KT4A 1NLRA 5FTTC 1OKQA 3FWEA 1VB4A 4WBBA 3MIBA 1UIJA 3AM2A 3MGUA 4RGAA 1GLHA 1TMF2 4Y1VA 5EFUA 1KD7A 2I07B 3Q9OA 4BYYA 5AC91 1H1IA 2GC1A 2FBEA 3I59B 4DFSA 3RMYA 1OFNA 2OZJA 5A3LA 5J96B 4F83A 1BEV1 4PQ9A 2QUOA 5I0UA 1NY71 4JGZC 5FO7B 3BOPA 2DVAA 1E57A 3U4XA 5ACA1 1GZ9A 1DYPA 4GH4C 2BVVA 3M4FA 1LHWA 4L92A 2Z69A 1H4GA 2R072 1VIWB 3RRDA 1H2LA 2W0XA 1BEV3 3H3ZA 3VV1A 4FPEA 1SCSA 1TME1 4XETA 2E9QA 3VN4A 1AR63 4UW6A 4W6YA 2WT1A 2A6VA 4YZ3A 1RUI2 1CVNA 3S30A 5ACA3 1RINA 4BMBA 2V5YA 2ZKLA 2CYFA 4XJUA 1WA4A 4YSFA 2FMDA 1RUC1 1VBD1 5I93A 1R083 2XBO2 5HCFA 4BZ4A 2A3XA 2RS12 2WZR1 1ULDA 3VL8A 5FMOS 4CP0A 5A32A 1ALYA 2O1QA 2ZMLA 2D40A 5GKAC 1D4M1 1YLLA 2GAUA 2VNRA 1J58A 1UL9A 2DFBA 5GLUA 4Q1RA 2BEOA 1YNAA 5GLZA 3ZN6A 2CGNA 1RUC3 1VBD3 4S2FA 1VP6A 4K40A 1PO23 1V9U3 4AI0A 4LA2A 5KXCA 2DVDA 5JI7A 1I6XA 4EN8B 2D5HA 4CZSA 1RTVA 4ITCA 1NCRB 1VBA3 3AZWA 1DGWX 1S0CA 2R49A 4IETA 1MZFA 3WINE 1IOAA 1V00A 3G6JB 1V6KA 4KH9A 1FPN3 1ZM1A 5D8AB 5C4WB 1TMF1 3FBMA 5J09A 1PNGA 1Q8OA 4E2GA 2WINB 1AVBA 3L9JT 3EO6A 3SITA 4XF9A 2VQ0A 4P14A 5H9PA 3SH4A 1OA3A 2ETEA 3WDVA 5JZGC 2V73A 4RD7A 1NA1C 2XVKA 1FAYA 2WNVC 1GR3A 5FPZA 3CL1A 3USUA 3OY8B 2Y0OA 4I3PA 1ND2C 1AXZA 5JAXA 2KA3A 2BWCA 3VKLA 1FX5A 1LESA 4IEPA 3AZYA 4AVVA 2XWJB 3BCWA 3ILRA 5C8WA 3ILFA 4WVVA 2R071 3T1LA 3RG0A 3ZFGA 1DQ6A 3ST7A 4P5HA 4YARA 2C0ZA 3WDXA 2CAVA 2P3JA 3M8LA 1PZ7A 4PIZA 1C1LA 4XTMA 4AEDC 1Q43A 3VHPA 4C1XA 3LA3A 5E8AA 3DL3A 2WKKA 2X5IC 3OD0A 5E88A 2A71A 1SLTA 4RFT0 1I9RA 5JI9A 3CU7A 2VW1A 4Z82A 1F9KA 1B35C 3OBTA 4AHXA 3K51A 4K7JA 1RUJ2 1DFQA 2XBO1 1JYCA 3G7DA 1XNBA 1RUI3 1RITA 2B46X 2QCSB 4GXLA 4AEKA 1RUD2 1SEFA 4EJRA 2VOVA 3I2DA 1ZBE2 4PLOA 3BTAA 1KITA 1DHKB 3AKQA 4DRVA 4AI8A 3BB6A 1DQ0A 2YHJA 1GANA 1C8NA 2C5DA 3UKVA 1CAWB 4PLNA 4QM8A 2RS13 4DMIA 5FLIA 3RNSA 4CDUC 5CFCA 2LM3A 3WDWA 1NOVA 2JG8B 1VB2A 1REEA 1YUDA 2ZS6B 1WUVA 4H3WA 2NN8A 3MW2A 3USSA 1LODA 5ABJB 1RVF2 4D7SA 2X53S 3IWZA 3VZKA 4Q0PA 4HANA 4QQPA 3P3PA 3OBRA 1SQ4A 4R4XA 1VBC2 4XBNA 4G9SB 4DINB 1PIV1 2ZGKA 3DF0A 1JBCA 1QJY1 3GBFA 2WJSA 3I7DA 1KJRA 4AYUA 4CRQA 2FMYA 2RJLA 4GA9A 4LHNA 4TLFA 3IN9A 3VKMA 1WLCA 2IFRA 4CDWA 1Z78A 5FAXA 1J3PA 1IQAA 1PZ8A 5BNOA 4FSJA 3GHNA 1W6PB 1DIWA 3GYDA 3D82A 1ZYBA 3AYDA 4M3CB 2F4PA 1VAKA 4FQ4A 1S2KA 2GC0A 3AMPA 3LGRA 1CQ9A 2QDRA 4XJZA 2VVEA 1ZBA2 4ATFA 5I0SA 4PDWA 2RS32 3O0VA 4Q29A 5E16A 1V6OA 2WA3A 4R9DA 4FOVA 3JB4C 3IMNA 4WV8A 4X6QB 1DYKA 3V0AA 3ZXFA 2GNMA 2ZX2A 3R05A 1VJ2A 1BVVA 1LGBA 3ZN4A 2ZJCA 3JQWA 4IEVA 3USUB 1SFNA 3PNAA 3TRSB 1H8TB 4QPIC 1NQJA 2CGOA 1EV12 2W68A 2YY1A 5BNQA 4FP2A 1XNKA 1IS6A 2DF7A 1MZEA 3I4IA 4Y20B 4GQ7A 5J7MA 5CAZA 2GMEA 4AFMA 1DZRA 1QH6A 3JUUA 1RUJ3 1U12A 3KB5A 5FCCA 1W6OA 2ZX3A 2GNDA 1H30A 1WMEA 3HT1A 5BNPC 1LHOA 2FQPA 2D7FA 4AVBA 1NCRC 3WNXA 1PGW2 1RUD3 3ELNA 3THTA 1S0EA 1ZBE3 1DF0A 2R0FA 2GN3A 1W6MA 3CJIA 2UYAA 4ZU5A 1CESA 1ZZ7A 1BVP1 2OIIA 1JUIA 3MDPA 3OJBA 4A2UA 4E4DX 1DQ4A 2JE7A 5K0UB 4COVA 4FPHA 3JBG2 3D8CA 4RS5C 3UJQA 1RVF3 4E4ZA 3W58A 1FV3A 2ZGNA 4ES8A 1EPZA 1MZ6A 4IV1C 2D3RA 2PHDA 5CFCB 1SFYA 4N9HA 3MW3A 2ES3A 4HN1A 4LBOA 1ZREA 3AJYA 2PHWA 4CDXA 5L7OC 3E97A 3VKFC 1VBC3 4QPGA 1O7FA 3R4UA 4Q4V2 1OSGA 3N3HA 3B69A 2VOKA 1SBEA 3RMXA 4YZ2A 1C8M1 2EF6A 2K2SA 2VUAA 3NKTA 1ZBA1 1QQP1 2RS31 4YFZA 1XU2A 3GZUC 1Z7S2 1YXWA 4WZFA 2DCTA 4QD2A 3KCCA 1UN1A 3INAA 4W65A 4CDWB 1DDLA 1HIXA 5FO8B 4COYA 1WMFA 1B09A 3J9SA 2D6KA 2XVGA 1LU1A 4GIQA 3LA2A 4QHBA 2D3SA 2TEPA 2IZWA 5JMCA 1AR91 5C6CA 2RS33 4XJWA 5JOXA 1QNYA 4PBOA 1S1AA 4FVVA 1LENA 1IS3A 5DZEA 4BHPA 5L36A 1ND3B 2YZ4A 4N9IA 3ATGA 1QOTA 4XF1A 4CDQB 2ARXA 2WFPA 4N53A 2RR11 3LKJA 5CU1A 5GLWA 4BE3A 2VMIA 1OFSA 2Q1MA 1J3RA 1LHVA 2K0GA 4OUSA 4EWEA 2A5ZA 2ENRA 3NKGA 4LE4A 1U5IA 3ZPYA 1URXA 2RM21 3WHTA 1EV13 2HWB2 2X8KA 3WLUA 2ZPXA 5EJ3A 3H3UA 3AMMA 5AVAA 1OPOA 1TQ5A 4COZA 1UU6A 1W6QA 4Y1XA 4EWAA 4JCKA 1RUF1 2RHPA 1SLBA 2AGSA 3NAPA 4ISRA 4L9BA 2ZGLA 5CG8A 4ONUA 1Q8QA 4XF3A 3ZXJA 4Q8LA 1WCSA 2HWF2 1XU1A 2CTVA 5GZFA 3WW3A 4HL0A 4FBFA 5SV8A 1XYPA 1ZZCA 1RIRA 2A6ZA 4X6RB 4FAGA 2QZ3A 3WP3A 1FATA 5JSRA 2YMZA 5I0TA 4FTBA 1YFWA 2DU1A 1XNDA 1NCQA 3GALA 4Q4V1 3ZSLA 1POV0 3OF1A 4K20A 3JBG3 3HMYA 2A75A 3WP5A 5KHHA 2JG9A 4LO7A 2BYVE 2PQQA 5K8SA 1QJX2 1S0JA 2EXIA 5E1RA 1POV1 2Z5WA 2ILMA 3AZZA 1QJU2 1EAH2 1R1ZA 1Z7S1 4CEWA 3VBHA 4Q4V3 1LOFA 1JOJA 1QXPA 1WBLA 4GMP0 4COWA 4MX3A 1OQEA 4GMP1 5IK5A 3O0WA 4QPGB 3U10A 5KHJA 3ZVXA 2H0VA 2LTNA 2B5HA 4OI0A 5T50A 3ZFGC 3ZYJB 4YG3A 1Z7S3 2PHLA 4HSLA 4Y22A 3MFAA 2IXHA 4FXGB 2RJKA 3WX5A 4KGGA 3ZXAC 3TN92 1IHMA 3ZMOA 3UV9A 4DXZA 4BCUA 3BALA 1LB2A 3D4KA 4XBLA 4FTEA 2R063 2JJ6A 2WA4A 5FREA 3T1MA 4JDOA 2HWB1 3R0RA 2Q5TA 4FT8A 2E51A 3WQ7A 3OD4A 3NJZA 2XUMA 2ZBJA 1O4TA 1RGSA 1Y9QA 2ZGPA 3LAGA 1RUH2 4GALA 3BPZA 3CJXA 3WG4A 5JZGB 3N36A 3SMHA 3H1WA 2WNVB 3ZSEA 2WC2A 4N53B 3EXUA 4JRAA 2SBAA 1FXZA 2HWB3 4D69A 2G9GA 2HWF1 3ME2A 1GNHA 5JOZA 4GKYA 4U2AA 4Q0SA 3ZSJA 5CFCC 4OULA 1FOD2 3RYRA 1AHSA 2JEMA 1AYM3 2WT0A 2VU9A 2DVFA 1S0IA 4NHLA 1XE8A 2ZGOA 4D94A 4XTPA 1SCRA 3LZZA 4HKWA 2JXAA 4ISQA 1KDKA 1W6QB 4OHVA 5GJ6A 2LUWA 3NAPB 1LCLA 3THPA 2ZHNA 1CJDA 1BK1A 2Z79A 3J4UH 4P9LA 4XDQA 1N1VA 1D0GA 1V9U2 1GSLA 4CYDA 2HWE2 1H0BA 1QJX1 3J26N 1PZ9A 1KDMA 1PVXA 3AKTA 3S6PA 1MVEA 1ENXA 1QJU1 1EAH1 2HKXA 4CDWC 4OLLA 1PNFA 1UPIA 4XOGA 1GV9A 1U0AA 4H7MA 2GMMA 3E6DA 5BNOC 5BYNA 2UWCA 4ASMB 5JWPA 1G9DA 1VBA2 3ES4A 1A78A 5BV6A 2D44A 4FAHA 2SLIA 5I8YA 4LA3A 5F1RA 1WLTA 2JD4A 1NCQB 2DCKA 1AL22 1QJX3 3KQRA 3I8TA 4X8PA 5SV5A 3M7AA 4PDWC 1QJU3 1EAH3 4HMZA 2GH8A 4IESA 2Y38A 1QGLA 2QZ2A 4YVSA 4NN0A 2WFF2 2D6LX 2JG9B 4PF5A