3VV2A

Crystal structure of complex form between s324a-subtilisin and mutant tkpro
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
320
structure length
320
Chain Sequence
STQPAQTIPWGIERVKAPSVWSITDGSVSVIQVAVLDTGVDYDHPDLAANIAWCVSTLRGKVSTKLRDCADQNGHGTHVIGTIAALNNDIGVVGVAPGVQIYSVRVLDARGSGSYSDIAIGIEQAILGPDGVADKDGDGIIAGDPDDDAAEVISMSLGGPADDSYLYDMIIQAYNAGIVIVAASGNEGAPSPSYPAAYPEVIAVGAIDSNDNIASFSNRQPEVSAPGVDILSTYPDDSYETLMGTAMATPHVSGVVALIQAAYYQKYGKILPVGTFDDISKNTVRGILHITADDLGPTGWDADYGYGVVRAALAVQAALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accelerated maturation of Tk-subtilisin by a Leu Pro mutation at the C-terminus of the propeptide, which reduces the binding of the propeptide to Tk-subtilisin
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Hydrolase
molecule keywords Tk-subtilisin
total genus 115
structure length 320
sequence length 320
ec nomenclature ec 3.4.21.-:
pdb deposition date 2012-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 3vv2A00
2PWBA 4I0WB 3DE4X 1C3LA 1SBCA 1THMA 4H6VA 1EGQA 3SICE 4AKTA 1SCJA 2PMWB 2PQ2A 5FFNA 3DVQX 1DBIA 1SCAA 3A3NA 1TK2A 1KDVA 1TM3E 2WUWE 1KDYA 3A3PA 2IY9A 1GCIA 1GTL1 4ZOQI 3D43A 2DQKA 4CFYA 1Y4AE 4H6XA 3T41A 1TM1E 1TMGE 1ZVKA 1C9JA 2X8JB 2HD4A 1SVNA 2W2OA 1WMDA 3DW3X 3GT4A 2QTWB 3DDZX 3PRKE 3P5BA 4WOCA 3ZXXA 2HPZA 2XRMA 5JXGA 2IXTA 1Q5PA 1TECE 3L1KA 5B1DA 1AQNA 1EA7A 4WOBA 3DE5X 4NMXB 1TO1E 1BFUA 2GKOA 4CFZA 1TO2E 2Z2XA 5FAXA 4NE7A 1Y1KE 1SUBA 1Y3CE 2W2MA 5AQEA 2PWAA 4YN3A 3VV2A 1P8JA 1SUCA 1SUEA 3DE0X 3AJ8A 4KG7A 1AV7A 3LPAA 1HT3A 1SBIA 1KE1A 4J94A 2WUVA 2TECE 3D9QX 1GT91 1R6VA 3BPSA 3DWEX 1GNVA 4K8RB 3WHIA 2P4EA 2WV7A 2B6NA 3GCWA 3BX1A 3DE6X 2Z30A 4H6WA 3LPCA 3QFHA 1YJCA 4OMCA 3SQOA 4CG0A 3AFGA 4DZTA 1T1EA 1GA6A 1SBNE 3I37X 2SECE 1AU9A 1NDQA 2X8JA 4KB5A 1SPBS 2W2QA 1IC6A 4Z2AA 1GNSA 1TM5E 3VYVA 2Z56A 5I9SA 1WVMA 1CSEE 5AVJA 2PRKA 1R64A 3I30X 1Y3BE 1SCBA 1SCNE 1WMFA 2DUJA 1SCDA 5AVKA 1SBTA 1ST2A 4C3UA 2W2PA 4BWGA 1DUIA 3F7OA 3VHQA 4OV6B 1NLUA 5FBZA 1S2NA 2V8BA 4AKSA 1Y4DE 1C9MA 1SIOA 1BH6A 5ARCA 1YU6A 3DE1X 4HVLA 1SN7A 1WSDA 3UNXA 3Q40A 2ID8A 1T1IA 1SIUA 1BE8A 1TM4E 5B1EA 2SNIE 1CNMA 5JXIA 3F7MA 1MEEA 2ST1A 1Y48E 3WIUA 1GA4A 1Y9ZA 2Z57A 4OMDA 1PJ8A 4ZARA 2ID4A 4C3VA 3DYBA 1LW6E 2G4VA 2SICE 1SBHA 5AMXA 1V6CA 1ZVJA 1YJBA 2PKCA 1OT5A 3LPDA 2PYZA 4DWWA 3TECE 1SUDA 3DE7X 1PEKE 1PTKA 1AF4A 3DVSX 5SICE 1AK9A 1P7WA 3OSZA 3VTAA 2Z2ZA 2E1PA 1KDZA 1AH2A 3EE6A 1Y33E 1BJRE 1WMEA 3EIFA 1NDUA 1V5IA 2ZWOA 3Q5GA 4MZDA 3VV3A 3DE2X 3TI7A 3ZXYA 3QMPA 1VSBA 3I2YX 1C9NA 1PFGA 4DJ5X 1Y3FE 1Y3DE 1S01A 1AVTA 3A3OA 3F49S 3I34X 1SUPA 4KPGA 3CO0S 1IAVA 3GT3A 1KE2A 1GA1A 1ST3A 3H42B 1UBNA 1Y34E 3HJRA 1GTJ1 4GI3A 5CW1A 3WIVA 1T1GA 4RYDA 1SELA 1A2QA 1S02A 1P7VA 3DE3X 4B5LA 3GCXA 2ZWPA 1YJAA 5JXJA 2W2NA 3DVRX 4HX2A 3DW1X 1XF1A 1SIBE 3EDYA 1MPTA 3LXUX 1R0RE 3QTLA 4FONA 1JEAA 3AJ9A 3BGOS 4JP8A 1BFKA 4M1ZA 5ARBA 2Z58A 3PTLA 4LVOA 5ARDA 3VSBA 1SUAA 2SBTA 1OYOA 1SH7A 2XTJA 4NE9A 1TM7E 3WQBA 1BE6A 3TI9A 5JMOA 5JXHA 4LVNA 1OYVA 5K7SA 2Z2YA 2ZRQA 1GTG1 2WWTA 3CNQS 2DP4E
chains in the Genus database with same CATH superfamily
2OUIA 1BC5A 3HCPA 1WXWA 4H60A 2BBTA 3DMFA 2NSJA 1NRWA 2DTEA 4GI7A 5C8YF 5I7VA 2PJDA 3D7NA 4BV9A 2CV1A 3U3KA 3PFIA 1JLKA 2B25A 3MJSA 3QOFA 3NHMA 5F9FA 3EPPA 1S4MA 4AWXA 3E3AA 5LR6A 2V6IA 5K01A 2J5BA 3CVXA 1LNZA 3B51X 1JBKA 1CRWG 4IHQA 4ENVA 1U2GC 2W6ID 3LUCA 4NS1A 2NU9A 1PT9A 4KDFA 1KDTA 5CAEB 1W6RA 3P2MA 3WOHA 3AEQB 4Q9HA 4DDTA 2BCEA 2F8LA 1K5HA 1G2IA 4GVXA 2WIBA 2PUHA 1E5LA 3AUXA 1CU1A 3UUFA 1R0CA 4W9NA 3B6IA 2W22A 3AYXB 5LXTF 5SZKB 2C57A 3WY9A 1BVUA 3W1WA 3ROTA 4DQLA 4JHLA 4LFCB 1C1XA 2YV1A 3D5EA 4PGFA 4UD6A 6LDHA 4QT4A 5H81A 4YY3B 1L4BA 2QU7A 5DCWA 1ADYA 4HUQA 1VJRA 3Q8XB 1UAYA 2WPDA 4GQBA 3RROA 4ESHA 2RHWA 3BS4A 3PNYA 5DXJA 3FOEC 2QXYA 4NU8X 3TW4A 5D1NA 4IM7A 2VCHA 4CKBB 2NZ2A 2VT2A 3N2KA 2Z56A 5I9SA 2J9FB 3ZQJA 2D2EA 5LLTA 1OH8A 1IWOA 1WMFA 4DQ0A 1NBME 1B42A 4QUAA 3SVTA 4JC5A 1G5PA 5BV7A 5GAJA 3RASA 2A1UB 3OZDA 4OOFA 4UEOA 3PF9A 4F04A 3UMGA 1AQ6A 2RMKA 2WHXA 2BP7A 5A3JA 2OO3A 4NBWA 1KC1A 2ZE5A 2WJYA 1B8NA 5F73A 3PGXA 3T0GA 1R0YA 3FNHA 5CLGA 4AL4A 4BMNA 5I9TA 2NW6A 3TZHA 3N0XA 2F62A 2V7PA 3PUVA 4CTOA 2X19A 5MHTA 2HAEA 3EASA 1ACJA 5F7ZA 2DUWA 1EYZA 3R23A 1XTSA 2B94A 3ZKAA 2NPOA 2GPTA 4KO1S 1IPFA 2C1XA 1W581 4H7FA 3ONNA 3SMQA 4AFNA 4AICA 5JISA 2C78A 4BQPA 1F6DA 3EVEA 5KVSA 4UZFA 1PGNA 4OAOA 1Y7IA 2QVGA 1TQHA 2IZ0A 3ND5A 5KMGA 4MK4A 4P0PB 1S5PA 1XZJA 2I71A 2GZAA 1WBDA 4FE7A 2J7KA 4PNZA 2QE6A 3NAMA 2HA6A 4RKEA 3N8GA 1MO4A 2VDNB 3I42A 4L0CA 4Q4DA 3TLEA 3FUCA 1MGPA 2AOTA 3I3OA 3P9SA 4QAJA 4PLCA 1JXAA 3TD2A 3P4XA 4JL8A 4TSFD 5B7PA 4BRWA 1OZAA 2VO1A 2GF9A 4JHXA 5DHSA 5A3VA 3PFNA 2HT1A 4I5IA 4FUTA 4AN0A 4B31A 1DKPA 4MITA 4ZO8A 2QMHA 4IGAA 1UT6A 1ZZGA 3KL2A 4ZAVA 3WIUA 2XXAB 5I7OA 3PDJA 4G0WA 1BFKA 4Z3OA 1DC8A 3AEZA 4TKVB 1MA0A 1PHPA 1VLVA 3FWHA 3TFWA 2RARA 2XMSA 4IH9A 4J0DA 4CCYB 4YMGA 2TS1A 3ZVKA 2QD3A 3K2IA 1ZMRA 1CQJB 1Z6YA 2J3QA 3DZFA 1E1CB 1A5SB 1YQ9A 3FHOA 1PV4A 2FOIA 1H4SA 3NANA 1VLMA 1HYBA 3A1DA 4DEYA 1Y4SA 5KCMA 3IDOA 4QDZA 4ICIA 4U7FA 4DIBA 2I6GA 4R8KA 5DSXA 4JLOA 3FTNA 3BSYA 4BX8A 3TYXA 3H75A 3BCHA 4FT4A 3P19A 3HBAA 3HYSA 5A04A 2QAGB 4X6YA 2J4DA 2H54A 1AF7A 3M49A 4JYZA 5JNTA 4M76B 3SDBA 5JZOA 1CT9A 3QPWA 5EGSA 3ZBPA 1NUQA 1PI3A 4OGLA 2JLCA 3SHQA 4YRKA 2D7DA 3MT9A 4PYQA 2JGKA 4P32A 5FR2A 5FHRA 3DM5A 4M6WB 1O94A 2ZJAA 1DQRA 2Y05A 3EZ7A 4KKVA 5FV4A 1E6CA 3UA3A 4RF3A 4DMRA 1W5BA 1YZHA 2FZ5A 3AVQA 2VXYA 3MOGA 3HYNA 1F1JA 3O91A 4KP7A 4PX2A 5D3KA 5HA5A 3ECAA 1YJCA 2PS1A 3W6NA 1HT0A 3BQ9A 3IBSA 2IH2A 3O4GA 3QYAA 3OX3A 1P6QA 3BD7A 4IKEA 4IXMA 3DCIA 4J0EA 2XUIA 1AMNA 2HPAA 2RHMA 1GSAA 3COYA 4LG1A 5KSWB 1LBQA 3ZWQA 3TM5A 1O94C 3WWEA 4DFDA 5ED0A 5AXAA 1EM8B 2QP9X 2YUIA 3INTA 1YOVA 3QKUA 2HRQA 3V2IA 821PA 3TCNA 3HGQA 4ACBA 4JJAA 4MHSA 5A2QA 5I9LA 3K4PA 2X0FA 4QJ5A 4HVLA 3RBVA 3G5TA 2B2XA 4KMMA 3ZG6A 1XWWA 4MSUA 1VPTA 2FQWA 4BNDA 4LHWA 1O6GA 2F48A 2PH1A 4BNJA 2OHIA 1D2NA 3RG2A 1I7PA 1R37A 1I7LA 3O92A 3EFHA 2GCOB 2OP0A 4JCCA 5B6JA 1C3OA 1ZD4A 2VUHB 4H4EA 5IXJA 4HXGA 3A9SA 3G89A 3BD8A 2XCSB 5LFAA 5H16A 3SY8A 4YAOA 1CUCA 1THTA 1WHTA 1G291 5LP6B 2ZJ1A 1QPBA 2Z2ZA 2R4UA 4R1SA 4X90A 3FDZB 4XUGB 3B1XA 4CG3A 2BFCA 3NC4A 4N40A 1T2EA 3U4GA 5KNDA 2QLMA 4RACA 4G23A 3CZAA 4JX8A 1TK3A 3AR3A 4JT2A 4FGZA 2AVDA 4JBGA 4DCVA 1QRSA 1Z47A 3BJIC 3W5IA 4KFSA 3TPCA 3OLQA 4F56A 4LQDA 1HTTA 3OIGA 4EF6A 4ZRDA 1YVRA 1M54A 4LF4B 2H07A 1G7RA 2ZUDA 3QNUA 4OY3A 4ARVA 2A14A 1K86A 3T52A 2ZJFA 4C5CA 5BN5B 1OV6A 1DPFA 2O8DA 1EINA 1TVCA 2I6FA 1NQXA 3WBFA 3UH0A 2HCTA 4MI3A 5CT6A 4KUEA 3WQQA 4MJ3A 2ZVDA 3HCAA 1ICIA 4GYKA 4PVCA 4RVCA 4QPZA 1N77A 3I45A 1VRWA 2JAUA 4JT4A 1MKYA 2O6HA 3ZS9A 2UVPA 4IAOA 1PF7E 4GP7A 2PUEA 2PX2A 1U9IA 4RVSA 1VOTA 4DCPA 1W47A 3EZXA 2L0XA 4G8CA 3TZ6A 5HZHA 3H9EO 3I2IA 1O97C 4ZVLA 1MNAA 1OC2A 1P39A 4CLEA 1PQUA 1ML3A 3DV9A 4JI7B 3N0TA 1YZFA 2JI8A 2ZIEA 3NAQA 2EBFX 2XRMA 4LDJA 1DEAA 3UXHA 1J90A 4B2IA 2C4WA 1GUAA 2JH8A 3QGMA 1FDRA 2HU8A 2O2CA 2Q7XA 4EI8A 2H2HA 2IWHA 4B79A 5FJIA 4Z6KA 2FSPA 2Q6IA 4F2WA 1T1JA 2I3AA 4YV2A 4CRWB 4DTIA 2QYOA 2UYCA 1GPDG 3O47A 2PYIA 2B3TA 3QXHA 4OHXA 4RD1A 4YP9A 3RADC 1CP3A 3LGXA 3F5DA 4CM7A 4RENA 4JKIA 1V7PC 1ADGA 1PKXA 1N1MA 1WL8A 2PSEA 3Q7TA 1MV5A 3OCJA 4JGBA 1W35A 4MX8A 1HT2E 3KE8A 3ONFA 1ZOPA 1YBAA 2DX7A 3OE7D 2X9GA 3GYGA 3U3RA 3ESQA 5D87A 2SECE 5DISB 3K0FB 3WLKX 3RQIA 4BNMA 5JD6A 1RBQA 3ZHXA 2XSZA 3LW7A 1PJAA 1Z2NX 4FHEA 1GU0A 3KQSA 4YRDA 2YYZA 1Q95A 4NDAA 4GR9A 4GICA 3VAYA 4BNWA 4EL0A 1ABBA 4PPNA 3AINA 1PGPA 3BK1A 1AXRA 2AX3A 3CRW1 3HKDA 3HWWA 3NQ41 4G25A 4HGZA 4RHEA 5L7YA 1Y4DE 4K6KA 1SWVA 5JZMA 1TX4B 1T3SA 1UKZA 1DDOA 1TAGA 3OKPA 3LLSA 4UMVA 4H7DA 2A7XA 3OCWA 3OIWA 3RSFA 4PNHA 2PAAA 4IYJA 2NZ8A 1QJCA 2XWQA 3HEBA 1V11B 4KQIA 1FX0B 3DEFA 3LHDA 3LJKA 3BXOA 4PAGA 4P7FA 4QVKA 1SQ6A 4KRYA 3DPUA 1CLUA 5F76A 2JDIA 2LTAA 3OTWA 4C3VA 2PKXA 2I4OA 2I7TA 4BVLA 3ISJA 1HOXA 1XMXA 1QDUA 2BC9A 2RI6A 3K96A 2D4HA 4FYYA 5YASA 4RKRA 4KJXA 2GR9A 2G9RA 1JYSA 4OI1A 4WBNA 4ZAXA 4F3CA 1TCUA 5AVWA 2W42A 4XFDA 4IIUA 4CHGA 5D3MB 1EIZA 1YS9A 1P9NA 5COQA 1YH3A 4N5DA 4IJWA 3GMTA 3MWDB 4Q01A 4A2QA 2Z1NA 4O3FA 1EVZA 5JTUA 4L9AA 3AV0B 3SSOA 2P9JA 1GTJ1 2O8VA 2VAWA 4ZEXA 2Q3CA 3OKFA 4RLFA 3CU5A 4XX0B 4RJTA 2XX3A 3HWX1 5TQ0A 3GLHB 2BHLA 3R3YA 4JU8A 4OG2A 1DINA 2ZUFA 4R2XA 1H0HA 1RI3A 2OB2A 5ICSA 5D1HA 4HN9A 2A9QA 4LI0A 4JP8A 4S1OA 2AR7A 1Z4NA 1Z5NA 3M4XA 1XCMA 4LWQA 4RZIA 4EW6A 1ZD9A 4RO0A 5I7EA 5AKGA 4RULA 4H2DA 4XWOA 4PHHA 3MCTA 4PTZA 5LNK6 4F38A 1BXRB 4RZ2A 3FDIA 1LDYA 2XHZA 4TM8A 1VSVA 2PSSA 3U81A 1TM3E 1H65A 1XEXA 1JFVA 3MBOA 1IM2A 1FLDA 3DSRA 2PGNA 4Q3AA 1M1ZA 3VOAA 1NX9A 1XQYA 2TMDA 3EG9B 1C9JA 1YCDA 3FKQA 4GXNA 3PX7A 2BI4A 3GVHA 5IS2A 3WLLA 4MP3A 4TTPA 1CERA 1Q0PA 4ZHQB 4RW0A 1YZLA 5EHNA 1DXQA 1II8A 1Q1BA 1SXJD 2QQEA 2QVYX 4ND2A 4J0QA 4RSRA 1MAHA 1UAGA 3G0CA 5IM4F 3GDHA 5T57A 4DT1A 4Y6LA 2WJWA 3QVTA 4HF7A 3CKYA 4F71A 2Q2NA 2IHZA 4A2CA 2DWQA 2LWIA 5HPYB 1QQAA 4OH7A 4CU5A 4BVHA 3K3PA 4XPZA 3VJLA 4D42A 3AG6A 3HNRA 5CLIA 2PK3A 2C9DA 5M2QA 6ABPA 1R4MA 1U2TA 2OGTA 1MB4A 3IMEA 3VPGA 4MYHA 4CM9D 5DPMA 2EP7A 3DE6X 4BTEA 4CE6A 5IHPA 4RHXA 3LD9A 4E5NA 4LXHA 3RS0A 5EAIA 5DM1A 1CWUA 5TEVA 3AVVA 3PDHA 9ABPA 2PZFA 4HBZA 5A1TA 1WVMA 1F2DA 4C2AA 5EZSA 2G1UA 1P6UA 2D0DA 2H4JA 1JHRA 3IDAA 3D1JA 3Q3IA 4CEHB 3L0SA 4AM8A 4JXKA 3KZ1E 3VPBA 2RC5A 4C4TA 4DVJA 2R68A 4ZCLA 1ID8A 4ESEA 3QKTA 3UFXA 2A4KA 2X1LA 3KJIA 3M89A 3R8CA 2IYSA 2QENA 2OESA 3WBBA 1SZJG 1HDGO 2IYLD 4GUAA 4NATA 4RZSA 4F5EA 4ECEA 2ZZMA 1P0PA 1UMCB 2GJKA 4QU5A 4XA8A 2XLCA 3LPLA 2FW1A 3BWMA 3ZBQA 5B4TA 1EP1B 2DYKA 3A9WA 4JENA 5DN9A 3IVCA 4MJLA 2JIZA 4ZODA 3H9UA 1KP9A 2OCGA 4DPKA 4DR3B 2B8NA 3JVDA 3NBUA 1BYIA 1W29A 4IY1A 4QOSA 4ZHSA 4QWMA 5FEMA 3TSWA 1YIOA 3ZI7A 3M4ZA 2JAWA 4CFSA 2OSVA 1PL0A 4O08A 4Q03A 4NCIA 3VAAA 1NI4A 4RV4A 3EVGA 4KQGA 2R84A 4FLFA 4IMRA 4FN4A 4JB0A 1KA9H 1QVRA 3KKPA 4QPCA 2F7SA 1BVHA 4HC4A 4X7BA 1T6NA 2WU0A 3CFYA 3OWOA 1QCCA 1Y3FE 3WLOA 1X7HA 1O95C 2G28A 2VA9A 4NJEB 1L5YA 1KE2A 4CI9A 3L5OA 4MS3B 5BSTA 5TMEA 4D4KA 2JLRA 3RRYA 5B37A 5BN3B 2XEDA 2VDLB 2B99A 3F9RA 3FG9A 1ZN7A 4ZVTA 2HLDA 4AN4A 4QXAA 2IVFA 4ZOLA 5KWIA 1R6AA 4PXSA 2VP3A 1H2YA 4NEGA 1E6UA 4ACAA 3AHCA 4EKYA 1OWNA 1RRCA 2B30A 4BO7A 4JC0A 4Q1CA 4MW1A 4DMKA 2FHSA 1XZMA 3P9NA 3LUDA 3TRFA 2WILA 1SUIA 3TI9A 4QULA 2HKIA 4C6SA 3ORSA 2O07A 1MO2A 1EZZA 4L50A 1YVDA 5IC5A 4QRIA 3IKTA 3I4FA 4P7BA 3G9UA 1NKVA 2GPBA 3G2JA 1EFVB 4L8VA 4YAIA 2OO7A 2WUWE 3KSAC 3ICWA 4UFPA 1FSGA 1C7FA 2JI6A 4WGGA 3AVUA 1TCAA 2H9AA 3C70A 4KWHA 4N0EA 5J47A 6PFKA 1IDN1 3THWA 1L8XA 4YLEA 3E7DA 1S8FA 5FNVA 2F3TA 3W2TA 2ANBA 3SEQA 5TVGA 1J49A 1IN4A 3DQZA 3H1BA 5AOBA 1LX7A 3EMKA 2PMKA 4LGYA 5HTKA 5IHXA 2GXAA 3IA7A 2QRVB 3QTBA 4IHAA 5EKXA 4XJSA 3UY4A 2A1IA 4MVWA 4JVSB 4AMVA 1PJCA 3GJ5A 3RV4A 3AIMA 1NWCA 1JQAA 2C5SA 1X7XA 3PHHA 4IQFA 3SR0A 3WYDA 1JLLB 4WZ6A 3RJ9A 2FWJA 3GRYA 1U5AA 3TR0A 4C14A 4DRYA 1DBVO 1G8SA 1QKIA 4WWHA 4CN8A 3CE9A 3ASYA 3H5LA 3TRDA 2EFDB 1FUEA 3DF9A 2D2VA 2JATA 3JQGA 4QDUA 4OB6A 5FWAA 4P92A 3R7NA 4BL5A 2ZETA 1N36B 3W3ZB 1NOKA 1TM2A 2BM0A 2HA4A 2R5FA 3SS8A 4UOEA 2BKEA 4WPGA 4D56A 5FPKA 4Y6QA 3BEDA 4GVPA 5GONB 1L5MA 3FGPA 2OYRA 1R3DA 3FYSA 4HAXA 3U1TA 1FNSA 1T8PA 4CMHA 1SD1A 3V4LA 1A0OA 2BMFA 1DKRA 1YT5A 4Y2GA 4PQEA 2OV8A 4DXDA 1STOA 5B1IA 1QOZA 1BQEA 2NNLD 1P4HA 4L7QA 3UNXA 3WP1B 3QBEA 4DHWA 2JCYA 4UHDA 2DHCA 2OCDA 3QI2A 3TAUA 2GK6A 1KTVA 2YZ2A 3DKPA 4LAFA 4WSOA 1R5JA 5AI4A 1JQBA 4RU1A 3ZR4B 3AKZA 4DKXA 1U99A 3NEJA 1XZBA 5FTLA 5BUCA 3VR2D 2BZ0A 5JBQA 1J8YF 1SHLA 1U3FA 1ZCBA 2O7RA 4QJBA 4RMIA 3UMBA 1SQGA 1Y1RA 1PX0A 3A4LA 2YWHA 3TQSA 2XXJA 3KR9A 1BA3A 1GEEA 2FTKE 3DE7X 4TV8F 2RCYA 2DERA 3BJZA 5C7LO 2NO0A 1SXIA 2P6MA 4NOLA 1DOHA 2JIZD 3DLCA 4JGIA 1PSWA 3QFCA 1M6WA 3IUQA 4EPTA 1VIAA 3FYHA 1U1GA 4MW2A 1I0IA 3GJYA 1Z62A 1ETHA 1IAVA 3FPGA 3U44B 2OTCA 2HYIC 4TM7A 4B74A 1PNOA 3ND8A 3EQ6A 3HBMA 4KR9A 3M5DA 3T3HA 1JB1A 1G0NA 4R8LA 1ZXLA 2OM6A 3VYRB 3ZZ0A 1RIIA 2P5SA 1DU4A 1XC7A 1XXHB 1VLZA 1W9MA 1LC3A 8GPBA 3T1HB 3KSUA 4CIAA 5DYIA 5DM0A 1QP0A 4JNKA 3EPRA 3A6GA 4J90A 4LWPA 2X0RA 3EF3A 3JWGA 3S2GA 2GXQA 3UENA 1GL3A 1QF7A 2IP2A 2GCPA 2EXXA 5P21A 3F73A 4C2UA 3RD5A 2NO6A 4RDCA 5BNFA 3TWOA 2LP4Y 2WWTA 3AUSA 2G72A 2H29A 2A1UA 1KH3A 1CQPA 4WJKB 1AUVA 1BEUB 1NVEA 2X4IA 3HLYA 2HU5A 3NYRA 1JT9A 3BXZA 4BRSA 1GZDA 2YXPX 3VKUA 2VT3A 3AF3A 2FX2A 4GR5A 2ZS7A 3D43A 3KJXA 5THQA 3SZ3A 5FLYA 3EW7A 5FULA 2MSKA 3WS7A 4AURA 5IUJC 3OMLA 2WM8A 4TTAA 3F7TA 2V54A 2XDQB 3P0EA 3Q7SA 1SXGA 2GHIA 2O48X 3LH5A 4RELA 1IK4A 1Y9EA 1DBWA 1DEKA 2I1WA 2Q5QA 3K72B 3NJ4A 3NXKA 1U3WA 4JR2A 1TQ6A 2FRDA 3UT5A 4HH3C 3OOJA 4RZUA 1QVVA 4DN6A 4YMUA 1K3UB 4V24A 3DE0X 1TFRA 4PAWA 2NZXA 5E6UA 1AXGA 5BV2P 5TNXA 3ZJ4A 1JG7A 2NVWA 1I51A 5HDBB 3SKYA 4C76A 1R0BA 3KJGA 1RP1A 3SSMA 2C0CA 4B83A 4YXFA 1F8GA 1W96A 3C3WA 3WIOA 1QLHA 2BPOA 2MSLA 2CXPA 4RVUA 3DTYA 1CUGA 3ILHA 3K7EA 2P1ZA 4RK4A 3WWPA 1CQIA 3LOUA 3OZTA 1EMDA 1WLSA 1Z2EA 2JEYA 3CUUA 5IP5A 5LYJA 2O2EA 3CUEF 2HK6A 2B4QA 3N8DA 1C30B 1W85B 1YL7A 4L9RA 1T5SA 1X92A 4RPHA 3H97A 4EJ0A 1VGQA 2PX5A 4IKPA 1VHLA 1SFRA 1C9EA 4OHZA 2EZ9A 5I8PA 2AC2A 4BNDB 3VR4D 3OAAD 1PT8A 3GFBA 1NYTA 2DEUA 4ARBA 4GWKA 1F20A 6REQB 1CUHA 1U8YA 2IYXA 2YN4A 1DTSA 2R7MA 2C7PA 2DR2A 1C1XB 4EAAA 1DKNA 5C5CA 3OESA 4WMLA 2FX3A 5CDFA 1JVNA 3SPXA 1JSZA 1W8IA 1EFRD 2FDXA 2RKBA 3TTWA 5BQXA 2BFMA 3LLUA 4HTAA 3OKAA 1NUAA 5IT4A 5LP6A 1UAAA 4PO3X 4MR9B 5J59A 1N34B 1UWCA 1RLUA 4LRUA 4HGPA 1HE3A 3SFVA 3GVCA 3BT7A 3M81A 4J0FA 4QRDA 3DB1A 5SICE 3V6MA 1UFVA 3GO4A 4P0TA 2JHPA 3JATA 1N0VC 1FB5A 3QWFA 1ZKDA 2R8ZA 4EKIA 1A2BA 3EMVA 4BCCA 4ZZ0A 1I2CA 1J33A 1ZITA 2R4TA 2R8BA 3F49S 4DSOA 1AGRA 1TEHA 4PZLA 3I8XA 1RWWA 3DL2A 4AZWA 3CISA 2FEXA 4Y7DA 3RIGA 3KEGA 3OCUA 3IDQA 2HIHA 3BFPA 1GLGA 5K3DA 3T3EA 4QXRA 1EJBA 4D3YA 2JIBA 3ERCA 4CVNA 1NRIA 3MWLA 3GP3A 3L04A 2WJ3A 4EYKA 4X24A 1WXFA 5H1YA 2G1KA 1QHNA 1P74A 1M2JA 3BERA 1R88A 1NNUA 3BIXA 5DBOA 4C2BA 5KVVA 2POQX 4H1HA 2PN1A 3AUJB 5PNTA 3WA6A 4B3SB 2JI7A 1FP4B 1B0AA 1QS0B 3NHWA 2JLXA 2OILA 3KB2A 3SJUA 2CCGA 2BLLA 2G5PA 4AMUA 4NRDA 5LIRA 1OD6A 2OFOA 1O4VA 3PUJA 3A3NA 4MGHA 4FHCA 1GFIA 4RMJA 4UXIA 5E4TA 2HJSA 1Z5OA 4AUNA 1FFYA 5JQGB 3P32A 3H5OA 5CVDA 1GRRA 3ZX4A 4B3XA 1KYYA 3EIOA 2XF2A 3Q7IA 4L8WB 2I1QA 4MRNA 1RQLA 3U1VA 5KTNA 3SJ7A 3PLAE 1VG9B 2JFZA 1GZUA 4DR7B 2VLBA 3DE5X 1BNCA 1UPXA 1YDMA 2BD0A 3DO8A 4BGUA 1YE3A 4CUZA 4PFQA 3MWEB 1Z4MA 2YKGA 3EOBI 5AD1A 3F1KA 3B13B 4D3SA 1M6NA 2B21A 3K8ZA 4NI5A 3TVDA 1KK0A 2X9QA 4D6PA 1U0LA 5CPBA 5JVDF 2YYYA 3BMQB 4M1MA 2QJRA 1I30A 4I4IA 2XB6A 2CMGA 4GBED 4YC7A 3H05A 1EVYA 3D5TA 4ILKA 4NZOA 1RXIA 2VI5A 1LZLA 2RFLA 2W8BA 5AM4A 4YMVA 1KI6A 4KVAA 3LT1A 4DB2A 1HEIA 3N05A 4M1KA 2PL3A 5AOAA 2H7VA 3G9QA 1MCZA 3DAOA 3ZE8A 1KETA 1J22A 2Z04A 5FWNA 5K6AC 5AH0A 4BMCA 2C1EA 4D96A 2GZ2A 3FPSA 4DE5A 2HMSA 2XMBA 3I6BA 3U62A 4DUZB 1YTUA 2B61A 1N32B 2XAUA 3C43A 3PT5A 3JXEA 1G5QA 4PZAA 4W8HA 1FPMA 3ZCTA 9MHTA 1NF2A 4M6WA 1UT5A 4XUCA 1EG2A 4NK4A 2A1TR 2YDYA 2CN1A 4I36A 3RI3A 3VU9A 2P6NA 4FYJA 1P1CA 3G8CA 3SK0A 4A3SA 5TT0A 3TLGA 4KDRA 2C9YA 2BOVA 2IYWA 4K3VA 4HADA 4ZT6A 3TMKA 3R74A 1VE6A 2WSLA 4N4AA 5A6SA 3U09A 5FRDA 1JAHA 3MM4A 4RF2A 1EEHA 3RRJA 4J3FA 1TKCA 4FDAA 1L7NA 3IUBA 5TDHA 1RPZA 2YHAA 1PV1A 1QUEA 4GGOA 3VZDA 2WWIA 1WW8A 2HLPA 3UHPA 4G5OA 3ZHCA 4J4TA 3WYNA 3KALA 1ZI6A 1TZCA 4D02A 3LT4A 1K0UA 4BVKA 5CEJA 1MW9X 1PYGA 2GXUA 3NLLA 4LRWA 1P19A 4LJ5A 1RPNA 1Y6RA 2XXBA 3CA8A 3CV3A 3FRHA 4G8JA 4JP2A 1LEHA 1XSEA 3BWCA 4KGVA 4LDAA 4PGHA 4RGYA 2H1WA 3OT4A 1K2VN 3DAYA 1H4VB 1JSRA 2Q1XA 5KDOA 5HQ3A 5AVOA 1QNLA 3R5SA 2KMLA 1CS0B 3DOIA 4HWSA 4AP6A 5BUSA 4G5FA 2C5BA 1GAWA 2OBBA 4V1CB 1QG2A 5EIEA 4RFSB 1A4RA 4P3XA 3UJNA 4RIEA 1W5EA 1ADFA 4CL2A 1GN8A 1HYQA 1I3OA 5CT4A 4H7JA 5FUQA 3UWMA 3DM9B 3EIUA 4RHFA 4KPUB 2BT4A 2PR2A 2BFCB 2VHVA 4RXUA 1I6KA 4S24A 1ZD1A 1EJ0A 3WFIA 1PZFA 2ESRA 2JB9A 1QZZA 3C5HA 3SYLA 3H17A 3ROQA 1RE1A 5KWVA 4LZNA 1XZIA 1BQ3A 3UJ7A 2IIVA 2LUOA 3NHZA 3QKRB 2EOAA 4U5XA 4J0IA 1LA2A 2OO5A 4MP6A 4QJ4A 4UTOA 3PC8C 5HCIA 3QPBA 2PBFA 3V8NA 3N2KB 2QT1A 3PFKA 2XRFA 2B8WA 3DEJA 1XU7A 3LBAA 3WXBA 1NXVA 4W8OA 4X1KB 1PGQA 2IELA 1D1QA 2L18A 4LX8A 4WNCA 2F1RA 2CLSA 1V45E 4XIGS 5DP1A 3BYZA 5HWSA 1PFWA 3JAMA 4R8SA 1E3WA 5H9WA 4O4HA 4BMOB 4WBNB 3VYUB 1YS7A 4Y7CA 4IIYA 4B6EA 4PG7A 1JL3A 1ZWLA 2PLNA 3ICQB 3A0RB 3H2IA 4TYNA 5AVSA 3BAFA 2G04A 3A6HA 3IUSA 4RZQA 4L0QA 2CUKA 3GJ7A 3FZGA 1NAIA 4ENWA 4BQEA 3EDCA 1U2SA 4JB3A 1PFUA 2YZ7A 3GUVA 2P2DA 2PUVA 4II2A 1WV0A 3IPLA 3NOQA 5HF5A 3P4YA 4JQSA 3VR4A 4IIVA 3HUFA 3ZBTA 3DEHA 4I50B 1PGJA 2R8PA 5LVAA 3RH0A 4NAVA 3BHJA 3U4IA 4Q15A 3HCOA 1C7RA 2R5WA 1T9DA 5TRTA 1HX7A 1MD9A 4UFOA 1N0WA 3D3WB 5JLJA 4E5YA 4IDCA 4BIMA 4JFRA 3WXMA 3WQRA 2N1MA 4GYYA 3B82A 4PZDA 1GPWB 3BK7A 4DR6B 3BOSA 4B40A 1FSFA 1W73A 4AJ1A 2Y99A 4I55A 4LV5B 2OK7A 4DLTA 1A5AB 4GEGA 4I9UA 4MV7A 4ODIA 4E03A 3PHBE 1TK9A 2B1QA 4FGKA 3F90A 3JASA 1L5VA 1Q91A 1J9ZA 3N2GB 3NW9A 3H5NA 4OJNA 2PYDA 1C2TA 1FYWA 3PK0A 4KMRA 3CVWA 3G2PA 2B82A 2QTHA 4E70A 3A70A 2XA9A 1P4RA 3PWZA 4RJIA 4Z3DA 2C9MA 1YB4A 2EW8A 4UC0A 4DEXA 3KQUA 2WK1A 3EGDA 4FCVA 4UUNA 3INRA 1Y33E 1G8PA 1WXDA 1LDBA 3Q11A 1E1CA 3D0RA 4GP6A 4JVNA 3DLIA 3EXHC 4KXUA 3HKDB 2PR7A 4NTZA 5D86A 1AZWA 3DULA 5DCUA 5DYWA 1XZHA 2R60A 5EG5A 4BB0A 4MUYA 4N3NA 1FDSA 5K0ZA 4FXPA 3CO0S 2COUA 3GPIA 3N8IA 5E38A 3LYLA 5MGNA 3EW9A 4R1LA 3WK5A 3LCUA 3EFBA 2P41A 3WK8A 3W5DA 4HFMA 5G4KA 1F2UA 3AWDA 3PNMA 4CL3A 3BWDD 3HP1A 2XWSA 4ZQIA 1QJ4A 2Q0XA 2G63A 3IKVA 3NH9A 1N8NA 1OFVA 1OSNA 1OR8A 2IEZA 4GW3A 2IV7A 4DCSA 1OBOA 1S2LA 1NT4A 3GVIA 1CJCA 1IBRA 1XR3A 5LA6A 3H5WA 4NBTA 1EWKA 1G9SA 2BBOA 2GN4A 3NM4A 5TPZD 3G2HA 5DNYB 1ZJJA 1DAHA 4MIEA 4BVGA 1JTVA 1SUAA 1XX6A 1D3AA 3E48A 4PX5A 4XARA 3VI4B 3ZWKA 4UNQA 4LVNA 2EEPA 3TE7A 3TKLA 1KIMA 1PVVA 5ECDA 3ED5A 4IGFA 3T3MB 1QF6A 4D44A 4E5UA 2QJTA 4IJQA 5CYPA 2ILVA 1BS9A 4NECA 4BO8A 4ZGGA 4NFHA 2XAAA 2UXCB 1U8AA 4DR2B 3HWRA 3RWOA 4W5HA 2P75A 1DIGA 5JD5A 5K0CA 2KPOA 2PMDA 3VAZA 2Z0MA 1AD2A 1HOTA 2AQHA 3FKJA 4GO1A 3RDPA 3UFBA 1YNSA 2CKDA 1PL7A 3E8SA 3TBFA 3V4ZA 3O73A 1T9BA 1GGMA 4QBTA 2CDRA 4QUKA 1OH6A 1M0WA 3ET5A 1QP4A 3OLWA 3QZUA 5FUVA 4F97A 4O2AF 3TVTA 4ETMA 2I91A 4UEKA 5B1YA 4NBLA 4RCVA 1RMYA 2AN1A 4CT0A 5I48A 1JDBC 5AQEA 3FD8A 3VV2A 2ZSJA 3KAJA 1SOWA 4RS4A 5EJMA 4CODB 2VPYA 2X3UA 4FGSA 1FUKA 4JASB 4REMA 4TSRA 2IHNA 2CYAA 4MA5A 4F11A 2I6SA 2OXEA 3TOVA 4HBGA 3DTNA 5EL0A 1JJVA 4HWRA 1N7IA 2OHHA 2HTEA 4NK5A 4H4CA 1GCGA 1TYEB 2XY4A 3YASA 4CI0B 2GARA 2GSWA 4P86A 1H2HA 4TMXA 4LXGA 1NMZA 1N1DA 1INLA 1R8QA 3N5KA 4LHEA 1WZ2A 1OX4A 2LVBA 3BMNB 1ZNWA 1K68A 2IP4A 3H3XA 2EVWX 3S40A 4EBBA 1JDJA 1JPUA 4KN8A 4YRFA 4AZ3B 1ISGA 3EOAI 3GCDA 3O9MA 1BJTA 3OLVA 1EXNA 1KEUA 3L43A 3TLAA 4ZAFA 2C92A 4ZHQA 5IJ9B 4L6AA 4ZJPA 4J76A 1L4YA 2IBSA 5IKXA 1C0IA 1DAGA 2ZJYA 3GBVA 4TL6A 1ISHA 5DXAA 3ZHQA 3VVCA 1SIOA 4UDNA 1WRBA 3K0AA 4MUXA 5DBGA 1PWZA 3OURA 4QAQA 4E12A 1QHHB 2VHYA 3TNLA 1QORA 2I80A 1IG3A 4IDEA 2MCFA 3ZU3A 3PNBA 4ZKEA 3MHTA 2ZYSA 2EF1A 2VR1A 1ZJYA 2X8WA 4TT3A 3CS3A 2ZBVA 2LV8A 4MWSA 1KQFA 1HSOA 2TYSB 3RS4A 1NGSA 3BF7A 1JZTA 1J06A 3C7DB 1E9RA 5J9FA 5JD4A 1AA9A 1MX9A 2FQ1A 2AYYA 5AW6A 1KEZA 2FUG1 1WMEA 4KHZA 4ND3A 3TI7A 1UMDA 2C4TA 1L4EA 2WJ4A 3NNDA 5F3WB 1H1DA 5FR1A 3D02A 5ALTA 1FW8A 3N59A 3PHIA 4HDKA 3A4VA 5CNKA 3CLUC 3UOGA 2XBLA 3HJNA 4BVEA 1N6IA 5ICGA 3NX4A 2J46A 2VYFA 3STVA 1JHMA 5KREA 2OKCA 1JTEA 2YY6A 5L3RA 4DIFA 3ZVLA 3AZOA 3QY9A 2HHHB 3ICEA 3GNSA 4GPD1 4AUEA 2BKUA 3LQ1A 2GKGA 3PUWA 2C07A 3HPRA 1S3GA 5BWCA 1T8UA 4L2IB 2F3SA 4GZLA 1O5IA 2P9HA 3L4KA 3U4MA 1CDOA 8MHTA 5DTQA 1O0CA 4C6TA 5JO9A 1ULBA 4RA6B 3SLKA 1AUQA 4HS9A 1Y9DA 4NENA 4FEAA 5H82A 4DLRA 3NIGB 4BMXA 1ZK4A 2PG3A 2I8AA 1E98A 4H7EA 3OD1A 1GSIA 1IN1A 1TU0A 3BTSA 3I12A 5AJUA 1QTQA 3RTCA 5GVRA 1U81A 2YQ5A 5JSFA 3F6YA 3V1KA 3O26A 2BL4A 5H02A 1FX1A 3BE5A 4DABA 1XRPA 5ES4B 1GCIA 1GEGA 1ESEA 3JY6A 4TXNA 1Q22A 1Z6GA 4CFYA 1T24A 4OHYA 1PLJA 3JD2A 1XTRA 4ILEA 1I7NA 1LGYA 1M2KA 3LSTA 3URKA 2ZTMA 1RQNA 2HI0A 1NLZA 5AUQA 5I7SA 2JBHA 1IONA 1KVRA 2WZQA 3RTBA 3JQBC 3TRJA 3GRUA 2G88A 4D4JA 3UMVA 1LQTA 3DBHB 4D9IA 2A86A 1ZSNA 1ZHFA 4MVJP 3V8RA 2RI0A 2ZS8A 4LSZA 1SRRA 3UJ8A 5A7HA 2ID7A 1J6UA 3SZRA 3ZD8A 3HDTA 3KJNA 4UDXX 1RD4A 2V03A 1XZPA 4GC9A 3ROMA 4WJLA 1NVVQ 1S2OA 1S4QA 1AQJA 4I8DA 2JCSA 3ADOA 1H9BA 4CHTA 1CCWA 1FS5A 2Q1UA 5JQWA 1C30A 1XXHE 5C8VA 2OBFA 4X85A 5JJCA 1G3IA 5AKZA 4QODA 2QRJA 4E5SA 4DHEA 1R64A 3D2LA 1ZKMA 1NUPA 4RL6A 2OQVA 1T3GA 1SBQA 1WULS 3E4CA 3ZY4A 2GN8A 1HKUA 4TV9F 3IHWA 4QBFA 5EZ5A 3N3AC 4ER3A 3EZGA 5CBPB 2V4ZA 4TVBA 4RK6A 4AKIA 2XCQA 3LCJA 5K0LA 2ZVPX 2AMVA 4UE3S 1NX6A 1BE8A 3AU9A 4IEIA 4LGVA 5K0JA 2VUSA 5A4AA 1PJ3A 2A58A 3FVTA 3P0RA 1VMKA 1V95A 1QB7A 2WUFA 2OPHA 3N2LA 1QE3A 3ZY6A 3D8UA 4MUIA 3TG2A 2Q5EA 2QD1A 1JG4A 1LW6E 4JLUA 3DBLB 2OYSA 3WSTA 1ILEA 4LIPD 2Y9MB 1O95A 4KIWA 3VU8A 2FPRA 5P8WA 3AVOA 4EMBA 2G9ZA 2JAPA 3PB3A 4MJ7A 2M6RA 2PYZA 1YXMA 4Q7QA 5KJ6A 4I5EA 3SE0A 2DKFA 3PGVA 3QUQA 4BFYA 3SQXA 4EJMA 3H2SA 5HCUA 2ZUUA 4R2WA 3RREA 1PBTA 3CUSA 3NC0C 3D1LA 3DS8A 2AN9A 3V2HA 4CPDA 4JD5A 1TJPB 2G40A 2ZAMA 1QLJA 1U02A 3UG7A 1VPDA 3JPYA 2NXJA 1XDWA 3E7XA 5DGHA 1HM5A 1KH2A 2OCAA 5AJWA 2I54A 1P45A 4G5XA 3FTQA 1C41A 3O83A 1UDXA 4YFYA 4IO1A 4DNOA 3KKNA 4MICA 2VDMB 2QVCA 4UW9A 3P9ZA 4MR8A 1TAHA 4A8JB 3HVIA 3W2IA 4WDQA 2Q50A 3ZQ6A 3T7RA 4NZMA 1PNRA 3OG9A 4KTVE 1KZ4A 1OWPA 4ERNA 1XRLA 4Q3DA 3L9XA 3AJAA 5C51B 2HJGA 1OTYA 1IAQA 3UC9A 2OHFA 3T1VA 1IN7A 4GM0A 2ET6A 4O33A 3NIFB 1W93A 1XNHA 2BDUA 3EWSA 3FOAA 3RYIB 4ZYWA 4GGMX 1E6LA 2WKRA 1T4BA 1B8OA 5K8VA 2O2SA 3HV2A 1IY9A 1W1UA 2ZI9A 4YJFB 1SBCA 1UC5B 2I8CA 2RHGB 3FWNA 4M9ZA 3SC6A 3KS9A 4CCWA 3AF6A 3CLRC 4AB1A 2VQ6A 3G7NA 4OHFA 2DQ4A 1OB5A 1JAZA 2DUUA 4CM4B 1RXWA 1O9BA 4AY5A 1AKMA 4IO0A 2QE7D 4U39A 3UJ3X 1T2UA 4QOEA 5F3DA 4I3FA 1EXVA 4V0SA 1E8MA 4JV5B 2IWRA 2QTTA 2JGDB 2ODQA 4ZXPA 1EBUA 5JYDA 2Q46A 2GN6A 3FLMA 1PKEA 5AOVA 5A5FA 4DKJA 2Y1KA 3OCXA 5LIPA 1TO2E 2JVKA 4CKYA 5F12A 1LLCA 3K9CA 1HORA 3K4HA 1DKQA 1IUNA 1NBWB 2XV1A 1EG7A 1FJHA 1TMYA 1BOFA 5TJ9A 1NF9A 5FOSA 4GPAA 2MT9A 5DNWA 3ZCPA 2JA1A 2FUNB 3HPQA 1AO0A 2X41A 1PT6A 2WNSA 4JN6B 3WRWA 2P79A 1UMCA 2JKZA 2ZWMA 2J9GA 3IBTA 1D8AA 3NATA 1DG1G 1ECLA 2BDTA 2EKZA 4O2BF 4YI5A 5FBHA 2HHAA 1G5FA 4FGUA 4BMVA 3GROA 4EA6A 2PU7A 2VBIA 2GOYA 3FJ1A 4EGFA 2KQUA 1UPCA 5AUOB 3MPOA 5K8TA 4LFAB 2X8JA 2F2TA 1KI9A 1FRNA 5HIKA 3OJCA 5BWNA 2IPMA 4TSKA 1Z25A 4OJYA 1NJ1A 4MARA 3SBOA 2NV2B 3LO8A 2YHIA 1S2NA 4C78A 4ZOLF 2IC5A 3ZGVA 3K9NA 2JCBA 3DOOA 2RGAA 3QKSA 4S1VA 3FAZA 3O90A 1SNYA 5ALFA 2F17A 1HH4A 3LP8A 1Z5UA 1NW8A 1GQYA 2VXOA 4ZO6A 3I09A 4CQMB 3GLSA 2WIAA 1RHMA 1G41A 2GAJA 3K1AA 5LNK1 4HQFA 2EFYA 3LI2A 4WDRA 3L7JA 2NADA 3HDGA 4PLFA 2ONJA 1N1GA 1X1EA 3WE7A 2OGZA 4RBNA 2O3SA 2Y0EA 3VDNB 2WKWA 2X4GA 4MLCA 3A36A 2F43B 1ZH8A 4EY7A 4FFBA 1EQAA 2FK7A 3TS1A 1Y3AA 3PZBA 4UNSA 2ANCA 1GR0A 3C74A 4NL4H 1RC0A 4MV4A 4XIIA 5BYJA 4DJ5X 3WBJA 3LOPA 5JEDA 3I34X 2JGLA 1SUPA 4DYVA 2J3DA 2HDNB 4EB3A 4OXRA 3CRQA 5GWXA 1TE2A 4J2OA 4JI1B 3FWYA 4BMZA 1ODKA 1H3FA 1CNFA 4LE0A 4L72A 2W83A 3GV0A 3C6YA 3ED1A 1H2BA 3TZBA 1RJDA 2HBRA 1ZGJA 1YFJA 1S02A 1Y37A 2Y77A 3GLUA 3RV3A 3NONA 3MAJA 3RSGA 1XKLA 2J0VA 3BBLA 4PFKA 1NASA 1MAAA 1T2NA 1M7BA 2X5KO 3BKWA 3D64A 1M6VB 2AF3C 4NP6A 2W5UA 2V5VA 2X6TA 3ROFA 5M04A 1OFIA 1X1CA 1CKEA 1N33B 3I2KA 4MW7A 3WGGA 5ESWA 2NU7A 3AFHA 2Q5OA 5KYNA 1Y8QA 3O3NB 1EWYA 2IOHA 3QKRA 2Q45A 2GK4A 2V7QD 2PS3A 3DZJA 5DBIA 5CIWA 4TX1A 5CA1F 3CF6R 1GLNA 1I0ZA 2BFPA 3D6FA 3HBFA 4LZOA 3TEJA 1GTZA 4ZHQF 5IZCC 3R7SA 5C8ZA 3NFRA 4V0KA 1VTKA 4FFPA 5GM1A 2EFGA 3MC1A 3L8FA 2OD9A 2I1LA 3GFSA 4OP3A 1P6XA 3FHCB 3SYNA 5J23A 4BFUA 1RRPA 1M6HA 3GMDA 2PH7A 4YT4A 1XI2A 3DMHA 2QLFA 5FTMA 1Q0TA 4LA4A 3TOZA 2B1IA 1MJFA 1XZEA 3M1YA 1TZKA 1XAGA 4AIRA 2O8EA 1OLXB 5EZYF 5C18A 1HT3A 1N2XA 1TCVA 2R1UA 2XD4A 3BRQA 3NC1C 4ZYZA 2JGEA 4WLEA 1XLWA 2AL7A 1FMFA 3R6DA 4TMFA 3DAGA 4BJ3A 1LCIA 2JFVA 3AY0A 3G8YA 3WHIA 4F1KA 2OL4A 4AY3A 3E70C 2GSDA 2XT6A 4PVDA 5IJZA 4X63A 1I1HA 3BA6A 4DEVA 3U56A 3HA2A 2HDOA 4HLUA 2ID9A 3BMCB 3DHVA 1QF9A 2NT4A 3DMTC 1K63A 4OJTA 4OL9A 3F2IA 4PAMA 4QEZA 3KETA 1H2RS 3QFRA 4JB2A 3PA8A 2QW1A 3B5JA 1XZLA 4R84A 2B5VA 1Z9BA 1ISMA 4FDLA 1RADA 4AKSA 1KZHA 5H0IA 3A0UA 1BQ4A 1DC3A 3R6WA 2A0KA 3T1NA 3HCEA 2J48A 4UCXA 2HNBA 5JDCC 2H4HA 3UM9A 1KJ9A 4HQKA 2P9QA 5IJXA 2HF7A 4DL9A 1BOOA 1ZL2A 2IHYA 2QUAA 2RHHA 2WD7B 1Z7EA 4HDCA 3WGZA 2GM3A 1P1IA 4M1WA 4R4JA 2VEOA 5LJIA 2A9OA 4MKRA 4J16A 1QGUA 2OFWA 4KR7A 4DLBA 3RFVA 1EJ6A 1V8ZA 1FDUA 1Y8CA 2RB4A 3QBTA 5HRUA 1JNYA 1MABA 1Z0IA 4G09A 3BCSA 3K16A 4KLNA 3KOYA 3WFJA 2I4NA 5IDQA 1QK5A 4JGGA 2F1IA 1JX6A 1SC6A 2BM1A 4N8DA 3ZWXA 1YA6A 1KI2A 4I2NA 3BHMA 1ZGHA 4B45A 4J1TC 1HDIA 4TUYF 4RA9A 5CTAA 2H4FA 1YDGA 3FI0A 3ZNNA 1Q0LA 3I2YX 3VYWA 3I32A 3U19A 1H0KA 1RTTA 4KLZA 2GEUA 4R6WA 5DEIA 4QLBA 1FFEA 2R3SA 3JW8A 4WNAA 3KQVA 2V6BA 1BKSB 1ZUD1 4O2AB 3ETLA 3F9CA 1XBTA 3X1DA 2QSZA 3BK2A 3WYGA 3N86A 4Z4QA 3HJAA 4D3XA 3ONDA 1AX9A 1XE3A 4EM6A 1IY0A 2I7XA 1XA0A 1OIWA 2FN4A 4ZJZA 1AHPA 1YJAA 1BO6A 1YQQA 1YF3A 3O3CA 5TGZA 2FMHA 1H2WA 3FSJX 2FPLA 1V8OA 3GFVA 1GZ4A 3QFTA 4Y18A 5ICMA 2LW7A 2FSVA 2VDQB 3KKEA 2PJRA 1VYVA 2NYVA 2YNMC 1O4WA 3KZKA 4GPTA 4R8MA 4R1OA 2ON6A 4YRTA 3ZDYB 5CDFE 4BPBA 3OC6A 2HSJA 1S3FA 3KOOA 5CA1B 1KOGA 1E7QA 4PO9A 2YBEA 2QRPA 3GAFA 3KYDA 3JQFA 1CYEA 2R2GA 1GO2A 1BMFD 1YB7A 1ZCFA 2HQSA 1Y4AE 2NYUA 2OCLA 3IDFA 4OUDA 1ZM3A 1TA9A 1CQIB 1DAIA 1A1SA 5CJJA 4RPKA 5JSKA 1BG6A 1Y63A 2B4KA 4WD3A 2J7PA 3GJ4A 4WESA 4WOCA 4Y1FA 2JFWA 4BKRA 3RSCA 5J3JA 5KX5F 1PR6A 3B9PA 1G3QA 3AZPA 2A3NA 2XVYA 4XIYA 1YU9A 2HJWA 1Z39A 2K87A 1O57A 3FCSB 4FR2A 1QZUA 4LYFA 4O4JF 1IHUA 1A77A 3R5JA 4MW9A 1SUEA 3MA0A 2UYGA 5D51S 3HB5X 4I7EA 1SBIA 2FR8A 4HRYA 3FVVA 2NV0A 3FCXA 3N7UA 3SJCA 3JQ9C 1FJXA 3C24A 4U63A 1PWEA 1SC4A 2B8TA 4KBGA 5DTMA 5B2EA 1FYVA 5F9MA 2O54A 1Q17A 1WXGA 2B6NA 1UPTA 1JR6A 3HP4A 2C95A 2XHEA 4IW3B 3UK0A 3OI7A 3UVEA 2QQGA 1LVUA 3W7BA 2SKCA 1TA4A 2CXNA 2VNSA 4ND8A 1K7EB 3VU0A 4W4TA 5CFMA 4B3RB 1FJGB 4Y9UA 4X1KA 3TM4A 1Q7TA 4C3UA 1TVKB 2O2XA 2EWMA 2RAPA 3B1KA 2BGNA 3O75A 3ETEA 5E95A 5EHIA 2NMVA 4QUBA 2CFIA 4YCSA 4QTXA 1VBFA 2DQZA 4I4TF 4L9WA 3VU3A 1LVGA 1Q84A 1T26A 1VG0B 3S27A 4LCBA 5IH7A 4JK3A 1DSSG 1O1YA 3FW1A 3IE2A 1PK8A 4PICA 4QXPA 2PL1A 1TEXA 1H2EA 3CBQA 3A1SA 3RM3A 4AX4A 1I7QB 5GJBA 2GO7A 3LX6A 1SXHA 1RIFA 1II0A 1M66A 4J0CA 1Q14A 1GUYA 3FGNA 2WMYA 3GGJA 2O57A 4A2WA 3AKDA 4D57A 1EUCB 4DNPA 3E58A 3L0IB 5ITVA 5JATA 3K09A 1O96B 1GDHA 5G0VA 3T7KA 3FVRA 3MHPA 2DB3A 4QUGA 1KDZA 3LUJA 5KYWA 1ELOA 5JAUA 4KQHA 3P0FA 1RAGA 3I9V1 3N58A 4JVMA 4I8XA 4DBLC 2FQXA 4YLYA 5FH9A 5J4HA 2QMUA 3G5LA 3ZE2B 1Y6JA 1MT0A 2ZSKA 4PR0A 4B3JA 3DDNA 3Q3HA 3QOXA 1VJ5A 3ICPA 3HFJA 1DRKA 5LQUA 3QKIA 5CIQA 3TSYA 3ZV7A 4URUR 4GMXA 4OP2A 4Q48A 1XMSA 2BKLA 5JC8A 4DQUA 2G7ZA 2UUBB 3L4EA 4QUDA 3H87A 2I9PA 3B78A 3H7IA 4S1PA 3ABIA 4HGYA 3DDHA 3LOQA 4FONA 1N75A 1NMSA 1RM4A 2V96A 1J23A 1MOZA 2BUCA 4AF8A 3KT0A 1MJGM 3OQMA 2HK9A 4XZ3A 2J9RA 3BRWD 5AIBA 2F4VB 3AY7A 2FFBA 3RFUA 1Q7BA 1SU6A 4TOIA 1HGXA 1RSZA 3FPHA 3S0JA 3CNBA 4P3YA 3TMYA 2C5GA 1T43A 1PVOA 5CU7A 2PNFA 4K03A 3QU9A 1SHUX 4FHZA 4MQMA 1SCAA 2V45A 1GYQA 2R6FA 3ELYA 3NDIA 1EWTA 3WL4A 1SZCA 2C5HA 2H1SA 3L06A 1ZH0A 3PSAA 4M1YA 3LU1A 3SQLA 1XRSB 5LMCA 2ZBEA 4DDUA 4YRIA 2A5FA 2QQFA 5FPQA 3UUEA 4W5WA 1M1UA 3IOCA 5KTYA 4UVHA 1BH2A 4OVKA 1HURA 2JJMA 4WBSA 4BBJA 4A73A 3HJUA 3MWYW 2IEDA 4DRXB 1YR8A 3UGKA 4CIXA 1PZNA 2HY7A 7ADHA 4AQDA 1VXRA 4QOJA 2GYWA 4F5ZA 3FR7A 3LFTA 2EF0A 1JKJB 1JH8A 3ROXA 3SS7X 2FPXA 3C45A 2FW7A 1KEVA 1PNVA 1U2DA 2CJWB 1RDFA 2FN7A 2H17A 2ODAA 3LT0A 3LX8A 4MWEA 4B9EA 4K46A 2NTJA 5JCZA 4PC2A 2W6MA 3Q3JB 4WGFA 3FKSA 3NHPA 3RC7A 5GZ6A 4WY8A 2YV5A 4EBFA 3NP9A 4C7XA 4NYIR 1B6GA 1ENYA 3UBMA 1M5TA 1FFCA 2RGNA 2J8ZA 3NT4A 3WRYA 2XBMA 2OQ2A 4ITVA 2NM0A 2YMMA 3FMGA 5DKFA 5K51A 5ALRA 1B4DA 2VDVE 4TUYA 5FI3A 1HE8B 4I4LA 2V7EA 3C5VA 4F9TA 3IOBA 4BKOA 1WDMA 2J5KA 4A23A 2RE8A 3T7CA 2IH4A 2H63A 3JQGB 1ULTA 3A06A 3IIJA 5HQ3B 4ZI3A 2A0UA 2VRNA 4C1NA 1VSUA 1YD7A 1B14A 1XQ1A 2D1SA 3L46A 1V1RB 2GZSA 2HO4A 5ICCA 2DPMA 1QYRA 3PPVA 2PSFA 3BREA 1R74A 3CB4A 1VPEA 5KO2A 1L5ZA 1QHFA 1FXWA 4JJ8A 4M9UA 2ZU0C 3HSYA 3KEFA 1ULSA 2YCLA 2OO5C 2CNDA 4HWGA 4MUJA 5IK2A 2DFKB 4F93B 4OYLA 4B3GA 5CHEA 1EDBA 2M6SA 5FORA 1PFGA 1AGXA 4DJJA 1FL9A 2OG1A 4GZ6A 1EP9A 3CZQA 4DJEC 2CBGA 4MR8B 5CT8A 4QDOA 1XD2B 4HGRA 3ADBA 3DNFA 3LQQA 2YJ4A 3GPLA 1SA0A 2P3SA 3JZAA 4G5HA 2IYTA 1FFGA 3ZW9A 3TG8A 4BO3A 1CUBA 5HYVA 3IE1A 3Q12A 2QI9C 3OC0A 4UPVA 3RUCA 3GW8A 2P8JA 5HZGA 4LS3A 3IAAA 3LM8A 4MDEA 3RYIA 1PEDA 1F4VA 3DMGA 2WE7A 3LTNC 1EGVB 1DJOA 4KTTE 1XAJA 2G9UA 1ONNA 2VBFA 1K8ZB 1I3NA 2I3DA 3IHKA 4B6RA 5ITZA 3FGOA 4FGJA 2DPHA 4JUAA 4XOUA 4ZREA 4KPFC 4K6CA 1P1RA 2GASA 4YMWA 5EHGA 3ZV6A 4YQFA 2H18A 2I0FA 3QELA 1DLJA 2GRAA 1TUBB 2UZ0A 3DVQX 3D0OA 3F67A 4FQ5A 4H3SA 5AI5A 1Z0UA 4LMPA 4MWOA 4K28A 4Y9RA 3OX2A 4YUYA 1BMTA 4DS3A 1Q7RA 5H4HA 3TLKA 4E4TA 4JI6B 1A9XA 4OB8A 2ISQA 5CVEA 3IVMA 1TUEA 1YR9A 1IMJA 5F33A 3RVLA 4LTNA 2AUNA 2WG0A 1BE0A 1OLUA 3PXAA 4E7PA 3K9LA 1E6WA 1U9IC 3OZ7A 4YUVA 5CLFA 3N6RA 4I1IA 3VNUA 2DLDA 1HZJA 1MNQA 1QHSA 3UKJA 1P0QA 1T8SA 1TNDA 2GXSA 3O7MA 4MKZA 2VKQA 1J5PA 1V2HE 5IZ4A 3QP9A 2ALJA 3QV1A 3KYIB 4EG3A 1BDIA 4Q93A 2AD1A 1MOSA 3ZE9A 4XEHA 3ZCQA 1KC3A 4LV8B 3L6UA 3VUEA 4KH1A 2JGAA 4URVR 2VYVA 1QIDA 1X8XA 2WYUA 5G40A 2FWBA 3OPYI 5F64A 3KSMA 1O6BA 3ISTA 1M33A 1V48A 1XTIA 3S2SA 1GGEA 1G2QA 4F84A 4NICA 4QHYA 2IZ7A 1WW2A 4EHHA 4OKSA 4EO9A 3FUWA 2R97A 4HH1A 1OA1A 3S2FA 2FPGB 3GRVA 1CV2A 1E1QA 3IUNA 1C7JA 2H5JA 4GI1A 1AE1A 5JJLA 3WLFA 3NHLA 3GLIB 2V6JA 2RI1A 2XZDA 4HVAA 3VKWA 5DLEA 4DANA 5CB4B 2YN2A 4HMOA 1AMUA 3QI7A 3RUHA 1ZLYA 3VR3A 4ER6A 4I1RA 3KUKA 4MP8A 4FKMA 4BE7B 1T2CA 1A50B 2FSHA 2LKDA 3A4TA 3NOOA 2CLKB 1YWGO 4CG1A 5JAOA 1PS8A 3OAAA 1K3FA 2FETA 3H18A 1L5WA 2WYOA 4GWLA 1P2GA 2W37A 3ZU2A 4JP5A 4QM7A 1P17A 3MBIA 1PTKA 4ZT7A 4L5BA 1RWNA 3CPEA 4ZVNA 3TGLA 1DXOA 2J41A 5TVKA 1Q7GA 1XTPA 2I6TA 3BQMB 3G79A 3UB3A 3JAWB 3NZEA 1QFSA 1UFOA 1V5IA 3FFAA 4KIUA 4XGKA 4JLAA 2UZIR 1R6BX 3NMUF 2QN1A 3DZKA 1HEYA 1AVTA 3JQQA 1MRZA 2H2AA 4ZMSA 1QYCA 2RGDA 2CXXA 1T2VA 5K4GA 2FSFA 3H8WA 2YVKA 3RK4A 1OLSA 1FEZA 3GK3A 3LDGA 3N8HA 3KR2A 2C2XA 4YR9A 2ZANA 4X65B 4PZ9A 2ORVA 3VNQA 1G20A 1WAMA 2ZIFA 3CCCA 4C1BA 3WDMA 2W58A 4ZEMA 1Z17A 1PL6A 3HU2A 1YUBA 4P38A 4ND6A 2NXEA 1NUUA 2QY9A 3N2YA 1BE6A 3HA7A 3WLPA 1Y6GA 1Q15A 1UIMA 3QVSA 3WJ7A 2YFHA 4DJDC 2AKYA 2BFBB 3LP5A 3Q9NA 1C81A 1YE5A 1YQDA 3K0EA 3MMNA 4IVNA 1CUDA 2PT9A 2YJNA 2IFTA 3GMSA 3KEQA 1V3QE 2FG6C 2XNSA 5DSZA 4KDCA 1E94E 2QS9A 2EJWA 3ANXA 2PAFA 4ZI7B 3A1TA 3B70A 2P5UA 3ZJVA 4HAYA 3T41A 1R3UA 3L1VA 4DGSA 1NQOA 4DB4A 2FZ4A 2KJQA 2I7CA 3ZDQA 3QVVA 1PJ2A 3FUUA 3PX2A 1OBFO 2QIOA 1LLUA 4BEVA 5JMWA 1OILA 4PHFA 1N5MA 2D2XA 1YFLA 1MFPA 1DTWA 2NO7A 2R1TA 3GAAA 1H8ED 3TNJA 3MS7A 4C7OA 3RVJA 3QUCA 4JDPA 2FPUA 4YHHB 2YXDA 2BJWA 2ZIVB 3EODA 3FN4A 1V71A 5JE8A 1JLMA 1KTIA 5GIPE 2WUGA 4Q4LA 3JRXA 2H1IA 2OK8A 2OZLA 4LGMA 4MWBA 1R9MA 1WCXA 2PA3A 3EY4A 1P2UA 2VDKB 1YS6A 1Z5GA 1U1DA 2ZQYA 3Q8KA 4TROA 5JNVA 3W1EA 4YR7A 2XYRA 1G17A 1KI1A 2XE4A 2DETA 3FTEA 1GPJA 1RVDA 2PTHA 3HH8A 3REGA 5HF6A 2PVSA 2PSDA 2JAHA 5DEOA 1Z12A 4GRDA 1UP4A 3TNYA 2LZ0A 1EX1A 1KMCA 2H1FA 3TMAA 2FR0A 4BXOA 2QRUA 3TRKA 4CMCA 1DAFA 1JSCA 1K8QA 3F7OA 3PWTA 4UAVA 4HHEA 4YJ3F 5FBZA 4ARAA 4AZ0A 4R3UC 1UMDB 1NIPA 1KAOA 4A9AA 1E7YA 4BFVA 4Q3NA 1F06A 1OGIA 3KPUA 1A71A 2VAMA 3FOCA 3GN2A 3P2KA 4OOEA 521PA 3VPAA 3A9TA 2QN6A 1T2DA 4ED9A 1VG1A 3NT2A 4L73A 4ZA2A 1KOJA 3LLVA 4QBIA 5GONF 3PNVA 4HNTA 3PXBA 3HWSA 4KGDA 2YIMA 1MC1A 5AW9A 2AHRA 1L5NA 3PZRA 4E88A 3U3OA 5ABPA 2B9EA 5HMMA 4NARA 4MS1B 5CFLA 3B8HA 1DFGA 3HL0A 1OV4A 3HN7A 3S99A 2HM7A 2XZLA 5K05A 3P96A 4LI3X 3L7MA 3VR3D 4RA9B 2VS1A 4Y9SA 4KXMA 4ZVRA 2VSXA 1GV0A 621PA 2D54A 1I3LA 5JYCA 2DLNA 2JFNA 1FTNA 1ONBA 1NL3A 3FYCA 2CZGA 3ORYA 2XPCA 3W8DA 5CCDA 3L92A 3DGEC 3IO5A 5KNBA 2Y66A 5EFOA 3K0BA 3GGGA 2AUMA 4XGQA 4PAQA 3HNOA 3CKMA 5LD2B 3I5YA 1I13A 2RG1A 1NM5A 5D84A 3RYFA 1BCSA 1JKXA 4W7SA 3QLUC 1C29B 4UE2A 2H9IA 2ZYVX 1CFJA 2B0JA 4DA0A 2X0KA 2HF9A 3OTQA 4JSRA 4R7ZA 1QC5B 1UJMA 2IODA 3PE4A 5A5VA 2FWPA 4FJ1A 4MQ5A 3UYKA 4LRQA 4CV2A 1J25A 4ZPXA 3MXOA 1A8HA 1N57A 1J70A 1T8TA 4FFBB 1UBKS 1SVOA 1NVXQ 2PKEA 3DKVA 1L5FA 1PZHA 4PSVA 3S44A 2JJQA 4YDQA 2ZJ3A 1XEWX 2GHTA 3DLTA 1JA9A 3HCBA 1X77A 4H7PA 4MCIA 3VOBA 1R6DA 1RTKA 3HB0A 5F7XA 1KGDA 2CFOA 4HZUB 2EDCA 4OL0A 5JCJD 4RY2A 1BHSA 1K06A 2QTBA 5EMJA 4Q9IA 3MTGA 2BH2A 1H5QA 4NZPA 3DEZA 4F2GA 3CQ9A 3W5UA 3K0HA 3E1SA 3H1EA 3OIFA 1T6XA 2FLWA 5HJ5A 5JRDS 5KNCA 3NS7A 3DBVO 1DHRA 4ZK2A 5EJ7A 2WJ6A 2YOGA 2DZDA 2UVQA 2VAPA 3E4DA 1VZ3A 3UWSA 4RTSA 1YKSA 3P9KA 4ZCPA 2R7AA 4JYCA 1Z8NA 1N6OA 1C1YA 2P0YA 1UJNA 4M0UA 3DHNA 2YFQA 5DP2A 4NCAA 1AQIA 2ZB2A 3OF3A 4L8YA 4MW4A 4QTZA 3OHSX 2PE5A 1D03A 1ZQ1A 5JS2A 1PTJA 3OF2A 1V11A 3BX1A 3IUPA 2X77A 2C99A 1XD9A 2O0MA 3C8ZA 1HE4A 4ZZ1A 1EX9A 2D00A 3CHYA 4DLZA 5K7SA 4D4IA 2VZEA 1BCRB 1GNSA 1HG0A 1X9HA 1EK2A 1FRQA 1P1FA 2AWNA 3R3XA 4O5AA 5TGTA 3E15A 1KWGA 2GVNA 2DSNA 3K9WA 4AIIA 4C22A 3I9LA 1JR3E 1KK3A 1SQ5A 2YICA 3R44A 4KSBA 4NYJR 4R3NA 4M9SA 5JMPA 4ES6A 2VFAA 2BFOA 2XCLA 4RF4A 3I76A 1IULA 2AF4C 2Q5FA 2QDKA 3PKZA 2OGUA 3TSZA 3UAYA 5MN5A 4ZVUA 2G0TA 2D7JA 2CMHA 2JFYA 3HFSA 4NCXA 5BPHA 1EFPB 2JFBA 2VF2A 4FYKA 3TUJC 1GA4A 1Y9JA 3DF7A 3LBYA 1PJ8A 1B8UA 1P4SA 4HRVA 4RANA 1QGED 2HU2A 3EGEA 3PFGA 4YDRA 1RPTA 2BGKA 3PI7A 4BFLA 4XYMA 4ZAZA 4Q7LA 4PLWA 3ESAA 4LJ4A 1LXCA 3SQNA 4DA8A 5JH7F 3SYRA 1E2KA 1TT7A 2HU7A 3W34A 5EWLB 4CM6A 4NPCA 1JJFA 1OX5A 3BFXA 3QJYA 4YGXB 3N2IA 2H59A 2HWXA 2E4VA 1DRWA 1H6AA 2ZWOA 3AT1A 1GGNA 1JHXA 2MYNA 3EC2A 2GFQA 4TWBA 4ZQHA 3ZHVA 3TB6A 5B7NA 1HF3A 3QA9A 2BGIA 2VRWA 2HRZA 2WTAA 4GS5A 2ZM5A 1COWA 3CW2A 4YLGA 1MB2A 3LCMA 3MJHA 3RVPA 1F2VA 1ZJZA 1FP7A 2EGGA 3CR3C 3H2ZA 2Z5GA 3VMMA 4LYHA 5BR8B 1H6BA 1E0SA 2QUBA 3NBQA 3GFRA 3PNPA 1PUXA 5EJ5A 1KZYC 2MINA 1PFVA 1WXIA 2RAUA 4PM4A 1UEJA 1UKEA 1GUZA 3E9ZA 3HGMA 4EUSA 1MIOB 1A7JA 4J0KA 1ZI9A 5KOJA 1ANKA 4DILA 121PA 3MYYA 4ZO9A 4H1VA 2P65A 1KAHA 1X38A 1MPTA 4O4HF 1DIAA 3BHNA 4EEZA 3MGBA 3IXLA 3DWGA 4OJQA 3VO1A 1AQYA 4RK0A 1GITA 5JCXA 2C82A 2HCBA 5BQ3A 1A69A 1X14A 5SV2A 3MMZA 2AFVA 3RSOA 1PBNA 4LQCA 4ZDKA 3OZUA 3COWA 3K6JA 2IHVA 1X3SA 2ZBRA 3N07A 2HIAA 5KX5A 2O3RA 2F8TA 3RVMA 1KK2A 4Z4HA 5AM5A 1T35A 5CPFA 1PZEA 2YOHA 3A6JA 2Q6OA 2XQVA 4Y0AA 4LHSA 5DWDA 4D43A 3IQFA 3RGGA 1R27A 2WD8A 2VCYA 5K8CA 2Q4EA 2P3LA 1TECE 1BU8A 2V3WA 3LXRA 3FCAA 2RGGA 1ZMXA 3NKFA 4KU4A 4MEJA 1VE1A 5CNIA 3EPJA 1L7XA 1U4OA 4N7MA 5FFFA 4DA7A 4DNFA 3OJ0A 4GNRA 1YHYA 1EHCA 3NBZC 5CJPA 2H2GA 3PUIA 3RBZA 4J7XA 2OAEA 5L6LB 1KVQA 4QEDA 2OV3A 3AHFA 1AG9A 1MEJA 3H9GA 3NGMA 3VNAA 5KNCH 3HYRA 3Q0TA 1D6JA 3UF0A 2OT3B 1DJPA 3CNLA 1T9KA 3H86A 2O0HA 3BL6A 4OXKA 2R48A 5DI3A 2Q5LA 4CDMA 5J4VA 3BPSA 4HTFB 5I7WA 4HVCA 2JIOA 1TYDE 3K30A 2AOTB 1I6LA 1E3TA 3GAZA 3LCRA 4AROA 5U9CA 3AOEA 1SQ0A 3MJDA 5GGXA 1ABEA 2G8NA 1F8YA 1ZBDA 2H7YA 4OGGA 4RJKA 5EQFA 3X0DA 1UOPA 2V1XA 2XRZA 4EY5A 1BDBA 5LL6P 1KPGA 1PEYA 2CHGA 3PRYA 3GEHA 1ZFNA 4HSGA 3ZDXB 1G7CA 1YR2A 5IKMA 4OV6B 3AR9A 1XQ9A 3NASA 3W6PA 1T1SA 2IXEA 2REXB 3NJRA 1X87A 1QO9A 1U6IA 1ZLXA 3LDAA 5AKEA 4M1QA 4PBTA 1UFRA 4WL0A 3LO5A 4HLUC 1C1DB 1MIHA 1UZLA 2X86A 4A10A 3IVAA 2JA2A 2PMFA 3MN1A 4R7TA 5ELMA 5AYVA 5AWFC 5FLKA 2KX7A 4IHJA 3R7BA 4XYLA 5F98A 5BWOA 4MVCA 1E9BA 5FYQA 2R0QC 1OHHA 1XDSA 4MWCA 1QP8A 2H1CA 3RAJA 4RLHA 3TJZA 4F60A 1Z33A 1ZXBA 5C1OA 5AK6A 2ERCA 4L4ZA 4RPJA 3ZIAD 4R16A 4HDNA 1RT9A 1AF4A 1ZU5A 1B93A 1DXYA 2QRKA 3MJEA 3O2NA 4LF6B 4L4SA 1T5OA 1BZYA 3NALA 1D1TA 1W36B 5B7GA 1JDUA 2CGEA 2YHSA 3RVNA 5D5QA 2H8GA 3SM9A 3CY6A 3C1UA 5EIBC 2LDXA 1CY7A 2ZRGA 3WL5A 3EMDA 3WL6A 1ATIA 1CRLA 4Q1VA 3R2JA 2X14A 1EFVA 3L7LA 2E4WA 1L7RA 1JAIA 2B5WA 3PYLA 3OIVA 2BE7A 2G70A 4F06A 4WVFA 1CTQA 2FGJA 3S3TA 2PPLA 3HCCA 1E92A 2D0IA 4RD0A 4PZEA 4IIHA 2XCOA 1F7UA 4ON9A 3DG9A 3UG6A 3RC9A 3IRVA 1PO7A 3K9HA 2TRSB 4Q3KA 3B2QA 4MW5A 2DCUA 4ZALA 2O5RA 3SNHA 2CLIB 3AONB 4NJMA 1HMYA 1IQPA 1U8ZA 3GXOA 4ENPA 3HTXA 4GHWA 2IZ1A 3JS5A 1EM8A 4F21A 4BKMA 3AF2A 4HAUA 8ADHA 3LQRA 3OPQA 1O9HA 3QELB 3I92A 2B1JA 1CF9A 4UKDA 4EARA 3BEOA 3P0IA 2A7QA 2ODPA 3C6KA 2HFKA 2I2WA 4RMNA 3LT2A 4X20A 4ZT3A 1QG4A 2JZNA 2WFAA 1U9CA 3H5IA 4N5IX 2PL5A 4FP9A 1LV8A 5J4LA 3QWAA 3T38A 1ZNQO 2JASA 1E9CA 2IU4A 4LJ9A 1ZVKA 5DTJA 2CHVA 4BEWA 1F4LA 1K88A 1IWPB 4ABYA 4D4GA 4B48A 4PLZA 1AA6A 4F4HA 4CMIA 3I1JA 5C4GB 4C0JA 1Q0SA 4PC7A 4BX9A 3LC7O 1BFUA 1SUWA 2ECFA 2NXCA 4BO6A 4C6TB 2NSDA 4F3RA 1M1NA 3VOTA 4TMWA 5F7OA 3RHTA 4JZKA 3PRHA 1GL7A 2Y76A 3BTOA 3LT5A 4JMLA 3F8TA 1PD1A 2ONKA 2WUVA 3IGFA 1JMKC 1ZD5A 1T0IA 4G36A 3TLBA 1PS9A 1THGA 2L17A 2I4TA 3G88A 1ZU4A 2CNOA 1CR1A 2PT5A 3D3KA 3RW9A 3SDZA 2Q4OA 2Q1TA 3PHLA 3ZU4A 1I2MA 2C42A 1P9OA 4CKCB 3P0HA 1QV7A 2FEAA 1TIPA 5FUYA 3T35A 2CSXA 5L53A 1TTQB 1FBNA 1VCNA 5A9SB 2ZRJA 4TV8B 3QU2A 4N5HX 2H52A 1Z34A 5CDSA 4BGIA 3PWSA 3GLIA 2JLUA 2R44A 4WHMA 5LB4A 5EJ6A 2RJ3A 4GBGA 3UO8B 3M82A 4H77A 4GG1A 3IP3A 2Q3JA 1F0KA 4GXRA 4UBNA 5D85A 5JAZA 3IKLA 4MMYB 4OCZA 2P2YA 3KB8A 1WDLA 1KR2A 4ZZ2A 1P8AA 3IQXA 1E9FA 1LI4A 2WW8A 4FS3A 2AV6A 4XKJA 4ZVOA 1V39A 1GRQA 4EHIA 1XKTA 3TLXA 2PUAA 2QD5A 2CSUA 2I87A 3KZVA 4QARA 3LZDA 5FI5A 1VDMA 4OYRA 3EDMA 4QO8A 1YDFA 1UKBA 3DDUA 4QQRA 5JAPA 1HQKA 4LTDA 1XD8A 2IYFA 3KPJA 2ZU6A 2SCUB 3L02A 4TS3A 5AKYA 2VJBA 3DV0B 1FDVA 3PPYA 5JFOA 4D74A 2JLBA 5LZ4A 1UBUS 4LOHA 5TV2A 3Q8MA 4J29A 3VKFA 3K15A 4LF5B 2LDBA 4P84A 2WJIA 2I03A 1TZMA 3TAHA 1URPA 1FQKA 4MMZB 5EJFA 3D7LA 3MAAC 3MBKA 4AAYA 4FW9A 4CN9A 4Y2RA 2X76A 4RM2A 1T3ZA 1ZRMA 3KYDB 1F51E 3QBDA 2GN1A 4FINA 1QZTA 3D8NA 4BDTA 3VV3A 5G2OA 3WIVA 3PJFA 5A71A 4QQ8A 5KNDH 3K20A 1RLIA 5EEGA 3EAGA 3KB6A 1ZK2A 2NSYA 3OT5A 2J3LA 3OJLA 1IB6A 3PIIA 2J6HA 2CHEA 3GR6A 5FNVF 3UHOA 1R1DA 3ZPXA 3L7CA 2QTGA 1DCMA 4RAQA 2IYUA 5DTRA 2X0EA 2PFSA 4YV0A 4O2BA 2RBKA 5E3IA 2ZYTX 3ACDA 4DMHA 4IOJA 4UVEA 2AJCA 3D6NB 1HRDA 5A3QA 4X71A 3D4LA 1N5JA 3S4YA 1KP2A 2BP7B 1KFKB 3MNFA 3ABOB 4NMWA 4DSZA 2ZRQA 2VF4X 1L1QA 5E6UB 1ZAYA 1QU3A 1KFJB 4P3KA 4DSNA 1AKYA 1KO5A 2WSIA 3DOHA 3WK6A 4RTQA 3T5BA 3UPTA 2AXNA 2CLEB 4L0DA 5IU6A 1PW7A 4C4XA 1U0NA 1CRPA 1QB8A 4LYJA 3CXUA 4BE4A 5C1PA 1ATZA 4FFOA 1PUIA 2AFHA 3OOYA 1RYHA 1YDHA 1OA0A 1DRVA 2BHNA 5ALKA 1LTQA 4J6FA 3MGAA 4H3HB 3W6OA 4DY4A 1Q1QA 4K87A 2K7ZA 2QGFA 4PCAA 1L3CA 2PSHA 2IYZA 4UDYX 1QFZA 1EXDA 2V1UA 2WZDA 3IT2A 3DQQA 5C81A 4QGBA 1JZSA 4EQ6A 3DEYX 5KYXB 5L95A 2CC2A 5KSYA 1BS1A 1I4TD 4HXFB 4JJKA 2YHBA 3RSLA 4P58A 2IS1A 5J5VA 1BAPA 3DVAA 3JAKA 3LYAA 5AVYA 2C0QA 2ZTSA 2F55A 4H6WA 4JMPA 4MYDA 2GF2A 3NORA 5LOVB 1NFQA 1NFFA 1Z4KA 4JXJA 4ZYTA 1YRWA 5CHYA 1NZFA 3CLHA 3PP8A 1UBEA 1HTWA 3BDAA 3K9FC 1M2OA 4PYLA 2CE2X 1QE5A 3RUEA 1U9YA 1SXJC 2WWXA 1ZSVA 4NS4A 4EHKA 4MV3A 2P6OA 3ZWAA 3E0XA 3P2OA 4M9XA 4KV9A 721PA 1UL1X 3EZYA 4KL8S 1F8XA 1Q0UA 5BURA 1DVRA 1PJ4A 4R2JA 4V2UA 5DLDA 1O95D 2W6NA 2GPWA 2LNDA 4UD2A 5KHOC 1HY3A 4KFUA 3O8DA 3ZIAA 3E82A 5ERYA 2H0QA 4BNIA 5CA0F 1Z36A 3G5MA 1JP7A 4DIUA 4ZU3A 1K97A 1WEKA 1X7ZB 2JFQA 3PF8A 4WK4B 1E5XA 1VIVA 3H9CA 1XQ6A 2E6KA 2GZMA 3AWIA 4UAUA 4Q1FA 3LRTA 5DT9A 3CW9A 4UE6A 3PD0A 3DFUA 5E6SB 1C7IA 1CY6A 4J49A 5EOVA 2HWWA 3TLMA 1BGVA 2PMBA 3IUMA 4DWWA 1QRTA 5BY2A 1K4YA 3NHAA 1ORIA 2V8OA 4YXWA 3TDMA 4OLJA 3LIPA 3U0BA 4NIMA 1CYDA 3VTAA 5BSWA 3T9FA 4BC1A 3PDUA 3R75A 3LIIA 2W4QA 3B38A 3T9EA 4B4UA 5B2FA 1E99A 1QIMA 2FR1A 1L4HA 1OC4A 3N7AA 4QGAA 1U3UA 4C07A 1GADO 1I9CA 2BW0A 3BDVA 4GKVA 5KNLA 2HJHA 5IKOA 2P9FA 3CLVA 1D4OA 2ECQA 2NUTA 4CIWA 2VZLA 1H2XA 2BFAA 3CEJA 1EPUA 4JAVC 4L78A 3ZTTA 4ARIA 2AXQA 1ML4A 5JROA 1F6BA 4WLVA 1YQXA 4NCKA 2PLFA 1FSSA 2QRGA 4XSVA 1DJQA 2FEKA 1IJEA 2JEZA 1EB8A 4GEKA 4GRAA 3T34A 1J39A 3V7FA 2BFDA 4I9GA 2G4CA 3ND6A 4OQXA 5D8DA 2Q0SA 1RW4A 2RAFA 5AK0A 4RY8A 5AVQA 1OI7A 3GOQA 1SOVA 2O5CA 3PIDA 1KRWA 4Y2UA 1KJZA 4RYLA 2XXAA 2Y1FA 1Y81A 2XYPA 3QX9A 3V1YA 3SF8B 5K0EA 4Q4AA 1MORA 1OYVA 2ACWA 4LE2A 1SZPA 3AR5A 3KVRA 4U6SA 3TW6A 3OEHA 1R7RA 3G2NA 4MQFA 2QG4A 1ODTC 2IV2X 1E3MA 2A84A 3KUCA 1V5GA 3RHFA 1K5DA 2AHOA 3Q72A 1TFUA 1RWMA 5IMSA 3ZWVA 4ASUA 2WAXA 3THWB 4PLYA 2DQKA 1T91A 4TTQA 4XDYA 4B33A 4KE8A 5JNSA 4JI2B 2B92A 1Q6YA 3H04A 5FNVB 3T3IA 1GCUA 2FCRA 3PD1A 4ZOCA 5JPIA 4AG3A 2BEWA 3TKYA 4DV6B 4LCJA 1IOLA 3GMIA 2I34A 1JAXA 2QMQA 3GIWA 1ESNA 4HYTA 4YRLA 5IASA 3T3GA 4EJSA 3KBOA 1IWBB 4WCFC 3U2QA 2RIRA 1Y1KE 1MH9A 3DR3A 4BNVA 2HGZA 5C1DA 1DXHA 2VYQA 5SZIA 4I1PA 1X7XB 1UC9A 4I4NA 4S0ZA 3KSRA 5AQ1A 5AHRA 2FLVA 1EFAA 1N2HA 2EZ8A 4Q9KA 4WXRA 2JLVA 3IT1A 4OQNA 1AHNA 4M0EA 2WFLB 1M6YA 1JQ3A 3DBRB 1JG2A 3N7TA 4HNAA 2I6QA 2F3UA 3C4QA 4KFRA 3TLJA 4IIFA 1KDPA 3MAGA 1U3GA 4BB9A 4EFKA 5L9AA 4GXQA 1PT7A 1RAEA 1RZUA 3I37X 4LPKA 3V1LA 1QIFA 4WNIA 4TKZA 3FSEA 4EGQA 2IX9A 2NP7A 1MO6A 3ENZA 2H8KA 1O9GA 5E7MA 1SCNE 4N0MA 3T3NA 3O95A 1ST2A 4Q4HA 1JKMA 2FZGA 5FL7D 3SSAA 4LY6A 5BN1A 1UBJS 2FP4B 3U5ZB 1EFRA 1NJSA 3V34A 3MEQA 4P4TA 1ZIYA 3QPCA 1EE2A 1FE8A 1Z3CA 2H48A 4UFNA 1WJGA 3R3VA 4WZAB 4E6EA 2L82A 1VYTA 2OC9A 3D6MA 2CDAA 4U3JB 5CT5A 4N1AA 3ENKA 5J2TF 2P3OA 3IE0A 4AX8A 2A5GA 5JZSA 2CJFA 1V6SA 4NABA 4V2IA 4PHTA 3LBIA 4Y1RA 4BLVA 3QVKA 2LR0A 1VLQA 2FF7A 5B55A 1Z4QA 4FZVA 5D01A 2PGLA 3K94A 2AN3A 4X54A 5IBCA