3VVVA

Skich domain of ndp52
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
114
structure length
108
Chain Sequence
GPSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Calcium-binding and coiled-coil domain-containing protein 2
total genus 17
structure length 108
sequence length 114
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vvvA00
2LFEA 3VVVA 4NLHA 3VVWA
chains in the Genus database with same CATH superfamily
1LK2A 3MUGA 1J8KA 1PKQA 4HWUA 3DUUA 1NC4A 3FCUB 1JZIA 1L9QA 3CIQA 3DSNA 2HJFB 4GG6A 4IOFD 3A67H 1DANT 5FYLD 4I89A 4Z7QE 1QLFB 5T1KB 4HIPA 2OTPA 2PXYD 3PY9A 5D1XE 2XN9A 3UJTL 4MFHA 1EK3A 3E0GA 4LU5L 2XI9A 1UZGA 4OKVB 2HFEA 3FB6A 3OQ3B 5ESAA 4ZDHB 1F56A 2V5SA 3IKCB 4F58H 4IMKC 1FNSH 1UM4H 4HZLA 4N0FB 4PGBB 5JXED 3QC5X 3ZKXC 4BWUA 3AY4C 5LN4A 1H6FA 4RGMC 5F9OL 4QNPE 4JFED 4YDVB 1IKNA 4TXVB 2VDNH 3KXFA 2P8PA 4I5BB 1Z5YD 2QJDA 3WS3B 4KVCH 4GG6E 4TQIA 3MFFA 3BSZH 2QV2A 2Y3NA 4U1KA 1FO0H 4NOBA 5I1EL 2O5XH 2OYPA 1YQVL 3TT3H 4MA8L 3KYKH 2KZWA 4NI3A 4GP5B 3P4OA 1VFBA 2LOEA 3D25A 1WVZA 3WN5A 4BCXA 3MNWA 4D0CB 1RZJC 5ID0B 2OP4L 3WJMB 1A02N 1JUFA 1WG3A 4PRIA 4TTDC 4MD4A 5TDPB 4K7PX 2GB2A 5ICXA 4G3YH 4ELMA 5IFHL 2ENSA 4AEIL 4FOMA 1OSZA 2NRDA 4Y4FD 4DKAA 4QYOB 4OIAA 5FLVA 2VSMB 1PYWB 4E9RA 4X5WA 2YEZA 1DVXA 1N8ZA 2BX5A 2VN4A 3MXWH 4Z7NB 2VN6A 2W0PA 2BH0A 2KL6A 3CVHA 1J0YA 4PJ5D 2UZYA 3D69A 5HHME 1RZPA 2AJ3A 2QZ5A 2G5BA 3UAAA 1NCGA 5DJYA 1OSEA 3P3YA 2WTPA 5M7QA 5HYQA 2EDYA 5CUSL 3T2LA 1VCBC 3C5SB 2D2OA 4WW2C 3ROOB 5DFVC 1UB6A 3NA4A 4AGLA 5KVDE 5KVFH 3KWUA 1GTNA 1JV5A 3WFBL 2QHRL 3FH8A 3OAYK 1DZ0A 3HUJB 1E28A 4LQ1A 3D12B 1L9MA 3OJVC 3MBEA 1OIOA 1UQSB 1Y0LB 4YEEA 4YEFA 2YQBA 3EW3B 4F1ZA 3QCTL 2CDGA 3H9YA 3IS0X 3N43B 4PH8A 4PJ7B 1ADWA 1SPDA 4FFYH 2R23A 4L1BA 5DJCB 5E5MB 5ALBL 1JDAA 3VQMA 1ZIAA 2ATKB 3CSTA 5TK2A 5K69A 4C8XA 1OD9A 2BINA 4OFPA 4ACPA 4ZW3A 3N5AA 4ZJ9A 4APQB 1A6AB 3Q43A 4JFDE 3SO5A 1DVFA 3WMPA 1RMFL 3K6IA 4Y4FB 4GW4B 4KQ3H 4K5LA 3L4CA 3S4SB 4X4KA 5BQDA 1DBBL 1VSCA 3SGJA 4Z9KB 2PP7A 2FO1A 3P1VA 3CFCH 2DLFL 5FB8B 1YPZB 3TYFA 3TYGH 4JL1A 4Q89A 5KUMA 1AE6H 1N0XL 3T4AC 1CVSC 5HJGA 1KLUA 1JYXA 1LE9A 2X7LA 4JE0A 4XVJH 4F58L 4FG6D 4V1DE 1BQKA 1HQ4B 1AOZA 3KYNB 1MFEH 2X40A 2YSSA 3ALXA 2IALA 3LDBC 1E4KA 3NFSH 3VFPA 4PVLA 4Q0XL 4UM9B 4P4KA 3N1FC 3UTZA 3C2SA 2ITEA 3IFNL 3IWVA 1BX2A 5AENA 3HHSB 3OSKA 1ZGLM 4XO3A 5E9AA 1NGYA 2O6FA 4XPHL 3ZN6A 2K7QA 1DJZA 4DNLA 2X9YA 4N0UE 1Y1UA 3OKMA 4NKMB 5IROC 1MSPA 3CD4A 4HH9A 1U58B 4I2XE 4NO2A 1JK8A 2NY2C 4FZEH 1JXGA 1O9VA 4TNVK 1I7TA 3UGEA 5D7JC 3AFLA 1L0YA 3NEOA 3AWFA 4H2CA 1P6FA 3X3GH 4PSRA 2D3NA 3T5WA 5INDA 4NRYA 3G6AB 1OK8A 3CZFB 4ELDA 1U8JB 1XVSA 4LK4A 4LLUB 4XNYH 2VDPL 5EV7A 4DN4L 3HI6L 1DFBL 2WXKA 3D25B 1E7UA 3JV0A 4DEPB 1YHPA 1BBDH 2QTVA 1MKFA 4L05A 4BK5C 4KROB 2NQDA 4QF1B 2DJ4A 2YRPA 4UWQB 5EZIL 2A9NH 4U1KB 4LLQB 1RK0B 5F89B 3EXJA 1MVUB 3BWUF 4AUYA 1XBRA 4G82A 3H7BA 3MLWH 5KYYB 2V5YA 4MMYA 2QVKA 1DQJA 1T3FA 5D2LA 4UB0L 5IUCA 3O3UN 4JCLA 2WKOF 1N8ZB 1Q38A 3BC9A 1AR2A 1CYGA 4HK3J 2GHZA 1GMIA 1E8XA 1NMAH 2XFXA 3CIAA 1ZLWH 3AREB 1KPUB 1DE4A 1A1OA 3EYFB 4M7ZB 4G6FB 4QTFA 4W6XB 1JPGA 1ZANH 1MCLA 1O9ZA 2DLTA 2BVPA 4NZDA 3P3TA 5F6HI 3UMTA 1NLBH 1RZGB 3NIDE 3M45A 5F7HA 3QDJD 1MNUH 2X4NB 4D3CL 1MCDA 2ATPB 4A2GA 2ARJQ 4KMTL 4K2UL 4MJIA 5HSFA 4IBWA 2K6WA 2ADIB 4PWHA 3SOBH 3AS1A 1AKPA 4KI5F 5DHYA 3ZUCA 1U2HA 4KQ3L 4HYTB 2XY1A 3PV7A 1E8YA 3CFDB 3KPRB 4JPVL 2IANA 3L3KA 3QJHA 4OGAC 4WGWB 4WEEA 1JXFA 1CGUA 2VWEE 1ZJBA 3L3JA 3QQNA 4HPYL 3BLKA 5D93B 3VW3H 3OG6B 2CBQA 3ZKND 1RSFA 1QI5A 4OB5H 3TASA 3PWJB 1VJSA 5C08D 3IDIA 2G9HB 1A6TB 3DX4A 3UAJD 5I1EH 1UH2A 2ATAA 5EU7E 3EH5B 4GSUA 4I18A 3IJSB 3LRSB 1YECL 4R97B 2AJZA 1OE3A 3RVVD 4FTVE 1UCTA 5HYFA 2AVFA 4QXWA 5CP7A 1QR1B 2BFGA 1TEGA 2PYFA 4KZDH 4FTVD 2VJXA 4HXBL 3RGVC 5AW4B 4DP5X 4W6YB 3VI3A 1RUAL 4PWEA 2VJ8A 5I1LB 2PPCA 2DTSA 2IF7A 3MOAL 4POYA 2UY6B 3BRFA 1Q4NX 4UAOB 5FECA 3V6OA 5FCUH 1EJFA 4W68A 1MI5D 1TO4A 1YUHB 2BK8A 2UXTA 2I7OA 3QQ3A 4L2YA 4XZ4A 2W60B 3UGUA 5HJ3B 4QAWA 2WHVA 1XCWA 1S7SB 1HILB 3I02B 4MKMA 4QXUH 4J3BA 2GFBA 1HKLH 3ZBMA 5TGBB 3APCA 2EH7L 5DZVA 1IAII 3EJJX 4XPBH 1CFVH 4FNPA 3HUJF 4Y5YA 4YSTA 1EFQA 3C5ZB 3VXMA 1HCYA 5FM8A 5CIPH 2UVEA 1AKJD 1LO2H 2Q76B 1SDAB 1LK3L 1VIWA 2FSEA 3FT0A 3P73A 3QWRA 4BFKA 4DCQA 2COQA 2VKWA 1JGIA 1N5YH 3CH1A 3ML8A 4YBQC 4QRPB 3RDTB 1TJGH 4HHGA 4JDEB 3NCXA 4JFQB 1NA8A 4WHYG 1XGTA 4OGYH 2YS4A 5EZLB 3PXLA 1T6VN 2UZXA 3IXTB 3PDGA 5AKVA 3NFPB 5JOPE 1UOKA 5BCAA 2JJVA 1QO3B 3HRZA 2GJZB 3MUHL 3JTBA 4FA6A 3BSZL 3L2NA 3GSRA 3L1OH 3DURB 3DECA 3HAEB 4FQLL 4LMQI 4RAUB 5BXFB 2YMXH 3FAXA 4JFZL 3KHOA 3I6LD 4YL9A 1RZKH 3P02A 5DMIH 4EN2A 1YDPA 1XGPA 4H88L 1QTSA 1KJ2A 2IPUK 1QPXA 2N3JA 3L3HA 4I2XA 4MS8D 2ITFA 3U7WL 4Y2DB 3QZWA 3ELQA 1A1MB 2IMMA 3SCMC 4A39A 4FNLH 2OSYA 4V2CB 2J1YA 3QUMH 4E42A 1CBVH 1TIUA 5JHDB 4MNHA 4GBXC 2AFNA 2A73B 5E6IB 1X7SA 1CICA 2K3TA 4HZAA 3HBQA 2Y23A 4JRYA 1AH1A 3SBRA 1B2WH 4QRRB 3T6VA 1MVFA 5AVWB 4L5FL 3QNZA 5CAYB 2OCJA 3U2JA 3TO4C 2V7NA 1BIHA 1MY5A 1NJ9B 3V6OE 1FDLL 3ERXA 2EDTA 2RR3A 5DUPL 5HHNA 2KI6A 3NK4A 1BZ7B 2WZPA 3FFOA 2OXHB 3SD5A 2P80A 3LKPA 4NQCA 1MQ8A 3CMOL 4NNPL 2GBTA 3WNKA 4WI2A 3C6SB 1NH6A 1CPUA 2VKXA 3QUZC 5C0IB 1EANA 2TRHA 1TYRA 3BVXA 4LSUH 2PN5A 3VCLA 2N7SA 1J05B 1REIA 2QADD 3DSFH 3NZ8A 3FJTA 1U8NB 4FLRA 1GY1A 5CHNA 3T2QA 2VB5A 5AW1B 2YQ3A 3P0YH 1HEHC 1QFPA 1S9XA 1T21B 3UC2A 1QLEH 5F21B 5AAWC 3GB7A 5C2UB 2C9QA 3GZKA 2A6JA 3ZYZA 3RA7L 2Q8AL 4N8UA 1A7OL 3NP3A 3FULA 3X17A 4L9DA 2FDBP 4ENED 1JN6A 4L8CB 1UJTA 4JGUA 1BQHG 2QEJA 3L3IB 3BKML 3ULUF 4M61A 5T1LA 2FK9A 1A14L 4K5PA 1IBFA 1OGTB 2ESVE 3QIUD 4O2FA 4OF6A 2KT6A 4FJ6A 4G80A 2VR3A 1T83A 2WWNA 1XX9C 3VXMB 2GSIB 3L5WA 3VM5A 2AXFB 5KSVB 3ZTNL 3RJQB 1H3WM 4XBEH 2BIHA 3CVBA 5EORL 3KR3H 4BSVB 4UF7C 3QIBB 5CU9A 2X3CA 3DGCR 5E1AA 4QOKA 4AOFA 4LPTA 2WUCL 2NR6D 2OMTB 3NFNA 1KJVA 3Q8FA 1QRKA 4V33A 3EGSB 1FLTX 1PX3A 4R4NC 1RJYA 2Q8BL 5D4JA 2CLVB 1OKEA 4PYHA 2G3ZA 3GSUB 3EO1A 3UX9B 4UDUB 5DD3H 1A6UH 2FUTA 4LL1A 3GB7B 2A1WH 1L6XA 4Z3TA 4X7TA 1HEZA 1LO3H 3PG2A 4PG2A 5I1IL 3BWZA 5A1AA 5GS0D 3SE9H 4GUPB 3VQ1C 3TN0D 3CE1A 3BP6B 1QASA 1I8LC 3OLEA 4I8DA 4WO4A 4BDVB 3KPPA 3QHFL 3HFFA 3LS4L 3ES6A 4JPWL 1U2CA 5DA4A 5MERB 2CBOA 5AOMA 2AAAA 3C6SA 2FJHB 5D96C 1MREL 3REVB 1EAPA 5CMAA 1PLCA 1K4DB 1R1CA 4MVBC 1LEGB 4JRXA 1XB3A 5I74C 5C07D 2H0FA 1M53A 2WXJA 2F5BH 4PIBA 3AB0B 3AXLA 4P2QB 1M6OB 1MXDA 3OPZL 4EZKA 4YDKL 4Z78B 5IHLB 5I30L 3ZHDA 2D8KA 4A2HA 2BNRA 3MLSL 3WNIA 5MHSD 1NGPH 1UXWA 2Z31A 3QNZB 3BP7B 4JPVH 1NICA 1L7IH 4AYEC 3LAFA 2I85A 2X4OB 1XEDA 4KJQC 4OH2A 4JHWH 4NAQA 2YGNA 2AVGA 3FKUS 4HKXA 4AK2A 2WBJB 2IEPA 3GJFK 1S7VB 4J5VA 1NBVH 4XAKE 4LFHD 2V4LA 4ZSOE 3ZE1F 4JDEA 4DPBX 5TF0A 4A2DA 4NWTH 4XN2A 2ZP8A 5E8OB 2XVBA 2H2SD 3KCPA 4WNSA 5H37A 1CFSB 2XXMB 4H8PA 4YSDA 3E1F1 2I60L 4JUTA 1KSRA 3HS8A 5B3NA 3WYRA 5JW4R 3ZDXE 1ES0A 4GW5A 3WFDL 1WIOA 1X3DA 1BF2A 3QIBC 1WBZA 3UBXB 3B9EA 1JTPA 1VPOH 1Z9SA 4RRPG 1Y18B 5MEQB 1NCCL 1PTZA 1XF2A 1AXIB 2VXTL 2CO7B 3RDTC 4GFXA 3TP4A 4B6ZA 2DMBA 3QIWA 4GRLC 1LGVA 1VA9A 1N6UA 4ILDA 4MZRA 3TN0B 2BVOB 3BQVA 1S2EA 2ISDA 3VXRB 5DZ9A 4APXA 4YHIA 4OKDA 3QWOB 1I75A 4HJ0C 1WD9A 4KMLB 4OTXL 4N0CC 1K5WA 4E41A 4BUHA 1NFIA 1TZHA 1Z7JA 1JNNL 1RVFL 2OXGB 3JTSB 4MVBD 2P8LA 1UVQA 2BXZA 5JPMB 3QIBA 4LQFH 1ZGLP 1RPKA 2YAMA 2OKMA 4R84A 3VI4B 4BSWA 2Y6TE 5IHBA 2ZOWA 3W5MA 4TLTA 2NTFA 1I9JL 5E4OA 3DVNA 1F3RB 2DKMA 4IW4C 4BFRA 3CZEA 2FX9H 4OJDH 4UM9A 2CNYA 1ORSB 4L8SA 1ZEAH 5CZRA 4E41D 3LCYA 1WAAE 4M61B 3CUPB 3OB0H 3TEYA 2MPAL 1MZYA 5JHDE 4HU8A 3A21A 1IAMA 2ERJC 3KPLB 4WKZA 4HJTA 4NT6B 4KJQD 5CUSH 1G7JA 2AJVL 2VQ4A 4PRHB 3ABZA 3UG5A 2N4IA 1MRDL 2HVJB 2CDEA 4NBYB 1G7IB 3CFCL 3ZJAA 4O2EB 1G9NC 3LH9A 4S1SH 4XOCA 3L4VA 4O5LH 3VXRA 3PL6D 3MAWA 4LAQL 5HVWA 4B95C 2IPTL 3M7OA 3KXFE 4MJ5A 4I18C 5DHVB 5SWZE 1TCMA 4BE6A 3US0A 5KVGH 3JBG7 5C0FA 4OSUH 1KXQA 5D7JD 2OSWA 1SJEB 4RWHA 3WMQA 2EABA 5F9AC 2OR8A 2P3YA 4AQ1A 2NZIA 3QJVB 3DROA 1CJYA 4U2ZA 4YO0A 4UTBA 4F7CB 4K8RH 1EZVY 4W4NA 3SYQA 2VLRA 4CL7A 2OL3L 1E67A 2YWYA 3GMNB 1NCWL 2WZ0A 4IKIA 5D1XC 1CXIA 2N59A 2XFXB 3W2DL 3GMMB 2KLRA 4JN2A 2EYSB 3CHQA 3QDAA 4NQEB 4R96A 1KDJA 5T1DL 1QNIA 4PB0L 2ADIA 4FC3E 2XWTA 1U30A 3P77A 4GLRI 1ED3B 5DGQA 3UTQA 1HQRB 4WI0A 4LOUD 1KGYE 2LTQB 2JLPA 3SPVA 4MYWB 2PR9A 4U6XA 5HY9B 2QPSA 1PKQE 4G72B 1SF5A 1P7KB 3B4NA 5DVKA 2RACA 1PD0A 4DK6A 1JZ3A 4QRRA 5J56B 4ZXBD 4N0YH 3NCFB 4LF3B 3DSFL 3TLRA 2DEWX 5ES4B 5J9PB 1THCA 4JR9H 5JR1H 2FJFA 3TIEA 1NCBH 5JIDA 3T3MF 3DGGB 4F2MA 5L9DH 2F15A 3FTSA 1MEXH 1DQJB 1Q94A 2OULB 2FL5A 4K3DH 1OB0A 2UWEF 2EACA 5E2WH 1T03H 4Y19E 1HZHH 1BLIA 3QUKB 4K9JA 1FGVH 4RGNE 2NNAA 3WIHL 5TE7L 2XWJB 2CU9A 2D9CA 1IAOB 2D0GA 2GJZA 3MGTA 1IJ9A 4GP4B 1MZZA 2VUOA 4IOIA 4N2OA 4X42A 2BVQA 2J1KA 1PD6A 3ARDD 2FAUA 1KTLA 4M1DH 3GSNA 3OF6A 4KOBA 1K8IB 4NHUB 5FKAA 5B3JE 2Y69B 4MKTA 2LV4A 3IDJA 4IRSB 5E2VH 3SQOH 4XODA 3QCVH 2BSTB 3DUHA 3ZHKA 2YAEA 3MLYL 4IRSD 3GPSA 3PWLA 2ZSWB 4AH2A 4F57H 4NLAA 4UQAA 4KMTH 1Q0YH 4LLWB 4KKAD 4OFKA 4X7SH 5IG7B 1EH9A 4M1CC 4JHVA 3CLFH 2B14A 3L9RA 2EDDA 1KV3A 3QEQA 5I0XA 4ZO8A 2EUVA 1XH1A 1EMTL 3B9KB 3H3KA 1Z3GH 3QPQC 2WO4A 3UACA 4Y4HB 1R5WB 5F7BA 5FCSH 4APQD 4C57C 1QLFA 5T1KA 3T3PB 4KXBA 1E6OL 2HSIA 4H26B 4K94L 3O41A 2VAAA 5EPMA 3SYAA 4CU7A 1BD2D 2DEYX 2GFBB 5KVEL 3IDUA 1BIIA 1HILA 2CJUL 1XF3A 3MLXL 2X0UA 3HLAA 4JPQA 5DURD 3D0VB 4HULB 1OTUD 2NZ1A 4MZIA 3B8SA 1NAMA 1TPXB 1ZRUA 2ODHA 4KPHL 3NOIA 1CXKA 1BWWA 2XBDA 1QEWB 1RK1B 3RX9A 5A6LA 4FHJA 2GI7A 4CJ0A 2E3VA 3K2KA 2EZ0C 4HK3N 2DI8A 4UIKL 4XPAH 1U36A 1PZBA 4G8AC 1XEUA 2FWUA 2WP3O 4HT1L 5FGBC 5BZWA 1L9OA 2ARJA 5A7BA 3U36B 4ZMLA 4WF7A 5I1CL 4NZTH 2VDLB 2R0LL 3OAZK 4QGTA 4QTIH 1ZE3H 2EDOA 3GI8L 4NBXB 3HR6A 1ZVSA 3IDNA 4YHMH 5F6HJ 4X6CE 1I1RA 4N86A 4P5KA 1OGSA 5SWQA 2E47A 3TNMA 1A8JH 1P53A 3ULSB 1KC5H 3CHPA 2Y3AA 3CXDL 2YQ2A 1K85A 5F44A 1WPCA 1ZWIB 5HDBB 4IBZA 1OB1A 1RUQL 3UTSA 1NBVL 5C0RH 3C60B 4FXKB 3TV3L 3NACL 5E99H 3P3RA 4GI6A 1I8MB 4CC1A 3QDMB 2MQ0A 2DWEA 3IDGA 3JTTB 1YY9D 4MQTB 4YIQA 2EH8H 5I9QC 3S35L 3VXPA 5DVLA 3UYOD 1EHAA 4J6RH 4GEIA 4TRPL 3DDGA 1A6ZA 1CO1A 4KK8C 3CDYA 1TQBC 4YDVA 5IFAL 3LX9A 5CSGA 4X5WB 5F0PB 3DGGA 2M2DA 3FF7A 3GLDA 2VLJD 1KMGA 4PJBB 1G9EA 2J6EA 2PCFB 4MD5A 4PJIA 4QHKI 3ZL1A 1GKEA 4HWEL 5FO7B 4CAGA 4CDHA 5JQ6H 1MLBA 3BXNA 4MMYB 3G6JA 4HWZB 4X8JB 5HHVH 4G70B 1WCBB 3GK8H 2HX7A 2YHGA 4CC4C 3ESOA 1C1EL 5GGVH 4CILA 2WXMA 1TR7A 4FMFA 1C12B 3GM0A 2EH7H 3G6DH 4ZTEA 1PEZA 2BSRB 2IBGA 1F0LA 5AD0B 4IBUA 3VVVA 2FHFA 3GHBL 2Q86A 4H1LH 2H8PB 4M43H 3WJJA 3NIFF 3LIUA 3Q3GA 3MV7E 1XH0A 5AB2A 2HTLD 1Z5HA 3B2VH 4DW2H 3CVIH 2J8UA 3EOBA 3JT0A 4MCZB 4TSAH 2VWEC 4KUZL 4RDBA 2I5YL 4A6YL 4UMSA 5HVFB 2FX7H 2YPVA 1IM9A 4TQ8A 5EUKA 3L45A 1II4E 3ZIMA 3K7UA 3FU8A 1ROWA 5DD0L 1GGCH 4YHYB 5A2BA 3B1TA 4PJFF 1KCUL 4Q4EA 4BZ2A 4NCC2 2MTPA 3HJ0A 4QRRE 1UA6L 5EZJA 2IOIA 1KLUB 5IV2B 1IC0A 1A9BB 3MV7A 3AVEA 4MBRA 5DTFB 1WWBX 3PWPD 2IFFL 3QDMD 3GBMH 1HQ4A 2UWEB 2V3DA 1LE9B 1BGXH 4Z7OB 4X80L 1SBBA 1U8IA 2BO0A 3OKOB 4QHMA 3Q44A 4ZZFA 2K7PA 2DW5A 3CG8A 1AR1B 3H53A 1R3IH 1KIRB 4CN4A 1AGDB 1XB8A 2HB0A 3I2CH 4WIQA 4XMUA 3BUPA 1TSRA 1E2WA 4OV6F 4WW2B 1CBJA 1BIIB 2EXYC 4K94H 1KIQA 4KX9A 3EFFB 5IFJB 1M1SA 5FW6A 1JWSA 1SFDA 4XMXA 4MNQE 2APWA 1F02I 2IH1B 2J12B 3DBSA 3JVFC 3O41B 1QLRB 3STBA 1T22B 5F9JA 4A6YA 2XPZA 3QR1A 2J25A 1IM9B 1HESA 1HZHL 3CBRA 2X1XR 4IGBB 5E70A 5GS1C 3NQKA 2XX1A 1BVZA 4QXGL 3P0YL 1X5YA 4LSPL 1A0QH 4PN6A 2YJLA 3UCQA 1LLAA 3VNYA 4UV7L 2O93L 2YRBA 3LH2L 3TS8A 4IMKA 5I6KA 3DX9B 4N3TA 3O6FA 2IDUA 4ZW6A 1D5XB 1J5OL 3ECWA 3QZLA 2X1QA 2C3VB 3MV8B 5IW1B 1XGRA 4U1IA 2CIKB 1YEKH 2V0AA 5BUGA 4PEEA 4H0LC 4POZD 3IF1B 4RFEA 5F7YC 4QTIL 2NY0C 2XZCL 4YDLC 3AG3B 4LBAA 1DLHA 3P2TA 4PWJA 2YKLH 2IFGA 3MRKB 1AD9A 4DKEH 1T03L 1GHFH 3LNHA 3MLVH 3MDJA 2KS0A 1W91A 3O6LH 4P23B 4WI5A 2Z91A 3V4UL 4Z77B 3W9EB 4E9SA 3Q9QA 1IGFH 4C56A 3QYNA 4AJVA 1RUKH 3ZYOA 1T0MB 2K3HA 4TULL 4UBDD 3BVDB 3K0WA 1E2ZA 4YZFE 4JN1L 4LHQB 3B9DA 2BP0A 5JNYB 3KLKA 4NN5C 4ZNEA 2K4AA 2ZOUA 3NIGF 4KI1A 4PGJA 1W72B 2OCFD 2X1PA 5H4YA 5HJBA 3KGRA 1EERB 2CZNA 5SWZD 4XN4A 1TKWB 4UDTB 1MFMA 4PJ7F 3MROA 2DWDA 4JHAL 3KBHE 3POHA 5DO8A 2PR4L 2NUTB 3L17A 2ICWB 1BD2A 2EYTA 3OR7A 5D72H 2GJ6B 2FLMA 2JB6B 4P46C 2OQJB 2B16A 3TNMB 5IQ7L 5F7EL 4NQEA 4R96B 4U6YA 5KZCD 1SN5A 5SWQB 5D2NA 3F6IA 2Y72A 2Y06H 3R06B 3DOSA 3Q7JA 5TH2B 1NCHA 2AABL 4KTYA 3VU1A 2G60L 1WCQA 3O4LA 4LSDA 4PJFB 2A77H 3V4VH 3WDHA 2D7QA 2XKUA 3KYKL 4QWWD 4B0MB 3IFLL 3Q6FA 4OW6A 4P2QE 3OHXB 1MJUH 3IPEA 4RESB 5C6PB 4NHCL 3AQYA 1YEJH 4GXVL 1IGIL 3T9WA 4CGUB 1NGYB 2H0EA 2YA1A 2ZOOA 3II2A 3TBTA 3WHE0 5DSCA 3LN4B 3MLRH 4WSJA 2EDBA 1JGVL 4J23A 4H25A 1ZAGA 4M48L 4M6NL 5ADOH 1J1OL 3PAVA 3QQ9C 3CC5A 4ZNEE 3GSXA 1HXMA 3FAWA 3BVVA 3MV9A 5JPMC 5DURB 3SDDB 3V9CA 4HWBL 5HGDB 4OCRL 5KS9A 1WWCA 3D4YA 5K5YA 3S8FB 3KBPA 2VC2H 4OLVL 1T1WB 1IRAY 4NO0B 2ZUYA 2VC2B 4XC1H 5I8CA 2HFGH 3SDCB 1TQSA 1UVQB 2V7HA 5K1NA 1JYNA 5CM1A 3N43F 3TL5A 1F4XH 2PTVA 4BSWB 1GH7A 1A9EA 2IBZY 3FQRB 2KHAA 4JFFD 5GRZA 1OOAA 3ARFC 3L13A 1ZHBB 3TCXA 2YPLD 1GS6X 2YD7A 4FN0A 4MJHA 4LLWA 5EBWB 5I1JH 2OMWA 3RL1A 1NM4A 3I2CL 3UJIH 5IBLD 2YD5A 1PDKB 1UWGL 3C8HA 4JJOA 4OIBA 4QHLB 3RVTC 3M8OL 5E2UL 2J72A 4YVNA 3S35X 2IWKA 3ARDA 4XXCA 3KPSA 5DK0A 4GKSB 2DJMA 3B5TA 1N70A 2QVTA 5DXWA 4X6DE 1QAWA 4UOJA 2PPAA 1SYSA 1R5WA 1U0QA 4L8DB 4K3JL 2EDKA 1N26A 4M8RA 4M8QB 3VXOB 1AZBA 1IQDA 5B8CB 5FOBB 3MCG1 4MNQA 3EBHA 1MCQA 3VWJA 3WLBA 1FYTA 1JZ2A 4JPKH 2VO5A 4QT5A 3BP4B 3QHZH 4GG8B 1UYWH 1L3NA 4Z95L 5F9DC 1SVZA 1BXVA 1Q94B 4N2CA 4KTEH 3VRLE 1UKQA 2A83B 1CIDA 5BNXD 5ICXB 4OVUA 1KBGH 4W9KC 5AVTB 4Z7VE 1P5UC 3UYPB 3VRJB 4UQCA 3WEXA 3BZ5A 4JKKA 3WKPA 5CD3B 4ZFQA 1L7TH 1SXBA 4DW2L 2R9HC 2CIIA 3QIUC 1AYOA 3TWYA 1IAOA 4UTAL 2I9TB 5IVXE 2NY1C 5I2IB 4OBRA 1I4FA 1BAGA 1ZEAL 1SOKA 2LGNA 2NNAB 3WD5L 1HZKA 2A5UA 4WUUA 3WG7B 3V7AG 1SN2A 4KI5D 4MZ3A 3RVUD 3BSGA 3MSPA 3LEVL 1MW1A 2BFVL 2WPGA 4FQJL 2XY2A 1FG2A 5E8NB 4FQHA 3MBEC 3P0VH 4Q4IA 4HGWB 5EZIH 2IH3B 1AFVH 5DRZB 6TAAA 2OYKA 1E4XL 2ZQKA 5FR3A 1ZIBA 3RU8H 3CN2A 1N6QL 3EYVB 3CZUB 5JZ7C 3V0VA 4ZOEA 1YMME 5H94A 2F74B 43C9A 1KPRB 4OV5A 3O3BA 4F20A 3FUIA 2NY7L 4TVPL 4NQVB 5C08B 2B59B 3QZPA 3M1BB 5I0VA 1YEIH 1NGZA 4WHCA 4HBCH 1AOHA 3TPUA 4U1JB 4WW2F 3NAAH 3OG4B 3Q9PA 5E95B 3FUEA 4G7QB 3GEWB 4I9WE 4WWID 3P9MA 3DETC 4XP5H 5F72S 2VNCA 1WC7A 3GPEA 2ZAGA 2ZOLA 4GO9A 3K2MC 2NXZD 4NCC1 1AZUA 2A4EA 1AHWC 1ZT1B 3LV3B 1JGDA 4P2OA 2FQDA 2D03H 2W9EH 1WEJH 5IMLB 1KJVB 4S0TD 1QFWL 3BPLB 1AR1D 4U3SB 3CV5A 1AZVA 4M5ZH 5AKSA 4ZUVA 1BYPA 3VFNA 1USQA 5FYKD 3RY4A 2X4SB 3RDJA 1LWJA 5FUCE 3STLB 4A63A 3HS0A 3R7QA 4KTDL 5FECB 1N0XH 2PW2A 3NCWA 2VLME 1JN6B 2XACC 1DQQB 1ZSDA 3U46B 3UTSE 4OCWH 4JRFA 3W11D 1IL1B 4MB4A 4WV1B 5C0GB 2Z8VC 2XQBH 5C3TA 4K5NA 1JNHA 1NGZB 1JWUB 4PGDB 4QMEA 5IESL 5BVPL 5TF1L 2PYED 1XWVA 4HD5A 2ZXAA 3X11A 4KPHH 4ZAKB 1JVKA 2R1WA 3D9AL 1NCDH 5FDYA 1J10A 1ETZA 5HGHB 1WF5A 2AKRB 5FDWA 3Q8EA 4BK5A 2ICEB 3MV8D 3DJRA 4IBTA 3H9HA 2HLAA 2IBZX 3PNRB 5C07E 2XFGB 3N0AA 4KJWC 4MWFA 1KFGA 5I71B 2H26B 1Q8MA 2IV9A 3MRGA 4HGWA 4XB7A 3OJMB 5LN8A 1TFPA 4WVRA 2PWHA 5L9DL 4LEXL 4AE1A 3FYEB 4X7EC 2QHLA 1FVDB 1QBMH 1UCBH 2MMXA 5IP4A 2J5LC 4L4VB 4ADGA 1F42A 1V3KA 4G6AC 4HEPA 5HI5C 5FUCC 4I1RA 3MLRL 2QPFA 3KHQA 3VXRD 1I4FB 1AGEB 4PJAE 2F19H 5AVXB 2DMGA 3OLDA 1KTDA 3K74B 1WBZB 5EF2A 3HB3C 1EFXA 3VI3E 4F33A 2BHUA 1FZKA 1T89C 5F7LB 1ND0A 5FO8A 4ZW8A 2W07A 3SKOA 1D2OA 3CN1A 3F7YA 5DJXA 5AW3B 3V4VL 1MELA 2A0LD 3B2MA 4NFCA 4CC4A 3QZWB 5C0JA 2MPVA 1M6OA 1NBYB 2OMNA 3NK3A 1OTUC 1F3DJ 1WFUA 1YC7A 1SLWA 1YG9A 4WFED 3NUKA 2EXSA 1GA2A 1NOLA 4P2RB 3RVXD 3SDAB 1XCQA 2D7NA 4K23H 5K9QI 1FNSL 1UM4L 2RA1A 5FK9A 3ARTA 1ZKAA 1EJ8A 3DX8A 5D93C 5FM4A 1CGXA 4NZFA 1QUPA 5GRXG 4P57B 2ZUQC 1FVEB 3KEDA 4KV5E 4OD1L 4P9ML 3CDZA 5A43C 2OR7A 4XVUD 4OFIA 3CLEH 5DJAB 1MEXL 2X0VA 3C12A 3GMPA 4L8BB 3US9A 5IZ7A 1O6TA 3VH8B 1O75A 1BREA 2Y2TA 1G7LB 4JGNA 4NYLB 1KG0B 2YJQA 2HJKB 3HHRB 2CJSA 4JM2C 4FXLA 4KUCD 4G5AA 5HD8D 3J27A 4QRPA 3MYJB 1Z2KA 5FYKH 3LPOA 1NOAA 3VWKA 2CGYA 3ZW3A 3VM7A 1WDAA 4M03A 4PJBE 4ZMXA 3EO1B 3A67L 4U49A 3QRBA 4RRPM 5C0DB 4MWFB 3H56A 1IGML 4ECNA 4AT6A 5I8CB 4P3DA 5L6YL 2DQUL 3BDXA 4NGHL 4E9XA 4TF4A 1B9KA 4AQEB 4XPTH 4G9FB 1PPIA 5FW8A 4I9XA 1RSYA 3OR6B 4L5FH 4HKZA 3QUYA 1JWUA 2KKQA 32C2A 5DMGC 4C4KT 4M7LT 4ENZA 5EBWA 5FCUL 2DB8A 4OIIH 1AP2B 4HWEH 1WC7B 3ARBB 3QC6X 2HCZX 2QZQA 4AC2A 3HG0A 1ZHBA 3JVGA 4S1RL 3V52H 1OXYA 2BCKB 3AG2B 3C8DA 4R5XA 3O2VL 2NNRA 3F7QA 3L3IA 2QVFB 3QNYB 2AXGA 4BZYA 2VLJB 4QHNA 3VU2A 3D2UB 1ZTXH 4JY5H 4X4XA 5AOZA 3UO1L 2RFXA 5D8JL 1TTAA 3OKEA 1FYTD 2F74A 43C9B 4DO6A 1RZKL 1G9ML 2ZXWB 5F8QC 4DOHB 1P9MC 1QP1A 4JJ5B 4JFPA 3IKKA 1AI1H 5L7XL 3FT2A 4HIQA 4BQCA 5C6TL 2A6DA 1C5CH 4KGJA 3E2HC 3RWEA 1B3IA 1LJMA 4XP5L 5F7DA 3GSXB 3NCBB 2J1XA 4XNUL 2YMTA 3LS5L 4K3GA 3P9MB 2GK0B 5T8IA 2XNAA 5ELIA 2GT9B 3SGEH 3SDXF 1CUOA 3GINA 2BZDA 5JQIB 4Z7OE 4K55A 5I8KH 4WWKC 1DO5A 3HE6D 5CZVL 3VFUA 2OMZA 4XC3L 4WO0A 1GC1H 1G7LA 1FORL 3H9SE 3OV6A 4CVUA 5HDQH 3S4SG 3FO0H 3GC3A 4HG4K 4R90H 1WFTA 4W9CC 4O4YL 4ZFFB 3P0VL 3T8XB 4L1LA 1XSIA 3DX3A 3ZKMD 4W9LC 3T1FA 5DFWH 3NIGE 1YNKH 1C9SA 3APNA 3RIKA 2PCXA 4HSAC 5FGSA 2F54E 1ZV2A 2H2PD 3PIQA 4YS4A 2WVSA 4MHHI 1BHGA 2B4CH 2NSQA 1AIZA 2XV6B 1E6JH 3KS0H 4XWOD 1RZFL 2H0PA 4M5YH 5GSRA 2UXFA 4M5SA 4CSTA 5IB3B 5ILTH 1BJMA 4NI6A 1XGPB 1BD2B 2ICWA 2WTOA 1JGEA 5LBSA 1E8WA 2Q3XA 3MRKA 2R1XA 5DD3L 5I1GH 3HC3H 3JV5A 1JPTH 1LO3L 5D7LB 3WTSA 2ZCHH 2QV4A 3NJMA 1EEZB 4C4BA 2F53B 4DGIH 4JB9L 4WNQA 5E6IA 4BUGA 5E4EB 2JLLA 1H3GA 1KELL 1T5WA 3FFCD 5T5FH 3TJPA 1HINL 3ZE2F 4GMSH 4OM1H 4XNZC 2KLTA 5K33A 2NDFA 4CW1A 1FYTB 3FUHA 3TH4T 1CI5A 1WZAA 2VRQA 5I30H 3FQNB 4WSGA 3S5LG 1I7UA 1UC6A 2FWSA 4NM8L 1CE1L 1FAKT 3CXFA 3MRBA 3DTDA 3SEPA 2I24N 1EBAA 1WBYB 3MA9H 2FGZA 1R24A 2A9BA 2HJLB 5E5RB 2B2XH 1FN4B 4CN6A 1MF2H 3NRQA 4ENEC 4YC2B 3EKCA 2XHNA 1WLHA 2WYTA 4ORGB 1JFHA 4PGCA 2W60A 1YN6A 2O1AA 3PV6A 3P30H 1WUZA 4O2FB 1DQTA 1J8HA 3I02A 3RKDC 5CFAA 3LYRA 2RJMA 1P2CB 1OF0A 3FB7A 2BIIA 3MGOB 2D31A 4KXCA 4Y16D 5INCA 1EEYB 3HG1D 4X5LA 4AVIA 1DQQA 1ZSDB 4Z7UE 3KEHA 4PJDA 2FSEB 3P73B 5DO2C 5ECJE 1A6WH 4R4BB 4WY7H 4R7XA 1CLYL 5DWUL 2B0SL 4B3EA 1OAKH 4XPGH 5GSVA 2DL9A 3TOPA 1YYMH 2R15A 3SPCA 1JTTA 1JGLL 1TTRA 4HPOL 4Z7WF 3RFZA 4Z18A 5C2BL 2FE0A 3S5ZA 3VFWA 3Q05A 4PJ8D 3T65A 5H8DA 3QCUH 3ARYA 3KPSE 3VACA 3V5DB 3MRNB 5D2LE 4MMZB 2K45A 3RVTD 1RV6X 3CQPA 1EAQA 3KYOB 2KH2B 4X6FB 1F13A 3SJVB 5ITFA 1UXSB 5D5ME 5ALCL 1UQSA 2K4WA 1HDMA 3NJIA 3T71A 3GSQB 5E1HB 5JHAA 1URIA 2GHWB 3ZE1B 2XQYG 4H4NA 1CLOH 2HH0H 1FE8L 1G9MH 4P2AA 4M6ML 4L3FA 5I1DB 4QLWA 3G5XA 1H0DB 1GXEA 1HYRC 4X6BB 4N8VG 1J5OH 2PO6C 3EUUA 5EO0B 4FQIH 5JO5A 1KTBA 2CKNA 2R4SL 3QJXA 3QVAA 3RX7A 4NNXA 5IQ7H 1ILUA 5IVXF 2XICA 2J8UB 4NO3A 5EOQH 5E8NA 1WGVA 4F8TA 2J88H 4N28A 3NPZB 1N8OE 2XVLA 1I9EA 5DQJA 3EO0B 2EDWA 3AU0A 5KSAD 4P9HH 1WK0A 4UQ9A 2CCVA 3H1ZA 4TNWF 4YSQA 2AEQH 2V9UA 5IGXH 1L5GA 4B9JA 1CU4L 3V5KB 5BRQA 1BV8A 1KJ3H 3HG1A 3MA9L 5DI8B 3DYOA 1RU9H 4B60A 1HH9B 4GAYB 3U9PL 1T1ZA 4R7NA 2C4FT 1RLWA 2EEXA 5KSBA 4K3DL 1YEHH 1OM3L 3SDCD 1CG9A 3EO9H 2VZ3A 3FN9A 1FGVL 1HXYA 3LRKA 4KHXL 2JJTA 4LDLB 5FM5M 1MQKL 3FB6B 2Z7YA 2E7MA 1OSPH 3FU9A 4ZQKB 2QPEB 2QVIA 2HG5B 5AUMB 5IB4A 5ERWB 3W57A 5JO5B 4B5ZA 5LUMA 4FNLL 4N6RA 4N0YL 1SOSA 2W65B 1VPOL 4WWNA 1F1GA 4JR9L 2YRLA 4CNIB 4HF5H 2XN0A 4JKLA 2YUXA 4Z7AA 3DETD 5ITFB 3L3GB 3RHWF 1KLGB 3MFGB 3BDBA 3G5ZB 1PKQB 2IOMA 3WO4C 5L8KB 1LNUA 2EIMB 2X41A 5E8DL 1MFAL 3OSVA 2OZ4L 5E6ID 3VSTA 2G5RA 3GMRB 2V8LA 3KAAA 3HPJA 4RNRB 1RKRA 5T1MB 2N7BA 1GSMA 1OHZA 4MX7B 4PGZA 3LPFA 4Y9GA 3RB5A 2G2PA 2C3WA 1HNFA 3QFDA 4C56E 3FUMA 2B5IC 2Z65C 1GGIH 2GJ6D 4FZ8L 3V79C 3SDXB 4HHAB 3PDDA 4K7FA 3NZSA 4PS8A 5IMKB 2HMID 4XO8A 3UTTA 4RA3A 4LVOB 4BM7A 3MNVB 4D2NA 5MEOB 4YHOH 1X44A 1FVCA 2CKBA 4W70A 4QRTA 4YGVA 3GNML 4Q6KA 5EEZA 3SCMB 3NJFA 3E7JA 3IDMA 1B0WA 3L1EA 2WSDA 4PWIA 2HJLA 1Q1JL 2QPDB 2VLLA 2NOYA 1YJDH 1AANA 3PHQB 3IXAA 1QHPA 5T3XD 3UDWA 4LPUA 3QFJB 1JCKA 1PYWA 4J7RA 3ZL4H 5ERWA 1TZIA 4LSRH 2ZOTA 4PJCF 5EU5B 5C0BB 5L2JB 4HUVA 1C5DB 3EZ8A 1DQDH 3OD3A 1R3JA 3BMWA 5FWRA 3INOA 1JG9A 4XMTA 2D3LA 1I8KB 1Q1PA 2ED8A 1X4YA 2RH0A 5E5LA 2Q6WA 4KO6A 5DI8A 4FTVB 4JRWA 5DEZA 3ATFA 1I8AA 3UXFA 2YD8A 2QMKA 4PREB 4R7NB 3WEAA 3WJMA 2DWDB 3UDWC 1L6PA 1NWOA 3NZUA 1YAIA 1YEFL 4XVTH 4ZFGH 4PLJD 3TFBA 2P8MA 3HG1B 1TTGA 3TIDB 3QDMA 2WM0A 4WJKB 1OGPA 2UZYB 5FYLL 4JQVA 2D2CC 2EDJA 3S36H 3BVUA 2VDQL 2J5WA 3QUMB 1G87A 3N85H 4JFHD 4FLOA 3D18A 2YEZB 3Q1SH 4GS7C 3L95B 3B9AA 2HKHL 3K8LA 3RTQC 1U8QB 3GXIA 4LPYA 3HE7D 3ZYJA 4MGXA 3ZMRA 3G3LA 2FJFB 1LEKB 3K6DA 1B4TA 2HKFL 2DQCL 5DRWB 3L4TA 5AZ2H 3RKPA 1KC5L 2CE6A 4F2FA 2AHIA 2DLIA 2Z4QB 3WNLA 2YPLB 4LDEB 4YH6A 2K8MA 4ODXA 3K71B 2JIXB 4LDCA 5BZWB 2MCMA 4GXFA 3MJWA 5KVGE 3NACH 5I1DA 3DHJA 3MMEA 4JM2D 3MLSH 2XZAH 1HHKB 3OHXC 5DJ0A 3U7AA 4AL8H 1IFGA 1BQLL 1G6RA 3DRTA 3FFCB 3MJ9H 4M1CD 2HRPL 1NBQA 2I25N 3ARRA 2IDFA 3GJFH 3QDGB 3UJJH 1D5BA 4BFIA 1HHIA 3GJEB 2FGWL 3B8YA 2G0LA 4I9WD 3ZSSA 1DFBH 4P5KB 1A7QL 4PLKD 4Y8DC 5B38G 4CMMB 2PPDA 3NIFB 3Q2NA 4W4OA 1DSFL 3NJHA 1BYOA 1Z5LA 2IGFL 2WCSA 5C92A 1FF5A 4WU5A 2VLJA 1YEKL 1N59B 5BO1L 4JE4B 5HD8C 3FRPA 4O02L 4KRMB 3O2WH 4BQ6A 1OT1A 1LEIA 2Y07L 2ZKYA 4N4YB 4G43A 4TL4A 2DKUA 3SE4C 1RK1A 1Q0EA 5LGHH 1MCOL 4LCCA 4MX7A 4HHWA 4NQXA 4ONHB 4J2XA 2N1KA 3OMZA 1PFCA 4GRMA 4TSCH 4JFYA 3FT4B 3SQRA 1BZDA 3D0VA 3UTSD 3RTQD 4G9FA 4EDXA 8FABB 1J8SA 1JCVA 4M3JA 3T0EA 3MR9B 2L3BA 1P1ZA 4ABUA 3ZMNA 2Z92A 3TYGL 3V4LA 1E65A 4NUJB 5D4IA 2W65A 2QSCH 1HIMH 3G6JF 5L4IA 3VMPA 1NANI 1P0SE 5BRZE 5LGJB 1BXAA 2C8NA 1B0RB 5CINL 4A2EA 4BFGA 4Z7OF 4YSUA 1RMFH 1VF5C 4H8WC 3JWDC 3U48A 2ZYRA 5CKGA 5DC9B 2QFPA 1QA9B 1TJHL 3RWCB 3QUXB 1MUJB 1G7QA 5TK4A 2XN9D 2EIZB 1JV2A 4IRZA 4ZTOL 3RVWD 4PJEB 1LMKA 3QUYC 5GS0H 1PCSA 3GO1H 3N50A 4KY1H 5J9PA 4MA8H 4OFYD 2AEWA 3OKLA 1ULVA 1GMEA 4ONGH 4LEXH 4M6OL 2LU7A 3UPRB 2MCG1 1YQ2A 2P48B 4Q9QL 1AIFA 4WFGD 4ANWA 1KB5B 2FL5B 3BMVA 2ZNXA 3ET9F 4G8GD 1E5UI 2RB8A 4FNRA 4DUWA 2H6PB 1VDGA 4JN1H 4D8PB 2BNUB 4LLVB 5KBPA 3HC2A 1KCRL 3LSOA 3UYRH 5D7KE 2D4FA 4EOWL 3QIBD 3VXUA 2XVKA 1XT5A 1FP5A 3AREC 5GIRB 4B0MM 2B77A 4M8UA 5IKCB 5AB1A 4MNGB 4OJFL 3R1GL 2YKLL 5KYXB 2IADB 2J4WH 4TPRH 3SBPA 4ES9A 5E8PA 4Q52A 3ZZQA 3MRQA 2ITDA 2CHDA 3D85B 3QI9A 4WHTA 3VGEA 3X1GA 1PLAA 1ZGLA 4FNTA 1DJYA 4S1DC 4EZMA 1M1XA 5J8OA 4BXSV 5EU6B 5B39B 2Q7AA 3E6HA 5ENWA 1NAKL 2OL3B 4FQCL 3WIHA 1OAZL 1KCBA 4OTXH 4ZXBC 3VFMB 1KJMA 2J6WA 2VXTH 3O3DB 3HFMH 4AKOA 2C9AA 3VJ6A 4Z76B 1W6WA 3C2AL 1E5ZA 4B9PA 1JWMA 4F37K 4Y4HD 1RULL 5EB9A 4QTHB 1XR8A 4Z7QB 4FEMA 4MJ5B 5DHVA 1RUML 2R1WB 2CK0H 1CFNA 4R5TA 3GBEA 3ZR5A 3WJLA 4PP1C 1PG7H 4JG9A 1PIGA 2DQGH 4DPAX 2BRRH 1MCJA 4XXWC 1IL1A 2FYYA 3GHEH 2YUVA 3UBXG 1W8NA 2FATH 3BAEL 3AY4A 3KS0J 2B2XL 2VL5B 1HC1A 4P4RA 4R0LC 1OAUL 4XGZB 4AV5A 1FNHA 4OD2A 4WV1A 3LMJL 1VZIA 1G7JB 3MRMB 1IM3A 4HFUL 4HUUA 3EGXA 4OCNC 1YJDC 3PJSB 4XT1C 2QKSA 3L1GA 1JPST 1DSFH 1P2CA 3FB7B 4HMDA 32C2B 2ZSVA 4LRNL 4F7PB 4H7VA 1INDH 5BO1H 3HE7B 1NCUA 4GI9A 4W81A 5EU6D 2PCPA 4KQ4H 2V5MA 5KSVA 3PGDB 2E7DA 5MI0B 1TQVA 2ICWJ 5F2FA 1YZZA 2WZ6A 4O2CA 2ZE0A 5E00A 3LKOB 3WD5H 3IU3A 2OMYA 5J1TC 2MCPH 2VDPH 1EUTA 2ED6A 2DMKA 3HZKB 4PWFA 4QXUL 5BOJA 4P2RE 1U3NA 1MCCA 3TN0A 3IMVA 1F2QA 2D73A 3BE1L 5H35A 3T0EE 1CYWA 4BRVA 1AC0A 5K9OB 3QWOA 3OX8A 5FUOH 3FO9B 3EJUA 5DZLA 5HHNB 1QACA 4YHZH 4KJYA 2OR9H 1PG7W 3NH7L 1NJ9A 4MB5A 2UXGA 3H9SA 4XMKH 1H15A 2WLLA 3MJ7B 3A6OA 4NYLA 4ICXA 3RWGB 2YMOA 1QKZH 5C0EB 1AVAA 5JLZB 1J9CT 2EXYD 5GXBB 4Z0XA 4FJZA 3U4BH 4AMKH 1FIGL 5ICUA 5CSBA 5EIIB 3LHPH 2X3AA 3V0VB 4HIJB 4LSVL 5HHOB 4E42B 2C4XA 3OAYH 4P2RA 4KTEL 4RGOL 4YDJB 3G04B 3BEWB 3GQFA 1FHGA 4ZMPA 3FC8A 2L7QA 1N4XH 3K91A 3NTCH 3J07A 5BZXA 2X6AA 4RGNC 4DTGL 1AAJA 2H32B 3GRWL 4NM8H 2IAMA 3ARGB 3MYZA 1A7PH 5I6PA 3QCUL 1E40A 4QRQB 1QHOA 2CIIB 4NHCH 2GTZA 3BAKA 4P06A 1IE5A 1L6ZA 2FO4B 1GOGA 1KGCE 4JFDB 1EXHA 3VTMA 1QWHA 1K4CA 2J1ZA 1WGOA 3ECVA 1URZA 5I6MA 5I6LA 3KL0A 2Z7UA 1NGWA 5JOPD 1NMCC 4PRBA 2JB5H 4FG6C 1P84J 1ZT4B 2OI9B 5JLZA 4UOW1 4UQ2B 4ODVH 3CXDH 5E8EA 4X9YA 1FFPA 1KENH 1EAPB 3UTPE 1QA9A 2Y36H 4LARH 4WW1B 4UT7H 5T1KD 1N5AA 4O58H 3RL2B 4N2DA 1C16A 4QKXB 2P5WA 2ZPKL 4KUZH 3VXSD 3T3PF 3DPDA 3ZKQD 5LCVA 4KZDL 1RIHL 2A6DB 1WA1X 2R0LH 2HP4A 2W0FA 1UJ3A 3IMTA 1ZLEA 3NCCB 1MIEL 4HD9A 4Y89A 4S0SD 1GW6A 2LQRA 3I74A 4WKXA 3GGWA 1CGVA 1TTBA 1T0PB 2VDOB 2AKRA 2VQ1A 1K3ZA 3IXTA 4Z7VB 3GDCA 4UQIM 3MXWL 2CCLA 2BCKA 2LU4A 2YGOA 1R5IA 1EO7A 2JCWA 1DBAL 2YRZA 3FU0A 1A9EB 1QW8A 1VFOA 3PJNA 4AQ8A 6FABH 5IQNA 5I74B 4Q6IA 2BIQA 4BSJA 4ODTL 5B1AB 2WNXA 5BOZG 4WRLA 3WEMA 3AADB 2R39A 2VRKA 1K3IA 5IROA 2CJ3A 4U3SA 1IT9H 2HLFD 4P4KC 3HS0C 1KTJA 1MFVA 1M9WA 4TNVF 2VZ1A 3AWEA 2OSLB 4IOSD 4RIRA 3TGXA 1JHTB 2E56A 3HIZA 4Y2OA 12E8L 1WWAX 3ZMEA 5B8CC 2B8OT 2E9GA 4OUUB 4JM4H 5HGAA 3ZDXF 2OK0H 1BJ1J 4XNBA 1SQ2N 4ZO6A 3TBYA 3ZTJG 5AOKA 3TFKC 1M2VB 1CFMA 3KLLA 1AE6L 4FCHA 1T5XA 2XWBA 4JL2A 3KJ6H 5TPWL 2X2HA 1LDSA 5I1AA 2E9BA 4EUPA 3CQQA 5MEPA 4FULA 1NAKH 1DBKH 2VERA 4JFZH 2Q2EB 2MWCA 2X4NA 4AQOA 3TBBA 1NGWB 4LP4A 3SSGA 4U31A 3V0WH 4DP8X 3LQZB 4L4VD 3TWCH 5BQ7A 2D7MA 3L3OC 4FL4B 1LO5B 3IJSA 5E9DD 5EU3B 1IFHL 3EG9B 1FVEA 1MCPL 1OLLA 4PI2A 1ZHKB 4OGZA 3DX7B 2DKSA 3DJ9A 1HWWA 4X80H 4Z6AT 1F4AA 1W2KT 2WV3A 1B4JL 1IIIA 4TLUA 4MXQD 4F7EB 3AM8C 3WFHB 3HI1A 1D7FA 5DHYB 1E43A 4EOWH 3LZPA 4LLVA 2V3FA 5FYKL 2ESVA 2P45B 1U91A 1TKWA 2XYCA 4UDTA 5KTEL 4XP1H 1EHLH 4NP4H 4JRLA 2G9KA 5HHOA 3S48A 2V9QA 3MRQB 2BERA 4V1DA 4Z7NF 2QHRH 5I23A 1PW3A 5G5DA 4ZFOL 1EFXB 4O51B 4X9IA 4DVBA 2Y5TA 2A3TA 3EBIA 1RULH 2VN7A 3L3OA 5AYUL 4JM2F 3B2VL 5LG6A 5KSBF 2Q7NA 4QRSB 3IJYB 1QFOA 1TFHA 3MJ6A 1DLHB 1AG6A 5DJ2A 5G4NA 1XZ0B 1S9VA 4KBPA 1EZVX 3O6KH 1YYLH 2XZQH 4X8XA 3NDZE 3D0AA 3MNMA 5CCKH 2OFQA 3SO3C 5D7IA 5ISZA 5DRXA 5LAXA 5KS9F 4RAUA 1RURL 4MJID 5JXAH 4LVHC 1BZ9B 2JNZA 2H3NA 4HXAL 1AQMA 1OP4A 1ETZB 5HGHA 2EE3A 1SLUA 3HG1E 2Z92B 1F18A 4FKEA 4GUPA 3CNKA 4K2UH 4WFGE 2WCPA 3CXHJ 4JRYE 3WEOA 1HJBC 3EYUL 3F12A 3FCTA 4D9QE 4JKPL 4ONHA 1U8MB 1EBPA 5B1KA 5FB8A 5CEZE 1NLBL 5DT1L 2UUDH 5KEZA 2A6IB 1MJ8L 2L7UA 4M4RB 2BLFA 1QLRA 3ZDZE 3EDDA 2EAEA 2EKSB 1M7UA 3BQUC 3H0TB 1UCBL 2WYZA 3EFFA 5IVNA 5IFJA 3MVSA 4M4PA 4WW2A 3DC0A 5M94B 3H6AA 1F6LL 3WU1A 1CDJA 1ZV9A 1RFDL 1FLRL 3V4PH 4JZJB 3BDYH 3Q06A 4YPGB 4RNRA 2BJMH 3PFUA 5CLXA 1S7XA 4U05A 2AQ3A 4GBXD 1B6DA 1QWNA 4K3HA 4PRIE 2XQBL 2E75C 3C8KB 2H5UA 1GPOH 5JOFA 3BO8A 1S7RB 2VLKB 2W91A 3ZRSA 4D94A 4F8OA 3TCTA 3VMOA 1SGKA 3QDJB 5F96L 3VD4A 3ZZ1A 2JB5L 3QXVA 5CN2A 1VGKA 2Z1PA 3FUFA 4NDMA 3U1PA 1ZE3C 4HETA 1NFDB 5BS0A 4I4WA 2QKIC 2JXMA 1YC8A 2EUZA 4OD3L 2YSTA 4PJ9A 4CKQA 1T21A 5C70A 5GGUB 2C9VA 1CFNB 3NP4A 3L5XL 4NX0A 3I50H 4I3GA 3L6FA 4Y2DC 4ZQKA 2HLEB 5D2NB 3FRUA 3FL7A 2R23B 3BVWA 3QZBA 4LDOB 4FQQA 4OBSA 3TV8A 5IR1B 4GMSL 3QSKB 4WV1C 1N0LA 1CG9B 3O6MH 3ZTCC 5A3ID 4MJIB 1HK6A 3NTCL 1BG9A 2BWQA 1AO7E 3LPWA 3HE6B 4NQSB 4XE5B 2BSDA 3H42L 3QULA 2RCSL 4D8PA 1E28B 3EYOA 2LTQC 1ID2A 3AJ7A 3OJDB 3V0EA 2VM4A 4R7DB 4PY7A 3MQIA 1C12A 4FNQA 1L5GB 4U1MA 1W72A 2KLSA 4AL8C 4EO5A 1TXKA 2VSKB 5AW6B 1UHVA 1V7NL 4MDJA 1XMEB 4A2FA 3MLZH 4U3XA 2IADA 1RZFH 4FTVA 1OGAD 1XMWA 3S97C 3BESR 4FABH 4B9GA 5IW6B 2ZUSA 4FJYA 3GS7A 2AZAA 4MD0A 1KCSL 5E2UH 5F88B 4JO4H 3HHMA 4DK5A 1F4YL 4JW3A 5KYYA 4OLEA 4WFHE 4XNXH 2LFGA 4PRPE 2FZ3A 2PWDA 3KMDA 4G6FD 2Y5QA 4UIKH 2F1EA 1QBAA 4NKDA 1MRCL 1GAFL 4WTZA 3VWJB 1AGCA 1B9ZA 4UOW0 5IB2B 4I0PC 1TQCB 4A37A 5AZEL 2DPKA 1NZRA 1YYML 2XYBA 3VXSB 4BH8A 1VACA 1T0NB 3IDGB 4PB9L 3IJ7A 1JRHL 1U95A 1NTDA 4J2QA 4EI0A 4OZGE 3OJDA 3DO4A 4G8GE 2DZEA 4O02B 4R4FH 1KYOK 1P5VA 3T3MB 3MNVA 1MJJA 2BDNH 5FFGA 1DSWA 2E6PA 1JK8B 1V05A 3CWGA 4ZG1A 1I1AC 1YNLH 1S4IA 1EAOA 2XG5A 1AD0A 1IC7L 1E9OB 5CIPB 4DERA 5ABDE 4LLYA 1DBML 4Y4FA 3MUJA 4NRZB 5EC1A 5EN2A 1JWSB 2GIMA 2GKIA 3F6LA 3IT8D 1U21A 4MNGE 2X4QA 3SBQA 1NEZA 4XVUC 3SDXA 3TO4B 5TGBA 3SDCA 2IH9A 2G75B 2DQFA 4Y19D 4AEIH 5JZ7D 4G11A 1PBYA 1ET7A 4N2FA 1J0KA 5K59F 4DO5A 4V11A 3VDAA 2VMFA 4S1RH 3KWWB 5IB1B 5HYSA 1AFVL 4POZC 3PWPB 3CC5B 4LE8A 2DQTL 5I18H 3IFOA 4JLRA 3NIDB 3ULUL 3RP1A 4PJXA 4PV9B 5DA0B 5JPNC 4H26A 2UYLA 5A3IC 3IJHB 3AXIA 3EAKA 3FUNA 1FL3B 4LPVA 3C09C 2H6OA 3VXNB 1E3ZA 3BDYL 2WBKA 1SLVA 4PJ8B 1YRKA 4EMZA 1UZ8A 1HOCB 5FO2A 5ADPL 1ZY9A 3ECQA 5GRUH 5GZNC 4LSQL 2MFNA 4LLYB 3RPIB 3BWAB 4EVNA 2NX5A 3GLEA 5LBSH 4AYID 3KLSA 1E5BA 1OAQH 1CXFA 2NPLX 1UD4A 3UYRL 5DT1H 4OQ1A 1RK7A 5T3ZD 3F12B 1HHHB 2IG2H 4KHXH 4PJXE 3I75B 4FCAA 1VEOA 5FGCB 5AOJA 5KTEH 2I32A 4F9LC 4QRBA 4Z7WB 4J39A 1NDMA 3EJRA 4MZ2A 2ATPA 1KFAL 3RIAF 4WK4B 4JKPH 2HX9A 2P8MB 2LVCA 1X4ZA 3TJEL 1ACYL 5DUPH 1A25A 3R8BB 3UP1A 1U8CA 4HIHA 3W0WE 1MLBB 1PJ9A 1TJMA 2ITCA 3BXNB 5F88A 4ZTPL 1OSZB 1YYLL 3CVHB 1SZNA 2CAKA 4J3OD 1X4XA 3BUQA 5JPNA 5L2JA 2ADGB 4IBVA 2ZWLT 3SD2A 5I15H 4FYRA 3V4PB 2OP4H 2XA3A 4RX4D 3F64A 1K2DA 3QO1B 5DRNA 1OZTG 3TTSA 2V17L 5ANMA 4ALAH 3A6BH 4JX0A 4GT7A 5DK3A 1DVFC 4IIQA 3VB8A 3K72A 5BJTA 4QRPE 4H5SA 3TCLB 5JIKA 2Z64C 3MZGB 1YMMD 1DDHB 4FS0A 4PJ9B 3AT8A 4QRPD 2WAQA 3AGWA 4Y9EA 1LQBC 1R75A 2A4ZA 4XP6H 5EFIB 4LU5H 5DWPA 2XXFA 2GC7C 4XPFH 4M62L 2F0CA 1NCOA 1QOKA 5CN3A 4LRIC 4OAWA 2VLRB 4F7TA 5ITBL 4UYPA 4MMZA 3QIWD 2Z35B 3DGDA 1NFDE 1YN7A 3EFOA 1RCYA 1Q9WA 2A9CA 5KVDL 3T65B 1GCFA 5MP6L 1FBIL 1UM6H 3B7UX 5DQ9A 2ALAA 3MLTA 3IDNB 3ETTA 3N1GC 5A2AA 1S7TB 3FCSB 4GAGL 2ZYIA 4LOEA 3MJ9A 1EQWA 4WU7B 5CBEA 2XZCH 1OAXL 1USZA 3G9VA 3AS3A 4HLJA 4IJTA 3QG7H 3KLHC 2CGRH 3L5JA 2ERJB 1KIPB 4IKKA 3DJZA 3QNYA 5CSZB 4M56A 4CMHB 4ZZKA 4WUKL 2ENQA 5HI3D 4MMZC 3NGBC 3BHBB 2EO1A 4MAZA 4Z0BL 4JO4L 1K5NA 3WFDH 4X50A 3ARPA 2HWZH 4K71C 5I0YA 3SE3A 3SGDI 1E9PB 3Q01A 3BT0A 4LRIA 4OUUA 4CU6A 1IEBB 2F58H 5INCB 1JZ5A 3TEZA 1PZDA 3DI3B 3COOA 1LO0H 1KENL 1CB4A 3BVNB 4PHZA 2BS8A 3VYOA 5IV2A 2Z4TA 3BPLC 3ZE0F 5GS2D 4ZUSB 4AEFA 3DMMA 3GMLB 2LR4A 5LQBL 2C3XA 3VXUE 4I48A 2D7OA 4BWTA 4AYDC 1PZ2A 2XN9E 4B9CA 4OJYA 4PRPB 3MU3A 1I1FB 3FCTB 1PNDA 4OF0A 2PXYA 2L04A 3NQIA 2OMXA 2VRAA 1XIWB 3U79A 1JL8A 2FB4H 4JFFB 4PJ9D 5ALCH 4ETQB 5I66A 4FAAB 4PJ7A 3W1ZA 3PWLB 4LSTL 1IEAB 3OPZH 2NT1A 5L88H 4MCYB 2PYEA 3O6FD 1DN0B 2H8PA 2WN3A 3DJSA 3PLYA 2UWEE 3ABKB 4CSPA 3ENEA 2ICEC 3DWTA 3O6LL 4HJGB 4OZGB 3Q3GB 1L7IL 4FQXD 4PV8A 3WNMA 3QORD 4LZKA 1X7QB 2VDLL 4F80A 1YYCA 3FSAA 4CVZA 1N3NA 1LXMA 1E9QA 3KLAB 1BVLA 1XH2A 2JTYA 3OZ9H 1XCQB 3CC1A 1X5GA 4QJ3B 4X6CA 2WLYA 3ABGA 1CZ8H 2AJXH 2EIBA 3IN2A 4X0NA 5BMFL 4F2MB 1QKZL 2IG2L 4N2BA 1NBYA 3T08A 3UC0L 4AYBA 4PR5B 2E46A 1FIGH 4YLCA 2FRGP 2ARWA 3RGBA 1VLXA 5D1ZC 1IBDA 2YC1A 5EDXA 1S5HA 3U2SB 2VC2L 2YKKA 1J8RA 3D52A 4UNUA 2J5LB 4M43L 4JMNA 1X7TA 5AWNH 2HT4C 5E9DE 5F3BA 4KUCF 2IGFH 1U93A 3I6GA 4BQBA 2VLKD 5I75C 1HE7A 5DJDA 2NW3A 3M17B 1A4CA 4OM0L 2WINA 4Z78A 2ESVD 2F08A 2VSCA 1MCWW 5D7HA 1XQ4A 1U3YA 1R3IL 3WCYA 1HHGA 2E27L 3OGCA 2L0DA 5IR1A 2ZAIA 3QULB 3REVA 1S8DA 5HI3C 5I8KL 5GRVK 5C0ND 4U1LA 5J12C 1HHHA 2VR7A 1OE1A 1IGCH 1CTNA 2HXAA 1V3JA 3BFWA 3QDGD 3K81A 5K9QG 1TCRB 2R2BA 1XIWD 3UOAB 4OT1H 3UG4A 2ARJB 1T89A 1BQUA 4PCYA 2VUKA 3L4XA 5C6TH 1N6VA 2O5YL 3WN6A 4NIKB 5F71A 4GQ9H 4LOUC 1MFEL 1QSEB 1Y7VA 3VG0L 3O8XA 1JGUL 4KJYB 4HJJL 4XN5A 2C7FA 4F93B 3U46A 3TO4D 2UX7A 1FZMB 4OLZH 3V8CA 4KDTC 2XWEA 4QI3A 3U6XS 5I1GL 2VLKA 3CFBB 3Q6GH 4N8PA 1NAMB 3U30B 3MRDA 5DD5L 1BF8A 1NDTA 4JY5L 2YBRA 1ZXQA 4I88A 2OMTA 3F5WA 2WQAA 3DVFA 1VKXA 2OMBA 3MRJA 3DXAD 3I3BA 1SVCP 2CGRL 4EUPG 3OKEB 4K15A 4AZ8A 1L9SA 1DO6A 2W1NA 5A2IH 2X6VA 3EJTA 3ECBA 1AZRA 3KYMB 3CMOH 3HZ3A 3ISYA 2ZXDA 3LH8A 2WNWA 3FOMB 3HZVA 1JD7A 3CFKB 5AKTA 4X6DA 3VQ2C 3P40A 2EKSA 4PG9A 5AG8A 2EQDA 3KJ4B 1M7IB 1YO4A 1EFXD 4OD2B 1SJHA 4NBZB 5IJCC 1IILE 2BVOA 2WGXA 2ZIDA 4EI5D 5DEGA 4D7PA 2HYMA 2Z7WA 5IBLC 3WL9A 3NEEA 1XF2B 2FLBT 2HVKB 4XHJC 3LDBB 3I3EA 4RBPK 5GJSH 4ZMWA 3LIZA 1LP9F 4R3SA 1EEZA 3QUML 4YDIL 1RJLB 3AMKA 1TQWA 2XWJA 3RVWC 1OAKL 3B9VA 4DKFL 2YUWA 1Q9KB 4AKPA 4LCWD 4NAJA 3CCHA 1XL4A 1DJSA 1UA7A 3NIFE 1E4XI 3QEHA 2CHZA 5H37H 4U1NA 4H1LA 5EO1A 5FS5A 3LKRA 4LKXB 3A6CL 1ADQA 1TPXC 3FUDA 3O3EA 3GXDA 5IROD 4OF3A 1VFUA 3KG5A 4OFQA 3CAFA 2VLKE 4JFEB 3GI8H 2Z93B 1JZDC 4GXUN 5JW5A 2VW4A 1J0ZA 2NYYC 4ABVA 4POUB 4PRNA 1KTDB 4K3EH 3RY5A 4WENB 3UTPD 4OI9A 1Y1DA 1JPEA 5J57B 1F5WA 2ZYHA 4S0HA 3FF8A 4GRLD 4YOKA 5J0BA 4G7RB 4NP4L 4DF9A 3CSPA 1N5YL 1AHWA 4FEIA 1NCAH 2ADJA 5SWZB 3GXTA 2J20A 1AACA 1LILA 4ZYKA 2QGDA 5F7DB 2ZG2A 4NPYB 4F5CA 1LK3H 2HZHA 3JWOL 4CVWA 1EJ6A 4MDIA 4JKMA 3DARA 5BV7C 2DQIL 2GBUA 4LT7A 3BKJL 3FB8B 4B9KC 4X0KA 1QTYT 1U6AL 4KY2A 1P6AB 3CHOA 1AGEA 2GSGB 4A7GA 4P5SA 1SY6L 1JNHB 2KYIA 4MLIA 4ZX3A 4N8CH 5BRPA 4GS7B 2P46B 3CH1B 3LZFL 2Q7YB 3SKJH 4AIXA 2BZCA 4U3CA 2X12A 1S3KH 4NQDD 4PJGE 4MQSB 3UADA 3VFGL 4NJ9H 1F3DH 2VMDA 2EE6A 3UEZA 3ZTEA 4L1TA 2A38A 2XN1A 4N24A 5D7IE 3GHBH 5ISZE 3TJHC 1JXKA 2FIKB 3CUPA 1SBSH 3GS4A 5CINH 2EDHA 1JXDA 1NL0H 2K1MA 5IB5B 2P24A 3WNOA 3M88A 2XX0A 2WN2A 4JG1H 4J3TA 4DP1X 2WJ7A 3O3AB 4LNRA 4J3SA 4YE4H 4GKLA 4HALA 3S0PA 3MZTA 2J88L 4PTUA 4RGOH 3DOIA 4HUUB 4TNEA 4DSYA 2WB7A 2MNUA 4YJZL 2F6AA 4YZFF 1KCUH 1INEL 5DLLA 3JWNH 1I1YA 3G7TA 4AJYV 4KNSA 4AGOA 1UA6H 3JWNE 1CGSH 4FQXB 5CBEB 1R5VB 2BDNL 3JWNG 1CXLA 3PP3H 1U3JA 1S7TA 3MACL 2CBPA 1WO2A 3GSVA 4PJBF 3O4OC 4LL9A 4M02A 5C09B 1JTOA 2BS9A 4Q6IC 3LKNB 3HR5A 1H6EA 3OC8A 4ABWA 3QGVA 2X4UB 3OHMB 3JYCA 5BVPH 1L9TA 4FFWC 5FK9B 2H9GA 4ES8A 2E9WA 1IC5L 4ZD3L 4MHHG 3TX4A 3WDJA 5D1QB 1J87A 5IM7B 5EU6A 3C60D 3QRGH 3NRFA 2DF3A 3BIBX 1QLEB 4K7PH 3LKPB 3MOQA 5KBDA 3UBHA 2NR6C 2YA0A 1MRCH 2A9AA 4PP2A 3OM3B 4H8WL 4OU3A 2IBBA 1WE5A 3VD9A 4JHZA 1JHLL 2EECA 2AJUH 1NINA 1UWEL 2VXVL 4XNYL 1KF9B 1C1EH 4LOFA 4D8OA 3IFPA 5TTRA 3OKLB 5DZOA 2A83A 3IE9A 1KBKA 4HGKC 5CD3A 1LM8V 5D1XB 5I0WA 3OC5A 1UT9A 4OI8A 3WELA 4ZYKB 1WEJL 2HVBA 2WXGA 3ISRA 3RNKA 4S1QL 3C6LD 2R0ZH 5DQDL 2ITCB 4L9LA 3NESA 3FQWB 3QJSB 4KK6C 4FZEL 1BJ1H 1Q1JH 3EF7A 3SZ6A 4MJ6B 1JGUH 4U6TA 2OJZL 1MJ7L 2X28A 5GQBA 4XRCB 2Q8BH 5AYTA 1X7QA 1XTMA 2WLJA 2WZAA 4GJTB 3C5ZC 4HS8L 3FTWA 4R3SB 1KLFA 1XSKA 2DLFH 2J1WA 3CN3A 4I3SL 2X53A 4M8QA 3VXOA 2W81C 1X5AA 5E6IC 3VFVB 5AG9A 2CO1A 1KN2L 5F7UA 1QZ1A 1Q9LA 5E1IA 3U0TB 3RUGE 1QSED 2XV0A 5F6IB 5JW4M 1I1YB 3FMGL 1IGYA 2EYRB 1XD0A 4KKCD 1UKTA 4J8RB 3LKRB 4LKXA 2VOTA 3FCBA 5H35B 4HKBB 4IRZL 5GGVY 3MRGB 1ORQB 1DUYB 2FH8A 5AW8B 2R29A 5I1KL 1T1YA 3KLHD 4HH9B 2ADYA 2Y9RT 4TV3A 1SYSB 2Y2WA 1NCCH 3QUZD 2ZSVB 4I7ZC 1VKXB 2V7HB 5D70H 2HUHA 1KTCA 1XHHA 3TT1H 3TZVC 1TSHA 2WUBH 2O5ZL 3MR9A 1MAML 4ZMZA 2ZF8A 4G71B 3KPNA 1RUPL 2F2HA 3ARFB 3RWIA 1UM5L 5L2KE 1J0IA 2P43B 3ALWA 4J3OC 1XR9B 5I1LA 1N2RA 3LS4H 3X3FL 5KJRH 4YFLI 4A04A 1DJIA 2ZUXA 2PLTA 4DGVH 1T6WA 3LPPA 4OCRH 2N01B 1NC2D 2C9PA 3MRRB 4WTWA 3BKJH 4AYMC 1HNGA 3VFNB 4GKNB 4F37F 5EF0A 2H47C 3G08A 5CZXD 1U8LA 2EEAA 3L4ZA 2X42A 5IUSA 1T1XB 1XF5B 2F61A 3T4YB 2LLNA 1P9MA 4GO8A 4ZAKD 4E36A 3INUL 5FUZL 1G7MA 2I69A 2Y7OA 3OKYA 4AI7A 1VFAA 3MODL 3PXJA 2ZUVA 3W37A 1FV1A 5DRZA 2F54A 3BN3B 4Z3FA 2EP6A 3WMSA 4BWWA 4KITB 3BRDA 3GRWH 4P0DA 1UZ6E 2MH4A 3IFLH 1NEPA 4P5MB 4AMXA 1WITA 2QSTA 3T2OA 1FZMA 1TJHH 1P4IL 1X5XA 3WJLC 1A6VL 25C8L 1B0GA 1RZGA 1UD6A 2NTSP 5AFAA 1E30A 2EC9U 5I82A 1DL7L 1HHKA 1NC4D 1NWPA 5I8OH 4MA1B 4LHUA 3TIDA 1AJ7H 5CCKL 3D33A 2PMZA 2PYEE 3LKSA 3I6GB 4Z7IA 1JPSL 3F7KA 5GPRA 2ILLA 3LRGA 4XH2A 2NXZC 2ID5A 3T3ME 3MJGX 1MWAH 3RWHA 5ACZA 5DZAA 4FFTA 2AJVH 1DVQA 3BAYA 3PL6C 4IMLB 4LLMB 4ZS7H 5IJBC 2CO6A 1N19A 4OLVH 2HWZL 5LCVH 1FG2B 3FZUC 3ZDXB 3RIFK 2FX9L 3I84A 2Q9OA 2GAZA 3NCYP 4Y7MA 3UAEA 4X8GA 4GSQA 5DVMA 3VD7A 4Y2DA 2OBGA 1CF8L 3H2PA 3E3QE 4FTDA 3AS0A 3KVDD 1GL4B 1M9SA 4GAJL 4GG6F 4WK2B 3PWUB 4UTBL 4BK4A 4XCYA 4HCRL 3IPBA 4NUGH 4G8EB 4TUKL 3WIAA 2VLLB 3FU3A 4DZ8B 2AQTA 1O5DT 3V95A 3U9WA 2F5AL 1ID5I 1B4LA 4JDVA 4N2EA 3ZYIA 4AM0Q 1PQZA 2PF6A 3LHAA 1DTUA 4AEHL 1OTTC 2FGWH 3KJ4C 4FQJH 3TBWB 2YBGA 4JMXA 3O9WC 4OZFG 3UZQA 1IZJA 2FHBA 3W9EA 1LDPL 2VDMH 3IKCA 3DKHA 5I76B 5DD6B 1E90A 4H88H 5L4FA 1EUUA 1EZLA 1YNTF 4M62H 3VTAA 5CJQL 3SE8H 1U8KA 3RPIA 2OMUB 2ZOKA 3VXNA 1VESA 3DUUB 3EADA 5T3XH 5IOPA 4NO0A 5DC0A 1DDTA 2CK0L 5BPPA 2YXFA 3GIZH 4IRJC 1QEWA 2YBRB 1WWWX 4FNSA 3CZNA 5D9SB 1I3GL 2EDQA 4O9HH 2QTEA 2GUOA 4F7PA 2HT2D 1BVOA 4NB7A 4ZTOH 3SY6A 2UYLB 1S78D 1E4KC 2R0ZL 3RLSA 5TE6L 2JCCB 3O6ML 4N8VB 2VYRE 4ACTA 4YHKH 3DTUB 2WC7A 3VG0H 3K6FA 4ZUTB 2CLRB 1KGIA 3D2UD 3GKWH 3ARVA 1IT9L 4HIXL 5DSCB 3BLPX 4UUJA 1D7BA 3P4NA 2BP3A 1U8PA 5B1BB 3WTWA 3CFIC 5ANME 3M1CA 3F04A 3G5YA 5CEXA 1DVFB 2QKIA 5DK2B 1ZSHA 2XKSA 4LOVA 1UFGA 3N41F 2NMSA 1MY7A 4UZUA 5T3ZE 3RURA 5KS9B 2WXLA 3V9EA 1KACB 4WY7L 1HINH 3ABLB 1QBBA 3QAZC 4L3CB 4LCCC 4QTHA 3S2AA 4F7MB 2FX7L 5D7JA 4LEOA 1U4FA 1U8HB 1OEZW 2E76C 5IHUH 4KK9C 2F7IA 4ODUB 2CALA 2GUYA 2R4RH 3IMSA 2ZCHL 4LCUB 1FIEA 3WKNA 1HHIB 1GGCL 4PBWD 2WXNA 5KSBB 1IKOP 1T0OA 2ADFH 3OVUB 2HPOA 4HC1H 1HH9A 4GAYA 1A6WL 4FE9A 4ELKB 1Z9MA 2DD8L 4KV5F 5B39A 3GZQA 3JXAA 2BIPA 2JFCA 3D69B 1H6TA 2WUBL 4U33A 2TSAA 5GS1B 1PAZA 2W38A 3X1BA 5I1KH 4YR6A 5DQJB 3D4ZA 5ISZD 2J6EH 1E2VA 4FXGA 1V3MA 2NX5E 1JNJA 4HOZA 1X5LA 1D6VL 1G7HB 4PVBA 3FTXA 2AK1L 5ID0A 1WRFA 2P26A 2HTKC 2M8XA 3T8MA 3QS2A 3A4FA 4J4PC 3B37A 5TQ0H 4A38A 3MNZB 1KPVB 1NEUA 3BYYA 1V10A 2E7BA 5BOPA 1T1ZB 5D5MB 2YFNA 1KGJA 1RK0A 2R29L 3C09B 4KVPA 43CAB 4JCWA 3AXHA 4BEIA 4OM1L 3WFZA 1IUZA 4JREB 3H7BB 3Q8AA 3FU5A 2WLIA 2WQWA 4IHOB 1KN2H 2XU9A 1OAUH 4ISVA 3FT3A 3LHPL 2FEEL 4R2GD 3CSYB 1BF5A 3DBXA 2GTQA 1Z6JT 3PL6B 5TE4H 2QQQA 1A7RL 2J43A 4L4TE 4X99A 5DZPA 4YHZL 4P5MA 4Y2NA 5DHXB 3IJ9A 4X9GA 1XH3A 3PQYD 3HZYB 5C0AA 5D2NE 5BUAA 2HN7B 3CX5K 5DFTA 3M7FB 1E8ZA 2CR6A 1DVZA 1JSYA 5M95B 1GR7A 2X4TA 1M7DA 1TVHB 2O61A 1KNOB 1FZJB 4LCIL 1A9VA 3SGDH 4QY8B 4I4WB 1PZ5B 2WIIA 4GSDH 4NXSA 2CJTA 1DR9A 3FYIB 4E2OA 2ZP0T 3WE1A 2ZKHL 2MTAA 3GLZA 1TQUA 1YA5A 4GT0A 1FVCB 3OF6D 4DKTA 1KIRA 5FYJD 3QXAB 5E9DA 3VYNA 3UAFA 2GT9A 1DJWA 1HWHB 4U6HB 4ZUTA 1CN4A 5GGTH 1A4KB 1TITA 3HB3D 1R9FA 1PMYA 1O7SA 2JCCA 4HFUH 4K7FB 1BXXA 1FSKB 2LT9A 2P28B 5CWSA 2DYRB 1SHXA 4PHXA 4Y5XA 2R69L 1AQHA 4GEJA 1S7XB 1HCFX 3GM8A 5D1ZD 3T09A 2AEQL 2HTLC 2FJGB 2QKIB 2G75A 1TVDA 3OAWA 4JQXA 1KB3A 2XA8L 3H0TA 2JELH 3Q2WA 4JRXD 5FEBA 3EGDA 1CF8H 2X4QB 1Q90A 5F7EH 1DJGA 3GUTA 5K39B 1EEYA 3FT9A 4YGAB 5C0CB 3F8UB 2ZCZA 1QQDA 3C08H 4QRRD 3PXHA 2MCAA 1N9PA 5EF3A 4RGNB 5BUPA 4QCIB 3RX8A 5CR1A 3QDME 3N40F 1NMAL 4PVMA 2VQ1B 4J3VA 2Y7SA 5DC4B 3VGGA 2CO7A 4PJGB 1ZTXL 3HN8A 4XNMA 5EZJB 2V17H 3BE1H 5AW7B 3FS9A 2OMUA 2CRIA 2ZOKB 3MREB 4MMXB 5HBBA 2NUPA 2JKNA 5IB2A 2EXTA 5FAAA 1MIMH 4TVPE 1WAEA 4JHUA 3UPCA 4KXAA 1CFSA 3K71A 2NXYB 2WSKA 3BJLA 1N5AB 5EIVA 5A7EA 2F7PA 1CURA 2NR6A 5F0JB 1WZLA 2AJ3B 4XE0A 5J6SA 2KDGA 5J1AA 1KULA 5DRWA 2IPUG 3GSOA 3Q1EA 4U0QB 3RWFB 3VGBA 1IV8A 2P5WD 1KFAH 1FL6A 3N6YA 4TSBL 1TMCB 4IMLA 1XF1A 5KBKA 2MRYA 2E86A 1D7DA 3QISA 1FJ1B 2JQZA 3VFSA 1RU9L 1QYGL 4ISVB 1E3FA 3SKNB 3NZHL 3A0OA 4GRWB 3RKDD 1KGCD 3GRBA 4TUOA 4HCRH 2XRAL 2BSRA 2NY3D 1ZD6A 1ADQH 3D30A 4GAFB 4XCYB 3TWCL 3IFNH 3US1A 1A0QL 1UWXH 4PMFA 3VGDA 5FYJH 2P8PB 4FX5A 1UD5A 3N1QC 1FFQA 3K80A 4PP1D 2Y36L 1SY6A 4LARL 4AENA 4WI9A 4CVXA 3MOAH 1X5JA 1X9LA 5LBSL 2Q0ZX 2HFEB 4AX3A 1TENA 3LNGA 3U1SL 5D1QE 5C0BE 4HZLB 1OF2B 3PHSA 2QFRA 3GMNA 4K7PY 1IGJB 1X9QA 4LHUB 1PZCA 2NLJB 2PTUA 4OB5L 1MCWM 1V7MH 5B3SB 4JAMB 4DUVA 1J1PL 2QDWA 5GS2H 5JHBA 4E41E 4HUWA 4X7TB 4JANA 5JXAL 5TE7H 3B2DC 2PWFA 1OY3B 2NY1D 5AQ0A 4IU2B 5A2LH 5KANG 1JYWA 4LAQH 2EIEA 3R4RA 1FH5L 3E6FB 1T5XB 3QJZA 4YO0B 5D5MF 2R59A 3ARFA 2NCMA 5HP5A 1XF3B 2JKWA 1YPZF 3WDIA 1NCBL 1EZSA 4OZHF 4L8SB 2C26A 4O5LL 3W0WD 1SY6H 4K73A 5I9QB 2DQCH 1U2YA 3CBKB 4PS7A 4UILL 1BEYL 3N06B 4BFOA 3RWDA 4NN6B 4WO4C 4TSCL 3F05A 3THMH 4F15C 1EEUA 4NRZA 5IIEB 1HE8A 1T1YB 3T2NH 5EUOE 2HVJA 4PG2C 4JQIA 5C8JA 2AEPH 2VUYA 3F2LA 2XIBA 4G7YL 4TOYH 4UTCA 3VXQA 3MRPB 1D7CA 3T6ZA 1UGNA 4XMZA 1KYAA 3P54A 3T8VA 5SWSD 3O0RH 4ZW7A 3IJEA 3O2WL 1EV2E 3MLVL 2BVTA 4Q58C 4XAKD 2BVQB 3OXRA 4R7VA 2EDMA 1F11B 3EH2A 1JNLH 1JHLH 2H1XA 3CDGA 5AOLA 4C4UA 2GITB 4X4YB 2D0HA 2F68X 2VITB 4IRZH 1BW8A 4QDGA 3IS1X 2CQVA 2TRYA 4G1EA 3S6CA 1AC6A 1EGJA 3BFQG 3E38A 4P3DB 2P1YA 4UANA 5AEAA 4BZ1A 3WNPA 1CE1H 3L9RB 4UTAH 3MBWB 2VH5L 2YK1H 5DCCA 3I3DA 4R9HA 5H2BB 3CFQA 4YHPA 4HAKA 2L4OA 4LSSH 3U7WH 3ZE0B 15C8L 3KPQA 4KOCA 2CJUH 1JZ8A 5JHLL 5HHXL 1MXGA 4ZX4A 1BQHB 4NHUA 4ZAKC 3LIZL 3LVTA 2X4OA 4Z95H 1BJ8A 2BP8B 4JB9H 5I19L 3L3OB 4FL4C 1HYSD 2JELL 3DX8B 4FF9A 4AZUA 3RRQA 2Z31C 5IKCA 3TJHD 1DEDA 1K4CB 1VZHA 3F58H 3TZVD 1KGUA 1NLDL 3DJTA 4I1PA 5AZUA 1Q0YL 4JZOA 5JDSA 7CGTA 5DJ2B 5T3XE 3KCPB 4WI8A 3AG1B 2IXQB 3I50L 4HCGA 1N67A 3QCVL 3QK0A 3V7AE 1ZTMA 4UM9D 3QEQE 5DVOA 2ZJSL 4U3HA 2ESVB 2H3XC 3IFPB 3RGHA 4KKAC 5AVSB 4JVWA 3GI9L 5AAMA 1IVLA