3VVVA

Skich domain of ndp52
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
114
structure length
108
Chain Sequence
b'GPSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding and coiled-coil domain-containing protein 2
publication title LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 17
structure length 108
sequence length 114
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vvvA00
3VVWA 3VVVA 2LFEA 4NLHA
chains in the Genus database with same CATH superfamily
5HD8D 3CVHL 4S1DD 1VGKB 4QNPF 2ADGB 1AHWA 1INEL 2HVJA 3KPSD 5JHDA 3A4FA 2Q2LA 1W8OA 2AJSL 1NBYB 5T5FL 2QPUA 3PWNA 2MMXA 5JDSA 1PNDA 2X4TB 4BWUA 1OK0A 2HAZA 1X44A 4D9LL 2ZSWA 3FBQA 5E6UB 5I1KL 2HXAA 3ARGD 4PRHB 4GXVH 4R7NB 1KJVA 4CILA 4EUPG 4YSUA 4JRWA 4FF9A 4HD5A 3P30L 4IU3A 4LASL 3ZKNC 1BZOA 2IXQA 2WVVB 2VERN 1YNTF 1QFUH 4Q6IB 3RVTC 1O6VA 2XVKA 1CE6B 3GINA 4K94L 3HE6D 2YPLB 1DQLL 3OWEA 4IS6A 4LLMB 1FG9C 4NQEB 3REWA 3MRHB 1GIGH 4KKAC 4RFOH 3HNTL 1G9HA 4KX8A 4GQQA 2ZD0A 4NI3A 5I18L 2NY7H 3U2JA 1KYDA 1M6OB 2Y0SA 5F9AC 3PL6B 4WY7H 5CEZH 3QNFA 1BECA 1SLUA 3GZPA 4OKVA 2VB5A 2YMTA 3UZEC 4E5XG 1ZMYA 3JTBA 2AK4B 3FZUD 2XDHA 4ZMVA 3GRWL 3WIAA 2WZPA 2VZVA 4IRJB 2B8OT 2DWEB 2H26B 3AG2B 5GZNA 2E27L 4BV1A 1NWPA 2L7UA 3VGAC 2W59A 1QTYT 3L5XL 3LMJL 3ECVA 4X5QA 3QFDA 5ESAB 3CLWA 4TUUA 5EB9A 4FQHA 3F83A 1RFDL 1N2RA 1OT4A 1GSMA 3T4AC 3AACA 2OJEA 2I7OA 1L0PA 2DWDA 1PZ3A 5IBTH 2JKRM 3NJMA 3OMZA 2V5YA 3L3DA 3MTXA 1KNOA 3ULUL 3BKJH 2CDFB 2KPWA 1LK3H 2DPKA 1MF2L 3PWLB 2H1PL 3QUYB 4G6JH 1W0VB 3WUWG 4LSDA 3ULSB 1Q72H 1YEFL 4NQEE 3MODL 5HYEA 1RK0A 4HC1L 5D7LE 1QEWB 3VH8G 4CDGC 3QYCA 5LCVL 1JGEB 3ZR6A 3CSFA 1B4LA 1YRKA 5DO2D 1EHLH 5IJKC 2QSVA 4G8FA 2DQEL 1OWRM 2APTA 4BSJA 3S5LB 2IGFL 4G9DA 12E8L 4NN7C 5EF0A 1G0XA 3H55A 3SDXF 1R5WA 3SBPA 3E9UA 1I8LC 2OSWA 2WXPA 4Z0XA 1D5BA 1SMOA 3QGVA 4Y5XA 4BQ9A 4JPIA 3ZLQC 1ZVNA 5CXPA 3TWCH 1NMCB 2TSAA 5CEYA 3DVGB 3D3VD 1FFPB 2BNUA 3GBML 4MB4A 1RP9A 4MGXA 3GIZH 4HF5L 1BZQK 3AU1A 4PJAB 4GRLA 3RB5A 1Y0LB 3Q9QA 4P2AA 2NZIA 4L1HA 3HB3D 5G5DA 1TETH 3DYMA 4Z3IA 5I1DB 4LPXA 4ZUUB 4HU2A 3U9PL 4DP0X 4MS6A 1U8JA 1WYJA 4OZGA 3LQAH 4DKFL 1KPVB 1ADQA 2NQ3A 5D7EA 4RMQA 4BM7A 4G1EB 5TE7H 2NLJB 5AVRB 1QWHA 1WAPA 1QO3B 1TFPA 4BK4A 1WRFA 3VM5A 4ENED 2JXMA 2OFQA 5EUOF 4BCXA 2OMNA 2NSMA 2Q7YB 1AANA 4N2MA 1MXGA 1TQWA 4ABQA 5F7UA 1ECZA 2XKUA 3EOBA 1I9JL 2W9LA 5BQ7B 5EEYA 1S7TA 2B15A 2P47B 1R34A 4JLRA 4HIPA 1UZGA 2FTAA 3VRJB 1OV8A 3INUH 3VXSB 3ZDYF 5KZCD 1U3HD 2NXZC 4DIXA 3CDGA 3AS3A 2FJHB 3UXFA 2VAAA 1OAYH 2XWXA 4XPHL 5F7DB 2YHGA 3DECA 3ZUNC 5DFVC 3GRWA 1JYXA 3RNQB 3WTXA 2EYSA 1E67A 3Q1SH 4X6DE 3WCYA 4FHBD 1EFXB 3WLBA 4JCWA 2F2HA 5HPMB 3GPSA 1FHNA 4GLRI 4AK2A 1PZSA 1IU1A 1EBAA 2DQCL 3MNWA 3WO4C 3PWVB 1ZSDA 3V10A 3VGFA 2FQFA 3ZR5A 1GJUA 3CDFA 5H4ZA 4R2GD 5J6GA 4EPSA 2QKIB 4YC2C 2R9HD 1G4RA 1DBAH 4PGCA 2NX5B 4WUKL 1XF2A 1UZ8A 3ZTNL 1OCRB 4X8XA 2OZ4L 2Q1EA 3FFDB 1BIHA 5L9DL 5LVEA 3HN3A 4PBXA 5GRVK 4CJ0A 4HUNB 2H3XC 4OIBA 2EDQA 5C7XL 1AYRA 5LCVA 1AIFB 4AYDC 2FUTA 3GTTA 3QEQA 3MV9D 1ZVHA 3EOAA 3ZE1F 2X70A 4TPRL 1SXSA 2W9DL 4PIBA 1ETA1 1HC1A 1LTXA 1YNKH 1E4KC 4PRID 3Q01A 4X5WB 3UAEA 4V1DD 2XBTA 2IDCA 4KKRA 4LLDB 4O2EB 2XN9E 4QHUA 4ODXA 2KDGA 2Y3NA 25C8H 5AYQA 2ENYA 3BWUF 2YPVH 1PCSA 1G6RB 3K0YA 4XP1H 3OKKA 3WENA 1DN0B 2D7MA 2WXGA 5FOBB 1Q9WA 1FNGB 4EMZA 3TYFA 3P3UA 4FQ2L 4MCZB 1ML0A 3M8OL 2F54E 2ZYSA 1IAIL 1G7LB 3TVMC 4LDLB 1ZE3H 1AIZA 2VN5A 5JW3H 3D1MC 2CD0A 1Y1DA 4HK3N 1RH8A 3IFPA 5I6XB 4HJEA 5ID0A 2PYFA 3HA0A 3RFZA 3LSOA 4KKLD 3UZVA 4AC4A 1A3RL 4XP6L 2OULB 2UXTA 3BPNC 3QH3A 4YBLB 1QSFA 1AFVH 2XBDA 4LL1A 1AH1A 4XP4L 4PGBA 1F4WH 4NWUH 1EAPA 5ESVA 2F8VA 1ES0A 4HIIB 4JO3H 1PLGL 3X12B 5DT1L 4MRCA 3RNKB 2VH5L 3D18B 4BE6A 1JCKA 2WANA 3KBPA 4F15B 2BNQB 4U3SB 1AP2B 3D2TA 1UYWH 1UWGH 3ZYZA 1HHJB 2WLNA 7PAZA 3GLDA 3T6VA 1N0XL 4LHUB 3QQ3A 4X9YA 4YK4B 2XKNB 5DEGB 1BSIA 2V37A 4YNYB 4DGVH 7FABH 5D7KE 1XCQA 1YPZF 5E94A 5IBUB 4NJAH 1MFEL 1CBVH 1TTCA 1OAKH 2DQIL 3S4SB 3QE5A 1T0OA 3DRTA 3G6AA 4XPBL 1MIEH 1P4UA 1QFUL 3KPNB 3ZGIA 1GL4B 3AY4A 4JFOA 5DA4A 4Y4HC 2P5WD 3S96B 3IFNL 3SO3B 1U8MA 3V0HA 3CHPA 2Z93A 5EOTB 1QSVA 4ZOAA 4B5EA 5C86A 5I76A 2CE6A 3LXBA 5D5MF 5J6HB 3VXTB 3JWNC 5KYYA 1CL7L 2NT0A 2NY2B 2OR8A 2ZOKA 3SSGA 2YZ1A 4WY7L 5DMYA 4AJ0A 1GGIH 1ZLDA 3SEPA 5CEZL 2CWRA 2MQGA 2OZ4A 5I74C 4OLXH 1E9QA 3HG3A 4TSAH 2DB8A 1Q94B 2YSTA 4XT1C 1XQ4A 2Z8SA 4RGMB 1U8IB 4N2NA 2AABH 2J6EH 3S3CB 4LZKA 5FCUH 3OZ9H 2VN6A 3JT0A 4X9BA 3TZVD 3QISA 4JQVA 2QDVA 1TJXA 4XC1H 5EV7A 5I1GL 1RL1A 5EEWA 3O41B 4P2QB 2QADC 3KAAA 4NQVA 2ZSVA 3PP4L 1J10A 1Z5LB 2VSKB 3X11B 2VUOA 3DUUA 3HZ3A 2NUPA 2K45A 4ACPA 4QKXB 1DVSA 2D7NA 2B39A 4OCXL 2E46A 3FT4B 1BPLB 1CIUA 2EDMA 4L8SB 5TDNA 4HT1L 4G6JL 1EEZB 5IW1B 5JQHC 4JHVA 4P57B 4Z7VF 1DVFC 2HTKD 5E4AA 1DJXA 3BSGA 3RJDA 2GI0A 4QXTB 5ITBL 3ZT6A 4B7IA 1TSHA 2ZAHA 1QPPA 1P1VA 3UROR 2YQ2A 1EO7A 1TDQA 2BP5M 3V6OE 1I7RA 4F2ME 5F1OB 1J1PL 1MLBB 4OD2B 3C60B 2MNWA 4RCAA 3LD8B 5D93C 1L0QA 3LKNB 1YLBB 3Q2NA 3QG7L 4FGMA 3VD0A 1AOHA 3E8UL 4JFPB 4MXWH 5A6MA 4OBRA 3TWCL 2WYTA 2ZUXA 1D5RA 2DQFB 4XCEB 5GGVY 3UGEA 5JHMA 3BT2H 4LLQB 3CZLA 1QD0A 1XGTA 3HS8A 2VZSA 3ZYOA 1NCCH 1RVFH 4XZUA 5C0BA 5K69A 3CVDA 5D7SL 4P2QE 1UGKA 3RGVC 1QPKA 2OJ1A 3LQAL 3X1NA 3CXDH 2F5BL 4GQRA 5H4YA 1AQKH 4Z78A 1BLIA 1P4IH 4AIXA 5IQ9A 5F6IB 3MKKA 3WLWC 3MXWH 4NC1C 4DVBA 3LKOB 1JS4A 4P2OB 3P0YL 3MUY1 1OXYA 2APXA 1GPOH 3IDMA 5HYIA 3KYOB 3CDZB 5MEPB 3WSQL 1DQMH 2X1XR 1IC7L 3TBTA 5CU5A 3U0WH 3PAZA 3BMWA 5SWSB 4WHCA 2WZ6A 2IANA 1NFKA 3MUGA 4IK7A 4Z7WB 3FO9A 4XOEA 5EDSA 2AEWA 1FYTB 4PU2A 3WMPA 4CMHB 3KLSA 4G6ML 1XVSA 1XDTT 5C07B 3GUTB 5GISH 1OB1A 2F74B 1N7MH 5I5RA 3V7MA 3MJ7A 2XU9A 4N2AA 1VGKA 1LMKA 2ADGA 3ZXAC 4LLWB 3SY6A 1NBYA 3GXDA 1ZIBA 2EADA 2X44D 4YLCA 5L2KE 4QD2E 2H0EA 2R1WB 4TLUA 2X4TA 3DJTA 4MA7H 5PAZA 1Q9LB 4PRHA 4R7NA 3GD1C 5MERB 1IKOP 3T6QC 4N0CC 1KCBA 2B5IC 5E6IB 2VSMB 4PP2B 4Y2OA 2G30A 3ZYIA 4QRPE 3NQIA 2FBRA 3QEGH 4XHJD 4BFKA 2VO5A 1MY5A 1ZA3A 4DK3A 1DBAL 1GH7A 2RD0A 1DN2A 4R7XA 2YPLA 4LLMA 2COQA 5BUAA 4JB9L 3ZKSD 3MRHA 4AG4H 4HLZG 2VXSH 2DBLH 1F90H 4HSQA 5DHDA 3DX9B 5DFAA 1VFBB 4HGWB 3EDJA 3T2NH 1M6OA 1HJCA 3PL6A 4FG6D 3DO4A 3PRZA 1U8OB 4QHMB 2VZ1A 4AK1A 3T1FB 5B8CC 2BS71 2I25N 1P7QA 3ENEA 4OFQA 2AK4A 2AV7B 4BXVA 2JIXA 3L95A 4IGBD 2DWEA 2H26A 4JANB 4LSTH 1T3FB 1NGWB 2DM2A 4P3CH 3F58H 4OB5L 1NCBL 3WAKA 4WCYL 4OH2A 3IJ7A 5B1BB 3DK0A 1A4JA 1XR9B 4TSCH 2CIKA 4GSUA 5ESAA 4D0DB 2OK0H 3EH5B 1K3IA 4HK3J 3BP4B 2NPLX 3MGTB 4MAYC 4HG4J 2ADJB 1HEHC 3IKCB 4NRXB 5AZEH 1HHKB 2FZ3B 2OP4L 4L2YA 2YN5A 1PY9A 1WZ1L 2N0KA 1WISA 5GS2H 4HJJL 1S8DB 4IBQA 4CGUB 4PRPB 1NTDA 2ZYRA 3MREB 4NFCA 4NM8H 1UWEL 3FUIA 4JFXA 2HLFC 4N0UB 1JZHA 2E3VA 3PWLA 3QUYA 1W0VA 1O6SB 1FAIH 3ULSA 4I3RH 1A4CA 1BQHB 5KBLA 1VACA 4L4VD 1HL9A 1OWWA 1QEWA 4HV8B 2WXRA 5FPIA 4MVBC 4RH4A 1JGEA 3F7VB 3T0XA 2DI8A 3FU5A 3SPVB 4PJ8C 1VERA 3SBRA 3UO1L 1A7NH 5JPNB 2XZCL 3BN9D 3K6OA 1ZT1B 1J5CA 5I66A 4PJEF 4JO3L 3S5LA 2HT4C 3GXFA 1CC3A 4ZODA 4Y19B 4MX7A 2DRUA 3BGAA 4WHYG 5CKGA 1CJYA 1UYWL 1JK9B 2X12A 4AL8L 3CHXA 1WTLA 2HZHA 4TRPH 4PGJA 4JW3A 4MNGB 4Q6IC 1CR9H 5ECGA 2I07A 2Q6WA 1FFPA 2GEEA 4JG9A 1G6RL 1OTTC 1UJ3C 3ABZA 1IX2A 4PG2C 3FHEA 4PJAA 5JXAH 4N87A 1U42A 4U1NB 5I1DA 4ZUUA 3TFBA 2WV3A 1SLXA 5FDYA 2Z8RA 5IG7B 3VRIB 2WJ5A 4LMQI 3HIZA 1WWAX 2D3NA 4J3VA 1KPVA 3G5ZB 4G1EA 4YDIL 4L8BA 4PRPE 1QO3A 4IRJC 1C1EL 1XXFC 2CR0A 4N2DA 3SDYL 3WNNA 4B9GA 1NBVL 2K70A 4X8JB 1YMMB 4IOFD 5D6DA 3CNKA 2Q7YA 1I85A 1NIBA 1BVLB 3B2PA 3W9EB 1R4XA 5EMYA 2AKRB 4RGOH 4YBHA 5ETUB 5BQ7A 1UKTA 4PEEA 1IKFH 1HYSC 2VDQH 1WHOA 4R4FH 4JFDA 3KPSE 3VRJA 3OJDB 3VXSA 4H8WH 3MU3A 4DGWC 4NP4H 3QPQC 1QATA 4U6YB 2FJHA 1GAFL 3BP6B 2D7TL 5F7DA 3VI4E 1OTUC 1TUPA 2IMNA 1SGKA 2G3ZA 4XC1L 5E95B 5AWNH 4S1QH 3RNQA 3TFKC 1GYUA 2Z1PA 3UTOA 5EU3B 2XV2A 4PRAB 1KXVA 5AW5B 4M6ML 4RX4D 4H40A 1CLYH 3HC4H 2YPVA 3B5TA 1YC8A 2UXFA 1AZRA 3A5VA 3D9AH 3FT2B 3BZDA 2MQCA 5DZAA 5GJSH 3VI3B 2QKIA 1S9VB 2H47C 2G5RA 2ZOWA 4KUCD 2A5UA 2NX5A 1GYCA 4ZFFB 2AJYL 4GBXB 4Y8DC 3KYNB 2GJ6B 4P46A 2ADFL 3IETB 2C3GA 4JDEB 3WS6A 4KQ4H 3EJRA 4IBZA 4ZAKB 3D85B 3HAEB 4XBPA 4XNAA 1MFAL 2EC9T 4PJBB 1AIFA 3FRUB 4K9EC 4L2LA 1KCVH 3V5HB 4YQXL 3NCFB 2HMIC 3D12B 5ABDE 2NW3B 4WW2F 4X5WA 3VYNA 1FBIL 2UX6A 2BO0A 2G3XA 3GKWH 4LLDA 5F97E 4O2EA 4KHTH 5D72H 3RWDB 5EBWA 1L0XA 1LP9B 5DUML 5FM8A 2C9XA 2YN3A 3MA9H 3TBWB 5KS9A 5DTFA 1ZVSB 1AQKL 4RQQB 1DN0A 1FNFA 5IEKB 1FNGA 3VU2A 1GKEA 1A1OB 4MCZA 5C0AD 4IKKA 1G7LA 3HZKB 3GLEA 3EOTL 3VI3E 4Y2DC 1RHFA 4PRNB 1DQML 2BH0A 3SY0B 3KPQB 4PB0L 3AM8A 2ICES 2NR6D 3GBEA 2BLFA 2ZF9A 3G6JB 4HAKA 5HHMB 3ZHNA 3FRPG 4OSUL 4R3SB 1MCFA 3HAEH 5KUKA 4I3GA 4XWGH 1UOWA 3P11H 3Q6FA 1HCYA 1NC4D 1BVNP 2PPFA 3QUGA 1M2OA 4QTFA 4U1LB 4W9FC 3D3VE 5I8OH 4HIIA 3X12A 3RNKA 3D18A 2MOGA 3SYQA 3WKQA 1DUZB 4FMFA 2BNQA 3QIWC 4NXSA 5JDJA 1KN4L 4U3SA 1AP2A 1HSBA 4M7KL 5DHVH 1U3YA 2WUCL 4UV4H 1GS7A 5E2TL 5BW7C 3LZNA 3QXDB 1HHJA 2XPYA 3FYIB 4OGXH 2J6EA 4M62H 4GMSL 4LHUA 1FV1B 3TJEL 2CO6B 1IKNA 2XKNA 4YNYA 4FLOA 4Y5VB 5T1LB 3FO2A 5L4IA 2F58H 1MFBL 4EJ1C 3S4SA 4U3CA 3OKDB 3FXIC 2IPUG 3KWVA 3CVIL 4U1HB 3KPNA 4QWWC 1KF9B 1RZJH 4ODUB 4N8VG 2H9GB 5DJDB 3K0WA 4Z7NF 1S7WB 1E8YA 3S96A 3OLDA 3WTUA 5EOTA 4WGKA 5KVMC 5EZOH 4AG4L 2F5AH 4XVUC 5J6HA 3S3DB 2JKTM 4HD9A 2ROYA 1SFHA 3FUJA 3N43B 4OT1L 5I6NA 1D7DA 1T4KA 1ODAA 1XWVA 5HJ3A 5GXBB 1G9MC 2WLJA 4TF4A 4NN5B 1HAUA 4MMXB 1G43A 3UDWA 1LEIB 4IBTA 4ZTOH 5MEOB 4UF7C 3QI9B 4OZHB 4WIQA 4ELKB 2ZUTA 5FHBL 4APQA 5D2LF 1L9SA 4ZQKB 4P3CL 1U8IA 1W80A 5AAWC 2DLFH 2WBJD 4TSCL 3BQUA 1BA9A 4DHLA 4ATTA 3HNSL 2AANA 1B0GB 2DQGH 4UTBL 5GS0D 2H4EA 5EIIB 2E75C 4NAQA 5CFHA 1G84A 4HAGA 3HHSB 1Z5LA 2KI6A 1N64H 4GSRA 1LO4L 3X11A 2ITCB 4LHQB 4GG6B 2PCPB 4Y4FC 3FFCD 1RP8A 2WKOA 4JFTA 3U83A 3GZOA 3WXVH 1PFCA 3B9KB 1PDKA 1LE5B 3FT4A 3NIDF 4L8SA 2QGCA 3VJ6B 3KEHA 1EEZA 3HG1A 4KO9A 1FAIL 4I3RL 3F5WB 5IW1A 1FFNB 4P57A 4G7QB 2W38A 2OCFD 2VMCA 3TA3D 1QFOA 3K8LA 2V7HB 4TULL 5DD1L 2VR8A 4QXTA 2OCCB 3Q7JA 1LE9B 4YK4C 4BYHA 1TZ8A 1P69B 4PRIE 5L8LB 2X0UA 3LB6C 3O0LA 4EO5A 4V1DE 4OD2A 1MLBA 3ALWA 2UY7B 2JQZA 3C60A 4HKJA 5DD6A 3LPWA 3LKNA 3LOWA 4J3SA 5DC2A 3HNVL 3EFFA 1EEUA 4JFPA 1D5ZB 1A47A 1J0JA 2DQFA 4XCEA 1LO0L 4ODSL 1IBBA 5ENWA 5DGQA 4KY1H 5JUEL 2D0HA 3HUJE 2R8SL 4BFRA 3AREA 4LLQA 3ESVF 5JZ7D 5JXAL 3I6KB 1RAMA 4RRPM 1OAUH 3SGJC 3FQYA 3HZYB 4BRJA 1EEYA 4XB7A 4YHMH 1L5GB 2X4UB 1JZ5A 4YO0B 5J57B 4HOZA 4YFEA 3OAYH 3BO8B 3V6OC 3LIUA 1L6PA 4QOKB 1MNNA 2YJLA 1XL6A 4BJLA 5JW4M 4XBEL 4QYAA 1AZVA 1RI8A 1WC7B 2QPSA 1SHWA 2HCZX 3LKOA 3ZZQA 1CXFA 2AXHA 4GRMA 4UM8B 4P2OA 2BIQA 4J3XA 2AFNA 1KB9K 1AGFB 3Q8AA 1R0AL 3KYOA 3QRGH 3CDZA 5MEPA 2B1OA 1CICD 4RGOL 1WCBB 2GSMB 2X53A 3TNNB 4FFVC 4R4FL 5SWSA 2UWEE 1MFDH 4Z7WA 1F11A 4LDOB 5IUSA 3D52A 1FYTA 1HVXA 2RH0A 1AQDB 1NGPL 1LK2B 4XP5L 5C07A 3GUTA 3ZDZF 2PLTA 2F74A 2XCMC 5DQJB 3CXHK 2HT3C 4AJWA 4S1QL 4KU1A 4LLWA 5EOCH 5FS5A 1T0MA 2CK0H 2NDGA 5ELIA 4KQ0A 1PGRB 2C4FU 3CC5B 4KK9D 2P5WE 1TQVA 5IVXF 2C26A 1Q9LA 4K7FB 5EBMB 3TS8A 3T8VA 2NY1C 4LLVB 5C0IB 5MERA 3IS1X 4UTBA 5ANMB 5E6IA 1NIDA 2VZ3A 2MHAB 3UTSB 4PP2A 4BZ2H 4YGVA 4GRWE 1HI6A 3HS0C 1KTRL 4S1RL 4W9JC 2ADIB 2OXGB 2JKJA 2LGNA 3Q8CA 4N2FA 4K7PH 3IMSA 3GDCA 2XFXB 4Q8BA 3U36B 3RZCB 1JV5A 3KCPB 1A66A 4KQ4L 4MXQC 1RK1B 2CO1A 2X3AA 4LSPL 5F9WC 5HDOA 1F0LA 1DEEB 1VFBA 4HGWA 1FZJB 2WLYA 4OJDH 4ZOBA 4LKCB 1U8OA 4OW6A 4QHMA 5I1JH 1U6AL 5LWYH 3G5VB 2EILB 3JT2A 3T1FA 2AV7A 3N2JA 4JFFD 1IC4H 1F3JB 3ZBMA 4JANA 4MBOA 4JHBA 1T3FA 3CZNA 3LNGA 2CO4A 5EEXA 1YYCA 1QG3A 4GKZA 1CIDA 3UYOD 1TQTA 1XR9A 2GTZB 2XXMB 4D0DA 4F8LA 1JGVH 3WEXB 5KVGE 1Z9PA 3BP4A 2ZUQC 3MGTA 3WFZA 4PJDF 15C8H 2ADJA 2FSDA 4LESA 5K39B 3IKCA 3T3MF 4NRXA 1HHKA 2A9CA 2FZ3A 5A3IC 1KB5H 2V9RA 4AIZA 4DP4X 5DJZB 1JL8A 3L4TA 2MPVA 1E65A 2H1XA 1S8DA 1DBBH 1SJVA 5DWUH 3MREA 3P9MB 2DMGA 4N0UA 4HFUL 3RZWA 2P5ED 2JSFA 3B34A 3MXVH 2Y36H 3L4YA 5GHWH 1O6SA 3UTTD 3EJQA 1AD0A 3G04B 2ARJB 4HV8A 3AU0A 3D69B 5ABZA 2ZE0A 3F7VA 3NJVA 3SPVA 1RURH 4MMZB 5JPNA 5AAPA 1LO2H 1RXLA 2BJMH 4Z7UA 4BEIA 3MCLH 4ZNEE 1EX0A 4WF7A 1ZT1A 3K2MC 1TJIL 2ZG3A 3NCXA 4GAJH 4Y19A 3DMMD 4JMNA 4TVUA 2NY4C 4TL4A 4I87A 4HOXA 5DMJB 3BW9B 1R19A 1A7PH 1JK9A 4PM1A 5EC1B 1KWKA 3GUFA 2NRDA 4MNGA 1P5UC 4YSRA 5GGRA 2E7BA 4CUCA 5KVFL 1CMOA 4ETQB 1ND0B 4KKNA 5FYKU 1UENA 2IBZY 5J3HC 1I8IB 1PKQE 2Z65C 5B21A 3N50A 1WT5C 1ROWA 2VE6B 4U1NA 1EHKB 1HILB 2AQSA 4NNXB 1E30A 4Y16B 1NIFA 5DJ2B 1RZJL 2OLDA 2X2IA 1NL0L 3MLVH 5IG7A 1YN7B 3FQ2A 3VRIA 2P24B 3WGVB 4KROD 1RCYA 4FXGC 1CGSL 4K55A 4K23L 5I0VA 4X8JA 1YMMA 3K8MA 1BVLA 2CBTA 3ILPB 5T3ZH 3W9EA 3H8NA 3N42F 2AKRA 5ETUA 3SCMB 4UQ9A 3K4ZA 3WG7B 2JKWA 2VDMB 1ROCA 1UEMA 4L4TB 3DJSA 3MFFB 2BWIA 1BQLH 3OJDA 4X4ME 4DP1X 4UDTB 4N2CA 5FYLE 2BERA 4RDQG 2DLFL 3D39D 5E2JA 4UTCA 2G0KA 4QNPE 4HCGA 3CFBB 4P4RB 1ZHKA 1BQKA 1ET7A 2YMXL 2KS0A 2VW4A 4D9RD 2WBKA 1CDGA 1SXBA 5EU3A 3EO9L 1N64L 4PRAA 1T0PB 5HD8C 4YDKL 4S1DC 3FT9A 3OKOA 3WXVL 2Q20A 4XCNB 5FYJU 3RBSA 3TV3H 4OLZH 2YD5A 4RAHA 1WITA 3JWNH 3FT2A 2YGNA 3RRQA 3VMNA 4JVPA 1GW0A 2JCCB 3MRLB 4AENB 5A2KH 3UTZB 1S9VA 4AV5A 1IRAY 3TONA 3ARGC 3SE4A 2FQEA 2X89D 2Y7OA 3LEXB 3BE1L 4EDXA 1J87A 2ED8A 2DI7A 4GBXA 1J9SA 2GJ6A 2MKLC 3KYNA 4YX2H 3DX1A 1Q1JL 2X2JA 4JDEA 3WIHH 3WIIH 4X9GA 3FBKA 4ZAKA 3D85A 3HE6C 3CFMA 3HAEA 2K4WA 4PJBA 1UCBL 2C3VB 3FRUA 4IJ3B 1XSJA 4HEMA 5KANG 1KJMB 2YGOA 2KZ1B 4KY1L 4M4PA 4NYLB 2NW3A 4X6CB 2N0MA 1NC2D 4HJUA 4AJVA 4MLSA 1FH2A 4B95C 3RWDA 4X7FC 3UC0H 1JI2A 4AM0A 4YHML 1LP9A 3FZUC 1AVAA 1DSFH 4X7DC 4KO6A 3PAUA 1JRHI 5HDBE 3TBWA 2P28B 2AQ2A 1H3UA 1MNUL 4XNZC 3NJJA 4F93B 4JQIH 5G55A 1DLFH 3HE7A 4RQQA 3RX8A 4KNQA 4L4VE 2LU3A 4AMXA 5IEKA 3OB0K 1V7MH 2WNXA 1A1OA 4NHUB 5KYWA 2BINA 1M56B 4X4YB 8CGTA 3TEXA 4UOW1 5AOZA 3QRGL 3AQYA 3C6EA 2JE8A 2OKMA 4PRNA 4WI5A 5DZPA 3SY0A 3VD7A 3KPQA 4Q0XL 4H0LC 3NDZE 3G6JA 4HQQL 2ZAGA 3FT3B 5J06A 4BGLA 5DMIH 5AFAA 5H2BB 4FMKA 1KXTB 2ZUSA 3ZL1A 3FOMB 4FABH 5FYJD 5GS1A 1H9VA 4FRWA 3GMNB 4RVBA 1MEXL 3SDXE 1N6QH 3EJJX 1A8ZA 1BX2A 1FE8L 1QZ1A 1DUZA 2DLGA 1JHKH 5TQ0H 1L6XA 5DO2C 3RY6C 4J3OC 5LXGL 3EYVB 4M4RB 5EOCL 3QXDA 2HKHL 2OSYA 5EZJB 2O6CA 4XPFH 4E41D 1FV1A 2EKJA 2CO6A 4ZUWA 1X6LA 2FH6A 4JY6B 2M2DA 2HH0H 2DQDH 1QOKA 1Z3RA 2QZ5A 3H42L 4LQFH 4RGNB 4Y5VA 5DRNB 5T1LA 1BXAA 35C8H 2JB5L 3T0WA 3ZZSA 4BZ2L 3MRGB 1RU9H 3OKDA 5DRZB 4CN4A 2BSEA 4U1HA 3LXUX 1TO5A 3IDGB 4ODUA 5CILL 2H9GA 2WJ7A 3QJHB 5LN8A 3HW7A 3H2WA 2O5NA 1S7WA 2X6AA 3HB3C 4HIEB 2IDFA 1NAKH 4RZKA 2H2SD 1ZANL 5EUOE 4E9VA 4KK6D 2BXYA 4WFFD 3TO4D 4E36A 1G7IB 1UWFA 4F7TB 5BS0D 3ILDA 3WTSA 2DTMH 2UZIL 3U7YH 3N1MC 5FO7B 4F57L 3F65A 1UCTA 4WEBL 4AQZA 4ENEC 4MMXA 2YK1H 1LEIA 5MEOA 3U6XA 3QI9A 4OZHA 2W0KA 4OCRH 2NW2B 2YIHA 3ECBB 5B39B 4ZQKA 4PLKD 5DLMH 1KYOJ 2HX8A 3OAZK 4M5TA 4A68A 3DIVA 1YAIA 5K59F 2CPUA 2P7TB 2Y06L 2CUIA 3UAJD 1B0GA 1BGXH 1TT6A 1U3HC 4ZO7A 3FSWA 5D8JL 5GGQL 4F1ZA 4YSCA 5EIIA 1NMBL 1OHQA 2YD8A 4D8OA 1CS6A 3QWOB 3HHSA 3W0WD 4K5MA 4GG6A 2ITCA 2PCPA 4OVVA 3NT0A 4YHLH 4TVPH 1YECH 3IJEB 3NN8B 1SOQA 2OSXA 3VJ6A 4O00A 2IG2H 5GSRB 3SE3C 1XXDC 2J7LA 3F5WA 3O6KL 1FFNA 3ZO9A 2LOEA 1FSKB 4FXKB 4GKNB 2HFTA 1U92B 2V7HA 2EVHA 2RMNA 1DBMH 1RURL 4FQLH 4D9QE 2G5BA 1ACYL 2BJML 4R2GC 3MCLL 1LE9A 5EF1A 1C8PA 4GAJL 4QEGA 2R9HC 4W9EC 4X4XA 4IKLA 3VWKD 2UY7A 1OT1A 5KVEE 2OW6A 5D4IA 1EJ8A 2YXMA 5F96H 4C4KT 2K6WA 3ZE1E 4X9IA 2Y5TB 2XN1A 3PP3H 1HINH 3MOAL 4YHKH 4F8QA 4JJ5B 1TKWA 3A6BH 5C0GB 1ZTXE 2RQEA 3U7WH 3I6KA 5B1JC 5J12C 3HZYA 3RKDD 4I0KA 4YFLF 3P0VL 1L5GA 2X4UA 5C0AE 2WBXA 4YO0A 2PR9A 4LPVA 3BO8A 3WN5B 3PF2A 4QOKA 1DBKL 3G5XB 4FDWA 4PVNA 4P4KD 3NG5A 1F1AA 2DMBA 2EKSB 5IKCB 3MLUH 1X6NA 1WC7A 3WKPA 1PD0A 3PDDA 4IJTA 3VM7A 4QJ5B 4BZ2A 5L7XH 4UM8A 1QRKA 5HGBA 3DUSB 1S7VB 3SQBB 1GYAA 2IPUK 1T21B 3RWJB 1HU8A 4ZX6A 2QGBA 3II2A 1WCBA 3X3FH 4BFGA 4EIUA 2G4EA 5BZZA 5FYLL 3TNNA 3RU8L 4NQDD 1CVRA 2NY5H 5F2FA 1NPNA 3L9YA 4X50A 1IVLA 3I9GH 3S5LG 4B9JA 4QHKJ 1VCAA 3BH8A 1U8NB 1AC0A 3BCDA 4KKLC 4JPVH 4KQ3L 3B9KC 1JPST 2XWTB 4MB5A 3ZTCC 2VL5B 4R96B 2ZONA 1CLZL 2DEYX 2VQUA 3FB5B 4KJQD 3NH7L 3B6SB 4Z3EA 1OGTB 3P54A 3LH8A 2C1OB 4P0DA 3VTTA 2EEFA 4BQ6A 1Q0XL 3O8XD 3CC5A 3PUUA 1KCLA 3T3PB 5EBMA 3FQ4A 4OLZL 1AGCA 2OMXB 4LLVA 4Z7OB 5FHAH 3SDAB 4TQPA 3MCKB 4IMKA 5B4MD 4ZJ9A 2DQHH 2MHAA 4X5RA 3UTSA 4G7SB 1P9MA 2XVBA 3F7LA 1KB5A 2ADIA 2OXGA 3DXAB 3FKUS 2EE0A 4KTDL 2W07B 1SOKA 5D5ME 4IDJH 3SKNB 3U36A 1RZ7L 3RZCA 2VDML 4LOEA 1XGRA 3KCPA 5C0FB 1RK1A 2FBJH 4GH7B 3EUUA 2Y1VA 3S35X 2F8XC 1NEPA 4L8CB 3AB0C 1DEEA 4DKTA 3FHQA 3H9SD 5AYUL 4F58H 3G5VA 4IRSB 4IM8A 4N6RB 2JLLA 4BWTA 4BKTC 1F3JA 3FU8A 3OMAB 5HDLA 2FEDD 4WUUD 4F9PA 5C9KA 1UUNA 4OLYH 3NUKA 3QHZL 3FFCE 1FUNA 1B3IA 1E9OB 2JK5B 5GIRB 1O7DC 1VGEL 2GTZA 2R0ZH 4AYID 3DX7B 4Z9KB 3A47A 2HFFB 4R83A 1G1OA 2MH4A 4I7ZC 1SQMA 1RK7A 1P53A 3TZVC 5DJZA 4LP8A 4KHXH 5DZNA 3DGGB 5HVFB 2L4OA 2R4RL 5CD3B 3UYRL 3P9MA 2DL2A 4Z7VE 1I9RH 3VA6A 4K3JL 3AS2A 2LU5A 5DUPH 5EU6B 3G04A 2ARJA 1MQKL 2BOBB 4K9EH 3V52H 3D69A 4G8GB 2Z91B 4AEHH 4PUBH 5C0CB 3TGXA 4N0YH 4MMZA 5CAYB 5A2CA 4YEEA 2V2TB 3A4EA 2HTKC 4D3CH 4GO6B 3VXPB 3BSZH 4HAFA 3WJJA 4YLQT 5HJDA 4L8DB 3THML 1EIBA 1SXNA 3VSUA 4OZIF 3BW9A 5EC1A 4KMQA 2W0FB 3L4CA 1J86A 1JPGB 3U4BH 2F7RA 3MLSH 4G1MB 1ND0A 1MZYA 3A21A 1CLVA 3MV7D 3VXUD 4ETQA 1U8PB 3RWCB 2WLMA 1I8IA 1JWMB 4LQFL 2NY6B 2FNWA 2A1WH 1ZGLP 3MJ8B 2VE6A 35C8L 3DI2B 1X5MA 4NNXA 4Y16A 1A14H 1NEUA 3KWTA 3H0TB 3QXAB 1UXLA 1T7XA 3ZE2B 1MAJA 3QULB 1YN7A 2A38A 1F00I 5HHPB 1XGZA 2IEPA 2EO9A 1IQWL 1FL6B 2XQ0A 4I0PB 2OAAA 4ESKA 4L1DA 5IB1B 2QJDA 3B2DC 1XEDA 4NCC2 4NOFA 2GSIB 5EU6E 1ULVA 1M1XB 3DJZA 1JVOA 3ILPA 4WVRA 3D0LB 1FCGA 3SCMA 4BQCA 3SGEH 3DBXB 1OE2A 3G08A 2EDTA 4DO5A 2A4CA 2YK1L 4PJXE 4R7DB 3WIHA 3B7UX 3IN0A 4L4TA 3MFFA 1MRFL 4YHPA 4HP5A 2EXTA 4UDTA 4FQQB 2R83A 5I1HH 1UADC 3PGCB 4PSPA 3TIDB 4PYGA 1S7UB 1RMFH 4ZMQA 1HL5A 3QUZD 3CFBA 4A6YB 4P4RA 4WFHD 1JPSH 1OQOA 2WNKA 2RHEA 4LHUG 1T1XB 3O11B 3FTVA 4UDUA 3TCTA 5AW8B 1NCDH 1W16A 3MO1B 4WSJA 1AO7D 3LQZB 4OCSH 5IBUG 1KIRB 1PMYA 3WNJA 5F3BB 3S4SG 3U30B 4YDLB 1GCYA 5AVVB 1CXIA 5JYLA 1ADWA 5DD5L 4JQIA 5F7KC 4PJCB 1VHPA 4MJIB 3QIBB 4OM1H 3SYPA 2JCCA 1OCWL 3MRLA 4NKIL 4PD4K 1S78D 3UTZA 4HU8A 1AAJA 2UUDH 2YXFA 1KJ2H 1BM7A 1DDHB 4XWOD 1DBML 1G9MH 3LEXA 2GAZB 1FPTL 5KVEL 4I9XA 5ANHA 4ZUVA 4O2FB 2QPEB 4JFFE 1U0QA 2VW6A 1ZHLB 4JPWH 4XHJC 4M7ZC 2P80A 4IOSA 3ORJA 2ZG2A 3QORB 4NUGL 2C9UA 2MQ3A 2CMRL 4WW1B 2C3VA 4YAQA 1E5YA 1TPXC 5EN3A 2VISB 4NZUH 3M6DA 1KJMA 3N04A 3MQIA 4YHKL 3KXFB 1B0RB 4PWEA 1TZHB 4NYLA 3RA7H 2VQ4A 4UBDD 4BINA 4X6CA 5FGBA 3U7WL 3GFUA 4FG6C 3HN5A 2WO3B 3PLYA 5T3XL 1GZQB 2CDEB 4LLAA 1JIBA 2EDWA 4IGBC 2V5MA 4YVNA 1UACH 4W6XB 5LO7A 2P5EE 3ELQA 1IT9H 1VPOL 2ZJSH 1NMAH 4KRLB 2HJFB 1XH3B 1IGYB 3V8OA 3ZKXB 4K2UH 4DGIL 5LGKA 1BD2B 4YEFA 3MLUL 3AABA 1AKJB 4I77L 4RSVA 2DYPD 2FJUB 1XF3B 4UOJA 1II4E 5SWQB 5L7XL 4NHUA 4AX3A 4MJIE 4JFQB 4X4YA 3SDDD 4BH8B 1CFVL 4JHUA 2GKIA 3VQMA 2Z8VC 4G6FD 2BS9A 2WWMC 1RSFA 2YUWA 1YVLA 3FT3A 4PJIB 5ESQB 1KXTA 2V5TA 3FOMA 3TBCA 5F0PB 3GMNA 3BPLC 4PJFF 4N90D 43CAB 4R26H 4U0RB 4PVMA 4PAZA 3TX4A 3CX5K 4QRQB 1QI4A 2OYLA 1E4JA 2TAAA 1CTOA 4AYGA 1P7BA 5SWZB 5FCSH 3SOBL 2EACA 4CW1B 2WLKA 3EYVA 4M4RA 5EZJA 4MKTA 3RAJH 4QIRA 2CNZA 3LTVA 2EE9A 4X5LA 5J1AA 3I6GB 4JY6A 1XAUA 4W4NA 4MQXD 4XNMB 4P5TD 5DRNA 5CBAB 4Z3JA 2R2HA 1CB4A 4XRCB 5KTEL 2WNWA 3MRGA 5DRZA 4B3EA 3NJIA 4L1BA 2MWCA 2O93L 3IDGA 4G8EA 3RWFB 2AI0L 3RDTB 3L7FB 3QJHA 2XFGB 5FUOH 1MDAA 5D1ZB 4TQHA 2UZYB 1BCIA 1XR8B 2D8KA 4CKVX 3WY3A 5ABAA 5IQOA 4PTUB 5BRQA 5FR3A 5J13C 4O4YH 1FLRL 1G7IA 5F7FA 4GO8A 4F7TA 5IR1B 3BZEB 1I1AD 5ADOH 3ARBB 2XG4B 4XPTH 5FO7A 3D39E 1C12B 2FWUA 3BAIA 3KR3H 1F86A 4HSAC 3LPFA 3V0FA 5B8CA 1KENH 4PWIA 5JO5B 2GUOB 1D9KD 2BY0A 1YEIH 4OF8A 1OALA 4EN3D 4PJ5B 5CZVL 2BRRL 2NW2A 3A23A 4OLYL 3TH3T 4LP4A 5B39A 4Y1AB 2XTLA 3CSPA 4P2RD 2H32B 3D08A 1X4YA 4ABUA 4JNXA 3HRZB 1AHMA 2AZAA 1BVOA 2YXVA 3VWJB 2DKUA 5DURB 3D0VB 1EPFA 5IBLD 1L6ZA 1HS6A 4WO4B 5E9AA 4MHHG 2WUBL 1FNAA 2KHAA 3ECUA 3QS2A 1BBJB 3TP4A 4M6NH 2J8UB 1D7BA 3QWOA 4HJIA 4JAMB 1E9PB 2Y7SA 3W81A 4NIKB 3WY4A 3FSVA 4GXUM 4KHXL 2H6OA 3G6DL 3CK0H 1T5XB 5E1AB 3WFCH 4XPAL 5G2NA 3WNPA 3IJEA 3ARQA 3NN8A 3PCYA 5IT2L 3LH9A 2Q3AA 5GSRA 1DQQB 4FXKA 4GKNA 1U92A 2X10A 3O3BB 3IB4A 2IVFC 4FKKA 3ABKB 2HT2D 1YMHB 2ETWA 4JPKL 5F1NB 4D3CL 1FVEA 1V3MA 1DYZA 1G1KA 1WFTA 2XKSA 4E41B 1VZHA 2OX5B 2PW2B 2VDKB 2FE0A 1EMTL 2H32H 2OJZH 1E4XI 1N5AB 2WB7A 1KDJA 2VQ1B 2Y5TA 3OLIA 1EUTA 1BAGA 4E42B 1J7VR 4EF3A 4JJ5A 4ODVL 4RA3A 1OSEA 1OLLA 1MWOA 3ZQWA 1NINA 5C0GA 1O0VA 1IZKA 2EXYC 2WM0A 4J4PC 2CLVB 1KTJA 2Q5BA 1UC6A 1TCRB 5F1KC 1A14L 3N41B 3V8CA 3WN5A 3AADB 2EECA 3KGSA 3S37L 1E5UI 3G5XA 3VYOA 4G83A 1PZCA 4HH9B 5PCYA 3L2LA 4A7GF 3T2PA 1SOSA 4L4JA 2EKSA 5IKCA 4ZFZA 3KHQA 1BFVH 4JMXA 1KACB 4WV1B 1KGXA 5FYJE 3EJZD 4B9CA 1BQ5A 2A6KB 2KBGA 3D2UD 2WXJA 5CIPB 3EHBD 5DEFB 3H2PA 3DUSA 1S7VA 3NZ8B 3SQBA 1BQSA 4LSQL 1QVOB 1T21A 3RWJA 5I6KA 2VRAA 4PJGB 5DHYB 3M1BA 4QRSB 2VDRH 3CFNA 3N9GH 1OKEA 3BWUC 2P46B 2GBAA 3BPOB 4H7VA 5IMOB 4N8CH 1JPTH 1BIIB 3DJRA 5HHQA 3ROOB 2H1LM 4F27A 2BWQA 2ED7A 4JUTA 1CPUA 5CJBA 3SDCD 3V0IA 2NR6C 4E41E 2ORBL 2CUMA 1U8NA 4LCCB 2D0GA 2XBZA 1XIWB 2UVFA 3K46A 1MCCA 3EYSL 3B7SA 1KY7A 2CALA 2DL9A 3M88A 4XNYL 2XWTA 2R4SH 2VL5A 1JYWA 1T03H 5IB5B 1TTRA 3FB5A 4TTDD 3US0A 1IL1B 3B6SA 3GMQB 1OGTA 4JFVA 3ZRCC 3FN3A 2A6DB 1ED3B 4OLWL 2C1OA 1F58L 1E5CA 2O5XL 4QTIH 2UYLB 3KVDD 4FFZL 3ATDA 4EOWH 5DK0B 1UVQA 2OMXA 4WFFE 4PS4L 3SDAA 1MJ7H 3ARFB 3MCKA 2DICA 2WQRA 2I5YL 4JM4L 4D0BB 5K9QG 2VLRA 2WCSA 3IPFA 4Z7NE 4HWEL 4MLIA 2VXUL 4JFZH 3CDYA 3DXAA 4MA8L 5SX5H 3UPRB 2YFNA 4H25B 2W07A 1KCWA 3ZZLA 3SKNA 5AZUA 3KS0J 1HESA 1BZ9B 5C0FA 5E0FA 1EO8H 4PJGE 2HRGA 5TDPB 4L8CA 5I9QC 3BDYL 2Y1ZA 1LILA 2VDNB 2IAMB 4PI2A 1MCLA 4YUEH 3BVVA 1J8RA 3UAAA 4F5CE 4Z7AA 4LSRL 4FZ8H 2YD3A 4OKDA 4A6YL 4N6RA 4FZEH 4PMFA 3RA7L 2XWDA 4FHJA 5D2LE 1DVQA 1UXWA 4DKDC 3QG6A 1Q0YH 3FS9A 3W0WE 2ICWJ 4FTVD 3T0AA 3KBEA 5DMGD 2YA2A 1NANI 1H3PH 1YY9D 3BUBA 3DHMA 1E9OA 1XGPA 1HZHL 4URTB 4WI3A 5C2BH 2OXHB 4O58H 3VFGH 4JFYB 1OM9A 3DX7A 2PR4H 1IT9L 3QFJB 1OP3H 1ASOA 1MZZA 4XNUH 2PWFA 3WEBA 4OCWH 2L3BA 4PW4A 5GS0C 4HUXB 1KLFB 4H4NA 4O5LH 3VXRD 4FI6A 5KSAD 2WC7A 3NACL 5D70H 1VIWA 5CD3A 1ZCRA 3QHTC 1CFQB 5E8EA 3GBNL 4G7VL 5A43C 2WWOA 4XNBA 3V0JA 3C08H 1W2KT 3MRDB 4L37B 3EKCA 1CFNA 1RKRA 4NGHH 4OR1A 5J89A 4G8GA 2Z91A 1X9UA 5DZLA 5C0CA 3WEMA 2WSKA 3CWGA 4JGJA 5A2LH 2N7SA 2G9HB 4KRPB 1BBDH 4HZAA 5KAQG 3HAEG 3PQYB 2AAAA 3TL5A 2J44A 5DCCA 2V2TA 3DIDA 1IEBB 3TA3C 3VXPA 4KUZH 4G71B 2HRHA 1TZIB 4L8DA 3BVTA 4ZPVA 5BW7A 3QEUB 1CXEA 3O0RH 1Z9OA 4IKJA 2NNXA 2PWDA 3KPRB 1JPGA 1I1RA 1PZAA 3EFDL 4P9HC 2VIRA 1SBSL 4G1MA 1CTMA 2IF7A 3VNYA 1U8PA 3FU9A 4GP5B 3RWCA 4K5NA 3WKMH 4F8NA 3BDXA 1X5KA 3F01A 2P9RA 3CVCA 3FCBA 3QAZC 3VXMB 2VKWA 5ILTL 4WAFA 2DQUH 3N85H 3ZGHA 4MYPA 1TOXA 1P1ZB 4R0LC 3H0TA 3QXAA 1KC5L 4I85A 5JZ7C 3GSQB 2BY1A 1U58B 3QULA 3MJGX 4RIRB 4ZFGH 5HHPA 4EI5B 4LEXH 2QV2A 3T0EB 4IRSC 4BZ1H 4TOYL 3E38A 4NQDE 3NIFF 1U8KB 3OXRB 3GSOB 3ABGA 2OTUB 5D1QD 4I0PA 3S6CA 3K72B 3OF6A 4PRBB 3MLYH 2A9BA 5BZWB 5IB1A 5D7IE 4OM0H 1IM9D 3PJSB 4JUSA 1OAXH 2GSIA 4LHJB 4X6BB 2GW5A 4PCYA 1M1XA 1KJ2A 2ZZUT 1QFPA 3GO1L 1I8KB 2VLKB 1FIEA 5IHLB 4LCUA 2W81C 3ULUF 3P3YA 4MNHB 3U79A 4R7DA 4LIQH 5CNHA 3RKPA 5E6SB 2XPGB 3EF4A 5GRWA 9PCYA 3QB7C 1EZVX 4Z0BH 3GLAA 1CICC 5IESL 5DZOA 3ZDZE 4FQQA 4L9LB 1Z66A 1NFDB 3PGCA 1TTFA 2Y2YA 3TIDA 4URKA 1RIHH 3OJVC 1D5IL 3R19A 4IOIB 1OCOB 4WI9A 5DEZA 4A6YA 3HS9A 1ZDSA 1H6EA 1VSCA 5DDHB 2R56H 3U0PB 1NGQL 1T1XA 2WK2A 5AKVA 3O11A 5AALA 1FGNL 3GXNA 3MO1A 5TF0A 4W1TA 3VXME 2ZOUA 3H1ZA 3LQZA 3Q2VA 1KIRA 4TUOB 2VERA 4PY7B 5F3BA 1E0OB 1U93B 2QQKL 1SJHB 5IB2B 2B59B 2HRLA 4ZRGA 3VSTA 2OYPA 1XZ0B 4PJCA 4LCIH 2ALWA 3QIBA 4IHBA 4KK9C 2MPAH 2Y2TA 3N40F 3H7LA 4IBLT 4IBUA 1DDHA 2GAZA 2IC2A 2D73A 4FYTA 5IJDC 3II3A 4RISH 2FJGB 2P43B 4O2FA 3BZ4B 2ITDB 3STBA 1ZHLA 2EIJB 4RAUB 4WUUE 3X3GH 3OC5A 3QORA 1C5BH 5EA0L 4OQTL 4P9ML 5I8EB 3BIKB 4XCFH 2P8LB 2OJZL 2YKKA 4WW1A 3GTVA 1E6OH 2HKFL 2VISA 1MWAL 2Y7LA 4XNQA 3SIKA 4BUQA 3DX8B 2YGPA 4H1LH 4ODHH 4Q7DA 3KXFA 1B0RA 1TZHA 1TVDA 1E90A 3DNKA 1NFDE 2MRYA 5HDQL 2LU4A 1JF1A 1VFAA 2QVTA 5MEND 4JCMA 4QXGL 1GZQA 3KHOA 5EIIG 2D7PA 5DVOA 4PJDE 2PETA 2XQBL 5CR8A 3T3ME 3O9WB 3QQ9D 4FFYL 2JQMA 4GI9A 1IGYA 1BD2A 4F33A 1AKJA 4YHNB 2XUWA 1XF3A 3HFML 1RUML 1AD9B 3CFTA 1HIML 5DHEA 4HHGA 5T8IA 3EDFA 2F15A 4JFQA 3UYPB 2LHAA 4JE0A 1YHPA 2JMRA 1IGJB 1QEXA 1GZHA 4EBQL 1JK8A 4LRIA 1DCEA 3PAYA 3E0GA 5KSVB 3BUPA 4N5EC 3NJFA 4PJIA 2VDKL 1FYHB 1HCFX 5ESQA 3ZT5A 2WQ8A 4ZD3H 5JXEA 1J8HD 3FB6B 3MNDA 5EU5B 3WE1A 5CWSB 4FNPA 4FHKA 1U8HB 5AOKA 3MV7E 2HTLD 3GMOB 5CGTA 3BN3B 5C09D 2ZCLH 1D7FA 3VXUE 3U30C 1PJ9A 3WIFB 43CAA 5JW4R 4QRQA 1SN0A 2P48B 2UZXB 5SWZA 1T03L 4DW2H 1QA9B 2A4ZA 4PYHA 4NQCD 2CDGB 1G9EA 4U7SA 1VEPA 4DH2A 1TIUA 3DMMC 3MHZA 3L4VA 1I3GL 1EHXA 3I6GA 3FUHA 4WDIB 4XNMA 1OE3A 4UI2A 5CBAA 3MRCB 2QQLH 4DZBA 2IH3B 5LAXB 2V17L 4PWJA 4W4OC 4GPVA 4XRCA 2V33A 1YEJL 1BFTA 3GXIA 2G5UA 5IQ7H 2D3LA 4JFZL 3RWFA 3RDTA 2W91A 2YD1A 5DEJA 4X0NA 5D1ZA 3TURA 4FLHA 2UZYA 3F12B 1XR8A 3EBIA 1WDAA 5IR1A 4GUOA 1CURA 4OF3A 3ZL4H 3MLWL 3FPXA 3ARBA 3LZQA 2XG4A 3PV6B 5KUMA 4KROC 4JN1L 2L04A 4FNQA 5GZOA 2B2XL 4FZ8L 4WFHE 1BVNT 3AT9A 4GIAA 1Q1PA 4NFBA 2GUOA 1QSED 1SPDA 2IQ9H 4PJ5A 1Q0YL 5CO1A 1F5WA 4OQTA 1AO7E 4Y1AA 5BUGA 4WK0B 1OAQL 3K2IA 2H32A 2HUHA 3L54A 1V3LA 2PW1B 2XA8H 3P9WB 4OCNC 3W5NA 5CJXC 4G11A 5GRYA 4JM2B 3O2DL 2BDNL 3VWJA 4HH8A 3D0VA 3DURB 1P6AB 2F19H 4WO4A 1MCJA 3NIGB 3TF7C 1XB6A 3MGOA 4GG8B 3MJ9L 1BBJA 4HS6A 4LAQH 3CFIC 1EO5A 2BX5A 2J8UA 3BX7C 1CD0A 3PABA 1ZKAA 4YSEA 1E9PA 5JW4Q 4OVUA 2WO4A 2HRPL 1L7TH 3QZBA 3Q8FA 2J12B 1T5XA 2O5ZL 5E1AA 1JV2B 4FFYA 3EJCA 4PHZA 1DQQA 2QMKA 3BQVA 1F1DA 1PS3A 1M71B 3W2DH 2VDNL 4NGHL 2UX7A 2PWEA 3Q6GH 3BVUA 3FPYA 3QHFH 4I5BB 1MAML 4IYKA 4NZRH 3HOGA 3O3BA 4OIIH 5A2FA 3FQ1A 2IDQA 3B7TA 4N5UA 3AXHA 2APFA 4GRWH 3BPCA 1U8LB 1J1OH 1YMHA 3C09C 3GEFA 5F1NA 5L4JA 1RZFH 4EN2A 2EVIA 4AKOA 1AR1B 1ZHNB 3BKMH 2OX5A 2PW2A 3HR5B 1DFBL 3F7QA 4I1RA 4EZKA 4C83B 1TFHA 3CJJA 1N5AA 2R0KH 2VQ1A 2QVKA 3QEHB 1K5NA 1RJYB 5KW9L 1W8EA 1TTGA 1N10A 4AT6B 3GIVB 2X2YA 5FW8A 4GQ9H 1ZVYA 1IEAB 3V5KB 3LS4L 1RUPH 3N85L 4NNPL 1K6QL 1SHSA 1WE5A 1TCRA 5LLIC 1IM3B 3G5YA 4FNLH 1I1AB 4P2YA 4KVNL 4U4BA 4NAJA 4BZ1L 2VUYA 2E6PA 1YQ2A 5FK9B 4Z3HA 1A6WH 2J55A 3NZSA 4XXWC 2M1KA 5JHDD 4WV1A 1OQXA 5KVGH 4JQXA 5CIPA 1I9IL 1WG3A 3Q44A 5DEFA 3DX4A 3NZ8A 4N90E 5K5YA 1QVOA 4H20H 4QMEA 3NSCA 1IIIA 2OYMA 2J73A 5D7JB 5DHYA 4ZTPH 4QRSA 1YJDC 4MAZA 5EIVA 2WVSA 5IMOA 5JNYB 1YZZA 3OKEB 1QHOA 3QDGB 2NXYB 3ISRA 3ROLB 1HE8A 1MLCA 3CLFL 4P23B 5ICXB 3ZK0A 1AZBA 1R17A 1WV7T 3CU1A 1DTUA 3DX2A 3IPBA 2J8OA 3MN8A 2I7SA 4KO7A 1NLDL 3QO1B 4DP5X 4GOSA 2WTOA 1H5BC 4FE9A 3RL2B 5IB5A 2R56L 4NUQA 1IL1A 1E7VA 3GMQA 3QUMH 1R46A 2A6DA 1ED3A 9CGTA 4N2EA 1UT2A 2AGJH 1FC1A 4RNRA 1GW6A 2UYLA 1CT8A 2AEQL 5KANI 1MCRA 2WB1A 4S0SD 2GJRA 5E9DB 4N2BA 5I1IL 4HUKB 2OR9L 1HOEA 2WZPD 5EO9B 3ARFA 2FWLB 2FX8H 5GZND 2NTSP 3BD3A 4WWOA 4D0BA 5DJ0B 1W72B 3MJ9A 2KLTA 3IXAB 3TH4T 2HVKB 1FVCB 3TIEB 3CN3A 1T6BX 4JCLA 2GJZB 5LNEA 3DKHA 3IT8D 1MCPL 4H25A 4FG2A 3V2AR 2A6IB 2VT0A 2BP8B 4GUCA 4AY0A 4XO9A 1PKOA 1ORQB 3FTGB 3NPZB 1C5BL 1MRDL 2AQRA 3IE9A 4P2RE 3HTLX 2IAMA 4PJ7B 2Y6SD 2H2SC 3GK8H 3QDGE 4HUMB 1ZHBB 4KK6C 5TE6L 3TO4C 2ZCHH 2Y25A 3CQFA 4M6OH 5AVUB 3AT8A 1IAII 3UJTH 2E74C 5K59E 2BY2A 2MKWA 1DEDA 3AXLB 4W6WB 3O6LL 4Z7QB 1EJOL 4J3TA 3SPGA 5FGSA 1HCVA 3FMGH 1KLGB 5CHNB 1RZ8B 3QFJA 4PLKC 1KTCA 1P4BH 3BPOC 4X6DF 1W72H 4PJAF 5ITFB 1CVSC 5E9DE 1A6UH 3RTQD 2A77H 4CC4A 2CJ3A 1GC1C 1UT1A 4G59C 4GLRH 1OSYA 3MLRH 4JGNA 2OI9B 2E86A 5TE4H 4LEOB 4HUXA 3UAJC 1KLFA 2EUXA 2YWZA 4TS6A 4WEUD 2P45B 4LCCC 1SXZA 1XIWC 3DHUA 3SPCA 3SQOH 4GRLD 1CFQA 3SDCB 1OM3H 4BZ1A 5I1EH 1WAAA 3ZDXE 3GSNH 3MJWA 4L37A 4Z18A 3RWGB 2XQYA 4NQTA 4ZD3L 3BVDB 3LKPB 1KFAL 2FX9H 3L3IB 3N3EA 3JQOB 6CGTA 4IW4C 2G9HA 3ISWA 4I3SH 6PAZA 2ZCLL 3PQYA 4HX1B 5AOMA 5E8PB 2DWTA 5I5JA 3QJQB 4DW2L 1TZIA 3S48A 4ZW7A 2VLJB 4WNJA 4H13C 1A7QH 4HUWB 3QEUA 4N8UA 5ISZD 4LCVA 4EZLA 3P69A 3KPRA 3VWKC 4OLUL 1T83A 2BY3A 2WIIB 3CCHB 4TUJB 4ZW5A 3T77B 2FGWL 5HHXL 2QQLL 4Z7QE 3GBLA 4ZW8A 2ZX6A 5KVDL 3AVEA 5K1VA 4TL5A 3GSQA 1XH2A 1U58A 3LKSB 4RIRA 2F1AA 2W92A 4LSUL 3T0EA 1N4XL 1U8KA 1TEYA 3GSOA 3OXRA 4AI7A 2OTUA 2V3FA 1BM3H 1P4LB 4FI7A 3K72A 3OQRA 4PRBA 1X5JA 2MTAA 5BZWA 1B4JL 4HHWA 2BNRB 1YC7A 4P4KC 2PXYB 3PJSA 4X6BA 3FTSA 1PY4A 1QYGH 4X80H 3R7QA 1P5VA 2KDYA 2VLKA 4CN1A 4LARL 2WZ0A 5CJQL 1IGCL 1BEXA 4JVWA 3IBEA 1ORSB 5EOQL 4XMPL 3E3QE 2XXGA 2IQ9L 4NKDB 3G9VA 3R06B 2IFFL 4XPGL 3KPPB 2RBLA 2AJVL 1DJYA 4GNKB 4LF3B 1CZ8L 7PCYA 3ULUD 2EEAA 4YHOH 1JZ4A 4IIQB 4N26A 2VDOB 1TQBC 1UOKA 3A4AA 1QLRA 3MUZ1 3DX3A 4H1LA 5IOPA 5DDHA 1TQSA 4LVHC 3U0PA 4HPYL 2YS4A 3B8YA 4UOW0 3SYAA 1Y6KR 1QKZL 1S7SB 2JI2A 3ZDYB 1A9EB 2I60H 4TUOA 3QEQD 2I85A 3X2QB 2A73B 2DLTA 2YOAA 3BVWA 1U93A 2JQAA 4KJQC 1SJHA 4KRPC 5IB2A 4NKOB 4EE2A 3IDXH 3EZJB 1XZ0A 3SHSA 3O8XC 1PIFA 2ERJB 2Z34A 3W2DL 4GXUN 1CGTA 5KG9B 2FSEB 3BD4A 1RLWA 4XCCL 2FJGA 1BJMA 4AWJC 3BZ4A 4Y0GA 5LN4A 3ZZ1A 3C2AH 1DJGA 2VCOA 1GR7A 2CO2A 3Q5OA 4RAUA 1ZD6A 3V9EA 3D05A 4HJSA 5I8EA 3VFOA 4MD4B 3BIKA 4RA0C 4JO2H 2P8LA 5E99H 5G4NA 2EO7A 4AITA 2R0KL 4N0FB 2R51A 3U4AA 5KJRH 4LU5H 3WEAA 1LDSA 4GFTB 3BAJA 3B9AA 4BFIB 4EI5C 5B39G 3CN0A 2NYZA 3T9WA 2LTQC 4Q14A 1OOWA 3ZTJG 3WFHB 3WS3B 3VG0H 3MV9A 4IBVA 1QSFD 2BXZA 2PPDA 4MB1A 1XGYL 4UAOC 3VXRE 2QHLA 4CN6A 5KYWB 3ZYJA 3FB7B 2BK8A 2FEDC 1RQ5A 2K6YA 4ZFOB 3O9WA 4ORGB 2L0DA 3MBWB 3BUTA 3VD9A 1LMIA 4GEJA 1DVFD 2YXWA 5FV2A 3EIFA 4D94A 3VAEA 4BK5A 1AD9A 4E9QA 1PG7X 2FYVA 5BRZB 3UYPA 5TK2A 5CLZA 5KSBB 3KW8A 4YSQA 1QFWH 5JPMB 4F9LA 3WNLA 2V3EA 1UT9A 3HI5L 2AEPL 4XN2A 3II1A 4U1MB 4S0HA 5HHVL 4BGDA 2BSTB 2ZWLT 1SRDA 1YEHH 3VGEA 1V05A 3FB6A 1CK0H 4WKZA 2QR0A 2EH8H 3MLTB 1LHZA 5CWSA 5EU5A 1U8HA 3UG4A 3GMOA 4R4BA 5ICZB 1EH9A 3WIFA 3N91A 3MRKA 5EWIH 4W9GC 2UZXA 2VGLM 2VXVH 2C7UB 1QA9A 2YD9A 3X13A 4UWQB 1TZGH 2CDGA 1F56A 2JELH 2WZ5A 5CLWA 2AGJL 1IC5H 1E50A 2OL3H 1KJ3L 2XIBA 3UH8A 2QGEA 4DKEH 4WDIA 2R29L 4CU6A 4TVPL 1M7IB 2OMUB 5D1QE 3MRCA 2DAVA 5G4MA 2IH3A 4OFPA 3QPXL 4Z3TA 3A6CL 3WO3B 4PY8I 5C0DB 3V0WH 2DLEA 3NVQA 4Y1SA 1ZTXH 3VYPA 4O2CB 2MNJB 1P0SE 3MV8B 3KPLB 4OZ4B 5IV2B 2Z7UA 2A9NL 1DQJB 5KSBE 1URIA 3BAYA 2YQ3A 1KYAA 1YPZB 1FNHA 2P1YA 1NFIB 4G3YH 2ESVB 3PV6A 2LQRA 2CBOA 1F4AA 2H8PB 4GAGL 3DSFH 3P4OB 4N68A 4N6QA 1LO3H 3K2UH 2BVEA 3SE8L 4YDNA 1A1MA 2R1YB 4M5YH 4ES9A 3WHXB 4Q9BA 1J5IA 5BZXA 4LOUD 5C6TH 2CGRH 3FAWA 2QQNL 1KBGL 4MNQB 1SEQH 1GOHA 4XC3H 3H85A 4UMGA 2D9CA 1FVDB 4JM2A 1JG9A 1YQVH 3QDJB 3WKYA 3DURA 3O6ML 1NUFA 3LZRA 1W72L 2DQTL 1FJ1B 4EVNB 2FHCA 3QUZC 1EFQA 4RFNC 5E5LA 5GJTH 3MRIB 4KPHH 1JV2A 3LPPA 2EDXA 3U7AA 1HWHB 1SXAA 2EDHA 3OKLB 3MUJA 4HOMA 2OMBA 2HFEB 4KTYA 2WN3A 5C0BD 3V9FA 4JZJC 3F6JA 4I5BA 3NPSC 1E3ZA 4DT2A 4H2AA 4NIYE 4MBRA 3O81A 2MJWA 3P0GB 4HXAL 5L0QB 3NEEA 3FU6A 1S5IL 1U8LA 1S78C 2FJSA 1QASA 3L3KB 3P4LA 4XWOC 4FL4C 1ZHNA 5MENE 1OAZL 3EOYG 5AL8A 3KJ6H 3L81A 1J8SA 3NFSH 4C83A 4Z7WF 5EEVA 2ZNXA 5JYMA 3QEHA 3S35H 4AT6A 5LQBH 3GIVA 4UYPA 3X1BA 3V5KA 3B1TA 1IEAA 4KVPA 2IWKA 4XGZB 3WEOA 3O3UN 4ADIA 3JZ7A 4LLUB 5GS0H 4YBQD 3SYOA 4KX7A 5INCB 5I73B 3QUMA 3CZFB 4UBDC 4X7EC 1S9KC 1ZDQA 1IM3A 3CFDB 1B6UA 3B1UA 5BMFH 4O02H 5T1DL 3HRPA 1PVHA 2W88A 5CEZD 4W70A 3JWDL 4KXCA 1AXSB 3HPLB 1XGUB 1P7HL 4A2GA 4MYWB 1J8HE 1BM3L 4TVSa 2RQ8A 2C4FT 3T8XB 5JIQA 1Z3GL 2EAEA 5C09E 5ACZB 1SJMA 1BWWA 1JGUL 4X80L 1JPFB 4CGTA 1RIUL 5D7JA 4PRHD 5E0QA 5IMLB 3SGDH 4PJHB 1MJ8L 2EH7L 3BWSA 3MLZL 5JNYA 4E9RA 4OIAA 3ROLA 5I0DA 3GB7B 3GSUB 4PJFE 1VRSA 1OGSA 2WYZA 4GW1A 3SDDC 4Q9RH 4P3DA 2DYRB 1F13A 4P23A 5ICXA 4P9HH 5ERWB 2Y24A 3DIFB 2YPLD 4KRNA 2W60B 4N20A 5CP7A 4NQED 3E6FB 3QO1A 2PN5A 4RETB 3ZKMD 4N2IA 5KOVC 4HLEA 1LQBC 2L7JA 5LHDA 2FO1A 2FHFA 4M02A 3S98A 3PL6D 5EPMB 2XOTA 3LN9A 5CMAB 2PKDA 5C08B 5E4EC 3KLLA 5I2IB 3WTTA 2HFGH 3MDJA 1IB5A 2AK4D 4BELD 4JFEB 5DZVA 3RI5K 5EO9A 3F62A 3GNMH 2E4FA 2CRMA 5DJ0A 1W72A 1KSRA 1GOGA 3ETBF 2HVKA 3IXAA 4X7TB 1FVCA 1R5VB 4OFYA 3TESA 4MQXC 4M7LL 4N8VB 4P5TC 2GJZA 3UCQA 1ZS8A 1TTUA 3L3OB 4I4WB 4OBSA 3H9ZA 4LGRB 3H7BA 3N40P 2P3YA 2GB2A 2A6IA 3VG9C 5ADPH 2BP8A 4OY9A 1QSEE 2X88A 4KXZH 1TCMA 4XVSL 3APNA 3R4DA 4YIQB 3PXJA 1ORQA 3FTGA 5IF0A 2H0FA 4JR9H 3SPIA 2HLEB 3FCTA 4JO2L 2CCWA 4PJ7A 4NB7A 1ZHBA 1YNTA 2B9BA 3KYKL 5CGYD 3NMEA 3EH4B 2VDOL 1CN4A 1I1AC 2CJUL 3QUYD 4M43H 4PWFA 4ZI8A 5E2UH 3B5GA 2CCLA 3TFKD 1WGVA 4PV8B 1NBQA 4L5FE 3VG0L 4FQIH 2EZ0D 4PLNC 2JKSA 3AXLA 4JDZB 1N3NB 1OF0A 4EN3C 5JHDB 1L4IA 1RUKH 1T5WB 3OPZH 4AGNA 5JDSB 3GQFA 5CHNA 3PG2A 5DS2A 1WAEA 3CFQA 5ITFA 5MHSD 2HYMA 4QRAA 1QQDA 3OV6A 3P4NB 1PZUB 1I9EA 1QABA 4LEOA 3F7KA 5IBLC 1M53A 1D2PA 1QFWL 4P59L 5GQBA 2FWOA 2MCPL 1J48A 3RWGA 4N2HA 3CXFA 3L3IA 3FF8A 4KOBA 1OGAB 2EH8L 2PCFB 3FN0H 3ATBA 1IMHC 3D06A 4ZMZA 1R9FA 3N1PC 4HX1A 5E8PA 3I50H 4GAYA 4XN5A 5E08H 5EWIL 4XP9L 5FM5M 4JJOA 4AEIH 3QCTH 1TZGL 2J71A 2VLJA 4YDJB 4LPUA 4OF6A 4HUWA 4PJ6A 4ALAH 5B7MA 3EF7A 2JELL 5F72S 3L2MA 1XMEB 3CCHA 2WIIA 4TUJA 4ZFOL 1JGLL 4U1GB 1PYWB 2LVEA 4DCQB 1Z2KA 4UINH 1WWWX 1TJMA 4PJEB 3QFGA 4ZT1A 5JHDE 1MREH 3VD3A 3VXSD 1MKFA 1O5PA 5MI0C 3SDXA 4ONGL 4XAWH 2G9KA 5TQ2L 4Y9BA 4RMWA 1F8TL 4QCIB 4JHAH 1G7HB 2NY0B 3AUWB 4JFWA 2DWDB 3CSTA 4XN9A 3LKSA 3QO0B 5KYNA 4FOMA 3K6FA 3KBFA 3C8DA 3L1OL 4AEEA 4KY2A 4OU3A 2GY5A 4BHUA 3T4YB 4QHPA 4UTAL 4X9FA 1P4LA 5HGAA 1CDBA 2BVUA 4J3OF 2BNRA 4PB9H 2PXYA 3VI3F 3WY2A 4A7QA 4AQ1A 1LXMA 1KLUB 1TMCB 3WJLC 1W9XA 2XSKA 3FDWA 3TN0B 4LCWB 1AXTH 1ORSA 3EJZC 1DANU 4Z6AT 5IFHH 1SVCP 3ZU8A 3EHBC 3UIZA 2C9RA 2WXLA 3BWZA 3NCCB 3PREA 4NKDA 4ES8A 4YSPA 3R06A 4MB3A 2YMOA 3KPPA 4G9DB 3TLRA 2R0WL 1V10A 2V5RA 2W5PA 5KAQF 2NX5D 5E24E 3Q06A 4LF3A 2C1PB 1AY1L 1WBYB 3FQUB 4XC3L 4QPEA 4XHQA 3GJFB 4NM4L 4Y5XB 3B2VH 5F8RC 3RGHA 3VFPB 1U3JA 1KPUB 4IIQA 1F4YH 4HALA 3SDCC 1QLFB 2G3NA 2H45A 3JWDC 4FJ6A 4EDWH 2F8IA 4HJGB 1NZRA 3ZDWA 3OHXB 4QWWD 1HTYA 3L45A 3O2VL 5IROA 4JDVB 5J5EA 1A9EA 3BI9X 2A73A 3E3QC 4TTDC 3F6LA 4G5ZL 1G1YA 5BVPH 4QAWA 3IGAB 4Z76A 2W0PA 4OZGB 1KEMH 4CDHA 4HSCX 1E4XL 5LBVA 4GW4B 4IRZH 4PSRA 3OAUH 2LW3A 4AMWA 5BO0D 5KG9A 2FSEA 3BFOA 3EYUH 1L3WA 1H19A 5JR1L 5T33L 2XLLA 5C0ND 1B9ZA 1RY7B 2W95A 3BSHA 2Z4QB 5GPRA 3ZTEA 3TU6A 4PWGA 3DC0A 3EOBB 3G6JF 1FNLA 4PREB 1WEJH 2J21A 4U1JB 2VITB 4MD4A 5I5MA 1A7RH 2UY6B 4JLRB 4MZIA 3M1OA 2DH2A 4N0FA 3AS0A 3C6LB 3E8VA 4MDIA 2YRLA 3KLHD 5EEUA 3QJUB 3EH2A 3MUHL 1TLKA 4BFIA 1RIVH 1XB8A 4HBCL 2B0SH 3Q8EA 3IBOA 3WFHA 4AM0Q 5DD3L 1MJUH 1QX1A 3FSOA 3QDAA 4FNRA 1VF5C 4NZTL 1Z5HA 1OPGH 2B1HH 5BMFL 5J11B 3FB7A 2OL3A 5FOJA 1BXVA 4ZFOA 4XMLL 4P5SA 5DMGC 2VDLB 4ORGA 1DVUA 3MBWA 5FEBA 2BNQD 4JGUA 1YY9C 3QWRD 4JFSA 2FX7L 3WFEH 4WW2B 5FLUA 2JKIS 3QW9A 4XXCC 5TK4A 4DN3L 5CN3A 2OA9A 5BRZA 4OZGE 5BXFB 3LRKA 1DBJH 4GSDL 4LHUD 2GYSA 3VXOB 1YO4A 4F8OA 1DLHB 1GHFL 5FYKH 4BFNA 2EQDA 4PV1C 3IF1A 1RZKL 4U1MA 1ITBB 2DF3A 3RPKA 4TLKA 1AKPA 5KSAC 3IKKA 5F7EH 2BSTA 2YD0A 1TU2B 3L4UA 1A7BA 4JPQA 3OSKA 3ULVL 2Y9RT 4JL1A 1DO6A 3MLTA 4ZXBB 4K5OA 3V4PB 1G5GA 5ICZA 3C12A 1NC4A 2F7PA 1IARB 3MYZA 1RV6X 2FCBA 3GI9H 2C7UA 4ZS7H 1DQDL 2LR4A 1QBMH 2E7HA 3EOAB 3IDIB 1Y07A 3RL1B 2ERJC 3IAQA 3SN6N 2NY2D 3S7GA 2D03H 1PLAA 1ZPLA 2APVA 2FT6A 4MJHA 4AQEB 2VDLH 4U1KA 5A1AA 1HSAB 1M7IA 2E7MA 2OMUA 2Q8AL 1YUHB 3FC8A 3D51A 5DVLA 4APQD 5C0DA 1UA7A 2XI9A 1AJ7L 1UB5A 2QL1A 3IAPA 1HQRB 1V7NL 4JRYB 4GG6F 4D7BA 4O2CA 3TYFB 4XOAA 3J07A 3MV8A 3TJPA 4KFMA 1NSNL 1YJDH 2BCKA 1IBHA 3NFNB 4OZ4A 3B3IB 1NDGB 3C5ZB 1L9PA 5IIEB 1DQJA 3FTWA 3U9WA 2ZWKA 3OJ2C 1GGBH 4K3DH 1RUQH 4KNTA 1YPZA 1WFNA 3IFPB 1ACZA 4UB0H 2ESVA 3ULUE 3QNZA 1X5ZA 2H8PA 3MRNB 2R0LL 1BFOB 5D1QC 3MOBL 4E9LA 2FK9A 3QP3A 1EERB 3PWPB 5FYJH 4RMUA 3IFLH 2UWEF 4PGBB 5DUBB 1MUJB 1TYJA 1HH6A 1EAPB 2OZNA 1E42A 2R1YA 2FDBP 2O30A 3ILQD 2ZP8A 4RWYL 3QNYA 1LDPH 2RGSA 4S0TD 5AAMC 3MRJA 2FJFA 5DVKA 5F7NC 3QEQE 4MNQA 2ZYIA 4ODTL 3CZUB 4L3AA 4LRNH 1U21A 3RJQB 3TPUB 1FVDA 3LIZH 5JPMC 3OPZL 1DE4A 3QDJA 2P8PB 3C60D 2WBJA 3O6FB 3QQ3B 4TXVB 2FYYA 4EI0A 1FJ1A 2WINB 4EVNA 2CQVA 3MRQB 1XCQB 4MD0B 5E94B 3PP3K 3N1FC 2FEJA 2WW8A 5E7FA 4DFIA 2RCSH 3ARED 1MXDA 3S2CA 2YD7A 4N24A 4MAUH 4TKWA 2PYEB 5J56B 2HFEA 1JE6A 4DVRH 4NRYB 4QXUL 1XBRA 4KJYB 3T5WA 1F4XL 3EJYD 3MBEB 1NKRA 3BH4A 1IJ9A 1FGVL 5KYYB 5E6RB 1I1FB 1NCIA 3VFNB 2B14A 2EVGA 1VZIA 3CBKB 3L3KA 5GRJH 4AKQA 3DUHA 2JKXA 1QSFE 1CD1B 1NAMH 3QR2A 2IPTH 4P2OD 3LRGA 4HYTB 1E9QB 4JO4H 3IDNB 2DQJH 5EU7E 3TBSB 5KN5B 1KBKA 1R5IB 3TTSA 3V4VB 2A9AA 5SWSD 4XGZA 1GC1H 4LLUA 4QXVA 3VDBA 3LH2H 3RI5F 1YYLL 1FYTD 2VXTH 3CZFA 3V7AG 2N3JA 3LEYL 4XCYA 2ICWB 2XZAH 2BSSB 4NQVB 5C07D 4N22A 1G7MB 1MW1A 4I13B 4Y89A 2NUPB 4WGWB 4QLWA 4KV5F 2HLAB 2ZXCA 1AXSA 3HPLA 1XGUA 4P5MB 5F71A 3KJ4B 2Y72A 3R1GL 4G6KL 3TASA 5B7EA 2DD8H 1WP6A 3AGVA 3QQ9C 1K3ZA 4H5SB 2CKBH 2X38A 2NY3B 3QJVB 2OMTB 2XQYG 2HWZH 2XV3A 1JPFA 1EGJH 5IMLA 2AVFA 4AMKH 4PJHA 2VRQA 5E6ID 5HJGA 5IHUH 3KS0H 5CLTA 1LWJA 3GB7A 3U2IA 3BKCL 3ZSTA 4X7SL 3SGKC 4I9WD 3NP4A 2PO6B 3KPOB 5ERWA 4E9YA 3DIFA 4OLVL 2QEJA 2W60A 3E2HB 3GSVB 2X4PB 5D96C 1GGCL 3WFDH 1G4MA 3V4VH 2J4WL 5AZ2L 5C71A 4BCYA 3KVQA 3BUQA 2KZBA 2HTLC 4XN1A 1GGTA 4XVJL 1G0YR 2G3MA 1JN6A 4KKZA 4C55A 1FNSL 1QFHA 2ICEA 4HK0A 4TSBH 5C08A 2ATAA 5I2IA 1PZ5B 5F1IB 3RVVD 2R69H 4EEEA 4JFEA 5BVPL 4UT7L 2XG5B 1X5HA 1RZKC 4I2XB 2C34A 2UZPA 1FIGH 2O1AA 1R5VA 1AQMA 3L3JA 3GI8L 2XV6B 4PIRF 4N2GA 3R7RA 4DVBB 4I4WA 3EYUL 4OCYH 4ZDHB 3EH1A 3QC5X 1G9NH 4OFDA 5TPWL 4TUKH 2FB4L 1MFVA 4YIQA 5GSVA 4QHNB 2IV8A 1D5XB 4AYFB 1A7RL 2WCGA 3T0BA 5F9OH 1JXGA 1PSKL 4D2NA 2IANB 4PRPD 4JHWL 3Q43A 2AHIA 3FO9B 4B9YA 5T1MB 2EVFA 2YO3A 2H3NA 1RIVL 4DAGL 3NSXA 5C3LD 3KEDA 5E5RB 3ETSA 1C5CH 3STLB 3D4GA 4PV8A 2BOCB 4FQXB 2HKAA 2Q76B 4H1LG 3MJ7B 4N8PA 4Y5YB 4JDZA 1N3NA 4H0IA 1OPGL 2B1HL 3UMNA 1T5WA 1T89A 5I19H 4Y19D 1U30A 1A3LH 3QRBA 2N1KA 4PGZA 1ADQL 5C0BE 3LZFH 1J9TA 3LJ3A 2YAMA 3P4NA 4TNEA 3HMXH 3P77A 5J1TC 1SDDB 2BP3A 4Y2OB 3ME0B 1KCSL 1OSPL 4OD1L 5B3JF 2NT1A 1ZA3B 5FYKL 2CHWA 4GKLA 5KWYC 4KNSA 3D34A 1NCAL 2ARJQ 3LRMA 2IDUA 1WTGT 2WP3T 1PLCA 2B77A 2GVYA 3LZLA 4E9XA 1MIMH 5B7FA 5AQ0A 1OGAA 4UU9A 2PCFA 4B9FA 3UTTA 3ASWA 4XO4A 1JZJA 5L8KB 3U6XS 1XO8A 3UACA 1TMQA 3HC0B 3MYJB 1X3DA 2IANE 3GI9L 2QHRL 5A6LA 4F91B 4NQUA 1MI5B 3AROA 5I71C 1P7QB 4M93B 1W8NA 1YMMD 4YDJA 4IBYA 2BM3A 5JA8B 1LLAA 2JIXB 3L95B 2QZQA 3AITA 3GRBA 2A0LD 4M3KB 2J8HA 5CEZE 3L3OC 2W80C 4QKTA 4Y9FA 1PYWA 1G5AA 2VDLL 2KL6A 2ZP0T 4RBPK 1SY6L 2EE6A 4DCQA 4DGUA 4XO8A 3C8HA 4PJEA 1A4JB 2FO4B 2CIKB 5HYFA 2VUKA 3GXPA 2COVD 2OTWB 2IBZX 3KDPB 4L0YA 5HDBF 1JRHH 4UIKH 4QCIA 4JREC 3HZVB 3ARSA 1G7HA 3BGMA 1E40A 4IKNA 4M5ZL 4Y4KB 3WJMB 3QDMB 1UM6H 3QO0A 4PRHE 4Y9GA 2IMMA 2MCAA 3RPBA 2CHNA 2LLGA 1GYVA 3W3BA 3T4YA 5SX4H 1R33A 2H41A 4JFXB 3S5ZA 4B6ZA 4N1HB 1WZKA 3RQ3A 2YPLE 2OMWB 3V4PL 1VACB 3AMLA 5JMOC 1EXGA 1KLUA 1AHWC 1GSKA 4EUPH 3KWWB 3RIAK 1Q9KB 3TN0A 4LCWA 2DLIA 3TV8A 3L1GA 3TT3L 3IFLL 2QDWA 4J3OD 2W65B 5I66B 2UUDK 4MQSB 5I30L 3HI1B 4MX7B 1FRGH 2C1PA 1CO1A 3NQKA 4GBXD 2B1AH 1WBYA 3FQUA 2GJ6D 5CJXA 2NSQA 3GJFA 3VFPA 1NDMB 2AK4E 3VGDA 4KZEL 3POCA 3Q0HA 2CZNA 3QIUB 1KPUA 1DVZA 4OQ1A 5DUJA 4AV0A 2FD6L 1QLFA 4NO0B 5FC9A 2I07B 4ZAKD 3D85D 4X6FA 1DJIA 3ML8A 4HJGA 4X6CF 5D2NA 2Q6WB 1AZNA 1D5MB 2Z8WC 3H3PL 3OHXA 4HS8H 4KAQL 3LDBB 1UWXK 4JDVA 4NQXA 1JVKA 1T22A 5F6HI 1IO4C 2DDQH 2YSSB 3OKYA 3BKYH 3IGAA 3TEZA 1JZ3A 2GIYA 5AVTB 4DVRL 2GJJA 3TYGH 5TF1L 3ZVVA 4GW4A 2R2BA 2WBWB 5EZIL 2O6EA 2OTPA 4L8BB 3FU0A 3NA9H 3M86A 3LXCA 4U6VL 3MX0B 5GZNC 3QS3A 3BAEL 1NM4A 1QHPA 1XAKA 3ZMRA 2Z4QA 2X89A 4ATWA 2VQTA 1F41A 4PREA 1OARL 4PCKA 5ALCH 4U1JA 2VITA 4S2SB 5FUZH 3KLAB 4H8QA 2YD2A 4V2BA 2UY6A 2BS8A 4JFDB 3C6LA 1A7OL 3VU1A 4WI8A 3K71B 1JDCA 3IGKA 4I88A 2BHUA 5ACMA 2CA3A 5DYFA 5HHMD 1F1GA 2Y6SC 2APBA 5MHSE 3VSVA 3I84A 3NFPB 5T3ZD 1TJHH 4O51B 4ABVA 3LH2L 2YBRB 1JHLL 3N0AA 4R97B 1ZA6B 3VMPA 3PHQA 4XMTA 3NZHH 2XZAL 3JV4B 1IGFH 4U1SB 4PJAE 3TWYA 4BKLB 1S7RB 2J88H 2VC2B 5IWLC 3QQDA 4N2OA 2V6HA 1SY6A 5I1CL 4ZMAT 4KUCF 1HFUA 1SNRA 4WW2A 1SXCA 2KT6A 5HVWA 4OTXL 1MDTA 4RDBA 4KH2A 3CVBA 2PPAA 5BXFA 4FS0A 1F6FB 3VXOA 4NZDA 3RTQC 5I75C 1DLHA 1EZUA 2E9JA 4QRRB 5T1LD 1AG0A 1QFWM 3JWOC 4NHCL 4P46B 1BHGA 2YRBA 2BSED 4ELDA 1TU2A 3PNWB 3MRRB 2Y07L 4MQ7B 4GRLC 5DR5H 3V95A 4ZXBA 4NQQA 1GTFA 2IV9A 4J3WA 1BP3B 3V4PA 4XBPB 3KDMB 2B20A 4ZSOB 1A5FL 3N06B 2DIEA 1M4KA 4JFDE 3V4VL 1EVTC 3DROB 3VXSE 5DFTA 3IDIA 4WK2B 1TR7A 4CVWA 1FCCA 2O72A 3RL1A 1IFHH 3GKZA 4W9IC 2XTJB 1OEZW 5IHWA 3HBZA 4R84A 2VC2H 2XIIA 4I18B 4AQEA 5EBWB 4J8RA 3EO1B 4P8QA 2F0CA 1HSAA 4GIPD 3APDA 3QI9D 1YUHA 5KS9B 4G7RB 1M42A 1U95A 3JUYA 1HHIB 5A40E 2AK1H 5IHHA 4K94C 2YGQA 5DTFB 2I32A