3VVVA

Skich domain of ndp52
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
114
structure length
108
Chain Sequence
GPSQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDKQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Calcium-binding and coiled-coil domain-containing protein 2
total genus 17
structure length 108
sequence length 114
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vvvA00
3VVVA 4NLHA 2LFEA 3VVWA
chains in the Genus database with same CATH superfamily
5GGSY 2JK5A 4R4FL 3ARBC 4JQVA 5T1LB 1EHNA 1EA9C 25C8H 2X40A 1B9KA 3BUQA 4W9LC 1FF5A 3T6XA 5C08D 1WCBA 2DYPD 1YC7A 4BV1A 1QYGL 1QI4A 2Y7QB 4L3EE 3SYQA 4PRIA 4YHKH 5I8CB 2J2ZA 1TO5A 4HIHA 2NZ9D 3V9FA 3E2HB 1NGZB 2IH9A 3FO0L 4S1RL 2D31B 4PP1D 1JERA 3T2LA 1ITCA 2DKSA 3TA4D 1F86A 1TPXB 4U1LA 3RVUD 1FV1B 2QZ5A 2YD6A 3ILEA 4JMXA 5J6SA 3WHE1 3H9SB 3L1FA 2QVIA 1RURL 2D7QA 2ZKWA 3DVGA 1KTLA 3EJUA 1IC4L 1OW0A 3CMOL 3R7RA 2FO4A 1TKWB 1GAFH 2Q8AL 4KHTL 2BNRE 4OV5A 2YQGA 1RH8A 1VADB 3V4PH 1N5YH 2I5YH 2YD4A 5J11C 1M05B 1V7MH 4XP1L 3DIFA 1FHGA 1WLHA 3GNMH 5MHSE 2VAJA 5SWQB 1PQZA 3C87A 5M7QA 5CEYA 4LCCA 4K5OA 2RAMA 2BSRB 3CFTA 1J9TA 3ZHFA 1EDHA 1WHPA 3BH8B 3HMXH 2CLZA 3GDCA 3GQFA 4JFFA 2WXIA 3F2LA 1CDBA 3MCKA 2J6WA 2WXLA 2BXZA 1BPLB 5G4NA 2WYTA 3TIDA 2N0KA 4NOFA 4J3SA 3LN4A 3O6FA 4DEPB 3UABA 2CH8A 3OR7A 3ARSA 2HPOA 3MV8E 3TYFB 5I1GH 1J5DA 4U7SA 2XXMB 3STZA 2YJQA 1J5OL 4JKKA 1F6LL 4W9HC 4JHVA 1FRGH 1IGTA 5JHBA 4YSUA 4OBSA 4AQAB 4Y1AA 2Q8BH 3APDA 4M61B 4FQ2L 3QCTL 1KYAA 1I85A 4HJGA 3GHEH 3CHPA 2XG5B 3D07A 2WSKA 3JYCA 4A39A 4IKIA 4OI7A 4GP8B 4L4VE 1NCAH 1I85C 2IAAC 4EVNA 4LIQH 2CO2A 1ZVYA 3AWFA 3PAZA 4GNKB 4NLAA 2JXMB 4M48H 3DBXB 4FI6A 1ZK5A 1U8JB 3VCLB 2VW4A 2ZUQC 3FN0L 5JDJA 5CN3A 1HSBA 1ZV9A 3D2UA 4P59L 3C2AH 1MJJA 4PJEE 3EYOA 1QFPA 3S2AA 4NBXB 2IH3B 1BVOA 4FC3E 1Q0YH 4LU5L 4NKMA 3QJRB 3AMKA 1TZGH 4LFHG 5C1MB 1CGTA 1QHOA 4LPYA 4DVBA 1E30A 4J39A 2F8VA 3KG5A 1IM9B 1LWHA 1J8HD 5E9AA 3FZUC 1T2JA 1T1XB 4QKTA 2QSQA 4NUGH 4MQXC 1YG9A 3GGWB 4WKZA 4N8UA 2XFXA 3N5AA 4APQD 1C16B 1YEEH 4HWBL 2DQJH 4GKLA 3LNHA 1YNKH 3FYEB 4UT9H 3T6VA 5AD0A 5E24E 3WUWA 2C34A 3NZHH 3OKMB 2D7OA 3NIGF 1KXTB 1L6XA 2FZ3B 4XP9H 1T1WB 2XLLA 4MB1A 1JDCA 5ES4B 5EN2A 3EFOB 1UJ3A 4EUPB 5EF0A 5HY9A 1NPJA 2EVIA 1EGJH 1SFDA 1LNUB 4F5CA 1JWSA 3LVEA 2VN6A 3BVNA 2QQNL 4RRPA 4ZMZA 2GYSA 5L9DH 2BOBB 4R26L 4JG9A 4U6VL 3DXAA 5DRWB 4MZRA 4XNYH 2H1LM 3O9WD 1IZKA 4TV3A 3T0VA 4UAOB 3RWHA 2B59B 5MEND 2BMKA 4WFED 1MNUH 3QQ3A 1IMHC 1OTSC 2GBVA 3RWFB 2VLKD 3U82B 1W0WB 4NQDA 3ARBA 3BP4A 4JQVC 4QYOB 4U2ZA 3US9A 5J8OA 5E2TH 2ZCKH 5EIQA 4C56A 1N8ZA 5I15H 4NEHB 3WJMB 2RB8A 1KPUA 3QIUD 3DX8B 3B8SA 1E8YA 3QQNA 4G9FD 4MQSB 3LMJL 1PYWB 4L4TE 3QZOA 4OZFG 1OM3H 3CIQA 3TVMD 4AV0A 4HX1B 4MVBD 3D3VA 1WZKA 4MS8C 2Z64C 3QUMA 5C09B 2X6AA 4DGWC 3MJ8B 1E6JL 1UEYA 2GAZA 4GW1B 3RJDA 4FULA 3ZUCA 2W92A 5LGHL 3CQQA 5C7XH 4QHPA 5AVWB 1RUAH 3SD2A 2EUXA 1W72B 3F6IA 2C1OA 2AK4E 3KXFB 5AZ2L 5KVEE 3W3BA 4NPKA 4PMEA 2YK1H 5D7LA 3CX5K 4WW1B 2EO9A 2VJXA 1XR9B 2WO3B 4YHYC 1PS3A 4MA7H 1HQ4A 4BK5C 4CADB 2J8UA 3ZTCC 2H2SD 3B2PA 3VE0A 1ZLSL 2F7RA 2VUKA 4MMXC 2HFEA 4RGMC 1BZEA 3AQXA 5INCA 2V2TA 1OP5K 1MWAL 4B97A 5HI5D 1FV1A 1UUSA 5EU7E 3SDCA 1BQLL 1FO0B 4UQEA 2I9LB 5J7CC 2X3BA 1GZHA 3PDOA 3PWLA 1LP9F 1MCJA 4AG4H 4JFZL 1F0LA 3LNDA 1G87A 3FT0A 1SMOA 5I73B 3K72B 3NGBC 4S1DD 2ENJA 1EAJA 3MJ9H 3P11H 1XMEB 1GVIA 1AXTL 2IF7A 3NUKA 4Q7DA 4AIOA 5HTSA 3DIFB 1GHFL 4Z7UB 3GMLA 2FHBA 4HXBL 3FT9A 4X9HA 4JCWA 1FZKB 4WWPA 5I5RA 1PQZB 3UBHA 4HUUB 3VD2A 4NDMA 1IVLA 3G6AA 2XJKA 3EXJA 2QGEA 1RZPA 1M6OA 1I1FB 1QBBA 1S78C 1KPVB 4NQEE 3FRPB 4KHXL 1IB5A 3GJFK 5JUEH 2QFPA 4KVNL 5ID1A 2V7NB 2AQQA 5IHLB 2YXFA 3H9SA 3S36L 4EIZC 4QKXB 2XZQH 4FDWA 5F1NA 3UJTL 4N0YH 3RNQA 5E6UB 2OXHA 4FZEL 4DSYA 2VR4A 2CIKA 2HLEB 1FFOA 1D5XB 2D0HA 2BHFA 2DQEH 3KNBA 1JPGA 5IY5B 1GRWA 1ZS8A 4NT6B 3SIKA 3MUGB 4RMQA 2GJJA 3KJ4C 1G7LB 1K8DA 1IJNA 2GKIA 4X2UA 3RBGA 1ZA3A 4H8WH 4HOWA 3LEXA 2WVVA 3FO2A 3LQAL 1RZGA 1THAA 4A1RA 2VAAB 4DP5X 4G8AC 1II4E 1C5BL 4XNQA 2KZ1B 2WXFA 1FZOA 4TNWF 3GM8A 1GC1L 1IAKA 3VSVA 2FWOA 4G8GB 3Q3GB 3ZL4H 5EFIB 1M71A 2CIIB 3MJ7B 1NCIA 3N1PC 1P4IL 2HTLC 1Z1WA 4BDVA 1OM9A 3LN5B 1BIIA 3DV6A 3ROOA 3BT0A 1IGML 1K4DB 2ZXAA 5E1HB 5GGTL 3AU0A 2D4FA 2I27N 1E5YA 3P11L 5ISZE 2BDNH 3OKKA 5F0MB 4R2GD 2N3JA 3TWYA 4NP4H 4Y4KD 3QDHA 4ZTPL 2F08A 1I8MA 2IBGA 1NFDA 4OFIA 3C9NB 1JDDA 2X4UB 5LN4A 1A5FL 1TCMA 1C5BH 3MNVA 3MUUA 2UUDH 3IRZA 2VSCA 2EDTA 1MI5B 1W9XA 4RBPH 3S2CA 4M1DL 1I4FA 4RLDA 5I19H 3H54A 2DPKA 3MKKA 1NGWA 2W1NA 3L2MA 3B9KC 3KL0A 3WEAA 4D94A 3NIDB 4A63A 2C4FU 3IE9A 2YGPA 3QW9A 3GUFA 1W16A 1BFOB 1EERB 3ESOA 4KUCF 5C0ND 4QHKI 3SDXA 1T21B 5CLXA 3QJFB 4NJ9L 5KJRL 2NTFB 2WXNA 3P30H 1XSKA 1KTCA 4HJ1A 4LQFH 1RK0A 5TDOA 5EBWA 2ZPKH 2NXZB 4YX2H 1T1XA 4ABVA 4KI5F 1DE4A 4M4RB 4FQQB 5F1IA 1J11A 4KY1H 5DFTA 1C16A 1DN2A 2EP6A 1YPZB 3CFDB 2XACC 3ASWA 3K2KA 4FNRA 4KMTL 3KM1A 4NO0D 5HYQA 5ADPL 4PJEF 1TEYA 2WKGA 1TEGA 3DGCR 2AXFB 3T0XA 1HILB 3IF1B 4A7SA 2EIZB 5JR1H 5E8NA 2R1YA 3AQZA 4NHCH 4YXKH 2XCMC 4HOZA 1QWNA 3MHZA 1VKXB 1DQKA 3K6OA 2LAGB 1E9PA 2QSTA 3VFUB 1A7OL 1IBBA 1YJDC 2QVMA 3JVGA 4WNJA 3KLHD 5SV4A 5D5MB 1JVLA 2DLFH 2JTDA 3UO1L 2VLRB 3EJPA 1I7TA 1YVLA 1F4YH 1IGCL 2PO6D 4NC0B 4F93B 1BG1A 3DRQB 3P1VA 1KYOJ 3KLAA 4Z3IA 3MA7B 5KVGL 4FI8A 1WBXA 4PRPA 4XC1H 5IJDC 3RWCA 1ADQH 1VZIA 1CFQA 3MBED 4OCYL 3ZTNH 4F91B 3RZCA 3AGWA 1IC7L 5I66A 1R47A 2IOOA 4OZHF 1N68A 2DI9A 4O5LL 4PBVC 2QQNH 4R7NA 4RMBA 2R8SL 1F4AA 4U1GC 2JLLA 3W11D 1SOSA 2P26A 3LHPL 5GISL 2EEFA 3F58L 2P5ED 2BPBA 4AKPA 5IOPA 3L5HA 3SO5A 2LU4A 3TT3H 4TYUA 4IBWA 2XXGA 3WGVB 1SOXA 5C9JA 4PBXA 4Y2OA 5BNXD 1EX0A 2CMRL 5AW7B 2J8UB 4XVOA 2IC2A 1LWRA 5GSVB 1YO4A 3DO7A 3WNOA 4KTEH 1E9OB 1E6JH 5EIIG 1R5WB 1IFRA 1WZAA 5HHMD 5KSBB 2I07A 5JZ7C 2EKJA 4JDVA 2EH8H 3T0EE 2DYSB 5F72S 4M5YH 3DJRA 1U8NA 4KZ0A 4AYDC 4FOMA 4JRYE 2JI1A 1M6UA 4EPSA 3I6KA 4E5XB 3OZLA 4OCWH 4O58L 1AACA 5E6ZA 4LEBA 1SEBA 4CVXA 4LSSH 1NM9A 1MRCL 3BI9X 3EFDH 4JFTA 3CTTA 3ML8A 4JFSA 5I15L 4M6AA 5SX5H 1QQDA 1YJDL 2YXWA 4QNPE 3GB7A 4UUJB 1NFKA 2PXYB 4FMKA 1IC5L 2BHYA 4CADA 4DKEH 4LLQA 2A6IB 3P9WB 1FYTA 2AK4B 2AXWA 4A7GF 5AW2B 2QGBA 4PJ9C 3UTTA 3ULUC 3FN0H 2YFNA 3EIFA 3IJSA 3S37H 2VDOL 5JHDB 1TO4A 3RKDC 5EOCH 2VRKA 3RFRA 1AXTH 2VDMB 3HHSB 4PRIB 5I8CA 4FHKA 3TV3H 4N2EA 5F1NB 4YE4L 3S3BB 4XB3A 2NY7L 2PW2B 4PV9B 3MRDB 3Q5YA 4N25A 4UZSA 5AVRB 3BUYB 3MV8B 3N2JA 3II2A 3DETD 3WKMH 1BD2A 4NUPA 1R46A 4NUJA 4XN7A 1F18A 2W0KA 1I8UA 4H20H 4PJ7F 5FA3A 3SE9H 4AEEA 2CDFB 1OSZA 2BY0A 3ZMEA 4PV1C 5DWPA 1KGUA 1G7LA 1K8DB 1EO5A 2Y2WA 2W5PA 3OX8A 1TKWA 3S88L 2DQJL 1M7DA 1DL7L 4TUJB 4S1SH 4EOWH 3MRQB 2VLKB 4MA7L 4U4BA 3LNGA 1HOEA 1UZ6E 2QQLH 1Z5LA 2CUMA 4RMVA 2WUBH 4DHLA 2MJWA 3QPKA 3JWOC 1AS6A 43CAB 5H8DA 4G8EB 4EMZA 3GUTA 1P4LA 3MJ7A 2QPEB 4KGJA 4LCIH 3BFWA 3QI9B 4PJ8B 3K6SB 1RZIA 4X7SH 4YO0A 2GPZA 1AI1L 1NANH 5KVGE 3WJJA 1PDKA 3QZNA 5I71B 3C5XA 2VTFA 1IQWL 3GBML 1DN0B 1NGZA 4DQOH 1YEDA 2ICEA 3KYKL 2WVVB 3FO2B 3T2OA 2H6UA 3P2TA 4OF7A 1PFOA 3B7RL 7TAAA 1GIGH 1E7VA 4M00A 4WKXA 2PCXA 3B2DC 3ZDZF 2G0LA 3QORA 4X6DA 5B4MD 5J6GB 3WOVA 3WSQH 3HIZA 2E7LC 2Y7NA 2LGNA 3D3VE 5E94B 5GS0D 4AGNA 3PQYB 5C0AA 5T3ZD 3P9LB 1AKJB 4HUVA 3CFEA 3IRPX 5E9DE 4ELME 4FN0A 3GT6A 3PWNA 4U2YA 4CNIA 3OBAA 1DBJL 4L5FE 4IMLB 1EHLL 5KOMC 2VDKH 1EJ6A 4FD0A 4YLCA 3V5KB 3BAKA 5EORH 4YDJA 4N3UA 3CFKA 1O7SA 4WI5A 2JV6A 2MKWA 1GY2A 4GMSH 3RL1B 3PWJA 3IMWA 4IJTA 4MJIA 4TULL 4X6CA 3RWIB 3TT1H 3WL9A 5JPNB 4FQIH 4IBVA 1LM8V 3EDKA 1MF2H 3LB6C 5AL0A 5KYWB 4X7FC 3JWNE 1UH2A 3CLFH 4FQXA 4XP6L 3WKNA 4DT2A 1SM3L 5DEZA 5K93A 3TEUA 2Z35B 3X1NA 1UM4H 1G7JB 2K6WA 2N0MA 3FCSA 1BAWA 3K6DA 4URTB 3OXSA 1MG3C 1PTZA 4HF5H 5E4EC 1AD0A 1JF1B 4N5EC 3ARDD 1DLHB 4UIMB 1UD2A 5HD8C 1JVOA 4XP1H 5DQ9B 3HRZB 3FCUB 3V0VB 1XCQB 1S5IH 4XCCH 3VXSE 2ATAA 3VFUA 3U7WL 5BS0D 2HKAA 5SWZA 4HUMB 5C0RH 2YC1A 4HISA 5EF3A 1QSEE 2CCLA 2EKSA 3K2UL 2DKUA 3EDEA 4JQXA 4YHZH 3Q44A 3VI3E 4A6YB 2YD1A 4GUOA 2WGXA 1DJWA 2FX7H 4K23H 3LPFA 4U3SA 3TH3T 4GSRA 3RTQC 1QLFB 3AUVA 3QK0A 4N8VB 3ZL1A 5C0FA 2V8LA 2FO8A 5F7AA 1HNYA 3WN5B 3RIFF 3MLUH 2XA8L 4HDIB 1OLLA 2MOGA 1KJVB 4AW4A 4NZJA 3HUJE 5D6DC 1IT9H 1XIWD 3Q1SH 4JHZA 2PCFA 4YHOL 5F21B 4L3FA 2E9WA 4P4RA 4UTAH 3OG6B 4MJJA 4G83A 1YEKL 5FYKH 4JFHD 5KWYC 3G5ZA 4I3RL 5GRYA 4F57H 3RTLA 3QS2A 2YSSB 2X5PA 4ZOBA 1WITA 5TE7L 1MPAL 2I07B 5A7BA 4WFFD 5IVNA 1QP1A 4G8FB 3WIFB 1DQLL 3ETTA 5H37A 2CGYA 3LAFA 1EO8L 1L0QA 4MYWB 1T5XA 4EDXA 1KGWA 2Z4QB 3FOMA 2VM4A 2KDGA 1OPOA 2H2SC 3BIAX 4RMWA 2D9QB 1UJ3B 4EUPA 4IRJB 1D5ZB 4RRPM 4WUUD 2PXYA 3DI3B 3TA3B 4JNXA 1E9QB 1DSFL 1U4EA 2WBJD 5GISH 4JN1L 4LNVA 3L7FB 1WD9A 3M07A 4HHWA 5E5UB 3CDZB 4IDJH 1DCLA 3AXHA 1GGIH 2QADD 5HGHB 5KBLA 4Y2DD 4X4ZA 2ZSVA 3G6JE 3JV6B 3QYCA 3DXAB 2EIEA 1IQDA 2XWJA 2PPCA 1OP5H 1PCXA 2A9AA 1W8OA 1F6AB 1ULVA 2OCCB 3QDMD 5DQJA 4FADA 5AOZA 1BQRA 1I7UB 5C0JA 5AAPA 1G84A 1NKGA 2OX5B 3ARDC 5DC2A 3FSAA 3JUYA 4H2AA 4I89A 5D2LA 3F6LA 4PB0H 5IESH 4FYSA 2C3WA 1QVOA 1WFNA 2BNRA 3TS8A 1CVSC 1J5CA 2HVBA 3FTXA 4N2BA 5EUOA 2CDGA 1IE5A 1DLFL 4BYHA 4Q0XL 5IMMA 5INDB 4PRPD 1UD6A 1FNHA 3VG0H 4ZDHA 3S8GB 5T3XL 3GSWA 5E00B 5FO8B 4LDCA 5CUSH 1NOFA 4PJHE 3UGEA 4I7ZC 1P6WA 4XVTL 4K7PX 2Q87A 4B5EA 3O81A 2IPKB 5B8CA 5IQOA 1JCKA 1HEZB 2F74B 2IWKA 1KB5H 1S7WA 2OKMA 3Q6FB 4RNRA 3TEWA 5T1KD 1B0WA 5KYUB 1A4BA 4HKBB 4HYTB 3NFSL 1DUZB 4EKJA 5JXEA 2F54B 3ISRA 4U1HA 1NAMH 3FQYA 4NKQB 1WFTA 4AKQA 1J1XH 4G6FD 2X12A 3VXNB 4UTBH 1NL0L 2MKLC 3MQIA 2H32B 1JYVA 4ZODA 5DA4A 1FFOB 5AVZB 1D5XA 2B1AH 2QZQA 2Z6FA 5GHWL 1IC7H 4M8RA 1P7BA 2EYTA 5BRPA 2QGCA 4C59B 4N6QA 1SN0A 1IAOA 1NWOA 1T5KA 1ZHKB 4FFVC 2I9LA 1PLGL 5C2UB 3KDMB 4QRUB 3ESMA 1G0XA 4TRPH 4GKZA 2AK1L 4LNRB 5JPMC 4OLVL 3ULVL 3LIZH 3OHXB 3TN0A 3CFEB 1EUTA 2E9BA 5FDYA 3OLDA 1ZMYA 1ML0A 1M1XB 5J13C 1EV2E 2ITEA 4ALAH 2F53D 3ZRFC 5IHZB 3GMMB 3WSQL 1H9DA 1GTNA 4FNPA 3MO1A 3TCTA 2JIXB 2DQTL 2ZONA 3GMLB 4HQQH 5J3HC 1CGYA 4XNUH 4KJQD 5KVEH 1Y6MR 3E3QE 2BSTB 2Z31D 3CCHB 4JLRA 4GRWE 2KS0A 4AGPA 1ILSA 2ADGA 4O9HL 1IQWH 3GSUA 5DXWA 4G43A 4DGIL 1A9EB 1MEXL 2ADJB 3FONB 3LPWA 1GJUA 1S3RA 1X5ZA 5AW9B 2AXGB 4U1IB 2OXHB 5FM4A 2V33A 4DO4A 1NMCB 1R24A 2Q76B 3QNXB 4YZWA 4PRHE 3HJEA 3Q48A 1S9VA 1AD0B 1EZUA 2CSPA 5DQ9A 2BNQD 5IM7A 1WD8A 3K1DA 4UM8B 3V0VA 3CFKB 2VR8A 3HE7A 5J4MA 3GF8A 5DD1L 1BDYA 1JL8A 2DIJA 4GH7B 2K78A 2OJZL 3RWDA 1CXKA 2OMVA 4URKA 5BW7A 1PMYA 2VN3A 1P4BL 5MI0B 2Z8RA 4FXGC 3STBA 5HSFA 3IM1A 1OGAD 2HKHL 3CZKA 5C6PB 1VJSA 2VR5A 3DVFA 2DLIA 2IJ0C 1D3CA 3EHBD 4NP4L 4OFYA 2NY7H 3S4SG 1XFPA 3ZHKA 4H25A 1U95A 3P02A 4RH4A 1GMIA 3MBWA 32C2A 1UZGA 2Q3XA 1NPNA 3VH8G 2UY6A 2TRHA 3QZWA 3HZVB 3FQTA 1ADQL 3KLQA 2W60B 2NY2C 4DNLA 4XC1L 3RHWK 1KWKA 4IHOA 4PHXA 4UB0H 3EW3B 4LBEB 4AUYA 3MX0A 4TSAL 3GINA 1GC1H 2WK2A 2YKLH 3DX6B 4L2LA 4Z77A 3QYNA 1MCLA 2N56A 5JW3H 3W0WE 1ZPLA 3BAYA 4H8UA 4KI1A 2VDPB 2W65B 4KQ0A 4MNHB 3NIFB 3WS6A 4OCXH 2PWGA 1GCYA 3MBEC 2ADIB 5IF0B 4MMXB 4Z3EA 3P4OB 4TSCH 1JPFB 5IB1A 2R69A 4OCSH 1CIDA 1ETB1 3DPDA 2LLNA 4MXQC 4I87A 2VITB 3TBCA 4QY8B 3NSCA 3QRGH 4KQ3L 1KLUB 4RA0C 1MFVA 4UT6H 4DP0X 4BK8A 3B2VH 2ZF8A 5GRZA 2XZQL 1SXAA 3QRGL 4KQ3H 4HULB 3U9PH 3U9WA 2X0UA 2V9QA 5J9PB 4HGKC 2VMCA 4ZAKB 1OE2A 1A7BA 4P2QD 1W72H 4CJ1A 4OLZL 2BX5A 1DJZA 1JS4A 1H5BA 3HNTL 3CZEA 4ES9A 5F0PB 2BIIA 4HH9A 1ET5A 4TSBL 4FX5A 3BZDA 3MLZL 1XTLA 1UKQA 3UZVA 5LWYH 1UHVA 2IEPA 2J72A 1CGVA 2HTLD 2WV3A 5AVQB 2F53A 4IRJA 2X2YA 2OL3A 1MFMA 1D5RA 4PI0A 4Q56A 5EUOB 4NO5B 1FG2B 4IS6B 3CDZA 2YWZA 4U7MA 4J4PA 4M5ZH 3C8HA 3ARDB 4H88H 4BZ2H 5DYFA 5F9OL 3NRFA 2KL6A 1RERA 4PPTA 1J8HE 4UUJA 2HSIA 1OCZB 2NY2B 4TSBH 1E50A 2IPKA 5F93C 3UC2A 1JZJA 2AGJH 3DUUB 4JZJA 3D5OF 4OZHB 3VQLA 3NIGE 2I7OA 3IAQA 3ASNB 4Z23A 3PP3H 2YZ1A 2VO5A 4WW2C 3BO8A 3MUZ1 2H0EA 4MDRA 5EZPA 3TIDB 2R83A 1MZZA 3Q9PA 2OZ4A 4IBQA 2B3IA 1A3LL 4K9EC 2CBTA 4Q6KA 1G9EA 1YNTA 2J1KA 2JNZA 5E70A 4OZFB 1NUNB 1V7NH 4XCFL 1EZVY 1HK6A 5C0IB 1PF3A 4XX1G 5I1EL 4B96A 1L9SA 1AGDB 2NNRA 1EEUA 5SWQA 1DJXA 3FTVA 4FCHA 3PV6B 4MAUH 3S96B 3UEZA 4V1DE 4N0UB 5D1ZD 2OA9A 2W9DH 3QNFA 2VLJB 2XG5A 3QUXA 4X9GA 3MRLA 4F20A 1NBZB 1ODAA 5D72H 1BBJB 4XH2B 2QELA 3T65A 3UACA 3UJTH 4ETYA 3BFOA 5CSZA 3IPBA 4MNQE 2J88L 4JM2A 3X3GL 1OV8A 1BQHB 5JOEA 2HFFA 5F9AC 4S1QL 4LL1A 3RX7A 4UB0L 3W39A 3SDXF 3EO9L 5EC2A 2OBGA 4F15B 4L8SC 3OKNA 4LSVH 2DQIL 4R8WH 3P3UA 1J5HA 4AM0B 1Z2KA 5HDLA 3G6JF 1TJXA 4U6VH 4JM0A 2HH0H 3LZPA 2QMJA 1CICC 1NC2B 3DDFA 1YEJL 4GKZB 1BOYA 3CLWA 4V33A 1USZA 3M8OL 4GS7B 4I13B 2ITDB 4G8IA 4JGMA 1PZUB 2KPNA 2Y06L 3QEQA 2BNUA 2ARJA 2ZOKB 3WFBH 3L1GA 2WAHA 5J6GA 5FYLD 2W95A 1MFBL 4M1GL 2NXYB 4JFQA 3OJDB 1WO2A 5E4IA 1QBAA 3RKPA 1XVSA 1ID5I 4TXVB 4LL9A 4PV8B 5C71A 1LO4L 1ND0A 1OKEA 3EJCA 4ZMPA 3PGDA 4U1NB 3TF4A 2XXFA 3WKQA 4W4OC 4ZXBA 4UTBL 3VFMB 4EN3C 4YDJB 2L0DA 3KZ8A 2E9GA 1RZ7H 4G6ML 2P44B 1RZJC 4XBPB 1I9EA 4MCZA 4QTHA 2FBJH 4G8EA 2EE2A 2GHWB 3K80A 3HOGA 1P4LB 2M26A 2DL9A 3NACH 4KKBC 4TQIA 4WTWA 5HGGS 2P9RA 4MJIB 3RY6A 3OKDB 2X4TB 4LK4A 3WL9B 1NJ9B 5I76A 3T2NL 2E56A 3N1QC 1YQVH 5IBLC 2WGNB 1NAMB 1T0OA 3DTXB 4FCAA 5DC0A 4U1MA 5DWUH 3FQTB 1IT9L 4M29A 5BQ7A 1XGYL 3FCBA 3IVKA 1GY1A 4C58B 4R4BB 5CD5D 1MLBB 4WIQA 3KPMB 4OF3A 5C0BB 3UZEC 3VTAA 4XO5A 2D3VA 2OMTA 5BV7H 1W0WA 3OKMA 1HXYA 2GFBA 3VVWA 3ML9A 5JDSB 2EEBA 1TTFA 3DSFL 1X7TA 4B9JA 4G6FB 1I9IH 1MVUA 2W65A 4P2OA 4EDWH 5GGRY 1CDIA 2GIXA 4IBSA 4KXDA 5T1MA 4PJXB 4S1RH 2V5YA 5FFLA 2BOBA 2Q20A 4FNLL 1WG3A 3VQ2C 2QQKL 1MWAH 5EU3A 5CJ5A 4PJDE 5C0AD 1BOGA 2FIRT 2OSXA 2VLLA 5GHWH 2MQ0A 3DYMA 25C8L 3B5TA 5C0GB 4DCQA 1SVCP 5C0EA 2NYYD 3H3PH 2BIPA 1KYOK 5ERWB 4N8CL 3VQMA 4NZRL 1ZA6B 1J1XL 5TDNA 2Y2TA 1J8RA 2NTSP 4DGVH 2YK1L 5ANME 4KROD 3AT0A 4R2GB 3WO4C 5IB3A 2C3VB 5I30H 2WQUA 5IHUH 3VI4A 2ZWNA 3KCPA 4NBZB 1EH9A 1O5DT 4PWHA 1A6VH 1DJSA 3M17B 4N2NA 3TBYB 3WDHA 5C70A 3U4EB 2BO0A 1OTSD 4MJHA 2K4AA 4K5MA 5CZVH 3VFGH 3QIWA 4HWBH 5F6IB 2V2TB 1TJHH 1T7XA 1MW1A 3SE8L 1D2OA 3VG9C 4H0IA 3CZFA 1AZRA 4KO7A 3B2MA 3Q2LA 2X7LA 2GIMA 5IVXE 1GTFA 1XR8A 4FJZA 5IFJB 3B7YA 4PGJA 4WFHE 5FO9A 4XO3A 5KAQF 1I9IL 3EGXB 1SXZA 4Y89A 4KK6D 1NH6A 3HBGA 4ZBJA 4EI5D 4I18A 4Y2DA 3WIHA 4F7PB 1KSRA 2D0FA 4Q4IA 3GYRA 1QLFA 1UT1A 2ORBL 1CVRA 5CFAA 4ZTOL 4X7TA 1AGCB 2E9IA 3HB3B 4M93B 4X80H 1XGYH 4IIZA 3QUML 5BRZD 3E6FB 3INUH 1AC6A 5INCB 1LK3H 3MRNB 4GW5A 3P3RA 1AG6A 4ODTL 5DFVD 5E4AA 2DEWX 3WN5C 4WHYG 1FO0A 4CMHB 3PNRB 2B5IB 1S7XB 3TL5A 2IAMC 1QRNA 1EFXB 3K81A 5FKPB 35C8L 4PH8A 3VD0A 2NY3D 1BP3B 1VLXA 1XAKA 2PP8A 2WWKO 3BEWB 1X44A 2VDRB 1MNNA 1FH2A 2OX5A 1P7KA 4KU1A 2Q10A 4MJ2A 4S0TD 1AQMA 1MSPA 1F4HA 4GAAA 1U8OB 1SHSA 5K9OA 3D0VB 2MEJB 3FTSA 3ZO0A 4K9EH 2EC8A 1SY6L 1N3NA 2Y5EA 1IBGL 5DUMH 3UJIL 1P9MA 1INDL 5AVTB 3SBRA 4FQPA 5HPOA 4GB9A 3PV6A 4FTVD 3CDGB 3IMRA 4NDMB 4B0MM 4EKXA 3ARVA 4LXFA 1VEMA 4QF1B 4B9YA 4ONFH 2ZICA 5JW4N 2QBWA 4NJAH 4KRNA 5IB2B 3VFSA 5KVDH 5L0QB 4BE6A 2AHIA 1T4KA 3E9UA 3EJYD 1SM3H 2ICCA 3HUJF 3JVFC 3MGTA 3TC9A 3ZT6A 4JPKH 4AVKA 5DK3A 1YUHA 3H56A 3QPXH 4EZKA 4FQIL 5KS9B 2RIKA 3ISYA 3VYOA 4MAYD 2FWSA 2A3TA 1C5CH 1KGCD 5CO1A 2OYMA 2ZYIA 4DAGL 2YXMA 1YZZA 5E56A 1IGJA 1DQTA 1UGKA 4N9GA 3QFJE 4AJVA 1T89A 1D9KB 3BJ91 1EHLH 4QCIB 2H32A 3CZGA 3ILQC 5D70H 4I4WA 4FFVD 5A16B 2OR7A 1FCGA 1B4RA 4PRDA 5BXFA 4F1SA 4AV5A 3K6NA 4E5XG 5D2LB 4XNQB 3RUGB 5G4OA 3C9NA 5I9QB 1EGJA 3QZMA 4O2FB 1KB3A 2Z31C 4P2RA 5KN5B 2HFFB 1QTSA 2HRHA 3K2UH 3GI9L 4YHZL 12E8H 4N2LA 1MRFH 3MYZA 1J88A 1RMFH 2FJGA 3HG5A 3LN5A 2AV1A 3FT3B 2X6BA 5I1EH 2YBGA 3GBMH 1TJHL 3ZE0F 4KTEL 1NBQA 1NMAL 1NC2A 1WWWX 3VI3B 1EXHA 4S11A 3BOVA 2XPYA 1EHAA 1MFEH 3SO3B 1S7WB 1FUNA 1RHHB 4MBRA 3FS9A 3IFNL 3HBQA 1F56A 4P46D 2MTPA 4BD4A 3SQBA 2R1WB 4XVJH 3KPRD 3L4UA 3E8UL 4U6YA 4B50A 2AI0L 4PAZA 4ZRGA 3DXAE 4LKCA 4GO6B 3WXWH 1DVFB 2O6FA 2WXRA 5BZWB 4FYQA 1VZHA 4U6XB 2Q6WA 3THMH 4BGDA 3GKWH 2CKBB 1WFJA 5FUOH 1FZJB 1RZKC 5TPWL 3ATAA 2AXJA 2C8NA 1I1AB 1NBYA 1X5YA 4OQ1A 4YAQB 1G6RA 4PJ7B 5D2LF 5DUJA 2WNKA 2HJLA 3S5LB 3ALXA 3LXAA 3T9WA 2E27H 4EN3B 2D3JA 5DJ8A 3UPCA 4JUSA 4PJ9D 2R1YB 1OL0A 1A14H 1XH3A 3SYPA 1FNAA 4I2XE 1PGRB 2R2HB 2X4PB 3VXPB 3SBPA 1U8QB 4NWTH 3IU3A 5GRUH 4FMVA 4FFZA 4LCVA 1DANT 1FIGL 2WLJA 1XH0A 5FYKD 2QV4A 4TF4A 4U3XA 2P5WA 5L2KB 1OEZW 4N2HA 5BMFH 4J2XA 5SWZE 1Q4NX 3NPSB 5D1XB 4X6BB 3VDAA 2ZX8A 3QHFL 3RB7A 1N5AA 3DBXA 3DHUA 4LSUH 4P4KC 3T2QA 2JB6A 3ROLA 2ISDA 3PPEA 1O5PA 1D6EA 3SBQA 1WIPA 1D2PA 5KYXB 1JNLL 3KYKH 4LOVA 3OMAB 3L3JA 4WO4C 5E8NB 5GRJH 1U95B 3TIEB 2ODHA 1QASA 3FTYA 3SKJH 2YAOA 4B9FA 2CO1A 3QZWB 3ZO9A 3FONA 3U9PL 3B34A 1E8WA 2V37A 2DYPB 4NZUL 2BIHA 2EIDA 5DK0B 4QO1A 2RR3A 3KCPB 2P8LB 4O58H 3WO3B 4AYSA 5E0FA 5EU5A 1PZ2A 3FBQA 3POCA 3GMRB 4G6MH 4H40A 3DO7B 1R3LA 3RWCB 2K9UA 4UM8A 4J5VA 4PJIB 2O61A 3GK8H 2E47A 2YHGA 2OCFD 1AKJD 3WXVL 4ANKA 2AJVH 5C0GA 4HMCA 2FK9A 5IFJA 1S2EA 3H9SD 3PGFH 1OCWL 2VIRA 2ADFL 2GJZB 4HV8A 3N06B 5L8KB 3KGUA 4MLSA 4QXWA 5ERWA 3UTSB 1KTBA 2WVTA 3CX5J 4QAMB 3WG7B 1VCBC 4Q9CA 2EDKA 2IQAA 1BAGA 4UTCA 1QFWM 1C5DB 2D3NA 4KRPC 1A6UL 1AAJA 1MREH 3DX2A 3TT3L 4PCTA 2NXYD 1VESA 1ZANL 3UYRL 2RCSH 2VLKE 4XPGH 4Y4HD 1QRND 4PJCE 3GRBA 4WV1C 5C08E 4QRQA 4RVBA 3X14B 2DQGH 1WA1X 2PYEB 2GUOB 5I18H 2EIKB 1UKTA 3SDDB 4CVUA 1YEJH 1LO3H 3OB0K 3O8XC 1QAWA 1YUKB 4RESB 1MHPL 4GW5B 4ZMTA 4XMPH 1LILA 2HUHA 3CZFB 5EZLA 3WIIH 5CN2A 3CPLB 4IGBA 1NEUA 1SBSH 5AW4B 2DMGA 3MNWB 5AKSA 3B43A 4M4PA 3TEXA 3CXDH 5TE4L 3QQ3B 2FVNA 2G3ZA 3IKCA 1Z9PA 4HA1A 1OAYH 2H47C 1Q0XL 4ZW8A 1J8SA 4K71C 1OE3A 2WQAA 1G9MC 4L37A 2E7HA 2H9GB 1RJLB 4UQ2B 3U1SH 1WSST 5JR1L 4XHJC 4F7MB 2VN7A 5DJZB 2YRPA 3MRRA 4N0UE 4KJWC 4D3CL 2L7QA 3POHA 4R0LA 3ZDYB 5DS1A 4F9PC 2R9HD 4JPIB 4GW1A 2O5YL 3D9AL 3SDAB 2ARJQ 2X4SA 1LDSA 4M7JH 4XOCA 4AVIA 1MJUL 2HRLA 3DVIA 4FZEH 5AEAA 1D5MB 4KNTA 2JSFA 1UC6A 1JE6A 3QORD 2F18A 4NCDA 5IBUB 4UILL 1DDHA 3QT2A 2FX8H 3UJJL 2MOQA 1MHHB 4ACPA 3ZZSA 5JMOC 4N9GB 2HPTA 2HFGL 4X98B 1RL1A 3DRTB 5FYJL 1Z9SA 1Q1PA 2CA4A 4KV5E 4Y2LA 3QIWD 1DQDL 2G5UA 2ZOOA 4OSUH 4HQQL 2VLKA 4YSDA 3BKJH 5EOQH 4ENED 2CJSA 4RMRA 1B0IA 3Q5TA 1S7QA 5F9OH 3GSOA 1D6VL 2GJ6E 4WY7L 4F33A 1AD9B 1ZLDA 5CBAA 3ARGB 3TCXA 2JJTC 3T71A 3DI2B 4JFZH 3BRFA 4ALAC 1V05A 2NYZA 3I9PA 4XGZA 3TVMA 1BBJA 5JQIB 5BOJA 1IGIL 2UYLB 5T3XD 2FT6A 4H1LG 4X4MA 3V0AC 3OLGA 2F61A 4ZFFB 2WBJB 1HXKA 2J73A 1DQDH 2BVQA 1BQHG 4JFYB 4PVLA 3TBVA 4PUBL 2QADB 2O5XL 5GGVL 3O2WH 5BRZE 2C9XA 1P4IH 5EC2B 1M6OB 1BVKA 2I24N 4KMTH 2R29A 4HJJH 1KJMA 1L9PA 4WU5B 4AM0A 2QPUA 4N90E 1IO4C 4YDIH 2APBA 3D4YA 3EOTL 2Z1PA 3GSVA 2WY3B 2MMXA 4WAFA 5LBSH 2PTTA 3EDFA 2ZCLH 1F3DJ 2PP7A 3A4FA 3Q8FA 1AHWA 3O9WB 4GP5B 4P9ML 2ZUSA 3QEQB 1U2YA 3A22A 3QCUL 2VISA 4YUEL 2I85A 3BP5B 2A6JB 2FGWH 4I77H 1B4TA 2P7TA 4WF7A 2CNYA 2KPWA 2HT3C 1KULA 3VI3A 1U8QA 3TBWA 4OF5A 1JUFB 1UCBL 1WEJH 3NOIA 4C4UA 3D0LA 1NKRA 5ETUA 4KAQH 5HHOE 5B7FA 4PVNA 3BCDA 2EC9T 5DHVB 4Y8DC 2LVEA 1KPRA 1N5AB 3MRKA 2VQ1B 3JTSB 4O2EA 4QR7A 3DX0A 3EJSA 3GXIA 3PFUA 2OW6A 3T0ED 1IM3A 2PCFB 3HRZA 5GGTH 1Y6NR 4NFCA 5C0CD 4E9LA 1K85A 4OZFH 1XCQA 4L2YA 5F96L 5KSAB 4LE8A 4MASA 1TVBB 5DQDL 2X2UA 5I18L 4JFED 3AW5A 1PZ5B 4MJIE 5KSBF 3RVUC 3MSPA 1AR1B 4H13C 1KJ3H 1JNHA 2DQMA 5JOFA 3NT0A 1GYUA 5HD8D 5D1QB 2X4UA 3QNZB 1YSOA 4A7TA 4XCEB 5IB5A 2GBUA 5ENWB 2C1PA 4W9EC 3FB6B 1JOIA 1YEGL 3KW7A 2A1WL 4S2SB 2Z65C 3L3GA 5I0VA 1JXFA 1DBML 3X1BA 5T5FA 2K0RA 3E6HB 4R3SA 3KW8A 4KROC 3VU1A 4BQBA 1A6WL 1RZJL 1JZGA 1A1NA 3U46A 4E9XA 1HXMA 2NYYC 3AROA 1CZ8H 1EMTL 2BOCB 2KH2B 3OAYK 4LHUA 3DBSA 4PJEA 4YC2C 1KXVA 3FQRB 4YPGA 1VENA 3QFJA 4L18A 4OJFL 4WUKH 1JPEA 1KJ2A 3L1EA 3RNKA 5D1ZC 3MLXH 1HKLL 3P3TA 1JGDA 2Y6TE 3FPXA 2ENQA 1U3HA 4KJQC 3Q8EA 3VFTB 4PJFB 3CHQA 3MNWA 5AVUB 3HG0A 3K2MC 2PKDA 5KVFL 1IC0A 2D31A 1T5XB 4IIQA 4BSVB 2NW3B 1Y18B 5F7LB 4YZFF 1KMGA 2XWXA 1NUFA 2R69H 4U1LB 2HT3D 2YO3A 3V8OA 3ETSA 4U33A 2LU5A 3FC8A 3HVDA 4QRQB 5I16B 3QUZD 1PAZA 2OTPA 3G6JB 3U4AA 1H8SA 1AO7E 3FMGL 2RJMA 4M8VA 5FCSH 3T0BA 3BIBX 3EGXA 1E27B 1DBMH 4K5PA 1FAIH 4ZX3A 1OGAB 1P1ZB 4JO8A 2Y7QA 4JPIA 4JR9H 4MCNA 5FR3A 2YPVA 4OM0L 3VD1A 4JFOA 2ZE0A 3W57A 1YAIA 3OKLA 4ORGB 5C0EB 3N9GL 2HLFC 2ESVA 1RZ8B 3GMOA 3APCA 3IB4A 1MLCA 1R3KA 2WLLB 4MMZB 3AS0A 1PW3A 1BYOA 1ZV5A 1Q9LA 1NAML 2ZAGA 4ZQKB 2CDEB 4X9IA 5TQ0H 4I3GA 1CL7H 4L5FL 3LKRA 4R7DA 1MHHA 3SPVB 4TQ8A 5HBBA 4KQ4L 3S3JA 1LP9A 3G04A 4WI4A 4ANWA 4IOFC 2EACA 1E67A 3PHQA 5DJZA 2XV0A 3VW3H 3QXAB 5D4HA 2OMUA 3WD5H 3DLQR 4F7TA 3DV4A 2ROYA 5H94B 2GTZA 1V7ML 3NZUA 4X4XA 1JDAA 5BO0D 2I5YL 4PGZA 3ZKMC 5CCKH 4ZQTA 1E3FA 3VG0L 3VXRA 2CR6A 2OR9H 2VUYA 1J0ZA 1OAQL 3JXAA 3HFML 4J3XA 2E0PA 3EJYC 3MREA 2UUDK 1MI5D 1V27A 1AP2A 2Q7YA 2B9BA 3QDME 4NYLB 3T0EA 3ABLB 2Y36L 1CDUA 2PTUA 5D71H 1WUZA 4Q2ZA 5C09E 2DAVA 2F53E 4AE1A 2MHAB 2UVEA 3FDWA 3JWDH 1SQMA 1EANA 4NS0A 2EXYC 5J56B 4HOMA 1RAMA 4P23A 5I24A 5JOPE 4KZCA 2FECL 5F7DB 4XNMB 3L3KA 3CN2A 2I60L 4P2AA 5DVPA 2ROXA 1FLRL 1FJ1B 3BPNC 2AJSH 2H3XC 4XX1E 3KYMB 3U30C 5B7EA 5J89A 3DPBA 1A9EA 4R26H 3G5VB 2J6EA 1QRNB 5FKPA 4Y1AB 3TU6A 3RTQB 1YNLL 5DUPL 5IW3A 1MVYA 4ILDA 5IVZB 4UZGA 2PYED 2HJFB 2QT6A 2XVGA 3BW9A 5IWLC 2E5EA 3VAEA 1QZ1A 4POZC 5I1IH 2VO8A 4LEOA 3OHXC 4NQED 1F00I 3OVUB 3FFDB 4FHJA 4IMKA 4JEGB 5BZXA 2XIIA 3I2CL 3SBWC 4XVUC 1U8JA 2Y69B 5DVNA 6CGTA 1CXFA 5HDBF 4XNDA 1R5IB 4HG4K 2B08A 5B39B 2BSTA 4JLRB 5IJKA 2VDKB 2YMXL 3HS0B 2BWDA 2WC7A 1HWHB 2XWEA 2ADGB 3CFQA 2G2PA 3GSUB 4UV4H 1OSYA 2WIIB 3VFOA 3SE9L 2ADJA 4C56E 2H0PA 5LGJB 3EADA 1HIMH 2X41A 3QUYC 1XL4A 4G9DB 3BRGC 1P7QD 3CNKA 1R24B 2Q76A 3JTSA 3H55A 3Q43A 4O2EB 3GD1C 5HDQL 1G7IA 3UDWA 2KERA 5BV7B 4HMEA 3SB3A 2GEQA 2Q86A 5FA4A 1K5NB 2HJKA 4OFKA 4AK1A 3KGTA 3M7OA 3WFDL 4DZBA 2XSKA 4N1HB 2FL5A 2ATPA 3BYYA 4JY6B 1L7TH 2OMXA 1XSIA 5EUKB 4P9HL 3TBWB 3NJJA 1F97A 3H7BB 3LZFH 3UMTA 4K3HA 3APNA 3WV0A 1OF2B 3DHMA 3SPHA 2FHFA 2BVOB 3R06A 4M7KL 5EC1A 2X4NA 1XL6A 1XH3B 4F3FB 3RDJA 3GC3A 2A74A 3MLRL 3H3BC 5EN2B 4OIBA 4C56B 3EFOA 1KXQE 1FN4B 1KBKA 3RGHA 3DX8A 1LNUA 2K8MA 3TO4A 1JZ8A 3PL6C 3F85A 4L1SA 1VGEL 5B1KA 5L4FA 1TJIL 4H1LH 1A6TB 3P4OA 2DQ6A 4HUKB 2NY3C 3IPFA 5H37G 3MC0A 3WMSA 5AAMA 4JREB 4P2CG 3AB0B 2XBDA 1RCYA 3P4LA 5IUCA 5LCVL 2WYHA 3UIZA 4LHUB 1PZ5A 1SEQL 4AYFA 5KSVA 3MJWA 3RVVD 4GI8A 2B15A 1SGKA 1QNZL 3UTOA 7FABL 3CLFL 4NOBA 1DVFA 3RPIA 4U6XA 3BZ5A 3ESPA 5D7KD 4ZAKA 3MZTA 1M7XA 2LOEA 5F7UA 1A2YB 5C0BE 4S2SA 1DVUA 3L3GB 3TNMB 3NCYS 4DZ8B 4H1LB 1WPCA 1CGSL 5IK3B 5L6YH 1XGQB 3C2SA 3MV7D 1G7PB 3ZT7A 1J86A 3PHSA 6PAZA 4P2QE 1QACA 5KANI 3N44B 4P9HC 3L5IA 3L9YA 1WRFA 1MREL 5HGAB 4XVUD 4PGCB 8FABA 5DLML 1QSFB 5HYJD 4ZOAA 1H3VA 1WT5A 5F3FA 1VERA 4FQHB 3FQ2A 4Y4FC 1WWBX 3OR6B 1TFHA 3GI8L 5KOVC 5F2FA 1LEKA 3VWKA 3IFOA 3QULA 4MD5B 3HMWL 3MXVL 5I82A 5IROC 3ALPA 3AREC 1U3HB 3MUY1 5K1JA 4K8RL 1HE8A 3SY0B 4DP8X 4OZIE 4WDIB 4M6ML 3MTRA 4NO2A 2HCZX 1BGXL 1DUYB 3AU1A 1DHKA 3LPPA 4OJAA 4WWKD 5EDSA 2H8PB 3H9SE 4CU6A 5FDWA 4JKWA 2V7NA 2Y25A 3ULSA 1U8KB 2Y07H 3RU8L 3IDMB 2BNRD 5E2VL 2ESVE 4HLZH 2ALAA 3B7TA 5D2NC 1WP6A 3G5ZB 5I6XB 1BZOA 1CR9L 3FCGA 1KFGA 1MQKL 4BZ2A 1K8IB 3EFFB 2W9EH 5BV7C 4U49A 3UG5A 4LMQI 4HFUL 4XCNB 4GG8B 3BKCL 4EOWL 4J7RA 2MNUA 1FNLA 3PJLA 1BQSA 2V3FA 5I19L 1X9RA 2EQDA 3LEXB 4HUUA 4P48A 4N0UA 4LQ1A 5FF6B 1GW0A 3ZL2A 1NMBH 2ZP8A 1NBZA 1N59B 3O0LA 2AABL 3AFLA 2R1XB 3B5HA 3OL2A 1UFUA 4IK7A 4JGJA 4NWTL 5GRUL 5B1JC 3ETBJ 2VDMH 1M42A 2FWOB 4G8GA 3WKML 1GPOH 4JO5A 1A0QL 3LRMA 1JZ5A 1WE5A 3TWCL 3QXAA 4RWHA 5F7BA 1IEAA 4RRPG 3BAXA 3OQ3B 1N64L 1DDHB 2X3AA 4ODWB 4XXWA 5FYKE 4NQVA 5H2BA 1T66C 3REWA 1KGIA 4IGBB 1JRHI 4GIOA 2R56L 3VXRB 5DMGC 4BFJA 4JDTL 4OB5H 2PYFA 4PJAA 4L29A 4B3VA 1NC4D 5KZCB 3BWAB 1BVZA 1FFPA 2L7UA 3O6KL 2HVJA 3MV9D 4DP2X 5FGBC 2J88H 1JGLL 1UB6B 4BQ6A 1R33A 3VWJB 4M93C 1S9WB 4G7VL 2VMFA 3OAWA 2DS4A 2EZ0C 3KBFA 5E2UL 3HE6C 3HLKA 1KTLB 1ASPA 1X5FA 4FJYA 4D2NA 3A67H 1RUKH 5F7DA 1QKZL 1PY9A 2XUWA 3APMA 1L7IL 4TLUA 2OMWA 1NQBA 5MHSD 3IS1X 3CFJB 1UG9A 5GGSA 2BW4A 3KYMA 2HMID 4KTDL 4XXCA 4UM9D 5GS1B 2R0LH 2VR9A 4ABWA 1ZY9A 4Y4FB 5DGQA 1PZAA 1WFUA 2ZX7A 3BD4A 4M43H 2VC2H 4Q6IC 5DFAA 4HKBA 3QXUA 5DRNB 2CMRH 3OKDA 2DQFB 1SJEA 3EBGA 2HX7A 2WTOA 1KXQA 5IQ9B 3OMIB 1XB6A 2XWCA 1IE4A 1MAKA 3O11A 3CC1A 4KZDL 3O4OC 1BFSA 1YY9D 1ZSHA 1QWHA 1AJ7H 1EFXD 3RY5A 3D18B 2ICES 2A4CA 5E8EB 3UGUA 1JXKA 1KXHA 5JZ7D 1ND0B 3LX9A 2Z1KA 4WK4B 4HUWA 1QMUA 3GXMA 3T4YB 2EYTB 4WCYH 1Q8MA 2K6YA 4JL2A 4ZFZB 4AQ1B 3VFMA 3BWUF 4OF8A 3QFJD 4YHLL 1XHHA 4LARL 2GFBB 2LFEA 3LH2H 2IAMD 5DK2B 1Z32X 4R84A 3F01A 3KHOA 4PJFF 4P2OB 3TO4B 1FPTH 1NJ9A 3T1FA 1YEWA 1SYSA 1T6BX 4ZG1A 1UADC 4UBDD 3QO1B 4KK9C 4PN6A 4CMMB 4ZO7A 3LPGA 3SE6A 2Y4SA 3PNWA 5HDBE 4DKTA 2C7UA 3GZKA 2FIKA 5GJTH 3BGMA 3GKZA 2CO7A 3RURA 2Y7SA 3ZDXB 4R4BA 4AYFB 1TTBA 5AAWA 5F7KC 1MLBA 5B3JF 2XBZA 5CBEA 4BQCA 5KSVB 1MCQA 3U4BL 2ZIDA 4BHUA 1HEJC 2HG5B 4H5SB 3CZNA 4Z78A 4O51B 1U4FA 3S98A 2V9RA 2Y07L 5JXAL 4KJWD 5IR1B 2H1PH 3DXAD 2DQHH 5TFSL 1EEZB 3KYNA 3SKMB 3OHMB 2ZF9A 3TNMA 4DVBB 3F5WB 3SE4A 5I28A 3NABH 1S9VB 5CNHA 4L9LC 5D1QA 2NZ1A 3QXDA 5ENWA 1RP8A 4WKZB 4X4ME 4X9FA 2VZUA 4G59C 3VYPA 1K9TA 5JHLH 4AYID 4ZUTB 5BJTB 2HP4A 3DMMC 2BP0A 4R7NB 2QKSA 3GI8H 3ZQXA 2JQMA 3D4GA 4U0RC 1KN2H 1HXMB 4QRRD 5I0XA 4Z7OE 5AVYB 1QQDB 1G9ML 4AI7A 1SXCA 3BPCA 1JPTL 4P2RE 4N0CC 5DJAB 5T1DH 3OPZL 3DIDA 1ODUA 4OJYA 4Y2OB 3H53A 1S9KC 3CH8A 3WTTA 2TRYA 2D4DA 4NC2B 3N6YA 4AXWA 5EBGA 4EQ3A 1ZXQA 4FA8A 1BVLA 1OZTG 2ED9A 4GUCA 2F1AA 1TVBA 1QSFA 4B60A 3IDMA 3SYOA 1CDHA 1Z6JT 1C8PA 4J3OD 2P3YA 4NBYB 4DETA 4XPBH 5DVKA 1XSOA 3UC0H 4L8SB 5DT1L 2M1KA 3EFFA 5J06A 1O7VA 2QKIC 4JKPL 1KGXA 2J7LA 1AGFA 2GEEA 1OWRM 3DURB 4H8WL 4NKIL 2IWFA 3CLEH 3ZGIA 4DK5A 4UBDC 3GRWH 4EI5C 1HHHA 4L1BA 5FYJU 4X6FA 2R1XA 5FB8B 1YMHA 1KN4H 1T1ZA 4WHCA 2EUVA 2IFFH 3RL2A 1AO7A 4QXVA 4YXHL 1KC5H 1YPZF 4Z95H 2HFTA 1KTJA 3PXLA 2IOMA 3QWOB 2P5EA 4JO1L 5CIPB 1JRHH 4JY5L 4L4TB 3VFPB 3GSNL 2DMHA 5DC9B 4LU5H 5DZOA 1K8IA 4X7DC 2FD6L 4LGPB 2DTSA 4D0BB 2XQYK 4P59H 3CVIL 2IBBA 5EB9A 2XZAL 3GSNH 4MSWA 1U93B 3W81A 5FYKU 3NYKA 4TLTA 4I4WB 1IAIH 1OCRB 1GYVA 4XNUL 1A1MB 1JD9A 2WINB 2V3DA 3KJ6H 5JORA 5JW5B 2MNWA 1Q0EA 4DVRH 2KZKA 2GI7A 3BUBA 3IDGB 3PDDA 4PW3A 43CAA 3KWUA 3PV7A 1UXLA 3WJLA 2FJGB 5E5LA 5IHHA 3FQ1A 3S8FB 2X4RA 1PLGH 2J8UE 4OM1H 3MV7B 2YMTA 2HX9A 3A21A 4AJ0A 4BSWB 4LSQH 2O30A 1AGBB 3ME0B 2PNDA 4I0PC 4JFOB 1MFBH 5DT1H 2FGZA 3PWPB 1Z66A 4P2QA 5HYJB 1F2XK 1JK9B 1FZKA 5D7JB 5I1KH 3HNVL 4XN5A 1GGBH 3RL1A 3SKOB 1O75A 3BWAA 3R4DA 3SQBB 1FGVL 3EHBB 4E42A 5IGXL 3KPSD 3VXMA 3EYUL 3HNSH 2PF6A 4RSVA 1NIDA 4F7EB 3MA9L 3ZDYF 3VDBA 3NDZE 4O2FA 1QWUA 4P2RB 3SQRA 2Y22A 4OJDH 3LKRB 3L3OB 3ZHDA 4N4YB 3QDJA 1ZLWK 5H4YA 2YUZA 3D18A 4LOFA 4XPAH 4RWYL 1F1AA 5DMKB 5JMRA 1ZK9A 5K9KA 1MJ8H 1AKJA 4OGAC 5CKGA 1PAMA 4NI6A 1I1YB 3ES6B 1B4JL 5EZIL 1MWAB 4WWKB 4NCC2 2Z93B 3T77B 7PCYA 2FECI 3O3DB 5GRWA 1AMYA 5HJGA 4W9JC 1L9MA 1PY4A 4NGHL 2R4SH 1G9MH 3KBEA 5T3XH 4X4KA 1FNEA 1KENH 4JN2B 1T2XA 4P2YA 1CPUA 1E2VA 5SWZB 5DRNA 3AT8A 4LSRL 4WI7A 5DJ0B 1A6ZA 2RD0A 3AG3B 2W8CA 3SGEH 3VFWB 2AANA 3EDDA 5KSUA 5EPMB 2I9TA 1CFVL 4AL8H 1T83C 3SDAD 3FPYA 4GXUM 1OSPH 2IGFL 5TTRA 5IT2H 2AQSA 2C7UB 6FABH 4PM1A 4LRNH 1WFOA 1M71B 2FGWL 4I77L 3VGHA 1LQBC 3FUIA 1J10A 1G7JA 4Q52A 3B6SA 4BDVB 5KYYB 1A7NH 1FFTB 3ETBF 3WTXA 3SE3A 5E6IA 1ZGLM 2Q86B 1TTUA 2P45B 1FFNA 1K4DA 2G60L 3G5VA 4Q14A 2H1PL 3ZDZE 4DKDC 4LVHC 3T4AC 5TQ0L 3ECUA 3MRGA 1QNIA 4YDIL 2QPDB 4MNQB 4ADJA 4HCFA 2YPLD 3RDTA 3FOLB 5DJYB 5KSAC 4A2EA 3KEDA 4K3JH 4MKMA 4Y5VC 5D7IB 5DUBA 2O5NA 2Z8VC 3QQXA 3K4ZA 4OLEA 3AQYA 3MJ9A 4F37F 1BXAA 1E65A 3AZUA 3NCJL 4PJIA 3VD3A 2NX5B 5JNYA 1LO2L 3WFEL 1FAIL 1JPSL 3T1WA 3NAAH 4B7IA 4ELDA 3CK0H 5I1JH 5LHDA 3TIEA 1R3IL 1B2YA 3D25A 2ATKB 4XR8C 2P28B 2JVUA 3CQFA 1KELL 4L9DA 4PG2C 4NUQA 3S4SB 2DQCH 1CLZH 3IDYB 5KS9F 2BCKA 5FYKL 1L3NA 1HZLA 4PREA 3S0PA 3P77A 3MBXL 3GSRA 1AIFB 4PRNB 5D7SL 4BWUA 2HT4C 2XI9A 4OLZH 4GQ9H 3RVXC 3ZE2B 4N3TA 4PTUA 4WRLA 2G2NA 1IGFH 5CWSA 3WTUA 4Y4FD 4LLWA 1L4IA 2FD6H 2BP8B 5F9JB 4MB4A 1ORSA 2IPTL 1F6AA 3H4HA 3T8XB 1SLXA 5DD0L 1E6OH 3LDBC 5FX3A 2NR6D 1ZRUA 1QLEH 3L08A 5JA9A 4KV5F 3ARED 1G7PA 5KS9E 1U2HA 1HXYB 1PG7X 3HG1B 4G42B 1IBFA 4HC1L 3IS0X 1VFBB 2HAZA 2QLYA 1RJZB 1AQHA 3EZJB 4B9GA 4L3EB 2P5EE 3FQ4A 1E9QA 2E9JA 2G9KA 3U4BH 3Q1EA 3NVQA 3NCEB 5T1MB 4LLVB 4X5WB 5IROD 2KBGA 4RX4A 2JK5B 5EHFA 5INDA 1D5IL 1NCBH 4Y16C 3KAAA 4EAEA 1DTUA 3IFOB 4FQJL 2VLJD 1TJGH 4FFZL 1XZWA 3BHBB 5F3HB 1WICA 5I66B 2UZYA 1RIVL 5TF0A 4D8PA 5DQJB 3RL2B 3SKUD 5B8CB 4RGOL 2WMPB 4QYAA 5DFWH 1HCVA 3PQYE 3C60B 5KYUA 4KKRA 1KJ3L 4RDQF 2XQBL 3L4YA 3LH2L 5DJ6A 1ONQB 1PG7L 4FXKC 2FEDD 5IW1B 4F7CA 3IDUA 1WAAA 4KFZC 4TUOB 5CF3A 3G5WA 1JD7A 1N64H 3FFCD 2ZWZA 5J12C 3L3HB 3GSQA 2ITCB 4MXVE 1NC2D 4NZTL 3M17A 4QD2E 3TNNA 1EWHA 3RWJB 4YNYB 4A2FA 4YFEA 3SN6N 2E4FA 4HWEL 4OUUA 1XGQA 3TBBA 3QUYD 1UOKA 2PR9A 4OF0A 1RK7A 5CSBA 1E3XA 1HL8A 3T3PE 4Y5XB 3RKDD 5D8JL 2YWYA 5T1DL 3W0WB 1LE5B 4AH2B 3AM8A 1HOCA 8FABB 4QXUH 3UIYA 4FE9A 5DR5H 5CXPA 4BQ9A 3L4ZA 3FB7B 2YARA 1RJYB 3CMOH 3PLYA 3KPPB 3PPSA 4KITB 4PWKA 1UASA 3L3IA 1K6QL 4JRYA 2W94A 4RISH 1WZ1H 2EXWD 2SEBB 5C7ZA 3CN0A 4XNXH 3FHQA 4K0OA 3VXUB 3N85L 1F5WA 2R2BA 4LPXA 1BLIA 3QAZB 5CLZA 4XBGA 4KTDH 3GB7B 1KCLA 1NBVH 4XZUA 4QLWA 5L88L 3CZJA 5CEZD 3RGVC 1FAKT 2JB5H 3P69A 4YOKA 2A6IA 1OTUD 1ZWIA 3JWNH 3LD8B 3NFNB 1U93A 4GMTH 1T66D 1EZVX 3G08B 1N6QH 4HLZG 4JFEA 3OF6A 5DZLA 4YFLI 3RFZB 2UZIL 3HHSA 4BZ1L 3CDFA 4B0MB 5GGRA 4LHQB 1QPPA 5E6SB 4BUHA 1ZVSA 3C5ZC 2APTA 2PW2A 4HEPG 5F0JB 1MCRA 1JCVA 2DM3A 4GBXA 4MRCA 4U31A 2DBLH 1WHOA 3UEQA 5DMIL 5I6MA 4IRZA 5CLTA 3UPAA 5E6YA 3L1OH 2GJRA 2Z8SA 4ENEC 3SQOL 4K3EL 1E4WH 1ZHLB 1CDYA 3WS3B 2OK0L 3KPOB 3V4VB 1OAZL 3HPLA 4K2UL 3HUJA 4KUZH 3WE6A 3CDGA 2B0SL 3HR6A 1AIZA 4XOBA 4HKXA 4AQ8A 2OW7A 1FPTL 1XIWB 3H9HA 2XWZA 3OGCA 4FQ1L 4YXLL 5GS2H 4UV7H 1CLVA 5IG7A 4WU5A 1R3HA 4PI2A 3MGTB 4Y1TA 3MCKB 4PD4J 4NQCB 1D7BA 4FNQA 1NCGA 4LLDB 3QNXA 4TLKA 2B1AL 4AKOA 5L6YL 2ZP9A 2XX1A 2E27L 2JKNA 4GRWB 3WFHA 5E9NA 2CGRH 3CAFA 5ICYA 3BP5A 1YN6A 4L1HA 1J0JA 1JZ2A 1LD9A 1JI1A 1OCCB 2G5BB 3QEGL 3JQOB 3NEOA 4K3EH 4YBHA 1MCIA 1M2OA 3GTVA 5FHAL 2EO1A 4AQAA 1ZTMA 1YEDB 2ICEB 2PMZA 3QWQB 4UILH 5HGDA 5HHXL 4I5BA 1V3KA 3I6LE 2IGLA 5J1AB 3SYAA 3L54A 3FOLA 5DJYA 1MW2A 5KW9L 1RUQL 3KMDA 5HVHC 3JT2A 4WEBL 4CU7A 2Z8WC 4AQ1A 3NJFA 4ERSH 2Y7MA 4L4TD 4M7JL 5ALCH 5KEZA 1YJDH 3WYRA 1ACXA 3CBJB 5C3TA 2OMZA 5CEZH 3I74A 4FFZH 4ZO9A 2PCYA 3R0MA 3IXAA 1ECYA 1O7DE 1S7RA 1CDJA 3GXNA 3WIHH 4MNHA 2KMWA 4YBLC 3ARFD 3PWNB 2ERJB 4CNIB 3MODL 1QI5A 5E6IB 1F3JB 3QO1A 1TYRA 4H26B 1A6AB 1U8CB 1U8MA 4KO5A 3IDJB 4F8QA 4ZUUB 3FH8A 2ZWLT 2EJ1A 4R5TA 4D9RD 2GG1A 5HP5A 4ZW7A 2F5AH 2BCKB 2W88A 4JE0A 4MCMA 4NNPL 3F65A 1T7YA 5D5ME 4TNGA 3S36X 1SMAA 5ISZA 3CXDL 3VXQA 2ODIA 4NQDB 4QYOA 1MFNA 4HGWB 4L48A 3F00A 4M6OL 1ZXKA 4MLIA 4Z78B 2Q6WB 1PJWA 3VI4F 4PLJD 4WI6A 3RTQD 4JQIA 1MKFA 1ZHBA 4HWZB 4TNVK 3PWPD 1UD8A 2G3XA 2AJXH 1S5HB 3QUKB 3MBXH 1MDAA 2DBJA 3OSKA 4HX1A 5FPIA 1BLNA 3KPSB 4IEFA 4OCYH 1DSFH 4UINL 1OIOA 3ZTNL 2GI0A 3MI6A 2CUIA 4GFTB 5C09A 3NJLA 4LPWA 1SJHA 3HZKA 1NEPA 4XRCA 3IDIA 3WDIA 1QNZH 2Z4TA 3OAYH 4G3YH 4L1TA 4P5TB 3WFCL 4JGUA 3QZPA 4TVPH 3IFLL 2HTKC 3SO3C 4ONFL 3EO1A 1T2QH 1N9PA 2CHXA 3V0IA 1YAZA 2CCWA 5D1XA 3G7TA 1PD1A 3O2VH 5DI8A 5D7LB 4UQDA 3HKZA 1SY6H 1J0HA 3BGMB 1P7QB 1W2KT 2UZYB 4D8PB 1HCZA 2WZ6A 4GJTB 5EU6D 3CH1A 3X1GA 5ADPH 3VWJC 2M8XA 4IIQB 4K94L 4Y9FA 4BSVA 1Y18A 1YYMH 1AQKH 3VMNA 5E23A 3RFZC 2DQUL 1XF2B 4XAKE 1Z5YD 1CG9B 4YX2L 2PO6C 1VF5C 1BPVA 3SOBL 3BPOB 1QLEL 4JFFE 2Z7UA 4MXWL 4YBQC 1E5ZA 3GSQB 1PYWA 2NUTA 3F7KA 4ODUA 1E27A 3T09A 2C9VA 1Y7VA 1P1ZA 4MS6A 2H0FA 3QEGH 1UJTA 1OSPL 2IGFH 4MDJB 5HJ3A 3FUJA 3HMWH 1HNFA 5D96C 2F54E 1MUJA 1CYGA 4HOXA 4UU9A 2X9YA 3S5ZA 2ESVB 2IALA 3S96A 1RZ8A 1TQBB 4J12A 1YEHL 1NPUA 4Z3JA 2DL2A 4TQPA 1HYRC 3TZVC 2WM0A 4XCCL 3EBAA 3K0YA 5EO1B 1BQUA 3TA3A 3CVBA 3P73A 3L3HA 2CRMA 2EINB 2PYEA 4ANVA 2OTUA 4DF9A 1DQQB 4TVPE 4ZUSB 1T03L 1FJ1A 3PHOB 5ICXA 1N0XH 4PMFA 1QSFE 2TSBA 2WN3A 1J8KA 3QDGD 5CJXA 4TL5A 2XJLA 3MRMA 3K8MA 2HB0A 5D2NB 5ICUA 1AGDA 3MA9H 3ZE1F 1I7UA 4F8TA 1WIOA 1JWMB 4CMHC 1CD9B 2B1OA 2ITDA 4G8IB 1VEOA 3IJYB 2O5ZL 4XE5B 2O1AA 4FNTA 5PCYA 5HYSB 4F9LA 1A3RL 5I1KL 5T1JA 1QABA 5ANMA 4PJ9B 1JHTA 4TPRH 2WZAA 3VXSB 5HJBA 1XZ0B 4PRAA 1AOZA 1EHXA 3LZOA 2OZNA 3KH3A 3QDAA 1PKOA 1AGFB 3LQAH 4G2AA 3WE6B 3WEMA 1D5IH 4FI7A 2BLFA 4ISVB 1XF3A 4ZPVB 5DS8A 1UWEL 3B8YA 2VDNB 4EDWL 1CB4A 1IGYB 1S7SA 3N1MC 1FO0H 4KPHH 1E0OB 5L88H 1MRFL 4AYMC 1UACL 1KLFA 3TFKC 5HDBB 1N7ML 2J56A 4WTQA 3ZR6A 2D73A 4P05A 2XVBA 4NQCA 4UIKL 1HEZA 2F74A 1IKNC 4Z7QF 4JAMB 3QHZL 1B6DA 1A3QA 4XMUA 4LCCB 4LCWE 4ATTA 5LDSA 2JCCF 3MROA 4J3UA 2IG2L 2HJFA 2NXZC 1KBGH 1E6OL 3FQUB 4FXLA 5DHMC 2HJKB 4YSAA 1LD9B 2F58L 4ZX5A 1YYCA 5CAYB 5E99H 1DZ0A 5DWUL 4JY4B 3V4VA 3R1GH 2WVUA 4PHZA 4P3WA 3KCWA 4H2CA 4NO0A 2WKOA 3SSGA 3ZQ9A 4OR1A 3WD5L 1GS6X 5HGDB 3KPQB 5AZEH 3LKQB 5BZZA 3ARRA 3ARXA 3C60D 4TUUA 1K4CB 3IJEA 4GSQA 3STZB 4KQ4H 3ZJAA 4R96A 1CL7L 5J57B 1JXJA 4QGTA 4WHTA 3SGJC 1JBJA 2E46A 4U1GB 3FB5B 4CILA 1D7FA 2XOTA 4MA8H 2LV4A 3B4NA 2GSIA 2CIIA 5KVDL 1CXEA 4UV4L 2W0FA 2CLRA 4PJBF 1IVTA 1AHKA 2YMXH 3Q05A 2VDPH 5EA0H 2YS4A 2WQXA 5DRXB 3Q2CA 5FA4B 1K5NA 3UTSD 1FDLL 3FULA 2EVHA 2DY2A 3UBXA 2V6HA 3D51A 3WAJA 2XPGA 4MD4A 3PWPA 3QSKB 4P2QB 4OCLC 3OKKB 3MNZB 2RGSA 4RAVA 5CS7A 3DROA 4DCQB 2A9MH 5I6LA 2A99A 3NP4A 3OJMB 4KDTA 3ELAT 3D2UB 3QUZA 1PX3A 2X4NB 3MRPB 4F3FA 4DVRL 4HUCA 4HS8L 1ZT7B 3RPIB 2XV3A 3MNVB 3MR9A 5IBTL 4R4NC 2O6PA 4Z7VF 4Y8AA 4IK6A 4JJ5A 2VLRA 3ECWA 4K3GA 1UURA 1ZAGA 3WTSA 2CWRA 1ED3A 1BXVA 2CM6A 3E3QC 4OGYH 1CF1A 4LVNB 5ELIA 3JWDL 3WTYA 1E5CA 4W4NA 3LKOB 1OGAE 1ETJA 4KNQA 2ZUWA 4FNUA 3L13A 3IDNA 1XR8B 2J1WA 3DK2A 4Y9GA 4JB9L 3ZIMA 2OMVB 3MMEB 4Y1AE 5IEKA 5JIMA 1E4XH 3OG4B 4H0HB 4PRBB 4UQ3B 1ET7A 2FRGP 1TZ8A 3HS0C 1DBAH 4QTIL 5EWIH 1JIBA 2KKQA 5T3ZL 1VSCA 1ZHBB 4HWZA 1P7QA 4DO5A 1NSNH 2ITFA 2YD2A 3BGFB 5KJ7E 3PABB 1ZJBA 3OB8A 4U1JB 1P5UA 1QFWL 1S6NA 1NUGA 2VWEE 1IM3B 4NPJA 4QT5B 1SHXA 1UQSB 4QRPB 5FKAB 5CEZE 4PTUB 4WFGE 3HZVA 3DGGB 4JDVB 3VSTA 4WZ9A 4AGMA 2NR6C 1DEDA 4CL7A 4Z7IA 3B7SA 1HDMB 2ZP0T 2PLTA 3U7YL 1FL3A 2AEPH 5CGBA 5IGXH 2J3SA 4L3CB 1T0PB 1QO3B 1C08A 5SWSD 1GZQA 4FFYH 2XY1A 3V0HA 3V4PA 3WY2A 1A4KB 4XP9L 1HC1A 3H6AA 4JHAL 1XGRB 2NX5A 1GKOA 1OQOA 2ZT9C 3RX8A 2FATH 1KY7A 1Z3RA 4CU8A 5AOJA 4A6YL 4MQTB 1U21A 3ARGD 4HW6A 4JO3L 4M62H 1G7QA 3IJSB 5E5MB 5EZOH 3DVNA 6FABL 4BFFA 1SLUA 5DO2D 4WY7H 1XWVA 2XRAH 3AVEA 1RUML 3CDCA 3UAJD 1RULL 4AZUA 4N85A 1ZVNA 2BZ7A 5ITFA 3UMNA 1L9NA 2HLAB 3S48A 3RYMA 2NY6B 1RK1A 5EU4B 2ALWA 4XC3L 2G9HB 1W0YT 4QXTA 4OCMC 1RD6A 4WFFE 1XGPB 4MNGB 4OD2A 1ZLVK 4ZFOA 1MCKA 1KJ2B 5J6HA 2FBOJ 4NGHH 1U8OA 5K9OB 2CA3A 2VDLL 3C12A 2QSVA 2VLJE 1U8NB 1CICD 2WNWA 1B4JH 3MLVL 1YQVL 3UTTE 2EUWA 1KBGL 2R15A 3FT4A 3S97C 3U0WH 1KB5B 5D7IE 1AXIB 4CSTA 4RWYH 4MJ6B 4XPAL 3U1QA 5FAAA 1N59A 1Z9MA 1KYFA 1KCSH 4PJAF 2VRAA 3O4LD 5AKRA 3SGEI 4DTGH 3WNLA 4NM8L 1U58B 2LLLA 4ZUVB 1WCQA 4ZMNA 4PJFE 2OSLB 2V5TA 1IEAB 1QKZH 1FRGL 4FYTA 5L2KE 2PWFA 2B2XH 2GUYA 2R2BB 4ODWA 5H2BB 5E2UH 3QJXA 2F8XC 2C3GA 3VGEA 1O9ZA 3SCMA 4M5TA 5BUPA 5F6HI 3MRDA 1EDYA 4KKBD 3DUUA 4JZJB 3O6KH 2BS9A 3BUTA 2R1WA 2IPUK 4Y7OC 1LVEA 5JW4M 1MLCB 1R3KB 3I3BA 4G3YL 4KXBA 3WFCH 4S10A 4JDTH 4OB5L 2KHAA 1Q9LB 1UKSA 3LS5H 1PL3A 3OTTA 3LKPA 4JPVH 3HMXL 1JSYA 5C0CB 2XNAA 3BSZA 3RWJA 2CHNA 4YAQA 4Z0XA 2R59A 3V6OC 3V6ZA 3CVIH 4RFOH 5GGSB 3ZZQA 1AJ7L 4KK5D 1F1GA 4U0RB 5E99L 5IEHA 3HC4L 1HOCB 1IJ9A 2DN7A 3VXPA 2V5MA 4KHTH 1H6FA 3EJTA 2CO6B 4HJ0C 2IG2H 1U8IB 1NMBL 1NCCL 1ZDQA 2OMNA 2WCSA 3QI9A 4PJ8A 3K6SA 2P24B 3LV3B 1OCWH 1FYHB 5E8OA 2OULB 4W9DC 1JI2A 5IZ7A 3WNKA 1GA2A 4KROB 1P7HL 4XZUB 3FO1B 3M46A 2WZPD 2V4LA 2EEAA 4QRRA 4UOJA 4KPHL 3WNPA 2BVYA 4BKTC 2N1TE 3SDYH 3KPQA 4JZNA 5A1AA 3FO0H 2Y23A 4LCWB 5IUSA 2EVJA 4Y5YA 4HD9A 4ZSOB 3ZKXC 5F7WC 1DBBL 1YMMD 4UNIA 1YN6B 1ZT4B 3L4TA 1QSZA 1BMZA 4DOHE 2EDEA 1GH7A 2X4PA 3MR9B 4M5SA 5ALCL 5SV3A 3IU3B 4IOSA 2FB4L 3H3KA 5JXAH 1CN4A 1Q9WB 1PG7W 2O5ZH 4DW2H 1GYAA 4X6CE 2C7FA 3BMWA 1MIML 2WZ5A 2ILLA 4KVCL 4Y1SA 4BA8A 1KCVH 4CDHA 5EEZA 3SD5A 4C47A 4CMMA 2VM9A 4HPOL 3C8KA 3OJDA 2FEEI 4YL9A 3SDXE 4U3SB 2W07A 5HHME 2YD9A 3QHFH 4NWUH 5C6WH 2VZ1A 5LO7A 1A8JH 1I3RB 2R9HC 1OY3B 4HDIA 2OFQA 3P9MA 2VABA 3QUZB 1JTTA 1T2QL 4OLXL 2L7JA 4K5LA 2GK0B 4AQ1C 4NNYA 1L0PA 5IOKA 3IDJA 4HWBA 1J05B 1CLYH 2UWEB 5DURB 4P4RB 5DD3H 5DJ2A 4X6DE 5JHDE 2OV0A 2GSGA 5AUMB 5E1QA 3I9GH 5GZNC 2YLKA 3ATDA 5GZOD 1LO5B 1N6VA 5E9DB 3MLZH 4ELMB 1TXKA 2PR4H 2ADFH 3P40A 3FNKA 3GEWB 4NSKA 4ZS6C 1NL0H 3BP6A 4DZBB 3WKPA 3ZKSD 1Y07A 3GKWL 2D7TH 2WTRB 3OZ9L 4L0PB 2K3HA 5C09D 4I0PD 3LXUX 3CZLA 1CR9H 2EEDA 2WXHA 4EJ1C 2AP2A 2K7QA 4JANB 4JPWH 4PWEA 4X6DF 1HILA 2WQVA 3N41B 2Z4QA 2P80D 1DJIA 1P1VA 2VC2L 2ZYHA 3LIZA 3EHBC 5AB2A 2RBLA 3QQ4A 1DQVA 4NI3A 4RAHA 5SWZD 3IAPA 5D7JC 2WBKA 1FNGA 4KNUA 5JIKA 4UQ2A 3X14A 3CBKB 4J27A 3JUZA 4M6MH 1F8TH 3U25A 2IWEA 1A9VA 5HGHA 4OCXL 5DZVA 4AC4A 1RMFL 4XNAA 1OXYA 2N7SA 1BVLB 4LLAA 3GSNB 4CW1A 1OAUH 3MXVH 4AL8C 1TZHB 3E2HC 5T33H 3MLRH 1TNNA 3T6ZA 1EK3A 1TDQA 3OC8A 1OB1B 3D7PA 4RISL 2X4SB 1FL3B 3C5ZA 2YUXA 4HJTA 2QSCL 2E6PA 2K9FB 1E4KC 3QZBA 4HBCL 3JTTA 3IFLH 1QO3A 3V6BR 4JFFD 1JGIA 2DWEB 2NX5E 2Q0ZX 1EZLA 1HINH 4NQTA 1SBSL 4X4YB 1GOFA 5AWNL 4AJYV 3ZDYE 1GZPA 3TTSA 4DAGH 1S3KH 4GRLD 2XPZA 1O0VA 5CU9A 1RJLA 4FG4A 2YJLA 4NO3A 4XWGH 3NK3A 4EI6B 2AXHA 3U7AA 4IDJL 4XWGL 2YAMA 5TPWH 2X42A 2ZAIA 2BFVH 5E00A 5GGQH 1PX8A 2NQDA 4APQB 3AJ7A 4POUB 3LS4H 1CFBA 3BZFB 4HPYL 3ZDZB 2AQTA 3B2UC 4GKNB 2X7LB 5I17A 4P5TA 4MD0A 4M3KB 5ITFB 4PIRF 2JTYA 3DK0A 1DCEA 1DJYA 5FO9B 1KIRB 1R6VA 4XE0A 4YXLH 1D5MA 4N1EA 2IALB 4XMKH 2BWQA 5IMOB 2R23B 1RIVH 2RFXA 4R83A 3QG6A 4ZOEA 1VIWA 3U83A 5AW6B 1UGNA 4YDVA 3F64A 2WBJA 5AZUA 1SJMA 2F1BA 1I1AD 5I1IL 3B3IB 3EUUA 4IDLA 5GZOC 4X7TB 3BLPX 3DRTA 3B7UX 3MODH 2ZWKA 4NM8H 4WSJA 4BIKA 2ZXGA 3D0AA 2V8MA 1BZ9A 2K6ZA 1UZ8A 4PJ7E 4CKQA 4RGND 4CRPA 3BVTA 3GI9H 4IKJA 2XTJC 1ET8A 5A2KH 4KKNA 5IFAL 2E6JA 3NQKA 4GO8A 3RJOA 3ZRSA 4Z3TA 1XF2A 2RHEA 2NZ9C 1S7QB 3D30A 1ZOXA 1XCWA 2XC8A 1JGLH 4MZIA 4HC1H 3MU3A 3RU8H 3NJVA 1MEXH 4F33B 4XAWL 9CGTA 4DKAA 3FFOA 5KW9H 4DEWA 3AREB 5SWSA 1MCWM 2EE0A 3EJRA 3JZYA 3IJYA 1I1YA 2IPTH 5D93C 2K70A 4NUJB 1IKOP 2A4ZA 2VDLH 4OD1H 1YNTF 1VHPA 2Z93A 1JHKL 4MX7A 4PJDF 4PLKD 4BSWA 2CDFA 2YMOA 4DO6A 4GQ9L 4A38A 2CCVA 4NN6B 5L4IA 4OFDA 3N85H 3ORJA 3MLTB 4CVZB 1TOXA 1KCUH 4YGAB 1QW8A 3VM5A 1A0QH 4PLNC 5IJCC 1T7VA 4OUOA 4NCC1 5EPMA 3NJMA 1F3RB 5B39G 3DA0A 3WHXA 3FO1A 3L9BA 2A9NH 1U91A 1H9VA 1BFVL 2AAVA 4HUVB 4W6XB 3TEZA 1LLAA 4JM2F 4N2OA 3NIDF 1T6VN 1UD3A 2YOCA 3F7PC 4KKQA 1JWUB 3NCJH 1PDKB 4I2XA 2W9EL 4GIAA 4J3OG 5I30L 1H0DB 5JLZA 1T0NA 1EPFA 2CLVA 2WLHA 3C60C 4OLWH 3FO9A 4PG9A 3V6FA 3OKEB 3L7EB 4EUPG 1F4XH 5BUAA 1NDMB 4JFXA 4KXZH 2X0VA 4JG1L 3GMPB 1W8NA 2DDQH 4RGOH 4GXVH 1FI8C 3MOQA 4I0KA 1KB5L 2CQVA 4P5KA 1UB6A 2HFEB 2VDQH 3QNZA 3SCMD 3QIBD 4M1CC 2X9WA 3U2IA 4YBLB 2V5RA 1OT4A 3V4PL 4XN4A 1R34A 2BRRH 2XY2A 3CCHA 1TITA 4I8DA 3SDDD 3VDCA 3RGBA 2OI9B 3E6HA 1MJJB 4H25B 1OB0A 3D48R 4LRNL 1H3GA 2BZDA 2LW3A 2BFGA 1RURH 3GZOA 4B7LA 4KDWA 4Y5VA 2X6CA 4ZMVA 2W81C 1KOAA 5KSAA 3Q8AA 3FUFA 1GW6A 1QPXA 4JAMA 3QRFM 1LMIA 3FFCA 1LO5A 2IVFC 2LHAA 2WXKA 3N43B 4X9YA 5E9DA 4ELMA 3RVTD 2NR6A 3BQUC 3HFMH 4XTRD 4KDVA 3GSRB 3QCVL 1J9CT 2XKNB 4PRNA 2Z9TA 4UI2A 2VSMB 4W93A 3TESA 1KCWA 2GCYB 5F70A 3SE3C 5ADOH 1RPQA 3T0WA 2WTRA 4B3EA 1F2QA 3D85A 3GBLA 1FZJA 1MWOA 3H85A 4UQ9A 3KYOB 4WTZA 2VR3A 2ZOUA 4E0RB 1HH6B 4GG6F 1T83A 2BERA 4JN1H 3E0GA 3D25B 3FTWA 1VAHA 5C2BL 1EMTH 4YHPA 3BGAA 2OSYA 3PYCA 5DJ2B 1I8LA 2QQLL 3KYAA 3BAEL 2ID5A 3LQAC 3C5ZD 4L4VD 5HDOA 2IDQA 4CVWA 2P5WB 5L2KA 5EOTA 1DL7H 3HS9A 4BZYA 3CK0L 3I6LD 4NX0A 1IFHH 3PU7A 2A5UA 3N0PB 2J12B 3X13A 2DIAA 2CKNA 1YPZE 4JR9L 2IV8A 2WJ7A 3GSNA 2UZXA 3PL6B 4HJEA 1R19A 1UENA 3MNZA 4N8VG 3WE1A 5IKCB 5DJDA 1J9RA 4XPHH 5KYXA 2BSDA 4LBEA 2AEOA 2GBAA 1DEEB 5E95B 1WISA 2X4OB 3MLSH 3BXNB 4P99A 1RVFH 1PZBA 3KLLA 2YD5A 2WWOA 3TV3L 4KDTC 5IW1A 4NQEA 1X4XA 5LKNA 1QATA 3KJ6L 4CC4A 2R0KL 5D7KE 1BD2E 2AEQL 3ASOB 2WLYA 3S37L 5I75C 1AFVH 2OP4L 1D5BA 4AYBA 3MDJA 1RLWA 4MDIB 3QAZC 2JH2A 5KZCD 3UAJC 1TNMA 3D3VB 3LZFL 1TQCB 2CBMA 4ZTOH 2IDTA 3BP7B 1HKLH 3QXDB 3TFBA 1I8MB 4Y5XA 1AH1A 1NFAA 3L4CA 5AFAA 3WJLC 1BX2B 3WI9A 4AH2A 3FQNB 2FWLB 3NPZB 3MRIB 4U7KA 4G11A 3UCQA 4R7VA 1RJYA 2C1OB 4O4YH 3L3IB 1MELA 3Q8BA 3SGJA 1Y1UA 4JCMA 2WP3O 2E7DA 4F7CB 2AMGA 3ZT5A 1A22B 3MFFA 3NRQA 5JW4R 3GRWL 3FCTB 1ZT1B 3MLYH 4LSTH 1BJMA 3Q8CA 3QEQD 4Z7VE 3DTUB 1JAEA 3RX9A 3HBPA 1BZ9B 1I9JL 1QBLH 2X2IA 4G7YL 4AXWB 5TDOB 3DJSA 2HVKA 1KB9J 1NGYB 2UY7A 3BQUB 1AZVA 4X6EB 4YZFE 3VXTB 4XP6H 4YPJA 3FAXA 1IKNA 3ATEA 7CGTA 3WY3A 3VNYA 1JV5B 2AEPL 2FYYB 4NAQA 5I6OA 2FJSA 3M8OH 1GGBL 4PUBH 2HH0L 3GTTA 2WANA 4CUCA 4F15C 1JZ3A 5I0DA 1VFOA