3VVWA

Ndp52 in complex with lc3c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
117
structure length
110
Chain Sequence
SQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Calcium-binding and coiled-coil domain-containing protein 2
total genus 14
structure length 110
sequence length 117
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vvwA00
3VVVA 3VVWA 4NLHA 2LFEA
chains in the Genus database with same CATH superfamily
4DNLA 4PG2C 1AGFB 1BPLB 2IF7A 4G8GE 4WKZB 5HPOA 3LMJL 1RY7B 1KXQA 1RVFL 3NJHA 3S9DB 3IAGC 1SYVB 1ZVSB 4M7KL 2ZP9A 5LWYL 1ZGLP 1ZPLA 3HN5A 4AIXA 1E50A 1I9IL 1SJEA 2WMPA 3DGCR 4JY6A 1EFXB 3F7PC 1ROCA 2R0ZH 1KWKA 1SLVA 4QOKA 2XFXA 3QSKB 5F6IB 1X5YA 2RCSH 4LPYA 2CR3A 4O02L 1XH3A 1KJVA 2F5AL 1RUPH 3HC4H 1QFPA 1JWSB 4EMZA 4LCWE 4KROD 1HAUA 3PQYB 2O30A 1OT1A 1U36A 1EAPB 1WCQA 3D2TA 3EJPA 3TEZA 4F37K 5DGRA 4LPCA 4CSTA 1WE5A 4X6CF 4L18A 4UNTA 3SQBA 2UZXA 4NKIH 5DUPL 3OQRA 2Q7YB 5ELIA 2JV6A 5E0QA 3NJVA 3MU3A 4ALAC 2OS7A 3MRPB 2BIPA 2BMKB 3BJ91 1KN2L 1N8ZA 4NZRH 3S35L 1WGOA 4Q4EA 4FG6C 3GXTA 2ZWNA 3ECQA 4FDWA 4KVPA 2GTQA 2ICEC 1IEAB 2J2ZA 4N0FB 4JHWH 1A4KA 4LLQA 3NCBB 1G7JB 1I7RA 4NT6A 4O00A 4R2GC 1KCWA 4B0MB 2VLJD 1ERNA 2DV6A 1FG2B 4N90D 5E6ZA 5EH1A 3SGEH 3WY3A 1YPZA 4YHNA 4PJBE 3MV9D 5JOFB 3TH3T 3QO1B 3AAZB 5I1GH 4JPWH 5DMYA 3BEVB 1A4CA 5EZIL 3ZYOA 1KCUL 3ARWA 2MRYA 3HVDA 3AT9A 4FADA 5C9JB 4RFNC 2CO7A 2J57A 1XO8A 1TTBA 1J11A 1D5MA 4HG4K 1UA7A 1LEKA 1A6WH 3IYLW 2EH8H 4LSSH 3L7FA 5DS1A 3V2AR 5J6HA 4WFFD 4PRHA 2NXZC 1PJWA 5TDNA 1AXSA 1IC0A 2ZQKA 4LSUL 4DTGL 3MRQB 4LCWD 4YVUA 1TKWB 1G9HA 2JTYA 3V0JA 4NZTH 1ZT7A 4C59B 4J23A 4Y5XB 5IESL 3U0TA 2B5IB 3EBIA 1QZ1A 3MACH 1JZHA 1DQQB 3WAJA 3QQ3A 5IJCC 3HUJA 5HYFA 1F13A 4BFJA 1FLRH 5CJXA 2XWRA 4BK5C 3M7FB 1G7HA 4FQHA 5DFVC 5CGMA 3IE9A 1MWAL 4XHJC 2CA3A 4Z76A 3P9LA 4ZMVA 1OOAA 2GSIB 3QORB 2C1PB 3WHE1 5LBSH 4L1BA 4YO0B 4FG4A 1TU2A 1V7NH 1U8KA 3E8VA 2CDGA 1U2YA 3UBXA 1JXGA 1VZIA 2AJVL 4R26H 5A2CA 1UWXH 1JP5A 2COQA 5EEUA 3JV0A 2V8LA 4L8SC 5AKTA 3WNMA 2HUEA 3QJZA 1F4HA 2XWTB 3ZR5A 3AREC 1NC4A 3MUJA 3DURB 3OXRB 5KS9A 5TDPA 2VDOB 3FRUA 3IM1A 3P1VA 4Y16C 4IBZA 5KJ4A 4AENB 2C3VB 4N25A 2Y4SA 2BNUB 3WTXA 4KY1H 3VE0A 2GUYA 4WSKA 2NNAB 1QVOB 1F58H 1KJ2H 3UG5A 4XP6L 1G7IB 3TNMA 4MDJA 1NJ9B 4GUPB 4HYTB 2ED8A 3APNA 4MD5B 4Y88A 4XN7A 4ZFGH 5JW4M 1XXDC 1PG7H 3LKSB 2Z7ZA 1U91B 1W0WB 3PWPA 4LOEA 3DI3B 3P4NB 2OL3H 1D6VL 3IRZA 5EZLA 3QUZD 1KPUB 1VKXB 4X5QA 1MN4A 2CXGA 4AQOA 1JK8A 3H3BC 3D25A 5DVNA 9CGTA 4FQJH 2C7FA 3QC5X 1G4RA 3QUMA 1PZBA 3P73A 4GAJL 4Y89A 3T0BA 2R2HB 4C57C 5DJZA 4UWQB 1S3RA 1I3VA 1WA1X 3QXAA 2QQLL 3JTBA 5AB2A 1PIGA 2ITFA 3PHQB 5JW4Q 2R51A 3FZUC 3IAQA 5FO9B 1WSST 3GGWA 4CC0A 5KVGE 1HDMB 1C12A 1IQWL 1XZ0B 3SKOB 1T1XB 1WDAA 4EI6B 5I9QC 4NYLA 1QBMH 3GEWB 2AK4A 4ZFGL 2IALA 3HB3B 2WXRA 4F8TA 3QWOB 5DU7A 4P4RB 1KBGL 5ERWB 4UQ9A 5AAMC 1OCCB 1SXSA 3VXMB 2R39A 1WVZA 1IGJB 3ABLB 2OYLA 3IT8D 1KT2B 2NW3B 4JFDE 1Y0LA 3FB5B 4JKLA 3LZOA 4KRLB 5DJAB 1U93A 2OTPA 3QG6B 3IU3A 3EYFB 2CO3A 3NCWA 1XIWB 3AWGA 2NYZA 4TNVK 4F7CB 4UT6A 5DMIL 3M1BB 3NUKA 1OPGH 4GAFB 3ZX1A 1TTUA 4JCMA 4LSRL 5T1KA 2FQDA 4FHKA 4L9DA 3FOMA 1OTSD 1RD6A 4OQ1A 4AYGA 4XOEA 5L2KA 2X4TB 3G6JF 4R5VA 3D33A 3P40A 3WS3A 2PPCA 3NK4A 2PCXA 1HQ4B 1YY8A 1IAMA 4W1TA 3FNKA 3KPRE 4DUVA 1DE4A 3N5AA 3HR6A 1S9VB 4NFCA 1CF8L 1T22B 2OP4H 4PJ8D 2P42B 4Y1SA 1ZT1A 1DJXA 2BSBA 2VCOA 1JF5A 4QYOA 3MGTB 3SKMB 4LOFA 3TP4A 1BOYA 3MV7D 2DQIL 4JR9L 4MMYB 4QT5A 2BXZA 3KBFA 5CNHA 2JMRA 2N4IA 1Z32X 3IFPA 1ZV5A 2CDGB 5DVKA 1KTLA 1JVKA 1VFAA 4YHPA 3UTQA 3HNVH 1T89C 4X6EA 2ZP8A 3FCGA 3LHPL 4RAVA 1S7XA 4H1LA 3FL7A 5J57B 4XP5L 2B1HL 4TPRL 3HMXL 3D18A 4LVOB 1F2XK 4HWBA 3G6AB 3MUHL 2XTJE 1UWEL 1T5KA 4LKCB 3AUWB 3B2VH 3FCSB 3VI4A 2XQBL 1BQLH 5LGHH 3VTAA 5GRVL 1VFBA 3WKNA 4U1LA 1PLAA 1F2QA 2PUQT 3AROA 4LLYA 2R1WA 4N26A 2V7HB 3DMMB 3NN8B 5D1ZC 2ADGA 1D6VH 4XCNA 1UATA 2CCVA 4WUUB 4U6HB 2IH1A 4LNVA 3QZOA 4ZRGA 2FK9A 2WHVA 1S7QA 1SEBA 3FT3B 1DBJL 2K4AA 2A1WH 1OGSA 4XP6H 3MMEB 4APXA 4KHTH 1MDTA 2E7DA 3TPKA 2ADFH 4J3UA 5JXEC 2WLIA 4B7IA 4ZS7L 1GXEA 3FAXA 4K5OA 3IU4H 4DFHA 2WAQA 1GSKA 2ZXDA 3E38A 3IB4A 3KG5A 4FN0A 5K9OA 1N6QL 4E9XA 5EF0A 1A8ZA 2E7LA 1K4CA 4GOSA 4QO1A 4N0RA 3QDMB 3C8KA 4BWUA 1U8CB 4ZTPL 1FNGA 2C9UA 1A7OL 3D1MC 4J3BA 1OGPA 4NUPA 1HH9B 2JKIS 2N59A 1UXLA 2CH8A 2D7TL 2P5EB 3NDZE 5HTSA 3AWEA 3ILDA 1E6JL 4TV3A 4DQOH 1FVDB 5KVEL 4JPVL 2IH8A 1JCVA 5FECA 1CO1A 4X2UA 1H5BB 3S97C 4DZBB 2YBGA 3LMJH 2F7RA 3CCHB 1J0KA 1EUTA 1TQWA 3BGFC 5KEZA 4NPYA 4I1NB 1HWGB 3GS4A 4HUWB 1HQRB 2VE6A 5D1QA 5E56A 4Y2DA 3SOTA 3TASA 3GHEH 4DOHB 2P24B 4OW6A 4HOXA 1JD9A 4NKQB 4WUUD 4PS7A 2D2OA 2WWKT 4XZ4A 2CUAA 3G9AB 4GIAA 4EKJA 2VRQA 4POUB 1HAWA 1ECZA 3QQ9C 5TF0A 4NQCE 4L1SA 4POZD 2CJ3A 3C2AH 3O45B 1EEQA 2YD7A 3MRDB 9PCYA 2DJSA 3D69B 5HDBB 1JPTH 1NCIA 3OGCA 4YPJA 5DWPA 1IZKA 1N5AB 2WYHA 3F6JA 3I6KB 4JQXC 1MCWW 4GKSB 4F9LA 3VMPA 2OZ4H 5D7KD 1KENH 7PCYA 1LO0L 5FYKL 1OGAA 4I77H 2D03L 4P2OD 4NJAL 3OB8A 4NNPL 4N4YB 5FM5O 4F2MB 4D0DA 4ESKA 2LLNA 1T1ZB 4WEUD 1A6ZB 3P4MA 4CJ0A 5FM5M 3BRDA 5JIIA 3F83A 3TBSA 1XCWA 4YDMA 3QRLA 3SBWC 3DO4A 5C0AB 2GI0A 1G6RH 5B1JC 3MLTA 1CF8H 5JDSB 3CX5J 5FHBL 5LAPA 2AEWA 5GS1B 5EBWB 1DCEA 1AZBA 3U6RB 2FLRT 3SYOA 5DVMA 5GISL 4H8PA 2WLMA 3MNZA 2X53A 2IPKA 1HQ4A 1OCWH 3ZDWA 3VFWB 3B37A 5GRVK 1AACA 4CMMB 4W4OC 2XG4B 3T8MA 3VI4B 1E9PB 4JO1L 4YSAA 3L5WB 1UCBL 2OR7A 4OBSA 3C8HA 2DDQL 3V7AE 5FR3A 4PJ6A 1TQBB 5JIPA 3HAEB 1NMAH 3HI5H 5DJ6B 2X1WL 4IU2B 4X80L 4ONHA 2AKRA 1GS6X 4KU1A 4WHDA 4IOIA 5BZWA 1DQLL 4DAGL 2NR6A 2Q3AA 3A6BL 1KV3A 2FL5B 2P52A 3HZMB 2JCCB 4YHMH 2GAZB 2X4QA 2JJUA 3LIZH 2BJML 3MOAL 5F1SA 3ZN6A 4M56A 3UTSA 4P59L 2KT6A 2GJ6D 2Z1KA 4XXCC 4Y5YB 2RFXA 4MCYA 2DLHA 5F7DA 4YHZL 1T20B 5EIIG 4JJHA 4PJGE 4YHIB 1ES0B 4FMKA 2ZWSA 4PJIA 2O1AA 1UJTA 5DT1H 3QWOA 4TLUA 5I0WA 5DA4A 4ZYKB 3MLYH 3ARBC 2WD0A 3OLGA 4N0UA 2VAAB 3ZE1E 3BVNA 2VW6A 4EBQH 3BZ4A 1L3NA 1Z9PA 5EORL 4L0PB 5A2BA 4D94A 1NCJA 3IJEB 3MFFB 4MXVE 4YHKL 2G75A 1N64L 3MV11 1BIIA 1T04B 3QEUB 5FKPA 4M6OH 3TCLB 2XI9A 3TV3H 2JI1A 2MPAL 1HZHH 3GDBA 1SZNA 1CCZA 1R33A 2W88A 4PB0L 5C0CA 3S5LG 1OW0A 3QEGL 4FYRA 3CLEH 5E5MB 2BJMH 3QWQB 4P4KB 1QFWM 4HF5L 2Q20A 4LVHB 4F92B 1AO7B 4OZFA 2ZCKH 3EOBA 1C16A 1AZZC 3MRMA 4JHZA 4ETQA 1MWOA 4HP5A 3VXTA 3MLSL 3TNMB 2E7CA 2J43A 3N40F 3DOIA 3D50A 4ALAH 1U3YA 4AKOA 1T5WA 4NNYB 3P4OA 1RUQL 2FJFB 5FB8A 1WZ1H 1A1MB 4KKQA 1E42A 1HH9A 4LKCA 2BZ7A 2ARJA 2XIIA 4NBYB 1BD2E 2UXTA 4EI5D 3SBRA 5DQDL 1D3CA 2FT6A 1AP2A 3GSNB 3HCVA 4PY7A 1XXFC 1MCWM 3GIZL 4R7DB 3SE9H 5A40E 3F7KA 3KYNA 3Q13A 3ZY7A 1BGXH 4RA3A 2GFBB 4X99B 4Y1AA 5C0IB 4D0BB 1YEJH 32C2B 2IQAB 3WEAA 4HXBH 4RIRA 4L3AA 3IDIA 3ZW3A 3LAFA 3TFBA 4M1DL 2YJQA 4AG4L 2BVTA 2NXYB 3KCWA 2WANA 3LIZA 3EIFA 4E5XA 5MENB 2MQCA 3UYPB 4LPVA 2GC4C 4XAWL 4XMZA 5H35A 3I6LE 1FH5L 4ZMPA 1DSFL 2V9TA 4U1JB 3NESA 3ATBA 4BK4A 3ZDZF 2HB0A 3LPWA 2YRZA 1G1YA 1QRNE 3I75A 5D7JA 4XPGL 1DE4B 4F1ZA 1K9TA 4FQLH 4W9IC 1KTBA 2CKBL 3HG5A 1TSHA 3WYRA 1MRCH 1D5ZA 1H3PL 2DQJL 1YA5A 2AVGA 3G08B 4TVPE 3ZZQA 2IQ9L 2X70A 4DIXA 1MCKA 2Y3AA 3QULA 4AQAB 5E7FA 3GRWL 1OAJA 4FXGA 4S0HA 1AQ8A 1NCWL 1WO2A 2WLNA 3GMRA 3U36A 1CGUA 1GGCH 1TZIA 1U8MA 1XF3B 3ASWA 3WEXB 4F20A 3LNHA 1R0AH 1GYWA 1VFOA 1G0YR 2IFFL 1KTLB 4JE0A 3UROR 2DJMA 1QFWH 4JHWL 1KZYA 2IXQB 3UJIL 4B9KC 4PGZA 3IDYC 5DEJA 4ZUTA 5CHNA 4OCRL 1PZ3A 3LEXB 3QPQD 5GXBB 5KVEH 1F1DA 1CDHA 5EOCJ 1NDMA 3TFKD 4M7ZC 4XZUB 2VZ3A 3ARFA 3BAWA 1AHKA 1XSJA 3UBXI 4ICXA 1PY4A 4MD0B 5D1ZI 4XGZA 4BE6A 3BAIA 2XN0A 1GGIL 3D07A 1Z5YD 2VLRE 1E7UA 1QHOA 2IDTA 1CQKA 2WQSA 3D3VE 1MAMH 2Z31C 1YZZA 4L37B 4ZK8A 3SDYH 1QRNA 3HFFA 4PV8A 2ADIA 2CSPA 2JXMB 5CP7A 4CADA 1RK1B 1RZFH 1KCSH 2AMGA 4B97A 3ZU8A 1NGWB 1TJMA 4S1QH 3IKCA 3CFQA 4XH2A 3TF7C 3KD4A 4YWGH 3BPCB 1FL3A 2DYPB 3RJQB 3ZDYE 2VDRH 3ZRSA 4JFDD 2MNUA 3H3KA 1P4IH 1NIAA 1W6WA 4JFFA 4RRPM 2ILLA 1DBJH 5I1KH 1B9ZA 3OKEB 1BJ1J 1J1XL 3RP1A 2AZAA 3K74B 4A7VA 5CEXB 2P5WD 4G9DB 1ONQA 2NX5A 3GBMH 3L7EA 3U7YL 3KWUA 3DOHA 3MYJB 1ODUA 2A6DB 2Z0UA 2C1OB 2DKUA 4MJ5A 4PJIB 3EG9A 2YZ8A 1GKEA 4WEBH 5D4IA 4TMPA 4ZX3A 4YDIH 5DJ0A 2A73B 1F3RB 4Q52A 4ELKB 1VGKB 5A6MA 5IKCB 3UJJH 3VDAA 2YMXH 4Q8BA 2AV1B 3BSZL 3B2PA 3C6SB 4GXUM 2ZG1A 1UCTA 4N2LA 3UAAA 5T1JA 1ZSDB 5B3SB 2YRPA 1AANA 5IJKA 1WICA 1N26A 5TF1H 4N22A 2R29H 3NPZB 5J6SA 4IGBC 4G5ZL 1N19A 1NANI 3N42B 3VW3H 1RZJL 4RQQA 5HHQB 1F45A 3BUIA 5L9DH 3DO7B 1XTMA 3ECWA 3DIVA 1EANA 1VRSA 3MNZB 3QCUH 3RG1C 3SE6A 3ULUL 3PXJA 1BZDA 4JQIL 4X4ME 4PJAF 1H8OA 2F74A 4JFDB 2EKSB 3S0PA 4PYGA 4DEUA 3EXLA 1MUJA 1FYTD 3IFNL 3MVSA 4OCWL 3X1BA 1AQMA 1L9QA 1PS3A 4OD3L 5HDBE 4RGOL 1OSYA 1U42A 2P46B 3GRWA 3VFTB 1AD0B 4JJOA 2FTAA 4D7PA 4BM7A 3LPGA 5E6ID 4ZW3A 3HC3H 4MBRA 1IAIH 4QNPE 2ENYA 4X6EB 5EIIB 1BM3L 3B1TA 4B41A 2FHCA 3TO2A 4OI8A 4X6DF 4OZ4B 3HIZA 3VXPB 1M05B 3SQOL 3VWKB 1MAKA 1NDTA 2KLTA 3NFPB 2JB5L 2R8SH 4QWWD 3FUEA 1BAWA 3OGCB 3H0TA 4OLUL 3MLSH 4YX2L 4U1HB 1IZJA 1U2CA 4QXTB 4JFQA 4PJEF 2AK1L 4GFXA 3RWHB 4WCYL 1P4BH 4QRBA 1MJJA 5E70A 4ZW5A 4XHQA 3L2MA 1IT9H 2C9RA 5F7NC 5K9JH 3W0WB 3HZYA 2NYYD 4MQXD 4PJ9D 4F8QA 5KSBA 3VWJA 4TTDD 1QP1A 1MFCL 4AI7A 4FLOA 2QZ5A 1VENA 2Y7LA 2X2HA 4M7LH 4WFFE 3RDJA 3VFRB 4DN3H 4RWYL 1BDYA 2AEPH 2D0FA 1HEJC 3LD8B 5C71A 2GSMB 4LOUC 5ISZB 1WWCA 2JK5A 5ACZA 2IOIA 5KSUA 4AV4A 5BRZA 3WL9A 3IJHB 1DBAL 5EZOH 4BGDA 3N0PB 1ZE3C 3B5HA 3GPEA 1UACL 1FFRA 2IDSA 2XT1B 4BEIA 4ZJ9A 3E3QE 4TUKH 1NFAA 3F64A 3IXTA 3U4BL 2XKSA 3L5XL 1FAKT 4X9IA 3DROB 1CG9A 5J7CC 4X6DB 2FQGA 1TCRB 2ED7A 5B4MC 2YFNA 3GSXB 5C0JA 4A6YA 2EDNA 3AC0A 4WW2C 1OP4A 3NJLA 2FYYB 3D69A 4HFUH 2R0KH 1VDGA 3MLWH 4LQFH 4JFEA 3VDCA 1EERB 4Y5YC 5AZ2L 1QR1B 1N18A 2H7WA 1T5XB 3BPOC 2YD8A 4IDJH 1UGNA 2CLZB 5C09B 6CGTA 4JFSA 2D0GA 1B4JL 1TZGL 1UT2A 2VZOA 3O3AB 4P07A 5JIMA 2GAZA 5J13B 4QF1B 1JRHI 3F7YA 4M03A 4JCLA 1AMYA 4Y2DB 3FQXA 1IFRA 2XV0A 4ZUWA 3TTSA 4BKLA 3HPLB 4M8QB 3VRLF 4IU2A 1RV6X 2EDMA 4KJWD 4WO4A 3IKCB 4XH2B 1AZCA 1TZIB 1U8MB 5E2UH 5I1AA 3LQAC 4YNYA 4MQXC 5I6LA 1LO5A 2OMWB 4N2IA 4NAMA 4AT6A 4BXSV 3CSFA 5F88A 5BS0A 2MWCA 5D7JD 5DFAA 5IB3B 2RBLA 3X14A 1XVSA 2KZBA 1UH3A 3KDMB 1S9WB 1AHWB 2CO2A 2QMJA 1JGEA 3ORJA 3DVGB 4J4PC 3D4CA 2FBJL 4Y4FD 1YJDL 4M8UA 3DVNA 3K80A 4RA0C 5DVLA 4BINA 4OKDA 3SGDI 3ABKB 1Q0YH 4JL1A 1EFXA 4I18A 1A6UL 1LK3H 4E41E 5AL0A 3D34A 1U8QB 3QUZC 2XY2A 5F89A 6FABL 1KB3A 1PMYA 4Z7WE 3KLAA 3ZTJG 5F3FA 2GC7C 1MCCA 4NJAH 5IEKA 1NQBA 2DZEA 1AC6A 4N8PA 2NSXA 2FL5A 4JY5H 2BCKA 2X41A 3ATAA 1SHMA 1DJWA 2EVHA 5EZIH 2ZPKH 1A7QL 4TXVB 1A25A 2JE8A 3FZUD 1BF2A 4ZXBA 2VABB 3MOBH 1I8IA 5DK0B 3NTCH 5LXVA 4QRQA 4PGJA 2ZXCA 4JKPL 1YECH 1H3XA 2ED9A 4MAZA 1DQDH 4LGPB 1GYCA 2XTJC 2DWDB 2G3MA 4LL9A 3FQTB 4TN9A 4RMBA 2RAMA 5T3XD 3B9AA 2JKLA 4FOMA 1WF5A 4GAGH 4WTWA 4Y4FB 2HX7A 4NZRL 4OB5L 2GUOA 2YKLL 3VMNA 4UZSA 2VZVA 5DFVD 1CI3M 3FXIC 5DD1H 5IGXH 1GIGH 4DP2X 2FIKB 2BP0B 1JPSL 1IGJA 2FJUB 4JLRB 4DGVH 5D2NB 4FI6A 4ZD3H 5D5MF 5ECGA 1EUUA 2WBKA 35C8H 4MSWA 4HU2A 3RWEB 4PLJD 1F8TL 2NY2D 1A6PA 3NCYP 4OJEH 4LEOB 1ZS8B 5MEQB 1ULVA 3VXSE 2NCMA 1ACCA 2XZAH 3WN6A 3UPCA 1X5JA 4ELKA 1CLVA 3K4DA 1AG0A 1HXYA 4OUOA 5AVZB 2DIBA 3P4OB 2O5YL 3BN9C 4P9MH 1GPOH 4RDQG 1E8XA 1ZEAH 5EC1A 5AB9A 1WAEA 3IWUA 4LRNH 4GXVH 3F84A 4NQDB 3ZMRA 1VESA 2ICWA 5CSBA 4HC1H 4AL8H 3T6QC 1BYNA 5IB2A 4WUKH 4QRTB 2FRGP 5H4YA 1JPFA 3WJLC 5DZAA 4L9LA 4X4XB 1VKXA 5C92A 1FG9C 4XXDA 3ZRCC 2MQGA 4F24A 5ACZB 4BKLB 1W0WA 5A6IA 3V4UL 2G30A 2ESVD 3QUGA 2DTML 1NEUA 2BHYA 1BQLL 4NQXA 2W0KA 4XNUH 1X6LA 1G43A 2JJSA 3G04B 4Z7OE 3CDZA 4N0CD 3ZTDC 4ZMAT 3Q01A 1I7TB 2CLRA 3FUHA 2C3VA 2MCPL 4HCRL 1HC1A 2EVIA 3TIEA 2E9GA 5CJXC 3LN5B 3MRFA 2TSAA 3QP3A 4PV9A 4K2UL 1M7IB 2VSDA 4GXVL 4JFQB 4QJ5B 1PKQA 1SJEB 2EECA 4TRPH 2FNBA 4RAUA 3JZ7A 4JFUA 1I9EA 3O4LB 3PWJB 3S96A 5FXCH 3QUZA 2HRGA 2RQEA 1C5CH 2EC9U 4FQXA 2VNCA 4XVTL 2ITCA 3H1ZA 4XMTA 1J5IA 2YD5A 3FBQA 4GAAA 4GRMA 2FGWH 5AD0B 2ZTBA 2W80C 3GXMA 2VO5A 2R2EA 4UOZA 1N2RA 3IPBA 4PP1C 4OGYH 2Y7QA 5E1AB 1M7DA 3FTXA 4NQUA 4K3HA 4NZUL 3QUYB 1VB9A 1J9QA 3MRLB 4KI5E 5I74B 3Q5OA 1KXHA 4H0IA 3AS2A 1DZBA 3G5XB 3C9NA 1DQMH 3MLRL 3NZSA 3DX6B 4PRAA 2VGLM 2X88A 5IMOA 3ROLA 5IK3B 5H94B 3IMSA 2LHAA 1NGQH 2GT9B 4NAJA 5F1NA 3T1FA 3B9KD 2YOCA 3CIQA 3RGVA 2EDBA 4Q6IA 3AS1A 1U3NA 3P11L 4HPOL 4JKPH 5KWYC 3AT8A 4NO5A 4CSZA 1XD1A 3LIUA 1NBYA 5SX5H 1ZLEA 4C4KO 1ZGLB 3J07A 2VR4A 4XBPB 3ESMA 4NZJA 1AHWC 3KGUA 2EE0A 4PW3A 2P80A 4MFHA 3GHBH 4QRRE 5DYFA 2MOGA 3HR5A 1R24A 2DEXX 3T6ZA 3OZLA 1D9KC 4WI4A 3UAFA 1L9RA 5BUGA 1BD2D 2Y24A 3BP5B 4CU7A 1QBML 3JTTB 5D5ME 2CKBH 2F19H 2I25N 2WNKA 2X9WA 1WIOA 1Z5LA 4ZQTA 3UGXA 2CNZA 3S37H 3X3FL 4A04A 3S34H 2ZXGA 1A4KB 4LLQB 2E4FA 1SJVA 2ZUQC 4L2YA 5GS2H 1S9VA 3CFEA 2LTQB 3GINA 3ZKMC 2B3RA 4XAWH 1GS7A 5EZJA 2I69A 4RFOL 1TJHH 3RZCA 1P84J 1KIRA 1UJ3B 4PWIA 4NQTA 3MRDA 3FSVA 5EOQH 4JDVA 3HE6B 3MRBB 1Q94A 3D08A 4WO4B 1GGBH 1Z2KA 4HUUB 5FGBC 4XP9H 3ZIMA 3PQYD 4NWTL 5BS0D 4YJZL 1R3LB 3BZFB 2QADB 3EZJB 4X4XA 3VFMA 4K3JH 4F80A 3N44B 1QKZH 5BVJA 1DBMH 2HVJB 2ZAIA 3B5TA 4XPTL 3I3DA 4P46D 1JBJA 3TPUB 4LEEA 4B9CA 3DSFL 4GT0A 3GSVB 1LE5A 4XO4A 5C09E 4HIJB 4HHAA 1RLWA 1UZ8B 3L4CA 2PR9A 3S3CB 3LKQB 3GSXA 4U1HA 4PJGA 2KZKA 1DANU 1BM7A 3OC8A 3C08H 2P5EA 4L4VD 3HB3C 4JB9L 5AAWA 1JV5A 3TBVA 5ESAA 4FRWA 4PJ5B 4WRLA 1COBA 1A7PH 2WKGA 4UUJA 3R7QA 3RNKB 1N9PA 4NJ9H 2BO0A 2GK2A 1J9RA 5DEGB 1MLBA 2X4SB 1HE8A 3IGLA 4G8IA 3ZYJA 1W6LA 3Q8BA 4PB0H 5GQBA 2OSWA 1S7VA 4Z7OF 5BRZB 3HG2A 4S1SL 3QT2A 1QACA 3F8UB 1NCAH 2DEWX 2FB4L 4MGXA 3QZWA 2WZ5A 3B3BA 3N44F 1I1AA 2BNQD 3BH8B 4OUUA 2GTZA 4K5PA 4U6VH 3MGOA 4RDBA 4LCYA 5IOKA 5I23A 4I5BB 2QADD 2AEPL 1OOWA 3V4VL 4CKQA 3WY2A 4Q2ZB 1WWBX 1XL4A 3VXRA 4ZS6C 3D85D 3FTVA 2FLMA 1MFCH 1EO5A 2WSPA 3GBDA 4G7YL 1HCFX 4N2MA 1O9VA 2EO9A 2OMTA 5CKGA 1BMZA 4HS3A 2CRMA 1OB0A 4OZHE 4GG6A 1FVCB 3HC0A 4PJDE 1GTFA 1QSFD 5I0YA 1RIUL 4YHML 5E6UB 4MA3A 2D7PA 2DAVA 3HI6L 3UEZA 2ZOWA 3AREB 4Y5VC 5LLIC 3IFPB 3QG6A 3O0RH 5DZVA 4XRCB 4P2OC 5DRNA 3SDCC 1C8PA 4D0DB 2NY3C 4QT5B 4AJWA 2J1ZA 1MI5E 4JZNA 1KGIA 35C8L 1IQDB 1AGBA 1CLZL 2G5BA 1ZOXA 3NPSB 4Z77A 3KGRA 1CDJA 1IEBA 3BWZA 1IM9A 5TDOA 4M8VA 2KDYA 1K6QL 5ITFA 1CD0A 5DO8A 2H1XA 4KRPC 4ZMTA 3V6BR 3ILQD 5IGXL 1XFPA 2Q76A 4OZGB 1N5AA 3I6KA 4D7BA 2D3LA 3WS3B 2H26A 3QEQA 1JN6B 5F9JB 3Q8FA 3MRIA 1CE6B 1H15B 1RZGA 2D4DA 3WD5L 4JRLA 4XWGH 3GSWB 3PGDA 4YHYC 4FTVE 2FO4A 2Y36L 3OHXA 2J55A 3D3VA 3SDAD 1L0XA 4NCDA 4KGLA 4PYHA 3EXJA 2BFGA 1DUZB 1CBJA 2EDKA 1T80A 3EYFA 3VYNA 2NXZB 4PJDA 2FH6A 2HLAA 3BQUA 1KIPB 1IO4C 2VXTH 4JGMA 2R0ZL 2G60H 3RWJB 2AI0L 1PDKA 2F54D 4YFEA 4Y4HB 2APWA 3W3BA 4J39A 3X11A 1JGUH 3KR3L 1FSKB 3TNNA 5FYKH 4FXLA 5ID0B 5D4JA 4F9PA 2R27A 1MREL 3GPSA 4M43H 5K9KB 3MCKA 1YEIL 3MTXA 3AVEA 3KPPA 2DN7A 3NJXA 4GG8B 2VJ0A 4Z7WF 2EXTA 4HAGA 5AAPA 1HH6A 1HXYB 4H0HB 4XB8A 3WJLA 5HPMA 3AXLB 2EDFA 3WMQA 1ES0A 4QRSB 3SDXB 1NGZA 1QTSA 4IKIA 1YEGL 1BXVA 3GT6A 3OZKA 5KSAB 4M61B 4ES8A 3MBEB 2WVSA 1Q0YL 2IPUK 3K72B 4GSQA 4GW5A 1UM4H 4L5FE 2BWIA 1ADQL 2Z4QB 4TQIA 5D2NA 2CALA 5JW5B 3ECBA 3Q7JA 2QQKL 3J7HA 5ECJE 4KY2A 2ZXAA 5BZWB 2CK0L 2WCSA 3DK0A 2QGCA 1ZGLA 4HC1L 4AL8L 2WO2B 3ESVF 3TH4T 1G9MC 2OJ1A 1XBDA 3NH7H 3EOTH 1E27B 2EACA 1L6ZA 3VMOA 1TCMA 3DC0A 2B3IA 4ENEC 4KJQD 3QWRD 4R96A 3TO4B 5EC2A 5CEZL 3WHXA 5IMOB 1AZNA 4UMGA 1HVXA 3NIFE 2VR5A 4NWUH 4X6FA 4I5BA 4F7EA 1EGJA 1H6EA 1I85C 2VSCA 3DVFA 2AJUH 4W70A 1LEIB 4LASH 1A4JB 4HWBL 4O5LL 5I0DA 5H37H 1UVQB 1SN0A 4YBQD 2HT2D 2OMYB 3ES6B 1GY2A 2HKHH 1MW1A 1RZ8A 3N55A 3BCDA 4PP1D 5F9OL 4IKKA 3VFOB 1MZYA 4OSUH 4PLOB 1KCVL 4XXCA 5IW3A 1PEWA 1A7RH 2OV0A 3OZ9H 2ZUYA 3MI6A 5EU5B 2M26A 3RTQB 4WO0A 3N1FC 5KSAD 4UINH 1QSVA 4JG0H 3MLZL 2OFQA 4BH7A 2B77A 5E2WH 3O8XD 3PFUA 1OHQA 2XIBA 4LRIC 3T4YA 3T8XB 2Z8VC 1PKQB 3Q44A 1JXDA 4L3ED 5FCUH 1UWEH 4U1GB 4U1JA 3B9KC 1JZ4A 4WJG3 1QW9A 4Y7MA 3RGHA 1S7TB 3C9NB 4KKCD 2BRRH 4PRAB 4ZMZA 4NN6B 2GIXA 5EUOF 5CIPH 4UT6H 2XWDA 1M2VB 4A38A 2Y3NA 1S9XA 3GMQB 3TO4D 2BERA 2BVQA 3DGDA 5DO2D 1PZ2A 2F58L 5KOVC 1SF3A 5T3ZH 5ADPH 2Z4TA 2Y1YA 4JGUA 3MFGB 2R2EB 1G7LA 3PP3K 3RNKA 5MERA 5F7BA 2QLVB 5LGYA 1FP5A 2JNZA 5A2LH 2X4SA 3L4WA 4PWEA 5CN3A 7TAAA 3FN9A 4LVHC 4K7PX 4CDHA 4LSTH 1U41A 4FXKB 4PTTB 5DUJA 5INCA 2HFFB 3RQ3A 5DQ9B 4NRXA 5K33A 3BAYA 3VXSD 2DLGA 3V6OC 2PR4H 2X1XR 2N01B 1FNGB 1G9NL 3PABA 3DRQA 4H25A 1AC0A 2IIJA 2XPZA 3GIZH 4K4KA 5GGSA 2V5RA 2XC8A 2C9XA 1X6NA 3BVWA 1UZ6E 1T7ZA 1WGVA 1QPXA 1V7MH 3B2UC 3SY6A 1PPIA 3MRMB 4KK8C 5I5RA 1R34A 3EFOB 1MRFL 1ZHKA 3G5VB 3WUWA 5TQ2H 5DRWA 3PIQA 2IWEA 3FW6A 5HJ3B 4OLZL 5AVTB 1RUQH 1V8HA 3QDJA 4NC0B 3N3EA 1J9TA 5T8IA 3K7UA 4M9PA 4BQ6A 4GG6F 4LCCC 2Z7UA 3S48A 3D3VB 4G6FB 4PCYA 3BVVA 2AKRB 3UL4A 3ZE0B 2VUYA 1YNKH 3PWNA 3HA0A 4MNQA 2OTWB 4GS7B 4PVNA 3IGAB 4D9QE 1F4WL 4ELME 2QVTA 2BHZA 5CEYB 1KYFA 4EIUA 4GO9A 3Q8CA 2X3BA 1NLDH 2J1XA 5J1TC 4K9JA 1HILA 4DP8X 4R4NC 2DLFH 2HX9A 2R7EB 3VD3A 1BVNP 4UZUA 3ARDD 4WHYG 1CLYL 3O9WA 5I5MA 1Y07A 2A6IB 4J27A 4IK6A 5K59E 2P7TB 1KCKA 3E2HC 3HRZC 3TV3L 3WLBA 3BVNB 4M6OL 4AGLA 4YHIA 4KMTH 1PZUB 3SKUD 1N64H 3L17A 4CC4A 1QLFA 4LP8A 4FLQA 4TUUA 3GJEA 1QATA 3JWOH 5B1JA 2XWZA 2AJZA 3EFFA 5LCVA 2FJGB 4YBLC 4M5YL 3SPIA 5AD0A 1EJ6A 2MEJB 3EADA 3DUSA 2DIEA 5D7LD 4DCQB 3VFVA 3NA9H 2CIIA 4WI7A 2CHNA 1G1CA 1MHCB 3TT3L 4YLCA 4ZO9A 3SGJA 5LKNA 3U0WL 2FJSA 1E2ZA 2X87A 2HZHA 5HHNB 2OL3L 3BPNC 1HEHC 1NBVH 1IEHA 2R2CA 3UZQB 3LHAA 1TETH 4U2YA 3KR3H 4XNMA 4YAQA 3VRIB 5JHBA 1A7NH 3SCMB 4FXGC 1CTNA 4LRIA 2DMCA 3NQKA 4LEBA 5DFTA 1OTUD 2KYIA 5AW5B 4FTVD 1P7QB 3OXSA 4NQQA 4P2RA 1KJMA 3AS0A 3OX8B 4YX2H 1DJSA 2WBWB 3KPSE 1JGVH 4Y5XA 4G1MA 5C3LD 4UDTA 1MFVA 1RZFL 3SDAA 3GKZA 2DBJA 5D7IB 4OLXH 1UZ6F 2B15A 5JPNC 3MJ7B 3SKNA 4AE1A 2HN7B 5FGCB 4NRZA 1MLBB 4GQZA 1LP9E 3RVVC 1EDYA 4K9EL 4JVUA 2D7NA 2PXYD 3TBTB 5HGBB 1TEYA 1S7VB 4GRWB 2AJVH 3UMNA 3MR9B 5IHWA 1RZ8B 1AFVH 3V9CA 1WH0A 3K72A 4HKJB 1J0YA 3HZ3A 4GUCA 4HBCL 3CFBA 1YQVL 1FL6B 1KGUA 2H0EA 2HT3C 1Z7JA 4N20A 5IIEB 2K3TA 5SV3A 4RGMB 4HJJL 1UXSA 4EZJA 3MSPA 3JVFC 4OCWH 5CIPB 2FT7A 1EHLH 1ZXKA 3Q2NA 5EN2A 1H8NA 1OTUC 4MQ7B 2E9JA 5D6DC 2PABA 3US0A 3WSQH 4OQTH 4K55A 5EC2B 5DWUL 2WAHA 1JZ5A 4BKSC 3PHQA 2IOMA 2OQJA 2OYMA 4GBXA 3QYNA 2Y07H 4ISVA 5HI5D 4XBGB 4DTGH 2E46A 3K46A 3NFNA 2PYEA 2G2RA 2CJSA 5EIQA 3AU1B 4LE8A 3CHRA 1A6WL 4LSSL 4MJ4A 4NNXA 5JHAA 3NA4A 5EMYA 3ZKXC 4UILL 1NGWA 1J1OL 2Q2LA 2BM3A 5GS0H 4LLWB 5TGBB 1G7LB 2JK5B 4FF9A 2DYPA 3OJMB 1KSRA 4G6JH 3VH8B 3BHBA 5EU7E 4WK4B 5F70A 3QB7C 3D4GA 4PJCA 4R7NA 5AAMA 2VLJA 5AW8B 3V5KB 1CD8A 1XGPB 3CZKA 1S5HA 2Y5EA 4P5KA 1KBKA 2XXMB 2YSSA 2NR6D 3Q6GL 5F1IB 2XN9D 5I75C 4MLIA 3SD2A 3QDGB 1IEBB 3GF8A 5TDOB 4IIQB 1L9MA 3OXRA 4UV4H 1JWMB 5KS9B 4LHUB 2NTSP 3W39B 4MNHA 1THAA 4HIHA 2J1YA 5L88L 3S37X 1UQSB 4R4FL 3CVBA 4UV7L 1BVNT 2EDRA 1F6LL 4QHPA 2CKBA 4RFEA 2VRKA 5D1XB 4AXWB 1HKLH 2H8PA 1FE8L 3O9WC 5C0NC 3QORA 1EHNA 1QHPA 3MRHB 1YMME 3VD1A 2BK8A 4GIPD 1KPUA 3U4KA 2JB6A 2Z92A 2VSMB 3KBHE 3ILEA 2DLIA 4Z7VF 2DYRB 1BREA 3L95A 4XI5C 1C5BH 4LSVH 2A1WL 4FCAA 1KELH 4B5EA 1ZAGA 3BKYL 2V3FA 3W81A 1S7SB 3GHPA 3FMGH 4OI7A 1KPRB 4M00A 3F58L 4V2BA 4F3FB 3SBPA 3A21A 1AHWA 1NCTA 2ZZUT 3NJJA 3WTYA 4K7FA 4RQQB 4WHYH 3S8FB 1P7QA 3OXSB 4P2RB 4AENA 3H0TB 2ZWZA 3H3PH 4NLHA 5F1KC 4Q9RL 1PEZA 1IC7H 2R23B 2XACC 2CJTA 4AGPA 5JPNA 2A74B 4CC1A 5AOIA 5GGSY 3W82A 1NC4B 2NY3B 3B2VL 5JW5A 2F15A 4K94H 4QGTA 4KQ3H 4LU5H 3C6SA 3W9EB 2PCYA 1M56B 3FQXB 4KO5A 4A2DA 5CFHA 1YEHL 5EIIA 3UAEA 1JMXA 4IJ3B 2AJXL 3IMVA 4F58H 1XMWA 3DJZA 1E4XH 1KT2A 5F89B 1U8KB 3WU1A 1AD0A 1FUNA 4ZUVA 4ZFZB 1KV7A 2Y9RT 4KKCC 4X5WB 4ODUB 3AGWA 3COOA 4YPGB 2Z31D 2K9FB 3GSQA 4KWUA 2IG2H 3MYJA 1CF1A 1E2WA 8CGTA 4ZDHA 1PGRB 5CLTA 3A6BH 3DV4B 5J0BA 2EKSA 3HFML 2Z7WA 3QAZB 4M8RA 5K39B 4XVJH 1Z9NA 4D0CA 2AANA 3J8F7 4KH9A 3ZE2B 5CD5C 4NB7A 2W07A 2YRLA 3ARBA 2VMDA 1PD6A 2O6PA 3C5ZB 4MCNA 4M02A 1K2DA 3I6GB 3L3HA 2O61A 4WSJA 4WK2B 2DKSA 5IQ9A 2GB2A 1KGCE 1P69B 2Z4QA 1DQML 2WWKO 3FSAA 4XWOD 4FFZA 4J1UB 5E0FA 1RSFA 3BEVA 2OKMA 1GGYA 3FPYA 3GMOB 3KW7A 4KKPA 5AVYB 4FQIL 3GMPA 4EQ3A 4P5MA 5KVEE 2ZSVA 4GFTB 4EN3C 3FSOA 5I1IL 1BIHA 2QGBA 1R1CA 2H2SC 2D31A 5GJSH 2I9TB 3FFDA 5LNDA 1TLMA 1CVRA 4A6YB 2WXJA 1WEJL 2VDLB 4LSTL 4YSPA 2AZUA 3EG9B 4M4PA 2W9EH 5FCSH 4G70B 1YY9D 1JXJA 4AOFA 3PY9A 3U1QA 4LPUA 3S37L 4D8PA 2ZOUA 2CZNA 1AQDA 4G72B 3VFPA 3ZOAA 4OQTA 3LXBA 1TCRA 4UI2A 1YYLL 4A67A 2VM4A 2WJ5A 1NCOA 4PRNA 3CNKA 3LTVA 5BV7L 3UYRL 3BAEL 4UOW1 4K5NA 5T3ZL 5IHZB 2OZ4L 1RJYA 5GZNC 4NKDA 4KNUA 2XPGB 4BK5A 3AADB 3MCLH 3QA3B 4QHNB 5E5RB 2AQTA 1NCGA 1NMBH 1TU2B 1WV7T 2FD6H 2GJRA 4OGZA 3HE6C 4TOYL 3LCYA 3HHSB 1MWAA 3A4DA 5BQDA 4PJ8A 3L3OC 4F7PB 4IMLB 3S4SB 2V9QA 5ACLA 2OW6A 4BZ2L 1WD8A 2ISDA 3UCQA 4PW4A 1MVUB 5BVPL 1NCCH 3NGBB 3K91A 2F7OA 2XA8H 4JQVC 3UZVB 3T4YB 4QRPD 3KBEA 3RPIB 4YSTA 5F9AC 4PLKD 2V5TA 4PS4H 3HBGA 1CFTA 3K2IA 5GS1A 2WUCH 3Q1SH 1M53A 5DK0A 3ESUF 4HK3N 3BP6B 3KYMA 4I0CC 5GGRY 2OMXA 1ND0B 2TAAA 1KJ2L 5MHSD 4G11A 5FW7A 5GSVA 1BYOA 1ICTA 1GPOL 1CFMA 2FZ3B 1B6DA 1HT6A 3UTZA 1I9JH 4B9YA 2YQ3A 4FTDA 1F02I 4FERA 3VFVB 2XZAL 2BXYA 1CIUA 1KNOA 2YFOA 2DH3A 4XVTH 1A9EB 4XN2A 4Z7OB 3QFJB 3H54A 1NGPL 2X4NA 5HHVL 2XTLA 3IJYA 4HJGA 4J3OD 4G7RB 3LZFH 2IBZY 3BQUC 3GZPA 3HI1A 3WN5A 3H9YA 1BQSA 5AW7B 1JPSH 4ZPVB 5ES4B 1XGQB 5JLZA 5DJCB 5T3XE 4KPHH 1T2XA 3PJLA 2HMID 1AGCA 5F2FA 1E8ZA 3ZT6A 3D39A 1CT8B 4IBUA 1BF5A 3Q2VA 1UXWB 4N3TA 5ISZE 4QRPB 1OP3K 3ZL1A 15C8L 2R83A 4QF1A 2D7OA 1JHKH 2D9CA 5C3TA 1PSKL 1M9SA 1RZJC 2YBRA 3OLEA 1KACB 4IMKA 5E03A 4NZTL 1FFPB 2H6UA 2P5WB 1X4XA 5AVUB 2NSMA 3VFGH 1KGWA 1XV8A 2BIHA 4U1IB 3VXUA 3M8OH 2BPBA 4IRSA 4OKVB 1LK2B 1U4EA 3H2WA 3QIWB 3T0EE 4OFQA 5EO0A 1KYUA 2X89A 4PGEA 1LEGA 4ANVA 2GITB 5BXFA 3L2LA 3RVTD 1MI5D 1B0RA 3G5YB 1Y6NR 2WXNA 4X6DA 3CSBA 3JUYA 4ODUA 2AC0A 3OAWA 2X28A 4F33A 4GSXA 1BBJB 1PG7X 1K8DB 1O5DT 3IN0A 2CWRA 4P3CL 3A6CL 3P3YA 3IDJB 5IM7A 4OQTL 3WE6A 1JZJA 3FUKA 3CVCA 5D7EA 5I76B 5C0RH 4ZMWA 1VCAA 4AE0A 1YPZE 4ZFOA 3FQWB 3SKJL 5EU6A 1CD1A 4AJVA 1K2DB 3I6GA 1PL3A 3HS0A 2ICWJ 2KZWA 3TBTA 5D72L 1E3FA 2PYFA 1B0WA 4C54A 1ODAA 1I1AC 1T0PB 2AABL 2Q0ZX 4HGMA 5AKSA 1SEBB 4AWJC 3CDGB 4RAHA 3WFHB 5CCGE 2BOCA 1TF4A 2X44D 3Q0HA 43C9A 3VRLE 4QCIB 3T77A 1R5VB 4C56A 1AKJA 2VMFA 4PSPA 2BY3A 3GSNH 3ZTNL 4YGVA 3QRGH 3BO8A 2EILB 3MJ8B 4XPBL 1PD1A 3WXWL 2VMCA 2LLLA 1C1EL 4MRCA 2FWOA 5EBGA 3ZE0E 1UD3A 2EYSA 3MRLA 2ROXA 2VC2B 2WWMC 4OIFA 1MCLA 1CXIA 4QUOA 5DSCA 5HDRA 3KVQA 1ZLUK 1RHFA 3P9MA 5J11C 1NL0L 3IBEA 3UTPE 5JNYB 1MHCA 1ZSHA 5DMGC 4JHVA 2V7NB 5BMFL 2BSED 2YN3A 2R4RL 4LOUD 4L4VE 5I8KH 2M2DA 4OVVA 4XI5D 3RIAK 4XBPA 4KQ4H 1Z9LA 1GYAA 1OAZH 4R7DA 4MJIA 5ESVA 1WAAA 5DJ6A 1A6ZA 1VZHA 3H6AA 3T4AA 1MQKL 3FO1A 4GAYA 4RH4A 1EMTH 3SDXE 2FJHB 4PP2B 1P84K 4OCYL 3KM2A 3JWOL 3DPBB 2DQTH 2BNRE 2LR4A 3LVEA 2IH9A 4JNXA 1URIA 1PKOA 1AD9A 1R6VA 5D93B 2OJZL 3JYBA 5D70H 2B1HH 2QR0A 2P44B 4TPRH 2K45A 4BQ9A 3VXRB 2FD6L 3IDUA 1KXVC 5IG7A 1YNTF 3HLAA 1SGKA 1F3JA 3ARRA 3BESR 3CQQA 1RZIA 2DLFL 3V6ZB 1G6VK 4ZNEA 3IMRA 3FO0H 1FF5A 3QR2A 1R19A 6TAAA 4KDTA 3HE7D 1GS8A 1S9YB 4YFLI 5DQJA 1X44A 2CD0A 5DK3A 5H37G 2WV3A 4HCRA 2F2HA 5JR1H 2P49B 3N1PC 1EFXD 5D1XA 4G8IB 5E7BA 2HJLB 4WV1B 2ZWKA 1NGYA 1BYPA 4OLUH 3SPJA 4KI5F 5I0VA 3KGSA 1SPDA 3TIDA 1T04A 2HKAA 3QEUA 5D7LE 4EPSA 4UM9B 3KYKH 2DM3A 5F7EL 1T0MA 2AXGA 4LO9A 1QI4A 2OP4L 1UWFA 1E67A 2VDKH 4TNEA 5E1HB 5E9DA 3CZFA 5E4OA 3ZZLA 4BELD 1D2OA 4GP5B 1SMAA 4XN8A 1KN4L 4ODTH 3GSQB 4J4PD 3FFCA 3HEIB 3TIEB 2EDLA 5ABAA 2GBTA 1MCDA 3OQ3B 5KYUA 1ETZB 3K2KA 4K3JL 2WUCL 4Z7UE 5AVQB 2YPKB 2NX5B 3CUPA 2NPLX 3EO9L 3MBWA 4JFEE 4LIQL 3A22A 3EBGA 4XP9L 3TJPA 1GGBL 1MHEB 5AYUH 3O6MH 3E6FA 2XWBA 3GXFA 3MA7A 5BVPH 4Z7VE 1GZQB 1F6AA 3RNQA 5TTRA 2J8OA 3L3HB 1OAKL 2JKRM 1TJHL 1B4LA 2ZUQB 7FABL 5JW3L 1CE6A 2WYTA 3UYOD 4HLEA 3QG7L 1RK1A 4XN9A 1OVZA 3RPBA 3LB6D 2R4SH 4GRLA 3P0GB 1VADA 3CFDB 1CGVA 3W1ZA 3QH3B 5HHMB 4FG0A 1Q38A 5I26A 1TSRA 4NX0A 5B8CB 5TF1L 4Z77B 1DEEA 1QBLL 2Y23A 2EH7H 5E2JA 4HOMA 2WXLA 4ZAKD 3PCYA 1P4BL 3NIGE 3WN5B 3WDHA 4NN6C 4UB0L 2VLKB 1G9MH 2WSDA 1D7BA 1T6WA 1DJGA 2Y2WA 1YEHH 5D1QD 3N40P 4PD4J 1RKRA 1VPOL 5SWSA 5GGRA 4M5TA 3WKPA 4KTDH 3UZEC 2UUDH 3GRGA 4LVNB 2W91A 4KAQH 1B6UA 2JKTM 1ZK5A 4GMSL 4W9HC 4BQCA 4FZEH 4ONGL 2YGPA 2WBXA 1KCVH 2EIKB 2W0LA 4R0LB 1UYWL 5GZNA 4N9GB 2P5WE 3G08A 4URTB 4WHCA 4GG6B 2WLZA 1RZKC 2IDUA 5F7AA 5FUZH 5TH2A 3N41B 4G6ML 5KAQF 2QKIC 1O7SA 3MZTA 2EYTA 2Z93A 4A2GA 2J72A 1I82A 1QR4A 4I87A 4YO0A 3QYCA 2P45B 4JKNA 2VC2H 5F44A 4RNRA 4X6CE 1UOLA 2X4RA 4HWBH 4BRVA 2ATKB 4N68A 4DKFL 1IAKA 1QFOA 5TD4A 1WISA 3DPBA 4LOVA 4AGMA 4HEME 2VLRD 2IDFA 3ABGA 4XVOA 3NSYA 3BH8A 1BZOA 2QV2A 2A83B 4KDWA 4AYEC 1AXSB 1XR8B 3BAJA 2OK0H 4WI9A 5F97E 1UUSA 4HAFA 1HOEA 4PY8J 2V7NA 4OZGE 5C6WH 1RJYB 3QPKA 4M48L 3VVVA 4J3OC 2GFBA 4UQDA 1S7RB 4X99A 1WFNA 1PG7W 2K6ZA 3L3IB 3OR7A 4WW1A 4A66A 4K3EH 3REWA 3DIFB 4UQ3B 2IMMA 3DUHA 2IFFH 1K8DA 4AQ1B 3FONB 4U6XA 1MHHA 2Y5TB 5GGQL 2XXCB 5DCCA 3LKQA 3CDYA 4OF6A 1YUKB 1GGCL 2A9AA 4IBQA 4MCZA 1E65A 2BY1A 4FQ1L 3STLA 5J9PB 2Q10A 2Z0BA 3ZSTA 1NKGA 3LX9A 3QUXB 4FNRA 3B7SA 3IDGB 4G42B 5ABDE 1HL9A 2W0FB 4KVCL 2GK0B 3OAZK 5IHLB 1JDDA 4NN5B 3TYFA 1DVFD 3FMGL 3P77A 3TN0B 4Z18A 1Q94B 4OJDH 1JOIA 2G60L 3L1FA 3U48A 3QEQB 1TYEB 1YUHB 4IRJD 4PJEB 4J8RA 5F9JA 1ZHBB 4S1DD 1S9XB 2ZUXA 3RNQB 2I7SA 3UTTD 2V3DA 2WYZA 3DX2A 3DHMA 5FKAB 4XCFH 1IV8A 3V4PA 3EJZC 3G3LA 1LXMA 2XG5A 4RISH 4U1MB 1I1YB 5T1MB 4EDWL 3MV9A 5IFHH 1SUJA 1OB1B 1AGBB 1NGXB 3RAJH 4AG4H 1ASPA 4DKFH 2F5BH 4V2CB 5C6TH 4NHCL 5T1DH 4MA7H 4OZIA 4P5SA 5C0CD 3SSGA 3DRQB 1OTTC 4NQCB 1IQDA 2JTDA 2VERA 3O0LA 4JRYA 4TQEL 1BP3B 4XC3L 2E9WA 4CMHC 3EGDA 3FU5A 5TDPB 2ENQA 1ETJA 1XF5A 4P23B 2DKMA 3QUMH 3M86A 3BRGC 1OZTG 2A6JB 1TMQA 3B6SA 3T3ME 1JIBA 2QT6A 1OM9A 3MROA 1AVAA 1Q1PA 3KPQA 4ELMF 3R8BB 5CINL 1UOKA 3PGDB 2UYLB 1JGDA 1JFQL 3MAWA 3ZZ1A 1HHJB 1M1XB 1RIUH 2V7HA 3DMMA 5FUOH 3T04D 2DI9A 4A7TA 3N85L 2GSIA 4QMEA 4NKMB 4F5CE 3Q1EA 4FI8A 3NZHL 1XF2B 3V55A 4ADJA 3CHQA 2EH7L 1UA6L 4PGBA 3DUUA 4QCIA 2K6YA 3T77B 4PN6A 1OGTA 3CSYA 4E0RA 4RNRB 4FZ8L 1ZLWH 4X8GA 1JRHL 5C3IA 1NPNA 3AXHA 1TQCB 2IGFL 4YSEA 5TDNB 5KANG 3V0AC 1NCBL 4M93C 3NCMA 1L5GB 4W9GC 3DURA 1SJMA 4TVPH 3JSSA 4I3SH 3D8MA 4R7VA 3GYRA 4HJUA 4ANUA 4RGND 4P5TB 2QPSA 4M61A 4J3OF 3DUSB 2Q7AA 3ISYA 4DP6X 4KQ0A 3RZWA 1MCRA 2UUDK 5DD6A 1NZRA 2OMZA 4FFYA 4JGJA 3RUGA 3VNZA 5GGTH 1FG2A 2UY7B 2ROYA 5KBNC 1BGXL 3QO1A 3PPEA 4OFKA 5AOLA 2NY0C 4U1NB 3FT0A 1DBBL 4R97C 1GJUA 1UFGA 2H6OA 4QXGH 3CBKB 4NZ8A 3IN2A 3TESA 1DZ0A 4HEPA 4OIBA 3MA9L 2HTLC 4J3TA 4E9WA 4YGVB 2Q8BL 2X4TA 4I0KA 3ZJAA 4FXKC 2HX8A 4QRAA 4D9RD 4PUBL 5IROD 1KUMA 1XGPA 1S9WA 1TOXA 4QR7A 5FC9A 3B2DC 1UADC 2QVMA 5CLWA 2UZYB 5DEFA 1X5ZA 2ZUWA 4JDEA 4Q89A 2H1PH 4X5RA 4Z5RB 3LS4L 1FBIL 5D7LA 3EDKA 2R1YB 4AEIH 3UPRA 3VGAB 1J9CT 3QIBD 3L1OL 1MRFH 4I85A 2FLBT 4NQDA 2HSIA 3NIFF 1M42A 4Z7QE 2CBOA 3FO0L 1WP6A 1V7ML 2BVQB 2B1AL 3MLWL 3VXMA 4NHUA 1FCGA 1QR1A 4AYFB 3ULVC 4J3SA 2XYCA 3NSXA 2CLVA 1JF1A 2C34A 4LHUG 5IM7B 2C7UA 3QDAA 4FQ2H 1GOGA 5EO1A 4DK3A 1UB6A 5FO9A 2FWLB 1XH2A 4FFZH 4BH7B 1T1XA 5C0JB 2O6CA 5C0DA 3U9WA 2B2XL 4M4RB 2F53E 4I77L 4NIYE 5E5UB 2AV7A 4PTUB 4X9FA 1RMFH 1IRAY 4Z3HA 3CX5K 5SX5K 4AK2A 2IGTA 3ESOA 4JRXB 1OCZB 3VFTA 1QYGH 4LAQL 3CVHH 1SXBA 4PRIA 4ZW8A 5INDA 1SY6A 3LKSA 4I2XE 4Y9BA 1YNKL 3EKCA 3V0GA 3O3BB 3WDIA 3PHAA 3DOSA 5BO1H 1UCBH 2CO6B 4R83A 3LKRA 5CGYC 4ZT1A 4CSSA 3D7PA 4JZOA 3RX9A 3ILQC 1A7RL 2J44A 2NSQA 3QUYA 5SWSE 1BWMA 3ARGB 2DICA 3QJRB 4Z7QB 4QXTA 5JDSA 1I53A 1MRDL 1JS4A 1S7XB 1TQCC 3FT4B 3HC3L 4ODTL 1IGML 4UOJA 3ZHKA 1T66C 4Z7NF 3V10A 1OL0A 3CVHA 2GY5A 2IGLA 4HPYH 3TF4A 4W81A 43CAA 2MIZA 4Z23A 3NSCA 2CIIB 2ESVA 1CTMA 1MOEA 3WJMB 2CDEB 5JIDA 2ATAA 2Q2EB 1IBBA 4L1LA 2JCCF 2WQUA 1XGYL 3SKMA 3T6VA 3QO0B 5HYJB 4FP8L 5FGCE 5B7EA 3DJRA 4P3CH 1E9QB 3OAUL 4KOCA 1KZQA 4N8CH 1JL8A 1R46A 1QFUH 1NGXA 2EINB 3L81A 2A6IA 3MLXH 3UC2A 3W57A 2GEQA 3WO4C 4MDRA 4B5ZA 2VYRE 1DDHB 5GS1C 1X5IA 1VJSA 3RWGA 2VISB 2IADB 2OJZH 5E8DH 3ML9A 1G4MA 4KVCH 5KVGL 3IS0X 4FNLH 2XTJD 1N0XL 1UKSA 1F11A 1YUHA 4PJEA 5GRWA 3V8OA 3E6FB 4OCYH 5EUOA 4Z5RA 15C8H 4HH9B 3QORD 1M9WA 1OV8A 4BZYA 3OF6A 1Y18A 2P1YA 1GZPB 1Y0LB 3FB5A 4H0LC 2G75B 3HMXH 1T0NB 1Q1JH 3CPLA 4HALA 1QRKA 1H0DB 2XJLA 3EYUH 4A37A 4DW2H 4FYQA 5DTFA 4PREA 1QI3A 2ZUVA 2PNDA 3NRPA 4HCIA 3WDJA 1AOZA 4HIQA 4Q56A 4X7DC 4AQ1A 4O51A 5IIEA 4H25B 1GSMA 3JTTA 5IQMA 1KPVB 1XTLA 4IBLT 4EOWL 4CVUA 3VDBA 4W6XB 1UXSB 2VXUH 3QVAA 5ALBH 1LO3H 1D6EB 4L4TA 2V2WA 1AO7A 4M5SA 2AJ3B 1T20A 1DDTA 4H40A 4Y5VB 1I3GH 3L6FB 2DBLL 2I26N 2K0RA 2LLGA 5CSZB 1EBPA 4N6RA 2H5UA 2WSKA 5K9QI 4ZS7H 3TN0A 2R1YA 3ARDC 2RQ8A 3UPRB 5DD1L 4NRZB 2VC2L 4G7SB 3AQYA 3L5WA 4EI5B 3FU7A 2YA2A 1ILSA 1CDYA 1G0XA 1UD4A 4KC3B 4JO4H 1TXKA 1E30A 4PGCA 1BLNB 2P8MB 5AENA 4JY6B 2FECI 4C55A 1KCLA 3PAUA 3CPUA 3ZHFA 4GKZA 4TVUA 5JPMA 1MPAL 2BH0A 4U1NA 1NAML 5C0BD 2X4RB 3BD4A 4MASA 4NO3A 3FT2B 3U7WL 4ZDHB 1ZS8A 4D3CH 2XRAH 5JXEA 1BZQK 1H3WM 3C5JB 5MENA 4ELMB 3T8VA 3CVHL 5HVWA 1AQHA 3EHBB 3BP4A 3MRCB 3FQ2A 1UA3A 2BHUA 5DDHA 2IXQA 5I1LA 2PPDA 4XPFL 2XU9A 2E7LC 1B0GB 4EUPA 1WFTA 5DD6B 5JYLA 3HNVL 5D6CB 3TEYA 4XCCL 4F2MA 4DP9X 1UWXK 3UYRH 4MJ2A 1QBLH 3P0VL 4L1DA 1Z6JT 2XVKA 3LN9A 2FR4A 1R75A 3P4MB 2AI0H 3WNNA 2NT0A 4OLYL 4OCMC 2GHWB 3BZEB 3QJOA 1BAGA 3JWOC 1P53A 3FO9A 4OZIB 3LDBC 4X7CC 4ZPTA 4R4BB 4KK5D 4OGAD 4OJAA 1TQSA 3F6IA 5D7SL 3B9KA 1S5HB 4PRBA 3WELA 2L7EA 3MV9B 5DR5H 4MNQD 5FYJU 4F3FA 2DQMA 3GI9L 4XNYL 3DUUB 3PL6A 3WFCL 4LVOC 1ITBB 5SWQB 4JY4B 1PKQE 1LP9B 1RP9A 2B08A 4JJ5A 2P80D 4MAYB 4HKXB 2JIXB 3L1GA 4HX1B 3X1FA 1XT5A 5H35B 5C0BB 1KLFB 1CYGA 2WXKA 4BRJA 1A3LL 4HW6A 1D5XA 3K6DA 4OD2B 2PXYB 1D7FA 3KPSB 5KS9F 2VXQA 2AV7B 3HS8A 1XX9C 4ODBD 2H8PB 4M3JA 4HIHB 4N2GA 2G4EA 1INDL 3MROB 4MMYA 1NBZA 4JDVB 5SWZE 5BRZE 4KXZI 4FQXB 4LPTA 4ADGA 4HJ0C 1CZ8L 4HLZH 3E3QC 1X5KA 3QR0A 3T6WA 3K6SB 4RSYA 3JBG7 2OMNA 5CUSL 5DJXB 3CPLB 3QJSB 5EO1B 3K6NA 5LNGA 2WQXA 3SZKC 4ADIA 2DMKA 4JK0D 3BPOB 4OT1L 5IQOA 1DBBH 2R0KL 3QDGA 2NY6C 1LHZA 3X11B 1LE9A 4PBVC 4PVMA 4G8EA 1P4LA 2ZSVB 4BBWA 1KB9J 2DIAA 2LVCA 4OF3A 5IVZB 3BFQG 2RFXB 1UWGL 5F7DB 4B6ZA 2YPLB 5DC2A 4HJIA 4MAUH 5EIVA 4LBAA 3ARTA 1A65A 5LUMA 2H0PA 1CFNA 3VJ6A 2C3GA 1ED3A 3B3IB 4KK9D 2FO1A 4IGBA 3MRNB 4U7MA 4BZ2H 5C0FB 3C6LD 4XNBA 1XGUA 5D7IE 4PJAA 3QGVA 2OXGB 3RGVB 3IMWA 4IBTA 4ELDA 3ARBB 3MNVB 4X8JB 4BYHA 4QGYA 4PJFB 3AMKA 5DJ2B 1FL5B 3MLYL 3WG7B 3H9SB 2ZOLB 1SVCP 3V0VA 3EUUA 3LD8C 4P2QE 4QTHA 4GW1B 4X5WA 2EH8L 5DTFB 5FM8A 3KWTA 4HIEA 5E99L 2EDXA 1CTOA 1YPZF 4XNXH 1A0QL 2EUVA 5LG6A 2DQFA 3T0EC 4YDZA 1I1FB 4Y5YA 3TM6A 4E9TA 2HWZL 4NKOA 1PCXA 4FNPA 4RESB 1S9KC 1CC3A 3EHBC 3NFSH 2WTRB 3HI5L 4UBDD 3ET9F 3SE8L 3FT9A 5K93A 1NAMH 2XHNA 3BP7B 4JO1H 4KO7A 2FSDA 2OMYA 4E42B 2VSKB 3AABA 1FZJB 5D7IF 2V37A 1ECYA 3AM8C 5IQ7H 3F7RA 2X0VA 2V2TB 4PGBB 2WBJD 4EZMA 4YE4L 2WIMA 2AABH 2OMBA 3O2DH 4K15A 3BUYB 1LO2H 1EDQA 1AE6L 2KPWA 1E28B 3DX7B 4X7SL 4EI5C 5JOPD 2ZYSA 3GZKA 1RURL 2MJWA 2MCAA 3E1F1 2Q3ZA 3EH1A 2GHZA 3H9SD 5MP6L 5DI8A 4WI0B 3JWNG 4JHAL 3VFNA 1IU1A 1AGDB 2DM7A 1WYJA 2HT4C 4G9FB 4O2CB 5I8OH 2CIKA 1HFUA 4NO2A 1CJYA 2ZG3A 2DTSA 2NMSA 3N04A 1LO4L 4OD1L 4CSPA 4ZFOB 2PN5A 3BFWA 2NY3D 3U79A 3VW3L 3KYOB 3A6CH 3DJTA 3I9PA 4P06A 1KLUB 1UD2A 3U9UA 3V95A 3OAZH 4APQC 2FX7L 3P0VH 5JOEA 1BMWA 1RUMH 1G5GA 1U8LB 1T1YA 3MBWB 3TJHC 1MG2C 5I66A 1IGIL 1KCUH 2QGDA 3DTXB 4KO6A 2YA0A 3GM0A 4PY7B 5ENWB 1I8MA 1LP9F 1EXHA 1ILUA 3ARSA 4DGWC 5DJXA 3GUTB 3QZBA 4M1CD 2BP5M 1B0RB 1C16B 1QABA 3B1UA 1VADB 2CJUH 2KPNA 5IF0A 5TK2A 4OZFG 3QCTH 5KZCB 4YNYB 3QH3A 3GBNH 5D2NC 2X1QA 4QTFA 2KLSA 4HMDA 4JFFD 2H41A 4HUCA 5F88B 1U3HD 4H44C 1JTPA 4RMVA 3M7OA 2J21A 3MLRH 4NS0A 4N0CC 4WIQA 3LXAA 4JO2L 4KTYA 1P4IL 4L37A 5KUKA 1ADQA 1BOGA 3RWCA 3LEVL 1CWVA 1PBYA 3D39B 1LNUB 4NKIL 3S36X 3S7GA 1SM3H 2QHRH 3MRKA 1U58B 4N8CL 4AZ8A 4F2EA 3UBFA 3MN8A 2R9HC 1HINH 1QTYT 1L6PA 1NGPH 1KCSL 1ORSB 2B39A 3LY6A 2F9BT 4LLDA 1NTDA 3P4NA 2AJYL 1OIOA 4EVNA 1FZKB 3LN4A 3JWNH 2WJ7A 1N68A 2F5AH 1WJ3A 1HXMA 2OXHA 4HSQA 2GYSA 3A24A 1RJZB 3EGSA 3APMA 2GJ6B 4HMCA 1RLBA 4R4BA 2C9PA 3ARVA 3P3RA 2VO8A 4UAOB 3OAYK 4HMEA 3TIDB 3T0DA 1GJWA 3GDCA 4HPYL 3QFJA 4KZEH 3SJVA 1TETL 3MREA 2X89D 2VN7A 5LWYH 4GSRA 3K8MA 2EDYA 1EEUA 1U3HC 2WXHA 3FCTB 1CI5A 2W60A 3CC1A 1BXUA 1XAKA 1ZT4B 5JNYA 3ARGC 2DRUA 3RLSA 2ZCLL 4JFOB 3AU0A 3PG2A 4IJTA 2RIKA 5GJTH 1MCFA 2PLTA 4NUGL 4FKKA 5GGVY 3ROOB 5IUCA 1ZLSL 2VN4A 2DQGL 4XP4L 1YMMA 2C1PA 5CZVH 2P5ED 2UX7A 4L4VA 3L45A 4GUPA 3JT2A 3PL6B 3IFLH 3BT2H 2BWDA 3J2PA 4FQLL 4JFXB 4DPBX 1YEWA 5ANMB 3PGCA 1G0DA 2GSGA 2NUTB 4P05A 1ACXA 4WWKC 4CC4C 2Y07L 3DA0A 4MJJA 1FO0A 1ETA1 4Y4KD 1SDAB 3R1GH 5DHYA 4C56D 5F3BA 5BZZA 1F90L 1J5OL 1CFQA 1VHPA 1N7MH 3FUJA 5I73B 2C4XA 2FZ3A 2DB8A 3GJEB 3NGBC 4WGVB 2VLME 3LH2L 1NAMA 2FJGA 3DDFA 5F3HB 4PJIF 4LIQH 2RJMA 5I1HL 3AY4C 4WGWB 3GS0A 3STZA 1QTPA 1KC5L 2I9LB 2FBJH 1T03L 4YMPA 2ERJB 1WBYA 3IJ8A 3QWNA 5I28A 2EC9T 4LP5A 2IFGA 4RZKA 1IX2A 2VKWA 5FOBB 5JUEH 4PREB 5J6GA 3BIAX 1JNHA 2N7SA 1OTTD 3BO8B 4B7LA 3EF7A 3L13A 5C08B 3REVA 1OPGL 4GRWH 4OLXL 2MKWA 3AJ7A 1OLZA 5LGKA 3D51A 2R2BA 1JGVL 3RI5F 4WWNA 3IXTB 2YAEA 1ZT7B 1L6XA 1DQDL 2VH5H 3RL1B 4R8WH 1J5HA 2M8XA 4GO8A 4X5XB 3I6LD 1TZGH 5AB0A 2WQAA 5IFAL 3RA7L 4QRPA 1MCJA 3CGTA 4N0YL 3L3OA 5GGTA 5JORA 1J8RA 4O4YH 1IM9D 4K71C 5EU3B 3VFRA 4YN3A 2R69A 4BA8A 1DQKA 3DYMA 3PDDA 3ZXAC 1KBGH 2ZF8A 3S36L 1FIGL 2J8UA 1A1NB 1N67A 3I2CL 5HYIA 4EI0A 3QIWD 1S5IL 3IDXH 4PFEA 1MNNA 1WZAA 5DRZA 5JHDA 5D70L 5DMKA 2WLLB 3MNDA 2V3EA 3I9GL 4M7LT 3FFCE 1ZKAA 4LLUA 5EULV 3ULUF 5JHLH 3MV8A 1NGYB 2ZUUA 3DROA 5DQ9A 5AOMA 1UACH 1KGYE 2DWXA 4KMTL 3QXAB 4QY8B 3OZ9L 4PJAE 2WP3T 3D6GA 5I0ZA 3QFGA 4MSWB 3IAPA 1F0LA 4X7TA 2MNWA 1SYSA 1A5FH 4Q9BA 1J88A 1E5AA 1MLCB 2SEBA 3L4VA 4CU6A 5A2IH 2F54E 5BOPA 3VD9A 4F9PC 5F0PB 1PQZA 5BMFH 3M07A 1SXAA 3VGFA 3PNWA 4BIKA 4D9LL 4UQIM 3D0LB 2W0FA 4NP4H 4KFMA 3UZEA 4ES9A 2UWEE 1IT9L 1AR1C 4Y4FA 3SIKA 1QPPA 1MSPA 1U91A 4HUVA 3P9LB 5KSBB 3NVQA 4DP1X 4NC2B 2V9RA 3O4LD 3I02B 5A43C 4YS4A 3CZJA 5LBSA 5TK4A 4IJ3C 1J12A 3PXHA 5FLVA 1N59B 1WG3A 3FO9B 4YXHL 2YOAA 1TQBC 1IBFA 2WLJA 4ODVL 3ZTNH 4IDJL 3DV6B 3W2DL 1P5UB 3PU7A 4I18C 4R97B 2ENJA 3CMOL 3RKPA 5A2AA 1AZUA 3QHFH 4DO6A 5LN8A 1GOHA 1OP3H 1VEOA 1NOLA 3BJLA 1KLUA 3OSVA 4QPEA 1SRDA 1T21A 2WLKA 4TQEH 5TFSH 1KIQB 4IRZH 5IVXE 1TZOA 5LDUA 1CFQB 3LH2H 3MODL 4EIZC 3O3EB 1XR8A 2AV1A 1E40A 4HK0A 3GRBA 4FKHA 2VQUA 3ARQA 3KLAB 3MNMA 4KHXL 4Z7QF 1FLRL 3W56A 1ZANL 3KEHA 3PWUB 5KYWB 5EU7C 1U8QA 3MGTA 2WVVA 4KKLD 5KYYB 1HHIA 1HEZA 3KXFB 3A6OA 3WKYA 2IV8A 1TTAA 2UWEA 2B4CL 3F04A 3X1GA 5BUPA 3KGTA 1KENL 5GS0L 2JFCA 4P2QD 2Q6WB 4M62L 3V9FA 1UH2A 3CN2A 2IO5A 4NSKA 4QHLA 5D8JH 2BVOA 3BSHA 3QCVH 4L23A 3UP1A 3ZDZB 5HYSB 3PDOB 3C2AL 3LYRA 1AMXA 2DQCL 5J89A 2CGZA 5I6KA 3HJEA 1J5DA 5CCHE 2RH0A 4JPIB 4PJ7F 4GEIA 5CZVL 2ZOTA 1Z66A 3OKMB 4FG6D 3MA7B 3VJ6B 4CN6A 4PJEE 5M94B 1JVOA 3WSQL 4X7FC 5IMKB 2EXWC 1F6FB 4R2GD 1HCYA 3ZKND 1E5CA 3F7YB 4IEFA 4X42A 2H0JA 4HZLB 5FW6A 4G6AC 4JM4H 4JZJC 4RRPG 1Q9KB 5CBEB 1K8IB 1G6RB 4L8DB 1PZAA 1QA9B 4XC3H 5E9DB 3L48A 5G5DB 5D5MB 2X12A 3IDYB 1MNUH 4OH2A 2D7TH 1G87A 1LMIA 3V5KA 1E90A 3OD3A 3QNXB 5GS0D 1FDLL 2RACA 2HVJA 3L2NA 1IBHA 1NEZA 4K7PL 4LFHD 3MMEA 4MA1B 2OSXA 4APXB 3BEWB 2CGRL 2WZAA 4EDWH 5SWZD 5C07E 3WLWC 4ODVH 1SJHB 1FV1A 1CICB 4D8OA 5CJOL 3I9AA 4P5RA 4PJ9B 3MJ7A 3E8UH 1PZ5A 5IROC 1NPJA 5KOMC 4Z7WB 1RQ5A 5EA0H 4NQVA 4KHTL 2Y5QA 1DEDA 3DBXA 4JO2H 5H94A 1DL7L 4XOBA 3UTTE 4EIBA 3SGEI 5ISZD 4IBVA 1K72A 1RU9H 4K3DL 2VDMB 4JGNA 2VZSA 2WQWA 1UJ3A 1U8IA 1RIHH 1NIEA 3PWLA 3GBNL 5ENWA 3AG2B 3DO3A 2D8KA 3NCJH 2VN5A 4OFPA 3NSFA 4BFIA 3DMMC 5LGHL 1E9OB 2XQBH 3ULVD 1QUNA 4JE4B 4XRCA 4V1DD 2NXYC 2BW5A 1HSBA 3WIFB 4WQOA 3BKCH 5C0EA 5FFOA 1QLEH 3GSRA 1NFDA 5E9DD 3EH2A 5C2BL 3GRWH 4X7EC 4HA1A 3F05A 4HLZG 2K6WA 3QIBA 4RBPK 4R84A 2GVYA 1E43A 2EUXA 1X7TA 3QCVL 1ZT1B 3JWDL 1YAIA 4O9HH 1FNSH 2AAVA 3S36H 3BAXA 4WWPA 5IHUH 4HS3B 2Q7NA 4XPAH 1QFUL 2OSLA 3BPNB 1E28A 4CNIA 2DWYA 2L7UA 2OK0L 4Z6AT 5HGGS 5ILTH 4FEMA 1JK9A 4BUQA 4S1QL 3DRTA 5E51A 1NH6A 5IFAH 5FF6A 4KZ0A 1QBBA 4NO0B 1YY9C 1OB1A 4NQSB 1MWAB 2BFVH 2DQHH 2VLJB 1GVIA 2VH5L 4NOFA 5KSBF 3VD0A 1M1XA 3WNKA 4M1DH 1GGIH 3FHAA 1N2RB 4A7GF 4PJ7E 1AE6H 4X7SH 3ZK0A 2BVEA 4XMLL 5K1VA 3VM7A 1FWXA 5DHXB 1QSEE 4KTEH 2OTUA 4XAKD 3VXNA 5TFSL 2QKIB 5C0AA 4M4RA 3JUZA 3ZKQD 4JAMA 1IGFL 3B6SB 4HJTA 4MS8C 2AXJA 3HG1E 4L5FL 5DS2A 1QQDB 4U2ZA 2V8MA 2AQ2A 1EAOA 5B38G 3CMOH 1FVDA 1E4WH 1Q0EA 1P4UA 1JV5B 1AGEA 2PCPB 4PBDA 2YQGA 3WS6C 4RLDA 4PIBA 1SUHA 5E9AA 1SBSL 5FGBA 4MJIE 3WN5C 2SODB 1A6AB 2NTFB 4NBZB 4U6YA 4WV1C 1NDGA 2VLLB 1EVTC 3G04A 1NLBH 3MV01 2R15A 4JW3A 3WY4A 1CLOL 2F19L 2QFRA 2VOTA 2ADJB 2I5YH 2MCMA 2F54B 5FM4A 2K9UA 3WE1A 2QVKA 2NZIA 5CO1A 1HZLA 1K5WA 2F1BA 3JTSA 1ZA6B 3LEYH 4G80A 4IHOB 2ESVE 3ZHLA 1FI8C 1HL4A 1B9KA 3HUJF 3EJUA 2BVPA 1OPOA 3FN0L 3GS7A 3OB0K 5AEAA 4EN3D 3Q06A 4X6BB 4WTQA 4PB9H 1QG3A 1OP5H 1NGQL 3LPFA 1JDCA 5BJTB 5KYXB 2ZCLH 2D0HA 2VQ1B 3TBWA 4XWOC 4UQBA 3IF1B 4EO5A 3K71B 3QI9B 1RZPA 4YGAB 3TEWA 1DBKH 3VGEA 2HMIC 3K4AA 5FOBA 2X38A 1HU8A 1UFUA 4YDNA 1AJ7L 1NKOA 1N4XL 2K7PA 4WWID 4HD5A 4PWFA 1OSZA 4LLAA 3RTQA 1NFKA 1FVEA 1R3KA 5AVWB 2BX5A 4B0MM 3OPZL 4HH8A 2FGWL 3LDBB 4H8WL 4AVJA 1NMAL 4PJBB 2D9QB 1OM3H 4C83B 1CURA 4PUBH 3OBAA 5B1AB 1TZAA 2WN2A 2J4WL 2NYYC 1ASOA 1I3RB 5EF1A 5D2LE 1IBGH 5IEHA 1X5XA 1IIKA 1BFVL 1JGIA 4G2AA 4DO5A 1RSYA 1U8IB 4PGCB 4QD2E 3WJJA 1OARH 5FHBH 4JQXA 2ZXEB 3QWRA 3QZWB 5CM1A 3B2UD 4YUEL 3UBHA 1UB5A 4DKEH 5AYTA 4OTXL 4JREC 4ZMNA 5E8EB 5C9KA 4ENED 3BKML 1MW0A 3TLRA 2J73A 3KJ6L 1WUZA 3C5SB 4K5LA 1NWOA 3A4FA 1DQTA 2UVFA 1NSNH 4M6NH 1MW3A 4KMQA 4RDQF 4W9CC 2DW5A 1SOKA 3MRCA 4D8PB 1PW3A 1T21B 5HY9B 4PHXA 1SYSB 3L4ZA 4JM2B 4GP4B 4P8QA 3TVMD 1TEGA 3UX9B 5I76A 5T5FA 1R17A 4WUKL 2F53D 4Z7UB 5I17A 1J05B 2MCG1 3VA2C 1MREH 5I8KL 2C26A 4BXVA 4AUJA 5CEZE 4PBXA 4TVSa 1G7JA 1I7RB 1NGZB 3BN3B 1A4JA 3MQIA 4KK5C 3UC0L 1JPTL 4D2NA 1QA9A 3IKKA 1A6VH 1XD0A 4U1KA 3P3SA 4BZ1H 2KKQA 4X5LA 3GMOA 5DMKB 5HXMA 1C1EH 2WIIA 3PWLB 1KGJA 1PSKH 2UVEA 4NUGH 4XPBH 5KSAC 4UM9A 2YHGA 4L3EA 1Z9OA 2BOCB 1KIPA 1T6BX 1NAKH 1MCOL 4OZHF 3HKZA 5AOZA 5J4MA 3NCYS 4ZD3L 5H4ZA 4FFTA 1GCFA 4AM0A 1IBDA 1AS8A 3UGEA 5F9WB 3QIUA 5L8JB 4A1RA 3NCCB 4DEPC 1MXDA 2WKOA 3SDXF 2UXFA 5CSZA 3OKLA 4G6KL 1DDHA 3V6ZA 3MCG1 4OVUA 4APQA 2FCBA 2YAPA 1TQVA 3OHXB 5DD5H 2BNQE 4OV5A 1MHEA 4JM2F 3H55A 3MRIB 4P57A 3SDDB 3C5XA 3SDXA 3BYTA 1YHPA 4DVRL 3JWNC 3PIQB 5HJ3A 4AYDC 4JFZH 2ALWA 3RY5A 5IBLC 5EFIA 2KERA 3TVMB 1OM3L 3CHXA 5HYJA 5KYYA 3TVMC 2ITEA 3LV3B 4WW2A 3MV9E 5EOCL 1DVUA 1G6RA 4EOWH 1PAZA 5F6IC 1V10A 5DRNB 3RVTC 3ZE0F 1MCSA 3ALPA 1DLFL 5BOZG 4UZGA 4XNXL 1NBQA 3OV6A 3X1NA 3EYUL 2HH0L 1AAJA 5IMKA 3PP4L 4YLBA 4MB5A 4Z0BL 4KRPB 4AYBA 1UEYA 4UTBH 4FQCH 1J8KA 1ZVYA 1YEKH 4I1RA 1L9PA 1AKJD 1RZIB 4ZMQA 1SFHA 1WPCA 1EJFA 1A6UH 1LK3L 8FABA 1JZFA 5LXGH 4IU3A 4MDJB 5L8KB 3SDCB 4NQSA 2YGNA 5L0QC 1NINA 3O3BA 1HHIB 3KXFA 1OARL 3WIAA 4J4PA 3N91A 5D96C 1S3KH 3B2XA 1E4JA 2MQ3A 4NQDD 3CFJA 4OIIL 3PHOB 3KPMB 1VFMA 2M1KA 3IEAA 1E5UI 3SDDD 5C7XL 2X4NB 2XN2A 2FO8A 2FQFA 3N6YA 4K8RH 1ZEAL 5DMGD 3UYPA 5CILL 2J6EL 1EO8H 2EDTA 1SNRA 3MUUA 3Q43A 5GRXG 4P5TD 3TCTA 3HRPA 3B4NA 4FP8H 4ODWA 4GSDH 3UTQB 3B9EA 2AJSL 3U4EB 2GJZB 3ZRFC 3Q2WA 3QZMA 4HC1A 3SCMD 1E2VA 5DF0A 4JVWA 5T3ZE 3DX1A 1B0GA 4ZTPH 3WTTA 5ESAB 4FTVB 5FA3A 2YUZA 3AT0A 4AEEA 4I8DA 4UUJB 1PFOA 2P9RA 2WZ0A 4OLZH 1YJDC 5FV1L 5D7JC 5F0MB 3UH8A 3AB0B 5HPMB 4I89A 1RURH 3QYMA 1BZ7A 4WU5B 1G94A 3ZPDA 1INQA 3IXAA 3V0VB 1II4E 2E47A 1I9RH 2DL2A 4XHJD 2QSVA 2AQNA 2PF6A 3BWAB 3LRSB 4PRHD 1FCCA 1FYTE 4HVBA 3GI8H 5A3ID 2XXGA 4XMXA 3CSGA 2W95A 4OUUB 4LLWA 5BRPA 3QJQB 1R5VA 3VGBA 5IP4A 2NRDA 2H3NB 2WXQA 3GI9H 5L2JA 3R7RA 2PW1A 3RDTB 3M1BA 4NM8H 2R2HA 1P0SE 3Q8AA 4QRPE 4NLAA 5FYJH 2J5WA 1Q0XL 1JMZA 4KAQL 2IDCA 4TOYH 1ZE3H 5E94B 3QQXA 5ILTL 3GXNA 3ILPB 2K70A 1QSFB 1YQ2A 3CV5A 4G3YL 3P9WB 3FRPA 5IW6A 1CFSA 4P48A 4Y19D 1V27A 2YPKA 4KK6D 2LFGA 2DY2A 3NEXA 2WXMA 1R47A 2R56L 5L6YL 2YEVB 1JGLL 3BLKA 4N2KA 4HKBA 2R29A 4EXPX 1A6TB 5EFIB 2CXKA 5INCB 6FABH 5C2BH 5IV2B 1KTKE 3NJIA 1J8HE 3DX0A 4HKJA 3LPPA 3QG7H 3WV0A 3D30A 3OKEA 3CLWA 3BHBB 3NEEA 4HPOH 4PLNC 1N3NA 3BIKB 2ZYHA 3MV7E 4PTTA 3U30B 2VLMD 4FQJL 4GBXD 1PX4A 3BVUA 2IMNA 2OAAA 3OJDB 2PWGA 5GRUH 2WO4A 5AYUL 4BFFA 1RJCA 3QXTA 1T3FA 3MXWL 1UKQA 3QIUB 4KTGA 2GKIA 3QDGD 1E6OH 2YXMA 4PJ5E 3GSWA 2BSSB 4HT1H 3MRRB 3NIDB 4XBMA 4LHUD 2XA3A 4M5ZH 4HCGA 3KPLB 2MNJB 4Q7DA 3SDAB 1FZOA 1XCQB 2W65B 1KN4H 2E76C 2E8YA 1KY6A 3LQZA 1P7KA 2FX9L 2NXZD 3V6FA 3VB8A 2R0WL 5A16A 4TSAL 2QV4A 2WB7A 2P43B 4UQ2A 5J12C 2VW4A 4U1KB 4E42A 3W11D 1XF4B 5E8OA 1JGDB 4L3EE 4I0PD 3BH9A 3OR7B 4WW1B 3ASNB 4CU8A 2X6BA 1YYMH 2BDNL 1QOKA 3MRHA 4JO3H 4E41A 1FL6A 5ALBL 1ACYL