3VVWA

Ndp52 in complex with lc3c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
117
structure length
110
Chain Sequence
b'SQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Calcium-binding and coiled-coil domain-containing protein 2
molecule tags Protein transport
source organism Homo sapiens
publication title LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy
pubmed doi rcsb
total genus 14
structure length 110
sequence length 117
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vvwA00
3VVWA 2LFEA 4NLHA 3VVVA
chains in the Genus database with same CATH superfamily
4KROC 1ZGLA 1G4RA 1SF3A 4TVPD 1LM8V 3FT4B 3K72A 5JHAA 1CE6B 2XVKA 1GS7A 3AUWB 5AW0B 2GI7A 5CU5A 3HZMA 4PJHB 5HTSA 5BVPL 5AAWA 1EHXA 5D5MA 2GITB 3QDMA 1R5IB 4ZMTA 2I07A 1OAYL 5TE4H 2OW7A 4M1GL 5AG8A 3W11D 2LE9A 2WWMD 4HJ0D 3A6CL 1NFDB 4UOQA 3SGJC 3ZE2B 4MWFA 1KLGA 3UZQB 3D0LA 1BD2B 4ZAKA 3NJGA 4M5ZL 3QULB 1UWXH 3QJSB 5E99H 1MI5D 3FHAA 1SLWA 4UTAH 1CTMA 5D7LD 2A73B 4X99B 4U7MA 4BQBA 4OLWL 2YPVL 5T1JA 1D2PA 1XHHA 2DLTA 4IKLA 2A77H 2YN3A 3EO1A 4CN1A 1CJYA 3JXAA 5CP3H 1M7XA 5KS9E 3ARDB 1I75A 3D18A 3GWJA 1DL7H 1MFVA 2WNGA 4TMPA 1M9SA 2DTMH 2DM2A 4RFNB 4Z9KB 2VLKE 2CALA 4LHUG 4AYFA 3RG1C 4WU5A 5F0LB 1QWHA 1ZIAA 3QR2A 1DDTA 5D96B 2R9HD 2BLFA 2QQLL 3HHRB 1BA9A 2YBRA 4LCWE 1NAMB 1KPVB 1X5JA 3DMMB 3LX9A 3MDJA 4ONFL 3VB9A 4I48A 2B2XH 3QDJD 1BFVH 3ERXA 1RMFL 2A9NH 3ULUF 4S1DD 1ZANH 2ZUQB 4JN1H 5EZOL 5KYUA 4F8OA 1VFUA 1JPGA 4LEEA 3W0WA 3U1SL 1GC1H 5C6TL 1T7VA 4XX1E 1FFPB 3VXUB 3AY4A 1S5IL 1XDTT 2EACA 2XVBA 3FU8A 3CDGA 5LNEA 4HK0A 4AGPA 3DSFL 2YQ3A 3DSNB 2R2BB 1JDCA 1YC7A 3GHBL 1I8AA 4DZBB 5HYSB 1EHLL 3KGUA 2ZG2A 3HC0A 3DJRA 2CPCA 2FNWA 2AI0H 2YXMA 2DMBA 2NY5C 3GSNH 4TVPL 4NZTH 4HVBA 2O26U 3B7YA 2XPYA 4FQXA 4XN5A 3TO4B 1QW8A 3QWQB 2H0FA 1I8LA 1FUNA 3DX1A 3GK8H 3A3YB 1EIBA 2Z8VC 1ORSA 3QEGH 1AGBA 5KYXB 1WITA 2A0LC 1QLFA 1U8KA 3I6GA 4F2MA 4ETYA 5DC9B 2ZCLL 4LL1A 3O4OB 5L4MA 2GYSA 4DUWA 1J48A 2ZX7A 3T71A 3LQAH 3GBMH 2WK2A 4BQCA 2ZAHA 4PJGF 1X5AA 1BQSA 3PRZA 4O2FA 3V0WH 4LLAA 4WIQA 4LSSL 1TEYA 3C75A 3NAAH 2BC4B 1BX2A 5AB9A 1OE2A 1NGYA 1C7TA 3G6AA 4JRFA 3NPZB 2W5PA 4U2YA 5DMGC 3BKCL 2J5WA 1SVZA 1J18A 2A2QT 1YEDA 4ZD3H 3QWRD 2EXSA 5DVKA 1T03H 2AJ3B 2R0LH 2HVBA 3STZA 1FBIH 3H6AA 1CLCA 4BWTA 2F53A 3LN5A 3T2LA 1B2WL 3FTUA 3RNQA 1Z5LB 4MCYA 4IRJD 1JGVH 1K3ZA 4OZGB 1G7IB 2UWEE 4XWOD 4OF8A 3MAWA 1CFQA 1L6PA 2IJ0C 2R2BA 3DX7A 3HAEB 2F7QA 1DBML 2BS9A 3AQZA 3BP7B 2E59A 4GP4B 4KOBA 3DBXA 5E8NA 3DTUB 4WGKA 2E86A 1NGQH 4JG0H 3N5AA 2Z4QA 3K2KA 4NSKA 1ZLSH 1BGXL 1GOFA 5KVEL 2DICA 2Z4QB 4NSKB 4XX1G 5ADPL 1TETH 1FGNL 1HJCA 2CK2A 4YDIH 1FNHA 2N7BA 2VO5A 1KV3A 4FP8L 4GXUM 4M5SA 1F3JA 4YXHL 4P07A 5LCVH 2AC0A 2V7NB 1F3RB 3BLKA 1AE6H 5JYLA 3QXAA 1BFSA 1CFSA 1JERA 5AQ0A 2R1WA 1CL7I 4OF6A 4Q58C 4LSTH 5I6OA 1IGCH 5JZ7C 3T77A 4QO1B 2XRAH 1OP9A 2XN9E 5FA3A 1DR9A 1JMXA 5IMKB 1E4JA 4WFEE 3VWKC 3M7OA 2K1MA 4F33B 1I8MA 4FOMA 3ZIMA 2D7OA 2E47A 2AVGA 2NTFA 2F1AA 2VJ8A 3QPQC 3NIGF 4NQCA 4Z3FA 2PMZA 5FF6B 5IW6A 3NQKA 1NOLA 4WHCA 3UTSA 4ZNEE 4ZMNA 4BZ1H 1HHGB 3FUEA 4MVBC 3CQFA 3QS2A 4EZJA 1V27A 4P49A 3QDJE 3AQDA 4BCXA 4Z95H 1FHNA 1U3JA 2WANA 4B7IA 3VXTA 4HDIA 3HRZA 2CJSA 3X3FH 1F13A 1RZ7L 4UT6A 1RZ7H 3O9WA 5IF0B 3FO2A 4ODSL 5AZEH 2W9DL 4QEGA 4ZD3L 3HG1B 3QORB 3MJ8B 5ACLA 2YO3A 3DX7B 2KERA 4GO8A 1OW0C 2ZYRA 3P3SA 4LOUC 1CGXA 5C09B 4ZW7A 4C54A 1SJHB 4OFDA 4MZ2A 3S3SA 3WXVL 1QVOB 3ZO0A 2PR4H 3BEWB 3L3IA 1FO0A 3GI8L 2I9LA 4XR8C 2NUTB 4G59C 3MLXH 3LB6C 4P9HL 4Y5XB 4WFFD 4KQ0A 5HJGA 2NY6C 5ALBH 5DEZA 3RWCB 4EN3A 2J1XA 3QRLA 5DS8B 5AOIA 4APQD 3LPFA 1FE8H 5BCAA 4D9RD 1DSYA 1WRFA 1NUNB 4GQQA 1D6EA 2JJTA 1BVNT 3QHFL 1MCSA 2WZAA 4I18B 5I6XC 5T33L 3ZDXF 4IRZH 1MWAL 4R7NB 3JWOL 4FP8H 4J3OC 1TVBA 3L3JA 3X3GH 3AACA 4DPRA 3X3GL 4R7NA 3L9RA 5D1XD 3QISA 4L5FE 4N0UB 3OKKA 3TYGL 1L0YA 4G6AC 5L6YL 3ZT6A 1BV8A 3PWNA 5E8DL 2YRPA 1LP9E 5CLZA 2KLRA 5F7FA 5F9JA 3PY9A 3V6OC 1WFUA 1ZE3C 2NY0C 3KR3H 1HK6A 1S8DA 2DH2A 4PWJA 4F8QA 2E9JA 5EA0H 1HH6B 3V5DA 3EXJA 4I48B 4TSAH 2RH0A 4RNRB 2HKHH 2VR6A 1CT8B 5I5RA 3PGFH 4OZGE 1OSZA 2HVKA 3U4BL 3DROB 4RNRA 5IG7B 5F6HI 4PJ8B 4AGLA 5I1DB 1UASA 3CFCL 4JKKA 3IFLL 3RVWD 5FYKU 1HAUA 2HT4D 2VXQA 2X6BA 4BFKA 2ZPKH 4D0DA 1LNUB 1NC4B 5DVLA 5JA8B 7PCYA 2YAEA 5IK3B 4Z3IA 3ULVC 3ZKXB 5DK3A 2YSSA 3TYFB 5KSBA 2OPCA 3N44B 1LE5A 4LCVA 3OX8B 1LDPH 3FU7A 2NY4C 4H25A 1IU1A 5AAMA 3D12B 2IAMB 3D18B 2CSPA 4DZBA 4MQSB 1MFUA 3MOAL 3FH5A 3L4WA 5IEHA 3PDGA 5LDSA 4F3FA 3VFGH 4PP1C 2X4PB 3KHQA 4XVOA 3NZ8B 5I26A 1RY7B 5BZDB 5F7UA 4L4TD 4XMPH 3KBEA 4EBQL 5H35B 1I85C 2IFGA 4RLDA 4KKAC 4OGAD 4X83A 3TASA 3VNYA 3FB6B 2ATKB 3PREA 4KFMA 4P3DA 3V6ZB 5DDHB 4QRPB 1MHHA 5CLXA 3ARTA 4YDKH 2VLLA 3HZ3A 1B4JL 3DMMD 5B22A 4JLRA 4PGBA 4PRPE 3TU6A 1MAJA 3IGUA 1JDAA 2QPFA 1TQVA 2BS8A 1A0QH 4O2CA 4H5SA 1KTRL 5ITFB 2E6JA 4BEIA 4JHBA 1BAFL 3FW6A 5EC2B 3US1A 1BD2E 3TNMB 4KAQL 4NRYA 5F3HA 2IBZY 5GZOD 1SRDA 3MUGA 1I1AB 2F5BH 1HWWA 1OO2A 5I6MA 2MOVA 2D7NA 2VO8A 5IEKB 32C2A 2IGFH 2JCCF 3APCA 1Z5HA 3B9KB 4XO5A 5HHXH 4Y8AA 5C09E 3G6JE 4L1DA 3DI3B 1MEXL 4LRIC 1IC7L 1A9BB 1CGSL 3EH4B 3RNQB 4FQXB 3WNKA 2E27L 2Z64C 3GFUA 3U6XS 1ULVA 1E9PB 3CFMA 3P73A 3QH3B 2BSCA 2N0KA 5CP7A 3F5WB 4POUB 2AV7A 2R4RL 3NOIA 4HEMA 4MD4B 2GEQA 1URZA 3B5GA 3MBEC 4HPYL 3N1QC 4Z8FL 2NX5D 4KI5D 5DMJB 4JO2L 5HJ3A 4WUUA 4ETQA 4YXLL 1PSKL 1X4YA 3IJEB 2YQGA 3MRGB 5BRPA 4CVXA 3HAEH 4G5AA 1CD1B 4FFZA 3BAEL 5LBSH 2VR3A 5GRUH 1J0YA 3Q5OA 3K7UA 3A67L 1WH0A 3SE3C 1QBBA 4NWTL 3AXLB 2EE9A 3ZX1A 5K9KA 5I6PA 4NC2B 3OWRA 3BVVA 1RP8A 4DVRH 3NGBB 5DZLA 3FQNB 3UJJL 2FX7H 1NIEA 5DHDA 1RZQA 1RIHH 1OLLA 1TTGA 3HB3D 1KWGA 3A6CH 1I8MB 5AW1B 4OGYH 3CH1B 3TO4C 2NTFB 4NQCB 5E9DE 1BLIA 3TIEB 1W0VA 2JI2A 2F7IA 3D39A 3OZLA 4XBGB 4GUCA 2YAOA 3W5NA 2VXTL 4XBGA 1PZ2A 4JRLA 1YCSA 3HC0B 4X5XA 1TQBC 1RHFA 4Q9RL 2H1XA 3TL5A 3ABZA 5CP3A 4YAQA 1DQJB 2YD8A 3FCBA 3MNVB 4LASH 4A6YA 4DT2A 3LS5H 1MRFL 2QQQA 4GW5A 3T2PA 1UZGA 3OLIA 1WGVA 3D34A 3OR6B 4PW9A 1DLFL 1U8QB 1LK2B 3FQXB 1SF5A 2WXNA 3ASNB 5GGVY 5C09A 3VTMA 1H5BC 2VDOH 3H2WA 1KY6A 4KK9C 3IJEA 1RZGA 1AQ8A 5LQBL 5F1OB 4ORZC 2A9NL 4K7PX 3T4AB 3WEMA 4P46D 4ATWA 2AEPH 3N41B 1NBZB 3T4AA 2DQDH 3KW8A 4MJ6B 1Z7JA 1MJUH 3NESA 4JAMB 4HIQA 3MREB 5IKCB 3WFCH 2X4RB 1JNHB 1UQSA 5F0MB 4L8CB 2BDNL 3ZHFA 4XNBA 1NPUA 3H4FA 3WNJA 1A6VH 1BPVA 1EZUA 3HIZA 4WF7A 3NTCL 3HTLX 4OVVA 4WEBH 5EU3B 3L9RB 2PYEE 1C12B 4C57C 2GUOA 2PXYA 3LRSB 5E1AA 4QLWA 4CL7A 4PJFF 3BRDA 1CFMA 5J5EA 1WAPA 4L29B 1Q0XL 4JREB 1OM9A 4LLYB 4NZTL 5JDSB 4AK2A 5DUBA 4OLXL 1SDDA 1M2VA 3DX6B 1OCCB 3S4SB 3WKNA 5JW4N 4X4MA 1ID5I 1MPAL 5EU7C 3ARDD 4ORGA 1NLBL 1S9VA 2J5LC 5FGSA 3SGEH 1EDQA 1BJ1H 3QPXL 2L7UA 4JPKL 1QI5A 1IARB 4KO5A 3KPOB 3ARFC 3KMDA 5LJYH 4PS8A 4ZMOA 3OC5A 3T1FA 2O5ZH 2O5ZL 3ARGB 3L54A 5JW4R 3IGFA 4ZMYA 3GUTB 2CJ3A 1T2XA 4M7LT 2YGQA 4NUQA 5AB0A 1SXNA 4LLUB 5I0WA 5JMOC 3DHPA 4LLMA 3VXSB 3SDXB 3LZQA 3SDDC 3QP3A 1K2DA 2NX5B 1HH9A 2R0WL 1KIRA 2DLFH 2P5PA 5FHBL 3TFKC 1DO6A 4L8CA 1SLVA 1HKLL 1QBLL 2ATKA 4P3DB 4PB9L 2XWBA 3D0VB 1D7BA 1UA6L 3HUJA 1SNRA 1JPGB 2CRZA 2HRPL 1WBXB 4XHQA 2ZOTA 5HJDA 5I1IH 1S7XA 4PRIE 3LHPL 4R97C 2YPVA 2XZCL 3CFKB 4YO0B 1FJ1B 2AXFB 2ITDB 3VWKA 1NC4A 3E1ZA 1U30A 3LNIA 4MQXD 4G83A 3JWNE 4MZRA 3O11A 4G6FD 4OZFB 2YKKA 4LSUH 4YSQA 2Q8BH 4XPBH 4NOBA 3FQWB 1A7NL 5E8PA 5F93C 4OI7A 1ZTMA 4GKNA 2OCJA 5DZ9A 1MCPH 1GA2A 1MCPL 2C4FT 1J88A 2DN7A 5I2IB 4WK2B 5IQMA 4BSWB 1ZCRA 4PJFE 2ESVB 3CVCA 4GBXB 5A2KH 4AZ8B 1RL1A 1OAKH 2NNAA 1DUZB 2RIKA 1CL7L 4D9RE 2HYMA 2VDQH 1B4RA 4PJ7F 5GJTH 1NMAH 4NO5A 1QG3A 3QEGL 1JZ7A 3E80A 3LQZA 3NJNA 4K7PY 1KFAL 3KPRD 1BF8A 2AHIA 5C0JB 4X2UA 1KC5L 3GTVA 3AAZB 5F7YC 3PFQA 2LTQC 3EOBA 3U1SH 1KT2A 4EEEA 4DP1X 5C0JA 1K2DB 1FDLL 4MXVF 1R3HB 4N5EC 4HKZA 4OVUA 2AQ1A 4MNGA 2B1HH 3T4YA 5FGBA 3D69A 5D2NC 1DVZA 2VQ1B 4ZO8A 4A7TA 3PJSB 1KB3A 1VZHA 4O2FB 4A7GF 3EOAA 3VFWA 1E4XH 1P69B 1T1XA 5A7BA 3KM1A 3QE5A 3IMUA 4X4XB 4N8VA 5T5FA 2FYYA 4HX1A 2WBJD 4JDEA 2PCPA 3OR7B 2FNBA 2H9GA 2LVEA 1U92B 4UINH 4TVPH 3T9WA 2H6UA 2FLRT 3JV4A 1Q94B 2CBQA 3C08L 4UB0H 4D2NA 5HDQH 4V1DA 3KBPA 3OQ3B 3TTYA 2VYRE 1XGQB 4ELMF 2NSMA 5D1QB 3WFBH 1QPXA 1OAXL 1ZIBA 1UWFA 4KKPA 4GQZA 1XGQA 3EBHA 3FHEA 5DWPA 2FQDA 3TCXA 2NY7L 4CGTA 4YGAB 1XTLA 3G5YB 3DRQB 1FZJA 1A7OL 5IHZA 2V37A 4PLKC 4NQXA 2FSEB 3V4VA 2WV3A 4DGYL 3F7YB 2FSEA 1KG0A 2PPAA 5KUMA 2YUWA 1FGNH 1NGZB 3FU6A 4JVWA 3TCTA 4UQ3A 1ETJA 2X1XR 3U2IA 1M7IB 2CH8A 1U95B 3CQQA 1JF1B 5A2CA 1MHEB 4B9IA 1J9SA 1N64H 5GPRA 3BQVA 4M7ZB 4PJEB 1D6VL 3QUZC 1EUTA 3HG1E 3K71B 2JB6A 2F8OA 1AKJD 2GK2A 3RDTB 4HHGA 3ABMB 1PQZB 1X7TA 3P0GB 1E43A 4PJHE 1MCJA 5BNXD 1HDMB 3U36B 3N43B 5TJWK 4ELME 1RZGB 1UB6A 2YEVB 3AITA 3TF7C 3WS3B 4YNYB 3MJ9H 1AG0A 2EUXA 4Z7VF 2F7PA 2ZCKL 4NYLB 3VI4A 3IDIA 3K2UH 4Y2LA 3FF8A 1AZZC 2C8NA 2PW1B 2WKOF 1MCEA 3DX9A 3ZE2E 3OG6B 3IS0X 5ELIA 3HN8A 1H0DB 2DQJL 1MLBA 1NC4D 2N4IA 3MV11 3HN5A 5TDNA 5I30H 5J11C 1ZXQA 4XN8A 2DWSA 2F19H 1P5UA 3DARA 3IMRA 3PWVA 3RWDA 3MV8A 5DZJA 5IF0A 5E7BA 5DI8B 4MNHB 4JDVB 4N25A 2PABA 3GB7B 1MZYA 3NABL 3CIQA 5F6IC 3DXAA 3I3DA 4IRSA 1SJEB 6CGTA 3IT8D 4MDRA 4ZI8A 2DYSB 4UDUB 4ZTEA 4TNVF 1K8DB 3LD8B 3ULVE 1P4IH 4CKQA 3GHEH 2NZ9C 3C8HA 1TTUA 1IKOP 3ESMA 4HIPA 3KH4A 1I31A 3O9WC 4OQ1A 2LV4A 2ZTBA 4ZQKB 1NCJA 3FTVA 1JYNA 1KIQA 1EQWA 4QUOA 3TV3L 3DOHA 4U3SA 3ZL4L 2WZ0A 3MLZL 1MWAB 4LNRB 1BLNB 3GXIA 2XCMC 2FJUB 4BE6A 1J1OL 1NIBA 3FN0H 3QXAB 3KWUA 1KGIA 4HV8B 4JRWA 5AENA 2FL5A 1UYWL 2CO6B 2ZP8A 1AXSB 4YH6A 5GS1C 3SJVE 5CLWA 4N0UA 5I0ZA 5MEPA 1KDJA 3C5JA 3OKNB 2E5EA 2VCOA 2DPKA 2YSTA 3V0JA 1OB1A 2GUOB 5D1ZD 2Z31D 3DGGA 3MUZ1 3BRFA 1A3QA 5K1JA 4PRID 2Y23A 3LEYL 2HRHA 5GS2H 2R7EA 1FFNB 1WBZA 4Y2OA 4Z7VB 5JW3H 4ALAL 3PGFL 3IPEA 1R75A 3EBAA 1KXTA 1KJ3H 3MCLL 1OW0A 3QQ3B 5C2BL 2G60H 3HG5A 1KJMB 2QPEB 3P4OA 3QQ3A 3WEOA 4HG4J 2R56L 1N7ML 3NGBC 4MFHA 1E6JH 4S2SB 4F8LA 2DM7A 3WHXB 1Z9SA 5DR5H 3PWLA 1IO4C 4AH2B 3CIAA 4FQHB 2GBVA 3GM8A 3KPOA 4ZUTB 4Z7OB 4K7FA 1BREA 4X7CC 3IAQA 3IGKA 5E4OA 3L08A 1SJVA 4TPRH 1V3JA 3TTSA 4IU2A 2I07B 1LO5A 3ECWA 3ARDC 4RISL 4LK4A 5I71B 4NN7C 2HKAA 2WAHA 3TV8A 5DEFA 3VB8A 3D39E 5EZPA 5KSUA 3BO8A 3E2HC 3F01A 4IBQA 4L8DA 4XVJH 2AF2A 2N3JA 3VA2C 1VFBA 4G8AC 4ZBJA 5AVSB 2JH2A 4YL9A 5D96C 3TZVB 3MLSH 4QHMA 4YC2B 2LU5A 1G7QA 3CZSA 3U9PH 2CO1A 4KGJA 5FYKE 1HNYA 1QATA 1XSKA 1ZLVK 2AK4A 1P84J 3EYSL 1XEUA 3FB6A 4JM2F 4GXFA 4JZJB 4HMEA 3RTQC 5F7HA 5I8KH 3SE8L 3NEOA 1QWNA 1K3IA 3KYMA 1HZHL 3P0YL 3N42F 3D7PA 3V9CA 1ZHLA 3BUIA 1TVBB 2BWQA 1IGYA 2YD0A 3MCKB 3P9MB 5DRZA 2EDJA 4N4YB 2ZPKL 1N5AB 1JRHL 1WZ1L 1VLXA 3MI6A 4AW7A 4WGVB 5JXAH 5AW8B 2F6AA 3B83A 2HN7A 1WS8A 1DVTA 1KEMH 5D1ZB 5C0NC 1BXVA 1KGUA 1XB3A 2GSIA 5AVWB 5F89A 5GZNA 2ZXCA 2XZAL 5E51A 5DSCB 3LKRB 1HSBB 4DETA 4L0PB 4G82A 4TVPE 3SPJA 1NIDA 3CJJA 4AKPA 5FM5O 2GABA 3QJUB 4MXWL 4ZJ9A 2RACA 3SDAD 4R26H 4EDWL 3T09A 4N20A 5D1QC 1TU2A 2X2IA 1Q94A 2WIMA 5F96H 4D7PA 4FJZA 3NJIA 4BSVB 3I9AA 3U9WA 2GTZB 3LIZL 3ASOB 3H9HB 2X40A 2JCCA 1T1WB 1DSWA 1XGTA 2PYEB 2VDOB 2YAFA 1OCWH 5FYKL 3RY4A 3BVUA 3ZZSA 1XL6A 1RH8A 4M5TA 4AYEC 4KNUA 5E2VH 2FB4H 3HJ0A 1ES0B 2JI1A 3VSVA 4G6FB 2WLYA 5LG6A 2N7AA 4GLRI 4X4ME 1YN6B 2HJFA 3RQ3A 5IFJB 4YHYC 5IFAH 2QKIA 3PGCA 4LO9A 4OF7A 1QEWB 2BP8A 4Q4IA 4DPAX 3Q6GH 1GZPB 3NSFA 5DJCB 1JF1A 2K9FB 3RZCD 4JG0L 5IJVB 4GOSA 1IT9H 1FE8L 5G5DA 5GGUA 1R5VB 1GZPA 3HVNA 4PRPA 4M3KB 1TTBA 2Y5TA 1UACH 1HINL 3P11H 2FD6H 1OL0A 2G5BA 2QLYA 3JWOH 4JO8A 1ZHLB 5I66B 4QKTA 4FJYA 3S96A 3QNXA 4FFYA 5TQ0H 3Q1SH 1JFHA 1M05A 4UQ2B 3HZMB 4R8WL 2OSWA 4MLSA 2UVFA 1WFJA 1CDGA 3Q2NA 4J3XA 1UB6B 3PFUA 4PV8B 5L0QB 4QTHA 2X41A 2O5XL 1WWWX 4R5VA 3C6LC 4QTIL 1HZKA 3RX7A 3IBEA 5KN5B 3ESPA 1MY7A 2BY2A 3FO9A 3QG7L 2BC4A 5A2JH 4CKVX 5KN5A 3G5YA 4I0PD 3ZY7A 4EUPG 4NHCL 4PUBH 4X6DB 4F1SA 2E7LC 4RQQA 4HUVB 2MOGA 3EZ8A 1U0QA 2QHRL 4PJHF 3QUKA 3PV6A 4U7SA 4ZSOA 1R3LB 4H26B 1R4XA 1CQYA 3JT0A 2FEEL 4V1DD 1DFBH 3TO4A 3GMLB 4QRSA 4OZGA 3X3FL 3ARBD 4YHZL 2ZIDA 3BMVA 4UM8B 2NTSP 4WJG3 1PEWA 1ZVSB 3FU9A 1F18A 3RZCC 1AFVL 2YPLB 4P5KB 1MVUA 1AFVH 5EN2A 3K71A 1EZVX 3S8WA 1E65A 1OWRM 3DIFA 2HTKC 1RJCA 3E2HB 3H7BB 3PHOB 4X7DC 2XXGA 1WK0A 3JYBA 4GFTB 4IGBA 2HG5A 2UY6B 1SEQL 3FK3A 4C55A 5B8CA 4JNXA 3ZUNC 3WN5C 2PR4L 1QFUH 4D9QE 4LSQL 1WWBX 1T2QH 3K74B 1PG7X 4QXUL 5I0DA 4ZMVA 4N85A 4YR6A 4LNRA 4M61B 4X5PA 3P9LB 1SHXA 4P04A 1UENA 5EORH 3QNYB 5AZUA 4Z7WF 1GYVA 3QVAA 4OTXH 5JHLL 2Q3ZA 2FVNA 1MSPA 2EH8L 1GAFL 2VR8A 1KF9B 3MV7E 5L0QC 4OT1H 4ZUUB 3GMQA 5CEZL 5KVDH 3BVNA 3IF1B 2MFNA 3FONA 3KWVA 3C5JB 3NPSC 2V2XB 3OKNA 4JRXD 2WOYA 4LLWA 3WIAA 4ECNA 4FAAB 2LU7A 4RSYA 1ZK9A 2WLKA 4G9FE 5CSBA 3SKUD 3CBRA 2IH1B 1F2XK 4RDQF 5HI3C 5JDSA 3L4VA 5BV7C 4UT6L 4DESA 1A1NA 1LXMA 1MQKH 4WO4D 4KHTH 2JCWA 5FFLA 3QJHA 1LO0L 2IQAB 4FQPA 4QHLA 5KTEH 4J8RB 1W72B 1MJ7L 2JE8A 4M03A 2K3TA 2V3FA 1MJJB 2FECL 1IC1A 4R4BA 5FS5A 1I3GL 2X1PA 3AVEA 3WD5H 2YK1H 3L7FA 5KVFH 5EBMA 4AVJA 5LGJB 3MRFA 4S1QL 1G43A 3D4CA 3WENA 3I6SA 4LPVA 1BBJB 3QUMH 1E8XA 2H8PA 4GAGH 4Y5VC 2VIRB 2KBGA 4BJLA 2BSSA 3LVTA 4CVZA 1CN4A 4F7EA 5AWNL 4MZIA 1MFBL 1X6LA 2VQ4A 3TBYA 1HH9B 3C6SA 4JFFA 1XGRA 1BM3H 4ZTPL 4LDLB 5JPNA 3D5OF 3K2IA 4ZPVA 1C16B 4WW2A 4UB0L 5IMLB 4PGDB 1H0DA 3T2NH 5FO9B 3AU1B 3B7RL 1T21A 4FG2A 4PGJA 3MTRA 2TSBA 2BIQA 1HHGA 4ONOA 3P02A 1E7UA 4FFTA 4AM0Q 1BZ8A 2JTDA 1MUJA 1TFHA 3BUTA 3LRSA 4JY4A 4PVBA 5LBSA 2B0SH 2VR4A 4MA3B 3WMQA 5EU3A 4S2SA 5DC2A 3RAJL 3VD2A 1WFTA 2D03L 5CS7A 2EYTB 5I17A 2FSDA 3S5LG 2IH1A 5LG1A 2EYTA 3HVDA 5EZIL 3KPLB 4G7QB 1AD9A 1UM6H 1X5MA 1KCVL 2ARWA 5DRNB 3VFOB 3A21A 3VXSD 5C0FB 1H6FA 5EZLB 3VGHA 2MCMA 5H2BA 1XCQA 3F7VA 1G6RL 2LT9A 4JM0A 4JO1H 5GSVA 1WBYB 5T5NF 5MERA 4TUKL 3ULVD 3D0LB 4ZAKB 2IOMA 3NSJA 3O45B 4LASL 3I74A 3P4MA 5F1IB 3VD1A 5EU4A 3HOGA 2X2HA 1YYML 2ZUYA 3FUIA 2DWTA 4MJ5B 3G6JA 5C0BB 3RWCA 3V52H 2GJ6E 5DMYA 4ALAC 2P8MB 1JGIA 2X2JA 4P4KD 5EUKA 3D08A 5JNYB 1N4XH 1QLEB 3T77B 3NCJH 1F42A 4K3HA 1I8IA 3EJYD 4WTXA 5M95B 3T0ED 5IUCA 3QCVL 3LZFL 4IBWA 4LF3B 4WU5B 1KTJA 1TCMA 1OGPA 3Q3GB 4HKZB 3MUJA 4RBPH 3MV9A 4PEEA 4W4OA 3ATEA 1VGEH 5FW6A 3ZE0B 2JXMB 2HTLD 4QRAA 3ZHNA 3QHZH 5EIVA 1QEWA 2BY1A 2Q8AL 4HC1L 3D69B 4LBAA 4RAHA 4G9DA 3U4EB 4P59H 2CGYA 4M7KL 3RGVA 1V7MH 4NIKB 1YEIL 3FCGA 4G9FB 4WAFA 2GEEA 2VN3A 4NQUA 5MHSD 3VGFA 3CK0H 3BN3B 3CU7A 4YHOH 3VM5A 3BDXA 3MRQB 3PQYE 1KBGL 2OZNA 2PO6A 3BSZH 5CD5C 3VX1A 2JWYA 4AW4A 1U4FA 2A7BA 5BQ7B 4MJID 1P0SE 3BP6B 2DWDB 4BSVA 4LQFL 5TE4L 4FFZH 1R3IH 2Y7SA 5D1ZC 5TH2A 3D05A 3H9SD 3VGBA 5IHWA 3GIVA 2LTQB 2Z0UA 3FSOA 3I2CL 3NSXA 5E8PB 1ES0A 4P2QE 4RGNB 3EF7A 3WEAA 2XBDA 3OLGA 3P4MB 5TQ2H 3AS1A 4JFPA 2ZUVA 1NEUA 4JANB 5EUOF 4WKZA 2WXKA 3FMGH 3HC3H 3BYYA 3JYCA 1BWWA 3GSUA 3P3TA 1OHZA 1ZA6B 4FN0A 4R83A 1I1RA 3CWGA 1H9VA 5TFSH 1P6WA 3VXPA 3K3QA 3WS6A 3WFZA 1R3HA 5C6PB 3EO0A 1KT2B 1K9TA 1PCSA 4ALAH 2XI9A 3NMEA 3LPPA 2JXMA 1AOHA 1YNTB 2O6PA 3DVNB 1A3RL 1V3KA 2G2NA 2NYZA 1E4KC 3PU7A 4HU2A 3RGVB 1ONQB 4CBZA 1UVQA 2DBLL 5KANG 3B2PA 2NY7H 4XCFH 1RMFH 1QSFD 4LGRB 4P48A 3VMNA 4TRPH 1WFIA 5HHME 2NY3D 4R4FL 3PAZA 4ZOCA 3WBDA 2VITA 4N0FB 4S0TD 5IEKA 4QRPD 3L48A 2A6IB 2CO2A 3M17A 2ICEA 4DZ8B 3FUDA 2UXTA 2FGZA 3JV4B 4DEWA 1TLKA 3UTOA 1MCIA 3BKMH 3SD5A 2Z3FA 2H2PC 5FPIA 4XVTL 1HQRB 1LP9A 2WYIA 3ULSA 1KWKA 2EDLA 2PETA 4U1MA 2YRBA 3IFPA 4KY2A 3F5WA 4PG2A 2PW2A 4B3VA 5BJTA 2W65B 1RJZB 3UEZA 3PDDA 2XLLA 2X4PA 5EIIB 3NT0A 3BXNB 1WA2X 1VGKA 4U0RC 4K3EH 2WINB 3QJHB 2R29H 4UM9A 5DLMH 4U6YB 3WL9A 1UADC 5F7WC 1WFOA 2AEWA 4HW6A 1R5VA 1ZSHA 3BQUC 1FCGA 3F62A 3FQUB 1MHEA 4JRYE 3GLDA 3KGSA 4Y9FA 2A6JB 5E99L 3ZR5A 1DBJH 4PJ5D 3VXPB 1THAA 3GTTA 1OARH 1J1XH 3SDCD 4JM2A 2UX6A 2ADGA 1HXKA 2MHAA 4WSJA 4EI5B 5HHNB 1FDLH 2F54A 2EO9A 4FEMA 1ZT1B 1EHNA 4TNGA 3WE6A 3TCLB 4GRLA 3C9NA 2EUZA 4NRYB 5TDOA 1U8OB 4Y16C 5D7IB 3CFEA 1NLDH 5JMRA 4N3UA 4DK5A 2KLTA 3ARSA 3UERA 3NFPB 1I7UB 2DQHH 5FW7A 3BKJH 3IK2A 2JVUA 4Z7OF 1AGDB 1RPQA 2IPUG 2W81C 3BUPA 4CU6A 5IT2H 1TEFA 4YHMH 5KOMC 1PKOA 1FORL 4NQEB 2F74B 3BAYA 1WTLA 3G5VB 1DJYA 1HZHH 3CN4A 1Z3GH 3P0YH 4UQBA 5IB3B 4ZUTA 3KPMA 4L3AA 1RERA 5TK4A 2XXFA 4R4BB 1UWXK 2YPLA 4UV4H 4APXB 2VZOA 1ZWIA 2XN0A 3MNWA 2E9IA 3FO1B 4BSJA 1BBDH 4OD2A 2IQ9L 1F6AA 2PPFA 4YPGA 5CZRA 4PRAA 3RX5A 5KG9A 3VFRA 4JG1H 4UM9B 1XIWC 1UEYA 3GSOB 4LVNB 1OXYA 35C8L 1VPOH 1HTYA 3JBG7 3LKOA 4FFYH 3Q2VA 5DD0L 1TTAA 5DA4A 3UL4A 2HH0L 4UYQA 2RGSA 3H54A 4ESKA 3CHSA 5L88H 4C4KO 2OJZH 2E9BA 3U48A 4YLCA 2XETA 3ELAT 1QTPA 1T1ZB 3WTUA 4ONFH 2Q7NA 1ZGLP 1L0QA 1QSFA 1BF2A 3FTWA 4C56A 4FXGB 1EAOA 3R18A 3TZVD 1G94A 3L8QA 2OYPA 3U7AA 1ZSDB 1F58H 4HUKB 3RVVD 1ADQA 3MV9B 1U8OA 4MA8H 4WW2F 1TENA 4Z76A 5C71A 3V0GA 1DLHB 3SYPA 3CFEB 4G11A 4HGWA 4JN2B 2DLGA 2BVPB 4U3XA 3GIZL 5HGHA 3HLAB 3GIZH 4WU7A 4X5QA 4XOEA 3IAGC 1HSBA 1WWAX 3KL3A 4LCWA 4NOFA 12E8L 4LRNL 1SDDB 3TN0B 4FFVD 2GIYA 1HXMA 2NCMA 2HAZA 2JI3A 4NS0A 3TJEL 2BNRE 1CG9A 3GBLA 2Y1AA 1MFAH 2IPTH 4Z23A 1T7WA 1CG9B 4XB7A 1JWSA 4DKTA 2O72A 1WG3A 4J4PA 4P5TC 5AYQA 3MYZA 1FH5H 2APSA 1UXLA 4GJTB 4JPVL 4AIOA 1SEQH 4NCC1 4ZMXA 5D93C 2CIKB 4ZODA 2E0PA 5JNYA 4A2GA 4OD2B 5E5RB 4NJ9L 1KENL 4NJ9H 4KFZC 4L9LA 3KPTA 5IQNA 3ZTNH 3C6SB 4JFFB 4X6CA 4MJ6A 2YAPA 4E42A 1LHZA 4JANA 2Q86A 3TZVA 4AZ8A 2PTUA 2OMXB 1F11A 1CTOA 2OTUA 4FZ8L 5KVDL 4R96B 1FNEA 5D7KD 1AQMA 1RZJC 1VESA 1IQWL 1SN5A 3HFFA 4FABL 5I6LA 2Q6WA 4O02H 5CSZB 3AAZA 1WISA 5HYIA 4OCXH 3HUJE 1UYWH 2AEIT 5EC1B 1LYQA 5FM5M 3UAJA 2SEBB 3CPLA 3QARA 4O2CB 5JO5A 1VKXB 3CCHA 3KR3L 2MCPH 4H8WC 1P4BL 3FFCB 5CJOH 1MFNA 2VSCA 5AD0B 4AL8H 3KLHD 5BXFB 4JKNA 2ETWA 2WO4A 1AIZA 2VT0A 2X70A 3CSGA 4YSOA 2J8UE 1ZT4A 4E41E 1SJMA 4XN7A 1CVSC 3PLYA 5DYOA 2NLJA 4WI8A 1NFDA 5FCUL 3ZTJH 1A7RH 4D7BA 1CMOA 3QFJD 3BZFB 3QWRA 3FF7A 4P5TB 3MRMA 3IDYB 1TU2B 5DFTA 3ZKXC 4DJMA 4EN3D 2VERN 2PYEA 2DI9A 2JMRA 3X2QB 5GGTA 4LIQE 1G1OA 3GPEA 4KVPA 1YEEL 3BC9A 2VWEE 1WT5A 5IFHL 3A4FA 4UWQB 4Y9BA 4JCWA 5F3FA 3TBSA 3WEXB 5HXMA 3GSNA 1IE4A 3AZUA 4IMLA 3OGCA 2OP4L 3MRRA 3EAKA 4OCYL 2R1XB 1RZJL 2AQQA 1RZJH 3OKLB 1PZSA 5BOZG 3UDWC 5KBLA 5KSAD 1TQSA 2VLKA 4E68A 3ZYJA 2IH8A 3MRGA 2CIIB 2D8KA 1EERB 3WXVH 3D3VE 4QTIH 1RUML 1SXZA 5BRZB 3REVB 1I1YA 3MBWB 4QXUH 3IRCA 5H35A 4XTRC 2NW3B 4LOVA 1GXEA 1SJXA 4AWJC 4E36A 2EE2A 1RSFA 4PJEA 1GGTA 5E8EB 2ZOLB 4PJIF 2BK8A 2C1PB 3ULVF 1TJIL 1TJIH 5IW1B 1O6TA 3CFBB 3VGDA 1FG2B 1QD0A 4N8VG 2O5YL 4WDIA 4AJ0A 2MRYA 1CO1A 1YUHB 2EE3A 3VRIA 1NCCL 2NY2D 1OE1A 3UJIL 1SOXA 1E5CA 3EYFA 2DM4A 3E6HB 5K9QG 4N5ED 4AK1A 5AYUH 2WVVA 4Z95L 4N6QA 4FXKA 4OJFH 5DQDH 5TE7L 3WN5A 3RE0A 1CYGA 5C08E 3GS7A 5DJ6A 1IM3A 5AWNH 2YD4A 3ZE0F 2D7TL 3P69A 2J72A 2AGJL 3FO9B 1ZPUA 3C2SA 2GTQA 4PCYA 1AGDA 2NPLX 2VUKA 3LKSA 4M9OA 3QUGA 1XWVA 1PLGH 4NM4H 2WVUA 2YA0A 2Q10A 4JJHA 4G2AA 1ZGLM 2KPWA 3AREB 2OL3A 3EYVB 3IDMA 5HDWA 1C8QA 4NRXA 1JVOA 2BNQD 1L3NA 1SDAB 2HA1A 2CM6A 2QTEA 1C5BH 2WLZA 1PDKA 3HA0A 4QHNA 2CCLA 4HPYH 4IMLB 3ZHDA 2K6YA 1MHCB 2CLZB 5BUPA 4N1EA 2DQUL 1ZVSA 1JHLH 2PP8A 1YNLH 2NXYC 3MJGX 4M8RA 2J43A 3O6LH 5JHMA 5GJSL 3HBGA 4IGBB 4YXLH 5T1LB 3K6NA 2OCFD 2Q1EA 2X9XA 3H7BA 4D0BB 3MRNA 4RISH 2OMVA 2K78A 5EEZA 5FCSH 2AQRA 4Y19B 2DDQL 2XQBL 2DDQH 1RZKC 4EOWL 1NM9A 1RUPL 1VEOA 4RGNE 3UG4A 4Y2NA 5IKCA 1OGAD 1MZZA 3FCUB 5IB4B 2Z6FA 2ORBH 5DC4B 4G8EA 5IVXE 3MVSA 2WZPD 4M3HA 1OAUH 1MUJB 3Q2LA 2CRIA 4D9QD 4R0LA 2OI9C 1P9MA 5AOZA 4TN9A 2VDML 4XOCA 1RVFL 2Q9OA 3GMQB 3OC8A 2BFGA 3FONB 3ULSB 2K8MA 1OP3H 2P46B 3W9DB 5JW4M 5F3BB 1CFQB 2FH8A 2WXIA 1FRGH 3TN0D 2HJKA 4DERA 3EGXA 4JO1L 3V9FA 3FUFA 1MKFA 3KPQA 3I6LE 1ZLVH 5T5NG 2KDYA 4HKBB 2Q7YA 4U3HA 4BCZA 4QYOB 1UOWA 2IGFL 5EBMB 5HHXL 4ZTOL 4F15B 5I1JH 1TIUA 3ALXA 5L2KB 3TEUA 4R26L 2UYLA 1TFPA 4OIFA 2NSXA 1EUUA 2ITEA 1XF5B 5E5MB 1I8KA 2CXGA 5IM7B 4KTDH 3QFDA 3ROLA 2K7PA 3TPKA 5A1AA 1N2RA 2FQFA 3LNDA 4GAFB 1YN7A 3CMOL 4QXGH 3SJVA 4KZDH 3FRUA 2D9QB 3ARFB 1INEH 4E42B 3EBGA 4HSQA 3GYRA 4B9PA 4DP0X 1Y7VA 2XV0A 4JAMA 1Y1DA 4K71C 3CZNA 3HE7B 3Q8FA 5DRWA 5BZWB 1SN2A 3NFPA 5C0AD 4NZRH 3OF6D 2DKMA 1PFOA 3LH8A 1HCYA 2NYYD 1G84A 4H8PA 3T3ME 1MW2A 2VUOA 4H88L 5F7DB 3IBOA 3AW5A 1T3FA 3MBEA 2A6DB 2CBPA 1AD0A 1TQCB 5CCGE 2VKXA 1Q1PA 4X98B 3HMWH 3L9EA 3AM8C 4PJHA 1G5GA 2H1LM 3RPKA 3UAJC 3VXRB 4LMQI 5HHPA 1OF2B 3I75B 4HKXB 3KPLA 4PJ5A 5A2LH 5C0AA 4GAJH 3APDA 3BCFA 4KK8D 5F89B 2NY5L 2GBUA 4HIXH 4DFIA 4ZX4A 4QRUA 3ULUC 3H2PA 4P2QD 2IPKA 3VXMA 2EDYA 5EU6E 2JJTC 4NQDA 5IGXH 1BJ1J 2DQCL 3MV7A 1MQKL 1KELL 3HBZA 3K0WA 5H2BB 4HAFA 4BSWA 3M88A 3L3DB 1AZBA 1NEZB 2XWCA 4LP8A 5BW7C 3OKOB 4LKCA 4M5ZH 2ICWJ 3NZUA 4IBSA 2P8MA 1TO4A 3PE9A 4YZWA 1C1EL 3TC9A 5DUPH 5LKNA 4BGDA 2YPVH 2ZXEB 1INDH 1AXSA 4ZFGH 3WTXA 3TIDB 3WI9A 1IVTA 3NTCH 1CLZH 1ZHBB 1M42A 2NZ1A 3FO0L 4ODXA 3JWNG 3WUZA 4DTGH 4JQIA 1AHMA 1YPZB 1HSAA 3KL5A 4N0CD 1ZHBA 4ODXB 2FRGP 5EPMA 3QDMD 1OTUC 5FHAH 2BNUB 2AABH 5AW6B 5E6IC 2FE0A 1MVFA 1PX4A 3UGXA 3KDMA 4UMSA 5DRWB 1GPOH 4XXDB 4BIKA 4C59B 3UMNA 3FTGA 1WPCA 1ANUA 1H8LA 2OQJA 1CB4A 4ZFOB 4U6XB 2X4QB 2PPEA 1UA6H 4TLUA 4NC1C 1Z3GL 2NW2B 4X4XA 5LWYH 3NIDE 5A6IA 1QFWH 1ADQL 3S96B 4BKTC 1TOXA 5DEGB 1GY1A 3BD4A 3QEQB 1ZLWK 4JFZH 3RVTC 4G43A 1HC1A 2PO6B 3ABLB 5CN2A 3HFML 1P1VA 2ALAA 5C07D 1YY8B 4BHUA 4W6YB 5JQ6L 1E4KA 2NXYD 3SPVB 2XN1A 2X6VA 2XNAB 4EVNA 4ZT1A 3T0WA 2E75C 2A4CA 4DKFH 5T3XL 3MX0A 4HIJB 4QAMB 4OLUL 4UMGA 5HGBA 1IFGA 1JZIA 1R3JB 2G3ZA 2BIOA 5KJ7E 2VLKB 4L48A 4GO6B 1R3JA 3GSUB 1FFOB 2G2RB 3QWNA 2VDQL 4K15A 2G9HB 5FUOH 2DLHA 2C4XA 2Y7NA 4R96A 4F7MB 4LLDA 2G9HA 3FTZA 2X88A 2LGNA 1NFAA 2F15A 1AJ7L 2FO4A 4U1SB 2P5WA 2Q6WB 1AGBB 2V17L 3QRBA 2L7QA 1E30A 3NJXA 4R4FH 4EKXA 5CZXD 1CIUA 4Z3JA 2WXHA 2FHFA 4UU9A 4JFEB 3DIFB 1GTNA 2ZXBA 3P0VL 3PHOA 3OZKA 2YBGA 1S78D 2Y24A 4PRIA 1I9IH 4Z7NB 2V0AA 4YNYA 3RJDA 5D1ZA 4RX4D 2PCFA 1Q1JL 3SKOA 3DX4A 3TCLA 1CLYH 2AZAA 4OV6F 4PS7A 1OVZA 1MIMH 4ZFOA 1J0JA 1MW1A 3TT3L 3WJJC 1DDHA 1MNUL 4XMKH 5ESQB 3IRPX 3REWB 3QO1A 2XACC 4YHOL 2O6FA 2R2HA 4X6DA 3C08H 32C2B 4JFOA 3CX2A 2G75A 5EFIB 2QR0B 3MA9H 3WLWD 2OL3H 4LHQB 4MJIB 2VXVH 3HZYB 1MPAH 4L4JA 2J57A 3WDHA 1AKJB 1OAKL 3SKNA 5AUMB 2DH3A 2FJFA 4GS7C 4NKIL 3AREA 3EYVA 5ESAA 1QR1B 2NNXA 4HA1A 5E6IB 1XGPA 3UIYA 1HQRA 1LP9B 4NZ8A 2YMTA 4QRSB 3CZUB 3GSNB 3LKNA 4QWWD 1G7PA 4WK4B 4P23A 1U41A 3CDYA 1FZJB 1GGBL 4G8GE 3L4TA 1G7PB 4U6HB 4FLRA 1CZ8L 2ZCLH 1R24B 5HHOA 1EFXB 2AJVH 4NX0A 1EXGA 2VN6A 1RHHB 2H2SD 2OR9L 1SBSL 3MODH 1YUKB 4XOBA 1E9QA 3MRCB 1VPOL 4FFYL 1WO2A 3ETTA 2ZUSA 4PW3A 5IROD 5DJXA 2ZT9C 4LB8A 4PRPB 3D3VD 2EC9T 1AR1B 1IM9A 2YUZA 3UZVB 4R7XA 3MR9A 1QAWA 3MRFB 4L37A 1G7HB 1Q9OA 3TFBA 5K9OB 3D8MA 4UQ2A 5IW3A 3WJJA 2A0LD 3CTTA 1I7TA 1YC8A 3ARPA 2FIKA 4I13B 1J7VR 3O3UN 4PTUB 4JHUA 2BSEA 1EPFA 1U91A 3NJHA 1S7SA 2ED8A 5C08D 1EZSA 2NNFA 2R2CA 4GEJA 4NKQB 2P5WE 4X6CF 3GZQA 4QRBA 2KS0A 1DFXA 1ZMYA 3JTBA 4YIQA 5JHDE 2WC7A 1T21B 4JL2A 3TN0A 1PGRB 2XTJC 2VW7A 4PJCB 3VXQB 1JS4A 4ZXBD 1XSJA 3KPQB 3RA7L 1W6WA 5F8RC 3C5SA 5FWRA 2XFXB 4V33A 5DJZB 4X9HA 4A38A 2GJRA 2J1YA 5E6IA 5EBGA 4LSSH 3N55A 2E7MA 3E8UL 3PP4H 1YJDL 3FO1A 5FXCH 5LBVA 4NBZB 4U6HA 3ZTCC 3TJPA 4CGUB 4N8PA 5CWSA 3VYPA 1CVRA 2AJ3A 5LAPA 4LAQL 1J8RA 1O7SA 1WQVT 4AV4A 5MERB 1RZFH 2WOBA 1MXDA 1EFXD 1JK8B 1DJZA 3T08A 1J11A 1F6AB 1FWXA 3U4BH 3TVMD 4PV1C 3BPLC 3DECA 5D7KE 1P7QB 5J1SC 5I8OL 3F58L 4PJFA 4A39A 3D06A 4OLVL 2YPKB 2TRHA 1XR8A 4HXBH 3U83A 1YDPB 2ZX8A 2C7UB 4GG6A 2CJUH 2P5EB 4MNQD 3QEQD 4KH2A 4Z7UE 2WIIA 3IXAB 2WTPA 1DSFL 3O41B 1N68A 1TMQA 3UP6A 2EZ0D 1LWRA 1PKQB 3W9DA 4E41D 3CC5A 1ID2A 1OP5K 1NOFA 3QIUC 3VW3H 4TNFA 4U1KB 3WKML 4NPYB 5JW3L 1S9YB 2APTA 3CC5B 3CFJB 1XZ0A 3K81A 4UQ9A 4HJIA 2RB8A 4PJBE 4FLQA 3VFOA 2C3GA 5B4MD 1HL8A 4Y4KD 4NHUB 1YEGL 3A47A 4KJWD 1W8OA 1WBYA 3GNML 1Z32X 3KPSB 1Q9WA 3O4LB 3V5KB 3N50A 1IEBA 1DZBA 3MFFB 3CV5A 4MHHG 1V8HA 3V5KA 2ADYA 1MCLA 4N2MA 5J6SA 3RKDD 4K7FB 4N0YL 4XBEL 3O2VL 5IVXF 5C0EB 1BBJA 2NT1A 3BWZA 5LCVL 4X7SH 1LD9A 3PWJA 1X6NA 1DE4B 3S36L 2UVEA 3PNWB 5E1HB 1Q9KA 2J6EA 5B1AB 2P52A 4U31A 5TE6H 3TURA 4WWKD 4QOKA 1X7QB 3O3BA 1AG6A 5E8DH 2WD0A 4L8SA 3MGOB 2ZWYA 2OMUA 1T80A 3QI9A 4AT6A 5A2IH 5T3ZD 1T66D 4P2OD 1CXLA 4HUMB 5JPNB 5AW4B 3MV9E 5IFJA 3LOWA 3GHEL 1ODUA 5F2FA 1MELA 4LPUA 4YLQT 3PL6C 4X8CA 4CRPA 1JZ3A 4OZFG 1QNIA 4YSAA 3ASWA 4IRZA 1ZA6A 2QADC 3U30C 1AQDB 1MEXH 1HVXA 3IJ9A 2MSPA 1J8HA 1MHHB 1K4DA 1XEDA 4F7PB 4OZIE 2SEBA 3CPLB 3F7KA 3M8OH 5B1KA 2G3XA 4PW4A 1R5WA 3MLUL 5FK9A 5HGAA 4ADGA 5C97A 5JXAL 4OF3A 2H26B 1V55B 2QT6A 2WCPA 4PRHE 3MNDA 4KUZH 3SIKA 1BFTA 4GKZB 1YNTA 5F9AC 1PKQA 1Z0NA 5HSFA 3WFDH 2E9WA 4HCRH 3IKKA 3QUZB 4FCHA 5ANHA 1UM5H 3SODB 5BS0D 3NN8B 3O6ML 1A0QL 5HJBA 5IR1A 3IETA 4XX5A 3ZE1F 3N91A 3HZKB 5TH2B 3UTQA 3MRDA 5E2UL 4YL4A 3FS9A 3W82A 4JY6A 5J13C 1OAQH 5JUEL 5BO0D 3QJFA 4MJ4A 2P8PA 3ZZ1A 4POYA 4JY6B 3X11A 1G9MH 3G5XA 4AIZB 1BIIB 3QUKB 5DUML 1SDYA 5DO2D 1B6DA 5AVZB 5KJ4A 2ENJA 1F45A 3GMLA 5FGBC 2JIXD 1NFKA 4ENZA 2HKFL 2WTOA 2ITCA 1TEGA 3NG5A 2DQUH 1MVUB 3EGDA 4P23B 1N59A 1RJZA 2AJUL 1U3HD 5EF2A 4LF3A 2X4TA 4NI3A 2CHWA 2ZKXA 1DVQA 3TBCA 4JM4L 1HSAB 1A9EB 5CZXC 4DNLA 5IFAL 4ZFZA 4EDXA 5SV4A 1FRGL 1RK0A 5IVOA 2FBRA 2UUDK 3DBSA 4U1JA 4Z8FH 5B8CB 2AAVA 4BFEA 4I0PA 3O6KH 4FYQA 1RUPH 1E0OB 1S7WB 1U8CA 2VISB 1IKNA 4HWZA 2OYLA 1JHKL 1X5KA 4A7UA 1JD7A 1LO3L 4JY5L 3L7EB 1BVNP 4C4KT 5GIRA 7CGTA 1M71B 2Y0SA 4MXWH 4S1RH 4L1SA 4Z77B 2IWGA 4F9LA 1DJSA 3DJTA 5CM1A 4KJPD 1RVFH 2EO7A 4KKAD 4OGAC 1SHSA 4YDJA 2N59A 3BFWA 2DWDA 5I1KL 5I1KH 1TLMA 1PVHA 1WSST 5JPNC 4K23L 3HZYA 3FZUC 3L3KB 1S7SB 4JFXA 2N1TE 1KJVB 4PJIB 1KMGA 3EH2A 3QG7H 3MNMA 2ENYA 4NIYE 1JRHH 1WZ1H 2AMUA 4P9MH 2ARJA 2ZUQC 2FHCA 1ZLUK 3S35H 2ZSWA 3L3HA 1JPEA 3WG7B 4WHTB 5ITFA 1V10A 2VXSH 2CO3A 2VMEA 5F0JB 1RHHA 3QAZB 1V05A 3OHXA 2F8VA 1NL0L 4QYOA 2DQIL 1CLZL 3AG3B 1MREH 2QQKL 2QJDA 4UBDD 4Y9EA 3SKJH 2OR7A 3QRFM 5L2KD 3L9BA 2GBTA 2IOIA 5EU6A 1ORSB 4PIRF 4XMPL 4Q9BA 4IHBA 1L7IL 6FABH 4JGMA 4JRYD 4JL1A 3JUYA 3NFSL 4MX7A 1NWPA 2BIPA 1LEKB 2BM3A 1NCBH 2WQXA 4PRAB 3OQRA 2HT2C 2XWZA 5B39B 5CR8A 4IU3A 1XGRB 4OGYL 4Y16A 4PTUA 5C9JB 1A4KB 2OXHA 4UDTB 5IB4A 2VABA 3H2QA 1OAZL 2H1PH 2VXTH 4HJUA 4GKSB 2FO8A 1T89C 1GR7A 4WFED 5I1CH 1DQDH 3JVGC 1HIML 2Y7MA 3QHTC 1S7UA 3O8XD 2KT6A 1YEJH 3IRZA 4URTB 3TM6A 2HCZX 5D2NE 3HMWL 2WKLA 1KPRB 3MFGB 4FA6A 1L0PA 3MLTA 1U33A 5LBSL 1KXVC 1N19A 1INDL 1T5XB 1I8LC 1MG2C 5T1KA 4LCYB 4NUGL 2DWYA 2B1AL 4JN2A 2YMXH 1W0YT 3KPMB 4MCZA 3O8XA 1I1AC 4DQAA 3W0WB 5HI5C 3KVPA 4ODUA 3O3DA 4PJXE 2LOEA 3OXSB 4Y4KB 1MCFA 2AW2A 1I7ZB 5AW5B 3V0DA 1A5FL 4NHUA 2OSLA 3VFRB 1JDDA 5KAQG 5HDLA 1TUPA 4CW1B 1DVYA 5HBBA 3U46B 3ETBF 4F5CE 2YD1A 3B9EA 1JGUL 4LCCA 5DJAB 4FQ1L 1W15A 4G1MA 4DAGH 3I9GL 1QHOA 3S3PA 3W57A 3C5ZD 1U2HA 1NUGA 4QCIB 5CZKA 5TPWL 2F54B 4U2ZA 3IFNL 2FO1A 1MIEH 2YR3A 3B2XA 5GGTH 4QCIA 3GD1C 4BBWA 1X7QA 3T3PB 4OQTH 4RGNC 2OMUB 3QI9B 3RWGB 1JSYA 2BO0A 2DTML 3HZVB 1I85A 1KBVA 4I3RH 2D2OA 2VABB 3HG2A 2G9KA 3QFJA 5MEOB 4P5RA 1C5CL 3RJOA 2A38A 1E90A 1N6QL 2I9TA 1YO4A 4OLXH 3DX8A 4HS6B 2VSMB 4QTFA 3CMGA 1BQUA 3OAWA 5DZAA 3CG8A 4N90E 5FO9A 2OR8A 4NKDB 4MTMA 4Y4HC 4ZX5A 3W39B 4MJHA 5A2BA 2H1PL 4KPHL 4PJEE 1DQLH 5CUSL 3QS3A 1DQLL 2VLJA 3HKFA 1JTOA 3CZGA 4LIQL 1HKLH 5F7DA 4KZEL 1OOAA 4UIKL 3MPCA 2VDMH 3O9WB 4XNQA 1XBRA 2IDUA 1JMZA 1JWUA 4P9HC 1QSED 3W3BA 1MFCH 4LU5H 4ZFFA 3LS5L 5CEZE 1QEXA 1JE6A 2I26N 2ZD0A 5BRZD 3DSFH 3B2MA 1HHIA 3ARYA 1Q1JH 5IBUB 4Z3HA 4JFDE 5DEFB 2MCAA 1DQKA 3EJCA 1AO7A 4TSBH 3QR1A 2Y22A 3QJFB 3WNOA 1TITA 1B3IA 2BCKA 4B97A 3GMRA 2Y7QB 2AGJH 2DQ6A 3CXHJ 4Y7MA 3G6DH 2BP5M 2D7MA 3JV5A 3GSNL 3GJEB 4GSRA 4PWIA 4XBPB 3X14B 4M3JA 1O7DC 2XV2A 4FQLL 2VRKA 3LQZB 1I7RB 3TNNB 4GI6A 4HCIA 1YAIA 1TKWB 4KJPC 1HHHA 4K9JA 3DOIA 3NSDA 3QEUA 3RIFF 3K4ZA 3EO0B 1BQHB 4FFVC 1A7OH 2WIIB 3IXAA 3AS2A 3NP3A 4LDOB 1R5WB 5SWZA 3DRTB 3ES6A 3OKDB 2OLDA 4DP9X 4HGWB 4U1JB 3E3QC 1E5YA 4K9EH 4P4RB 1FQ9C 3POCA 4DEPB 3BWAB 1COBA 1S7VA 4XPGL 2PYFB 3H85A 4UT9H 3O4LE 5FOBA 2FBOJ 1MJ8L 4MCNA 3SCMD 1A64A 5G2NA 2YPLD 4H8QA 2WJ5A 1IBZA 4N8VB 1IGIH 3U7WL 1XH1A 3BUDA 3H53A 1UXWB 3HHMA 4ZZFA 3GI9H 2A6IA 1NCWH 3QZWB 4H2CA 3GSRB 1NCWL 4PCTA 3L5HA 4LCUB 2NT0A 3KJ4C 2ZX9A 1RP9A 2DIAA 2OX5B 4MD0B 4C56E 1ACYL 1YQ2A 3V4UH 1I3RA 3SY6A 4F27A 5D7SH 1T6VN 5C0EA 1ZGLB 3RLSA 3Q1EA 3M86A 3K80A 4PJIA 1MLCB 4K5NA 3RX8A 5IHZB 2LAAA 1A6UL 4PJAA 3EJUA 4KKBC 5I8OH 2ZKHL 1HNFA 2J5LB 2GB2A 3TF4A 3LZLA 2E8YA 2PWHA 3ALPA 4OD1L 5EIIA 2GJPA 3F7LA 4J23A 4NWUH 3GJEA 1G6RH 4HCFA 1GJWA 5CGYC 5LLIC 1XZWA 3QW9A 4PSPA 5E70A 2CGRH 5EOQH 5CKGA 1MIML 1S7WA 4Y9CA 5E6RB 2EUVA 4K5LA 3S37X 3MR9B 4GKNB 4FA8A 3NDZE 3HPJB 4I0KA 2Q0ZX 1QI3A 4ZUWA 3LJ3A 1QRND 1UZ6E 2X42A 2WQRA 2UZPA 3HG3A 4RGOL 1P5VB 4PJ8D 1WAAF 2FWLB 1B0WA 2C3VA 1QFWI 5E95B 5SWZB 3DYMA 4I2XE 4EI6A 3WE6B 3EYFB 1MQ8A 4RH4A 2GUYA 1M6OB 5CKAA 5I76A 1AHWB 4X6DE 2ZNXA 4XMLL 1FZMB 2HLAB 2W88A 1BM7A 1VGEL 3MJ9L 4Y5VA 4I1RA 3CDZA 5FYJL 1OANA 5TF0A 2AJVL 2BMKB 2P8PB 3EDJA 1RZ8A 2IPUK 3BGMB 3H1ZA 4H0IA 3H3KA 4ZDHA 4B5EA 4M8QA 4UAHA 1IVLA 3QUHA 5EFIA 2NYKA 4J4PD 3S34L 1I3RB 3BIKA 3EFFB 3PABB 2YFNA 1UH3A 4LZKA 2HMIC 3MLYL 4LNVA 5EF1A 1AANA 2FYYB 1JNNH 4HX1B 2R51A 3MRRB 4ODSH 4W9FC 3MRPB 1G7MB 3H0TA 2IADB 5EU6D 2IDTA 4POZD 3L16A 4ODUB 1GYAA 1J1PL 5IQ7L 4UINL 1ZY9A 2A1WH 4ADJA 2IVFC 2Y2YA 1RK0B 1W16A 3PHQB 4JB9L 2GJ6D 5DLML 1KJ2H 4ZQKA 3REVA 2X4SA 1UXMA 2LR4A 5DRXB 3WV0A 1S78C 3KPSE 3U46A 2BP0B 5CEXB 4A2EA 3EJSA 4QIRA 4CC4A 4OGZA 4PLJC 2FQGA 5GGVL 2LABA 5IBLD 2B1HL 3WUWA 3DO7A 1KN2H 5BRQA 3U0PA 3FMGL 3HC3L 4GT0A 1YDPA 1VSCA 4KK5C 4NP9A 4XE5B 4ZAKC 4DGWC 2C7UA 2CJUL 3F2LA 1TETL 4QLRA 3JV6B 1I82A 4RRPG 1A4CA 2Y72A 3D50A 3M1OA 3JV6A 1JNLL 5DUPL 1YMMB 4IRSC 4C8XA 5TE6L 1XVSA 1S9WB 1GH7A 4R90L 1XCTA 1HHKA 1KTKE 3MLTB 4UT7H 4L0ZA 4DWHA 4Y5YB 2YHGA 3TT3H 3UACA 1DL7L 2XWJA 4PBXA 2WXPA 4XO4A 4ZS7L 1UD4A 1M56B 3CBJB 3NDYE 3LEYH 1OWWA 1GPOL 1VJSA 2ATPA 8PAZA 2IOOA 4CSSA 3P4LA 1ACZA 1AD0B 3IDMB 4BZ2L 2ICEC 3NIFF 4DN4L 5C0RL 2BSED 4IKJA 4WI0A 2AJXL 4R5TA 3T8VA 3GSWA 3EFDL 1REIA 2B2XL 2W9LA 2CR3A 4WW1A 4NQCE 5E9DB 1B6UA 1PYWB 1AHWC 3FN0L 5LGJA 2BNRD 3UJTH 3N06B 4LESA 4N2BA 3S36H 1GGBH 1WA1X 4JMNA 2HJLA 1WFMA 2GSMB 1L6ZA 1D6VH 2P7TB 4I4WA 1NOAA 2BVQA 1E50A 1ZLWH 4BZYA 1U8LA 2Z8WC 4HJJH 2JJSC 3SO5A 1D9KC 4L8SB 3GMMB 4IHOA 4WI6A 4LSPH 3ZTDC 3SDDA 4GRLD 5EU5B 5ID0B 1FNSH 2GHWB 2APXA 2V3EA 3X14A 5FYLH 2ARJQ 3PAVA 3QIUA 2WBXA 5DA0B 3BKCH 1FNAA 2PWDA 4F91B 3C60B 5HHOE 1GZQA 1MN4A 1D5BB 2XQYG 5KVGE 4QRTB 5D72L 4BFBD 1H8SA 1IGYB 3MCKA 4TQ8A 1KN2L 1YMMA 4J3WA 4X5LA 5C92A 4L4TE 2C9SA 3QXTA 2F19L 3FFCA 3O41A 1NC2A 1JXDA 5C0AE 4JEGB 2XU9A 4ISVA 3EDFA 4Y8DC 2BVPA 4LGSB 4NPYA 2PYFA 1GGIH 2VAJA 1L6XA 5IMKA 3S4SA 3ILQD 3KNBA 4S10A 1BQLH 4OLYL 2AQ2A 5DZNA 2H3NA 3BDYH 2BVEA 3BW9B 5HI4C 1PZ3A 3P4NB 3PDOB 3OKMB 3DOSA 2F68X 4P4KC 5DD0H 1X5LA 3ARUA 1JWSB 5E2JA 5EU4B 2EAEA 5IMMB 2YAMA 4XBMA 3WEBA 4O58H 5D7LE 3VG0L 3JUZA 2ITCB 5DFVC 3T2QA 1Y6NR 2FWUA 5SWSD 5ITBH 5ADOL 2V8LA 3C8KB 1MF2L 4XNMA 2ADJB 4AJYV 5IB5A 1DQJA 3RVTD 3PWPE 3SJVB 3BRGC 4XAWL 1H19A 4TQHA 2DQEL 3ARFA 1TSRA 3CVIH 4J7RA 1CLVA 3WELA 5JHDB 4FG6C 5G5DB 5GGUB 3UC0L 4CC1A 3BAIA 1F1DA 2VXSL 1KLFA 3QJTB 2NW3A 4QJ5B 1ITCA 2EDNA 2PCYA 3BKYH 4L3CA 3LZOA 3KPRB 3BWAA 1DFBL 1DVFC 1NCTA 5HVWA 4TLTA 2YD5A 5KVEE 4UTBA 3HAEG 4IKKA 5C0IB 1G0YR 1NLDL 5FKPA 4KRPC 5T3ZL 4N9OB 4R97B 5I6KA 3QZWA 5T3XE 2WZPA 1QSEE 5LGKA 5FKPB 3R1GH 1FYTB 4UIMB 3VXME 3L9YA 3ZRSA 4AVHA 4GKZA 3HPLB 2OV0A 3SE4C 5F0PB 3OVUB 2BFVH 3BHBB 4ERSH 5KVMC 4HZ1A 2Q76B 4TVUA 3RPIA 1KBKA 4C4BA 2EE6A 1KB5B 1NICA 1IGML 4O2EB 3WKPA 4DCQB 5ICYA 3EBIA 4IJTA 1OP3K 4JDZA 2R2HB 1ZEAH 4PB0L 2FBJH 3QQ4B 1NPNA 1DVFD 1QNZL 1P9MC 3KYOB 3DUSA 1MW0A 3E9TA 3OPZL 4B9CA 5D1QD 3A6BL 3SO3C 1RUKL 3O6KL 3QZBA 5IMMA 5EOCJ 1AKJA 4XMVA 3KLAA 4PJ9C 5F7MC 3GZOA 1LO2L 4OFPA 4QHNB 3S5LA 2GFBB 2D2CC 4AG4L 1BQ5A 3RFZC 1A3LL 1A3LH 4HF5H 5HPOA 3IMBA 1QYGH 5EUOA 4B60A 1YECL 5ALCH 4IMKA 5IK3A 5F97E 3UYRH 3RY6C 2OJZL 3PS6A 3MRNB 2WXRA 2P26A 1A14H 4XXDA 2UZIL 1SGKA 3WOVA 4HWBH 3FUHA 3ELQA 1W72H 4HWBL 4X5WB 4I0PB 2R4RH 2X4NA 4YSEA 5GS3A 5E5LA 5FYKH 3RL2B 1S2EA 3WIIL 3CVIL 1LE9B 2X4NB 3DX0A 2QADD 5G4MA 4PJAF 5J3HD 3IJYB 5KSBF 4J3VA 4XB8A 1P2CB 2X6CA 5C08A 5BOPA 2QFRA 3D85B 4OIBA 1JN6A 1A21A 5LNGA 1G7LA 3Q8AA 4X6EA 1K85A 1CWVA 2R15A 3IEAA 5A16B 5CD5D 1AS6A 1XH2A 3UCRA 1WCBA 3VH8B 3K4AA 2PKDA 4JFXB 4APQA 5T3ZH 4KMTH 4MS6A 1D7FA 4AJWA 1F90L 3VM7A 3P11L 1Q0XH 3NA9L 1DSFH 2EDXA 4N2IA 4K2UL 3B37A 2W65A 2ZUTA 4FQLH 2OZ4L 3B6SA 3GDBA 2YWYA 4JFYB 3D0AA 1AGCA 1F3DJ 2XY1A 2CLRB 2OMZB 1BVLB 4KDVA 1QFWM 3SN6N 2J56A 1IFRA 3BDBA 4HETA 3TA4D 1JF5A 2BRRH 2IANB 3FQWA 5FC9A 4UIKH 4M7ZC 4BK5A 2FJGA 2D03H 3HI1A 4P23D 3Q6GL 3RDTC 2E4FA 3DYOA 1O6SA 5CWSB 2F08A 2VKWA 4BDVA 2YD7A 4B53A 1KCLA 3U36A 1W80A 1HINH 4N0YH 5JHBA 4N2HA 1MVYA 3A0OA 2XN9D 4YSSA 3WLWC 1HI6B 3LXCA 3MUHL 3QUYD 1E4XI 4KAQH 4CJ1A 3BE1L 3APNA 4P99A 3IDIB 1DLFH 3B1UA 3I02A 5K93A 5FB8B 4K3DL 4PRNB 2X09A 2FAUA 4GKSA 3BJ91 3LKQB 5FHBH 4AMXA 4JRXB 1IAMA 1CFVH 2HG5B 4LEBA 5BUAA 1KPRA 1IZJA 1A25A 3C5ZA 4HIHB 4DP7X 5BS0B 1I1FB 1M1XA 1AGEA 3QNZB 3THML 1UCTA 3OBAA 4XPTL 2MCG1 5GZNC 5HGDA 3M1CA 4DP5X 2IXQB 3DXAB 1OTSD 4IRSB 4GPVA 5K9KB 3BPNC 3HMXL 4HUNB 5HYFA 4M8UA 3RIFK 1UATA 4BFRA 2DMCA 3GRWA 5E6SB 4GBXC 1HHJA 4Y4HA 3BVDB 4GSXA 4K9EL 3CLFL 2EH8H 4A1RA 4XZ4A 4FHKA 4AL8C 1KLUA 2FJHA 3BW9A 4NO0A 2J21A 1UJ3B 4OAWA 3NIFE 3TP4A 2IANA 2C9AA 2UZXA 2VXUH 3SYAA 2FJGB 3BD3A 3HI1B 4XCCL 1QSZA 1JAEA 4JHWL 3Q05A 3KJ6H 4GH7B 5E1QA 2BSTB 4QT5A 2AS5M 4DVRL 4URKA 3O81A 1ORQA 2XWTA 4XODA 1VA9A 4POZC 5B1JA 3SDYH 2HUEA 1MJ7H 4XWOC 2YD9A 2Z7WA 5FYJH 3C60D 1BYOA 2R29A 3BI9X 3AWEA 2ZKHH 4Y19D 5JQIB 2HX9A 1SHWA 1QKZL 2AERT 1DQQA 5CLTA 3LKQA 4NKMA 2CCVA 4XI5C 1DQQB 3F7RA 1EXUA 1Q8MA 1EFQA 4IGBD 4NKMB 1I9RL 1VFAB 4WCYL 2R8SL 4WVRA 1CD0A 4YK4C 5KAQF 3KNBB 3IXTB 4P59L 4ZOBA 4FQJL 4JFSA 1MFBH 3MREA 3UBXI 1AS7A 3HNSL 1TNMA 3GSWB 4PRBA 5J89A 5DTFA 2P5ED 4MNQB 3DX9B 1HYRC 3AU1A 1RURL 2A4ZA 4HS8H 1RURH 4PMEA 5D4QA 3LVEA 3QYMA 2I25N 4G80A 4ZFFB 4KY1H 5ICZA 2HSIA 3RZCB 3NCYP 4GW1A 1I3GH 4QXTA 2ADFL 5DD3H 5E8OA 3VSTA 5IVNA 4WUKH 2NNRA 3CFQA 4PJGA 5FYJU 2OXGB 5C0GB 4W4OC 1UHVA 2FLMA 2LQRA 2Z1PA 3MLRH 1D5MA 5CEZD 3CFDA 4MQ7A 1IUZA 5FYJE 3W9EB 3LKPA 5LUMA 1CFTA 4HAGA 5CAYB 3CFNA 1R6VA 3TNNA 1KFGA 3BT2L 5AFAA 1FN4B 4M6MH 3ZHKA 4M6ML 2VB5A 2JKNA 2WWNA 5F7EL 1TYJA 2XQBH 5I18L 1Z9MA 5AL0A 4EZKA 1CDYA 1TKWA 3KYKL 1XGYL 3MNZB 5DRZB 5CMAA 2X0VA 4NWTH 3ZXAC 4EQ2A 2JKXA 5IBTL 1YVLA 3O4OC 4PRHA 4K07A 2JCCE 2BP3A 2UV3A 3QDGE 2DQTL 2UXGA 1CFSB 2B0SL 3WJLA 1IGTB 1IGJB 1NCBL 5I16A 3KCPA 3FT2B 3O2WH 1S7VB 2LHAA 1M9WA 3AG2B 2FL5B 4JFQB 4OM0H 3ZUCA 3GSRA 1QUPA 2JJWA 4YX2H 1RJYA 2X6MA 4NAQA 1E6OL 1B9ZA 1A6PA 2HLFC 2ROXA 5B7MA 4LARL 3R4RA 4MB3A 3BAXA 4AIZA 5I1CL 3MRMB 5C6TH 2R8SH 1FHGA 2FJFB 5KBPA 4GRWH 1G7JA 4M7JL 4I18C 3LEVH 4S0SD 1FV1A 4PU2A 2F0CA 5I6XB 4KRMB 1T20A 1WZMA 4L4TA 4X50A 5AW3B 2OM5A 4L9LC 4F58H 5CJQH 2CMRL 3S5LB 2FTAA 4Z7IA 2B9BA 2YMOA 4Q8BA 4PR5B 3BSGA 3CFKA 1KYOJ 2A9AA 4FHBD 5AW9B 2DD8L 3K6IA 1MOEA 5DK2B 5A2AA 2H7WA 4G7YL 3SOBL 1CS6A 2ADFH 2FT8A 1IKNC 3JZYA 5DD3L 4V1DE 4ZMPA 3PWUB 4LQFH 5KYNA 1RI8A 5FUCE 2Y5EA 1JWMA 2AXHA 3CU1A 3WFHA 2CA3A 4XWGL 1SJHA 1T6BX 4HEPA 4F7PA 1ET8A 4AEHH 3US0A 3F6JA 4OI8A 4L8DB 4PJ8C 3ZDYE 1P5VA 2DS4A 3RL2A 5HD8C 2VL5B 1ZKAA 2GVYA 3EGSB 2CR0A 4U3CA 3VDAA 5B3JF 4MX7B 1J5OL 2NMSA 3PIQA 1S3KH 3MRHA 1TR7A 4FQCH 3CVHH 1J1XL 2X1QA 3IMVA 5ID1A 4C47A 4UT7L 1N64L 2LAGB 1CR9L 2BIHA 3RRQA 4AQ1B 4P8QA 3TEWA 3IFOB 1YY9D 2Q8BL 1A6WL 3FT2A 3AROA 3TA3C 3T6ZA 2D4FA 3P77B 5FLUA 3HRZC 4LCWD 4ZDHB 4I3RL 2EEBA 3QZPA 5HPMA 1KTLB 1N8ZA 4H0GA 5L88L 4OM1H 5JW5B 4PRDA 1KPVA 3DMMA 1EDYA 2G75B 3D25A 3X1NA 4WFGE 1DEEB 4WEUD 3GM0A 4XP5L 5ACZA 3C6LB 2FJSA 3K6DA 3DTXB 2OMZA 4PJDB 2J25A 4NO2A 4UTAL 3IDGA 1BFVL 3EFFA 2OCCB 1E7VA 1D2OA 1R34A 3GHPA 4AXWB 2V8MA 3CSYA 1Q9LB 5E0QA 1QSEB 1UD6A 3FQRB 5LHDA 2H2SC 3DPDA 4B9KC 5L2JB 3QULA 3F7QA 1B3JA 1UXSA 3OXSA 3QDAA 4Y4KA 5L2KE 1BXUA 2CDEA 3VJ6A 4Z7QF 3DETC 2WQVA 2KUTA 5KVDE 2R0ZH 2V5YA 1KYAA 1UJ3C 4LSPL 5I74C 5IQLA 2W0LA 2FJHB 5KW9L 1U8CB 2VISA 2KHAA 1E28B 1U8MA 3ARXA 1NTDA 3Q01A 3QA3B 3QIBA 5MI0B 1WA0X 2NY6B 2UWEB 3SCMB 1QPKA 3GC3A 5C9JA 1E28A 1BVZA 1KPUB 1UOLA 5JXED 2MPVA 2GK0B 3DTDA 1WC7A 4R84A 1MRDH 1EBPA 3MRBA 4HBCH 4UZUA 3SOBH 3G5ZA 2BSBA 4G8EB 1CDHA 5DK0A 2A9MH 3CFTA 1LQSR 2X0UA 4XVSH 1NAMH 3SYOA 3EO9H 4GMSL 5DMKA 4KNQA 4G6ML 1QZNA 4R0LB 3WTSA 4NP4L 4WENB 1Q4NX 1K8IA 1I1FA 1M1XB 3QNZA 4EIUA 3UTSD 2NY2C 4HS3A 5J56B 2OK0L 2ZWSA 4OZIB 3F6LA 2FCBA 2XWJB 2DQEH 2ZNWA 4OR1A 1EHAA 1RJLB 2OMBA 3OSKA 4KROB 4NAJA 5HGDB 5T5FH 3OPZH 3RVUD 1FVEB 1XF4A 3QUXC 3WNPA 1P53A 3QNXB 1M57B 1KTLA 1VB9A 2XWRA 1FL6B 4ZYKA 1MCNA 3SPCA 1G1KA 3GGWB 1S7QB 4H1LG 2Q2LA 4C58B 3OKMA 2DY2A 2JSFA 4LP5A 3ZDYF 4B9GA 3IDGB 4NLAA 2OAAA 3CAFA 1FCCA 2VLRE 3LD8C 5CF3A 2UZXB 4AYBA 1P4BH 3LH2L 4YHKH 2X28A 4OW6A 1W72L 4JFVA 3VJ6B 4N24A 1JGEB 4YHML 1AIFA 4PJGB 2QZ5A 3WIIH 1AZRA 2X2YA 3TEXA 3QNFA 1OKEA 1ZE3H 1H15A 3EDKA 4G8GD 5D7JD 2H41A 4HH8A 1U8QA 5CP7B 3ROOB 3HZVA 2J6EH 5CIPB 1R33A 3GJFA 5INDA 1C16A 4G7SB 2FATL 5BZZA 1A4AA 5F6HJ 3ZJAA 1U8KB 5EB9A 3DX8B 1I7RA 1HYSD 5E1IA 4KO6A 1T0MA 1LWJA 2EJ1A 4PWHA 1DANU 5J57B 4HWEL 3O6FD 4J3UA 1CD1A 4JZOB 1HXYB 1OPGL 4OKDA 1N12A 1QBML 4QYAA 5KBDA 3E0GA 1CGWA 3VQMA 5A3ID 2CLVB 1D5XB 4XH2B 1JXFA 3ZBMA 2VM4A 2CRMA 2FZ3A 3UPCA 1AR2A 1KIPB 4R90H 4QY8B 1NGYB 5B8CC 4P4KA 4Y4FA 4D94A 3QUZA 1JK9B 4OJAA 3RURA 3DHMA 2XICA 3WFBL 4J12A 3RPIB 4EE2A 3ZL1A 3KCWA 4HIEA 3NUKA 4CADB 5JQHC 5DD1H 1HX0A 3CZFB 5JHDD 1L9SA 1W2KT 2XBZA 4XP6H 4DO6A 3K2UL 2RMNA 2MQ3A 4AV5A 2H4EA 1R3KA 3CSPA 4DW2L 1S9VB 4XNUH 3P4OB 5E03A 2MNJB 3ZKNC 2BXZA 1KB5H 5EBLB 3VWJC 2DEWX 3LRHA 4D3CH 2VR5A 4A6YB 1RZKL 3PWLB 2FWSA 4E2OA 5I9QB 4P5TD 1RV6X 2J6WA 3B9KD 4JW3A 2HPOA 5AZ2H 4OCYH 4LGPB 1JYVA 4WFFE 4WWID 5J6HA 2Z35B 2YSSB 1IGFH 3UH8A 4XC1H 4L0YA 4F1ZA 4NM4L 4D8OA 3NJKA 1B4TA 1IGMH 4P2QA 1FG2A 3EH1A 3GKWL 3OTTA 3SBQA 2R2EB 5C07B 1NAKL 5CXPA 5IEHB 1D5ZA 4RAUB 1UXWA 5B38G 2PYED 5DEGA 2P5WD 1PJWA 4KQ4H 4LCUA 4NM8H 3ARVA 4NM8L 2R0KH 3ARGC 3AREC 4WFHD 1IT9L 2Z34A 3OAUL 1A3ZA 4WNJA 4PJ9B 2G4EA 4B6ZA 4B50A 5IHUL 4B5ZA 1U2YA 4AQ1A 3HPLA 4X7FC 2F2HA 3K1KC 3KYNA 3DGCR 3L1OL 3TBTB 1BZDA 3IDXH 3LEXB 5DFVD 1AACA 5JUEH 4YO0A 3GIVB 4JLRB 1X5XA 3FT4A 4UV7L 5C3TA 4GMTH 2WGNB 1CDJA 1PD6A 3CXFA 2P8LA 1JV2A 4AYSA 1G9MC 4H1LH 2HLFD 1FFOA 3K8LA 4JDTH 4RMWA 1FLRH 4W9HC 5DD6A 5DUBB 5E00B 3UCQA 2D31A 3VSQA 2GFBA 1OQOA 5DRNA 1CLOL 1ZT4B 3GNMH 3ARGD 3IN0A 4O58L 3VG0H 3U25A 1TZIA 1MCDA 5C0RH 1CTNA 1XSIA 2BIMA 3H0TB 5IIEB 5IOPA 3WD5L 4U1IA 3FL7A 1XQ4A 5L4FA 1YLBB 1BFOB 4I0CC 1BHGA 3M46A 5EU7E 1J1OH 4IIQA 3T1FB 1FO0L 5MI0C 3LQAC 3VI3B 1CFBA 2ODHA 3WDJA 4FXLA 4GXUN 3GLEA 4ENED 4PHZA 5HD8D 5DZOA 4X7TB 2D7TH 4PH8A 5T3ZE 1WYJA 1S5HA 3K6FA 4LLMB 3VXSA 1EMTH 3T0EB 4ZTOH 3VDBA 4PJXF 1S5HB 5F71A 1VCBC 1M71A 4HJ1A 1BEXA 4A63A 5B3NA 2YBRB 1JV5B 1P2CA 1TZOA 2FIRT 2QVTA 2ICEB 4DZ8A 4MAUH 3CVHB 4NUJB 5C2BH 2HP4A 5D7LB 4MXQC 4ZZKA 3K1DA 4W9CC 5ETUA 2HXAA 5T1KB 1A7QH 1A7QL 4LAJH 2CBMA 4OCNC 4X6FB 4F93B 4KKCD 5D93B 4PJAB 3RGBA 3WSQL 4UAOB 2BERA 1EANA 1FVEA 3HE7D 2F58H 1Q9LA 4OTXL 4ODVL 3PCYA 4KV5F 4BK5C 4BZ2A 1KCWA 5F9WC 2VLRD 1AI1L 3GXTA 3E6HA 3HS8A 2C3HA 1MRCH 3ZE1B 3VXUE 4YPJA 2V9UA 5GS2D 2LW3A 3GGWA 1IKFH 3ARZA 2VXQL 1MREL 1UZ6F 4L4VA 3DV6B 4NO3A 3VFGL 1Q0EA 4MJ2A 2OULB 1TDQA 2HX8A 1OQXA 1JPTH 1IM9B 3UZVA 4JHWH 5ANMA 4ZUWB 4MWFB 1I8KB 4G5ZL 1KG0B 5I24A 2IBBA 4X5XB 3BHBA 4MKTA 1A7BA 5K9JL 1KZQA 3MOQA 2HJLB 1NFIB 3C12A 1EH9A 2E76C 2VAAA 4XGZA 1ORQB 4XP9H 3QR0A 1RK7A 4N8CH 2VUYA 3HCVA 1WT5C 3FSWA 2V7HB 4KTDL 4WUKL 1IBDA 2X38A 3EYUL 2OMYA 1E6OH 4GXVH 3ZHLA 3GUFA 2DI7A 1EDHA 2BOLA 1HDMA 4A6YL 1M2OA 1MFMA 4WWNA 4ZFOL 2XC8A 4JO3H 3BGAA 2ZF8A 4LKXA 1PZ5B 3V4VH 3BGFC 4F2MB 1YEIH 3A6OA 4MNGB 5AKSA 4FI6A 4A2DA 5CJQL 1ZDQA 2OJEA 5MP6L 5DQ9B 3AGWA 4ZO9A 3FCTA 3UO1H 4UZSA 1YEHL 3GRWH 1G4MA 1QRNB 1UACL 3ISWA 1K5NB 3U1PA 4K23H 3RFZA 3STZB 2FX7L 1CYXA 4PSRA 4RGMC 4TKWA 3ZMEA 4JX0A 1ZV5A 4J1UA 3X17A 5IROA 3SDYL 2JNZA 3QIUD 3D4GA 3CFDB 1NKGA 2IG2L 2Y7QA 4U6VL 4ZW5A 3H6JA 7PAZA 4KZCA 5B21A 4LOFA 3MA7A 4FQCL 2AKRA 2V5TA 3BAEH 5AW2B 4E9XA 4QF1A 5BO1H 4OF5A 5DJYB 3R06B 4AM0B 4HLZH 1OTUD 1WF5A 5CO1A 2WTRB 3KYKH 4LVEA 3ARED 3DHJA 4O00A 1MRFH 4MJJA 3PL6B 4L4VE 3WNIA 1YRKA 2DIJA 1N6UA 1D5XA 1A4BA 3O3EB 1PU0A 1JPFA 1NC2B 4I77L 1JPFB 4Y4FB 3ZRCC 3O2WL 4LVOB 3IDJA 3TJHC 4AYDC 4HS6A 4XP5H 3TX4A 1TMCB 4AUUA 4DN3L 4GY4A 3C87A 4LLUA 5FFOA 4OZ4A 5G4OA 5HHNA 5I1GH 2ATPB 1LJMA 4S11A 3SGKA 4ABVA 4H8HA 2NX5A 4KUCD 4WW2B 3KEHA 1MJUL 3INUH 3U7YL 2L8AA 4XNQB 3KVQA 4R4ND 4DFHA 3KBHE 1BX2B 1ADQH 4N0UE 1IE5A 4GG8A 1P6FA 1L7TH 5IQ9B 4TYUA 2A6DA 3PWVB 3RWDB 4TSBL 5H94B 1U8LB 3UTTB 3P2BA 5JHLH 3TBWB 4FQHA 5SWSE 3QDJA 2X89D 2WKOA 2HVJA 3DPBB 43CAA 5L7XH 4XMKL 4X6CB 4Z5RA 3LAFA 4XCYA 3QJZA 2UZYA 1DJIA 3OJ2C 3PV7A 2DQTH 1WVZA 4LVHC 3S3JA 1DCEA 4Q89A 3V2AR 4UQEA 4WUUE 1F97A 2NRDA 4E41A 4PD4J 3EHBB 4KXAA 5D2LE 4YK4B 1QFWL 2VLRA 4R2GC 4Z1PA 5KG9B 3KH3A 4AQ8C