3VVWA

Ndp52 in complex with lc3c
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
117
structure length
110
Chain Sequence
SQVIFNSVEKFYIPGGDVTCHYTFTQHFIPRRKDWIGIFRVGWKTTREYYTFMWVTLPIDQQEVQFKAYYLPKDDEYYQFCYVDEDGVVRGASIPFQFRPENEEDILVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LC3C, bound selectively by a noncanonical LIR motif in NDP52, is required for antibacterial autophagy
pubmed doi rcsb
molecule keywords Calcium-binding and coiled-coil domain-containing protein 2
molecule tags Protein transport
source organism Homo sapiens
total genus 14
structure length 110
sequence length 117
ec nomenclature
pdb deposition date 2012-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vvwA00
3VVWA 2LFEA 3VVVA 4NLHA
chains in the Genus database with same CATH superfamily
1F90L 4Z7NE 3F6IA 4N3UA 4UZUA 1N8OE 4PB9L 3W56A 4QHKJ 2WLLB 2WXKA 4R96A 3HE6A 4YHOL 5F6HJ 3NJJA 2EC9T 1FUNA 2MCG1 2FH8A 4PJ8A 4FI6A 4U7SA 3TBWB 1T4KB 4CVZA 2BWQA 3ZYIA 4DUXA 5ISZE 5JIQA 4YGAB 3MLRH 2YD6A 3GS4A 2BDNL 3BVUA 4JFED 1T22B 4N1CA 3A24A 2EVFA 3O8XA 5EOTA 4LVNC 2XKNA 1JWMB 3KYOB 2A9NL 1N5YL 1JF5A 3HG5A 4WI4A 4UDUB 4F7EB 4P49A 5C09A 4ZUUB 3PABB 3L4YA 5TDPB 4OZIF 1YEKL 3SE3A 4X7TB 3GXUB 1AZZC 2B3IA 3LX9A 5EWIH 4XN4A 5IUSA 5I1AA 3FCUB 2IV8A 3CFBB 4JFSA 3HNVL 3US1A 4G5AA 3O0RL 4IHOB 2R83A 4N9GA 4IKNA 2ALAA 3P4NA 3L9BA 3RGVB 3BAWA 2R27A 2Y36H 4OFDA 3RL1B 4UQCA 4JDEA 4GBXD 1E4HA 3MJ9L 3ZL4H 2IQ9L 1M7UA 2DY2A 5F9JB 4ADJA 4APQD 3QK0A 2Y7MA 3GZKA 4Q2ZB 1V05A 3T3PE 5DQ9A 4QXGH 5MENE 2B14A 5F72S 3MLTB 3MRLB 3DXAE 2NT1A 3V52H 1IQDA 1HNFA 2YAEA 2N7SA 1P4BH 3IDUA 4JHWL 3SEPA 3DX9A 2ZONA 2ZOUA 1EXUB 4B96A 1RMFH 5D93C 2IADB 2DL2A 2YIHA 3GSUA 3HZYA 5CBAA 3SN6N 3RIFF 2CM5A 1QNZL 5L0QB 1OB1B 4HIQA 2CDFA 5LWYH 1TVDA 1DVXA 2PLTA 1XGUB 2IANA 5KW9H 2RGSA 4YGVB 5DZ9A 2X3BA 3IDXH 4HSCX 4KWUA 1KXQA 4QNPE 5JQIB 2JXMB 1BVNT 3BPOB 1WZMA 4FAAB 3AS3A 4MMXA 4M5ZH 3GK8H 1A4JB 2GY5A 4J28A 4Q74A 2XXCB 5J9PB 1ET7A 3VXOA 1X7QA 4NO5A 4XN5A 2X42A 5EO1A 4WI0A 1KTDB 3ZRFC 4PR5A 1KLFB 3ZN6A 4W9IC 4KJYA 5FGBC 1OAKH 2GI0A 5M94B 1NMAH 4WUUE 2Y72A 4R5XA 2CLZA 3MROB 4HIJA 3MUHL 5IFHL 4K9EH 4OGQC 2X0UA 2VAAB 4ZRGA 2Q87A 3GS0A 3UTOA 2SEBA 4AT6A 2L7UA 5IROA 3APNA 4APXA 4X7SL 2ATPA 1B90A 3KPSE 3WFEL 2VT0A 4IGBC 4U1NB 1VGEH 1YNTA 4E68A 3RVUC 4MA1B 4Q9QL 1FG2A 3WEOA 2WBWB 2YOCA 3QIBB 5FUOL 1UXMA 2V2TA 4L9LC 1FNSL 2DQUL 1KCRL 3QRBA 4HUNB 4TNGA 5E51A 2ZE0A 3S3DB 3WKMH 3G5XB 4J4PC 1EZUA 5DVLA 1E4WL 2AQQA 4G7YH 5FFLA 3X12B 2JLLA 4Z7VF 1TTAA 1A6UL 2CUAA 4H44C 1AKJA 4LGPB 3F85A 1MI5D 2EINB 1A7RL 1IM9D 2XFGB 1CL7I 4F92B 2FJHB 3OKLA 4S1QH 1XCQA 2QQNL 1G7PB 3HFMH 1OP5K 1ILUA 1W16A 3QAZC 2IPTH 1IGYA 2IALA 2WQAA 3U30B 3VFNA 3F7YB 3U6RA 4CGUB 5BRPA 2G0LA 1E65A 4NQVB 4GFTB 3VU2A 2WXFA 2FD6H 1NCHA 3FQUB 5BJTA 4UAOC 3UZEA 3WS6C 5IOPB 1GVIA 3MBED 4P3CL 3SE9H 3LIUA 3LN4A 2V2XA 2BZDA 1KG0B 4F2EA 1U91A 4XVOA 3RE0A 5IQ9B 4R97B 3RIFK 4J3OH 2VABB 3E2HB 3NCXA 5E6ID 3K3QA 3VFSA 2FX8H 4PJFA 2HPOA 4Y2DA 2EDRA 1AZVA 3L5WA 2ZX9A 4R0LB 5C7XL 3V5KB 4YDIL 1NAKL 3L4ZA 1PGRB 3CC5A 3QIWB 2CDEA 3O6LL 4H1LH 3EHBD 3JYCA 3OLIA 4KXDA 5EC2B 3BP6B 2MRYA 4A2LA 1KGYE 2EKSA 1ACYH 4GKZA 2Q20A 1GGIH 2ZWLT 4GQ9H 3DARA 4DKFH 4FQ2H 1W0VB 2IGFL 3AGWA 3LZPA 5B3JF 4JO3L 3V4LA 3MBWB 4GBXA 2AVGA 4PGBA 4UM9A 5IF0A 4KZEH 3OGCA 2BY1A 3BP4B 1BYPA 3ILQC 3V0IA 4XC3L 5JW4R 5BZDB 5T33L 2ARJB 3FFDA 5K93A 1I7TB 3MRIA 3CTTA 4HALA 3HG1A 4I1NB 5MEND 4RSVA 1ZVYA 3LCYA 3BQUB 4Y5YA 1XF3A 2ZJSL 1QRNA 3I9IA 1LWJA 3KPMB 3ABMB 5EZLA 4ESKA 1QZ1A 2CDGA 4BH7B 2IMNA 2D8KA 2UY7A 4BE5A 4LZKA 3UGUA 4LPWA 3JUZA 3K7UA 3QUYB 1INDL 5D2LB 4L48A 5KG9B 4V2BA 4NNXB 4OZHA 2EC9U 3ZPDA 5CD5C 2EDMA 4QHNA 3BJLA 1XGQA 3BSZA 1G9MC 3NK4A 2BX5A 4JVPA 5GS0C 5K9KA 2J72A 2J7LA 3AY2A 4M93B 4L3EE 4RMVA 4A6YA 4OI7A 1K8IB 3MRHA 3MRQB 1G7JB 3DV4B 5BXFA 1E6JH 2Q5BA 5HHMD 2AP2A 4WDIA 5LBGA 2WOYA 4RZCA 2QADB 4UT6A 4ZO9A 5D1QA 2A9DA 3HRZA 4OCXL 4XVUD 4NM8L 2C4FT 3P30H 2YJQA 2ZKWA 3CFJB 4Y19E 4AL8C 5I2IB 4JW3A 5GXBB 4FNTA 4X7FC 4R7NB 3OWRA 1K2DA 5AEAA 3AQYA 1CO1A 5E8DL 5L88L 2PO6A 3D0LB 3GRWH 3L5XH 1SLWA 1KCVH 4FULA 1HEZB 2F8VA 4B9ZA 5J5EA 3GJFB 1Z6JT 2BXYA 2YWYA 2G5BA 3B8YA 3KPSD 4I4WB 2R4RL 4E0RB 2G60H 5T8IA 1PJ9A 1A64A 2W95A 4ZZKA 2EUXA 3U1PA 2J2ZA 3IFOA 5ACZB 2WGXA 5I8KH 2WYIA 1YECL 2CR3A 2FEEI 1KB5A 4GQQA 4GAGL 3O2VL 1KTJA 4AQ1B 3KPPB 4TUKL 1FAKT 1ZIBA 3SGJC 5EPMB 2QMKA 5H35B 2QFRA 4NI3A 3B2MA 2Y06L 4WW1A 4X6CF 1D6VL 5HDQL 3B9KD 4UZSA 3S34H 3BE1L 3AY4C 3QFJA 4PJEE 2P47B 3BZEA 3CMGA 4PJ7B 1JZ2A 5DJ0A 4ZFFB 3BUTA 5HGBA 1R4XA 5HJ3B 3SY0A 3DDFA 5DJ2B 1U3HB 1JNLH 1U8MB 2C9RA 3WFHB 4IDJH 3B7RL 3PL6D 4JFPA 1OVZA 1SYSB 2PW2A 5F9OH 3NJMA 1JHKH 5B1JC 1KBPA 4WKZB 3L1OL 3ULVC 2P7TA 4ZQKA 1RAMA 1WICA 1CD1A 1WZ1H 3W5MA 3HBPA 4ICWA 4GW5A 1PDKB 3FFCE 1R3IH 3HC3H 4NUQA 4ZPVA 3VGFA 4WGKA 5DUJA 4D7BA 2YD0A 4Z7AA 4Z7UF 1YQVL 2BSED 1Y18A 4JZNA 4NKOA 4A2FA 1I53A 1R5VB 2O5ZH 2ZCLL 3GMPB 1DUZB 4QHMA 1QW8A 3QUXA 4XCYA 4GLRI 4WU7A 2FGWH 3ULUH 2AQTA 5J13B 2BJMH 2GPZA 1NM4A 5A2BA 1OCWL 3HZKB 2Y2TA 4QOKB 5CCGE 4F27A 1RP8A 3BSZL 3GXPA 2NY0C 3QCVH 3CG8A 4JDVB 4ORGB 1KFAL 4V11A 2UV3A 4UBDC 2EIBA 4PRPB 4A6YL 2BSDA 1QSEA 3JYBA 5DT1L 4IRZA 1NLDH 2JH2A 4KMLB 3QDJE 2E8YA 3C09C 2E0PA 4UT6L 4W9LC 2DQMA 4WO4B 3IKCA 4ZW7A 2BCKA 4JQXC 2ZTBA 5AOKA 1C5DA 1W80A 1A6ZB 3SD5A 4HSAC 2A83B 3GNML 4LSQL 3D87B 4I0CC 1UB6A 1YY9D 5CAYB 5LGKA 5DRNB 5A16A 1SMAA 1MELA 1RIUL 3OC5A 2VMCA 3OXSB 4J27A 4ODHL 3RX9A 3KYMB 4JR9H 2XZCH 3EFDH 3L2MA 2XBZA 4OVVA 4Y4HC 2ZUSA 2WMPA 3JWOL 2VR5A 4RX4D 5DHVB 3ARDC 5DUMH 3NCFB 3FUEA 2R0KL 4PG9B 5L2KA 4YSRA 5TFSL 3MA7A 4PRBA 3RIAF 1T66D 2MQ3A 1KB5L 3NJNA 4HUWA 4XCFH 5F8QC 4RCAA 1A7OL 2B77A 4QKXB 1NBCA 3DPBB 3L3KA 1IGML 3MUJA 3O6KH 3P11H 4L3ED 1AHWC 1HWGB 2F7RA 2QEJA 3MLUH 2ICWJ 4GSRA 1CGSL 1KEGL 1J8RA 1QNIA 1P5VA 2CALA 4GKSA 3NH7H 5IB4A 1CIUA 2VC2H 4N24A 3ARBD 5JHAA 3BFOA 1NPJA 3VAEA 3VI4F 4LF3A 4PD4K 3VXMB 2L04A 1NIEA 3DBXA 3DJRA 3KBHE 4HT1H 4YDKL 5IB2B 1NCCH 5LVEA 3MLXL 4Y19D 3ZQ9A 4DAGL 2IWGA 4F8NA 1I85C 3CH8A 4RGNC 3O81A 4MJ4A 5LBSL 4ETYA 2EECA 2VQUA 3M17A 5DQDH 5IHUH 2NY7L 4JJ5A 3FB6A 1CLCA 3ZDZF 3FN9A 3GT6A 1SBSL 2A9ML 3GF8A 2VL5B 3HCVB 1OTUC 4HU2A 3I9AA 3KL0A 3DGGA 4UOW0 3ZE2F 4X7EC 1RPUA 1G7HA 3FSZA 5GJSH 2H7WA 5E2UL 1KDIA 2PR9A 5KS9A 3T5WA 4YHYB 4OFYD 3MREB 3DI3B 4NC1C 4TRPL 4MJ6B 3RWHA 2EDQA 3HMXH 1Q9LB 3LOWA 3W9EB 2YMOA 1KLGA 2DI9A 4XXDB 1ACCA 5TH2A 1TCRB 2B16A 3O6FA 1ZVSA 1MAMH 2PYEA 2WVSA 3GKWH 1RZFH 2DTML 3K72B 3OR7B 3BKYH 4OCYL 3TV3H 4FD0A 1E2ZA 1D7BA 2DF3A 4KNUA 4IBWA 4WFHE 1MIEH 4RFOL 2DD8L 2EDEA 4IRZL 5FHBH 4GT0A 3QG7L 1UWEH 1R6VA 5D9SB 2VQ1B 4U33A 4M3JA 4MXVE 4BUQA 1AFVH 4HH9A 4U6YB 2H0PA 1JNJA 3NP3A 3DUUA 1G1YA 4BQ8A 2VW7A 3SDXF 1RL1A 1JS4A 1SZNA 2CBOA 3ABLB 2YS4A 3WHXB 2AK4D 3RBSA 3ULSB 3RP1A 4PY8I 2VOTA 3OMNB 3V5DB 5MEOA 3WJLC 3GIZL 5I73B 1S8DA 1S7UB 1OSPH 2EXWD 3KPQB 1KTLB 2C4FU 3K6FA 3HNSL 4GS7B 5K9OB 4UDTB 5IEHB 1T1WA 3SJVB 4DEUA 3VD0A 1SPDA 4PJBA 1JI2A 2ZOLA 3MO1B 4MWFA 4ZOEA 3QCTH 3NEOA 4FQHA 4OGYL 4FL4B 5DMGD 3IJYB 3DOHA 2YC1A 4PJXA 5J1TC 3S97C 2QQLL 4OLZL 2C3XA 2PXYC 3QA3A 5HDOA 1XXDC 3WGVB 1A3ZA 1WTLA 4JZJB 2CJUH 4LHUA 4L2LA 4NFCA 2F9BT 3NFPB 3VWJD 2MMXA 4U49A 2JI1A 5HYQA 3VFMA 2QVKA 4PWHA 4MQ7B 1P5UA 1CBVH 1UZ6F 3BZ4B 5F6IC 2DYPD 3QYNA 3EYUH 1RJCA 2GAZB 3QDJD 3IVKA 1DBJL 3EYQD 3KDPB 4LOVA 4RAUA 5C9JA 5D70H 4LP5A 3UTSE 4F5CA 3JWNE 1KOAA 4TPRL 3EBIA 4RMUA 1YY8A 3H9SB 1KWGA 3H6JA 5T5FL 3VSVA 4CU6A 3NEXA 3RTQD 4ABWA 4GJTB 4XPHH 5KVGE 1HHJA 1PZDA 1UEMA 3Q13A 5DJZB 3ZL1A 2P8LA 4QXTB 1VF5C 4WV1A 4D9LH 2BVQA 5FYJH 2OKMA 3EBHA 4L4TB 4ZXBC 5B8CB 5C1MB 4EN3A 4JPVH 1AI1H 2V3FA 4IMKA 2G3NA 3P3TA 3S98A 5IR1A 3MNZA 4L8DA 4ZMQA 5FUZH 5DWUL 5BV7C 5HGGS 1MREH 1TTBA 3R06A 4Z8FH 1PIFA 1WISA 4QRRB 3SGKA 3PJSA 1QYGL 3B5HA 5DJ8B 5EBLA 2C5DC 4Z3HA 3E6FA 4MMZB 5GS2D 4MKMA 4HCRH 1XF4B 4XN9A 3VFOA 2BMKB 4X5LA 3ARWA 4ENEC 2DWXA 4DP2X 5KYWB 4HCIA 1EWHA 2VLRB 1JCVA 5F1NB 3VGAC 3ZKQD 5C0BE 5I28A 2QGDA 3HFFA 3FTSA 2K3HA 4NGHL 4FTVB 2ZUQB 5GISL 5G5DA 4J6RL 4JE4B 1OCCB 2CCWA 1JK8B 3CGTA 5AVZB 5SWSE 4D0DA 3B2DC 4LNRA 2CXGA 3ZQXA 3VD3A 2IAMC 2V5SA 4AXWB 5DDHB 4MB5A 4XODA 2OMYB 4MDJB 4MA7L 3D18B 3GHEH 1BPLB 2PPDA 2HCZX 5FW8A 2ORBH 32C2A 4NQCE 4P46B 3MTRA 1NGQL 1FL5B 2WKOF 5GGRB 3R8BB 1S9VA 3CN3A 3FQTA 3RUGF 4B5EA 4KAQH 5T5NG 4APQC 3TIEB 5FW6A 1E4XI 1A4KA 4TV3A 3C60A 3NEEA 4ODSH 5CEZD 1A6WL 2VXUH 1TZIB 5C92A 3SBPA 5J56B 1DQKA 1NZRA 4QGTA 1WGVA 5TGBB 2X53A 2G3XA 4Y9CA 3WXVL 1BJ1J 1U8LA 1JPFA 3H55A 4FMVA 5DUBA 1D5ZB 2WBJC 3DTXB 3FN3A 3ESPA 1D2OA 2ZF8A 3L7FB 3PUUA 1ZGLA 3GMLB 1RUPL 5IVXE 1HSBB 3D4YA 4H40A 4OJEH 3OJDB 1VACA 3L3IA 4UV4H 2J8UF 2DQIH 3A0OA 4JG1H 1YEGL 3CPUA 3GBNL 3T0EC 1PLGL 3I02A 4M6AA 4ODXA 1F3JB 3C6SA 3TO4C 3PJNA 1NGYA 3P3SA 5E5MA 4U6XB 2KHAA 2NNAA 2WNKA 4JHBA 4WJG3 2F7QA 4Q97A 1FZKA 2JCWA 1X5JA 3F05A 3QG6A 4DP5X 3H0TA 3L4VA 5ABZA 3U4EB 4U6TA 1EFQA 2L4OA 3UBXA 2VDPH 4DVBB 3NACH 3M1BA 1JNNL 3KNBA 3GSRB 1U30A 4OIAA 4DERA 1T03L 2WCPA 3S5LA 1Q0YH 2VQTA 3CVIH 3EG9A 3T77A 4XPAL 4Z3IA 5D7SL 3IPEA 1MQKL 3ESOA 1INQB 1UCTA 2VKXA 5AKTA 1IUZA 1S7XA 3MCKA 1AGEB 5DJ6A 3ZBMA 5E8PA 3CXHK 3HNTH 4ZSOB 2XZZA 3MX0B 5IQOA 5DRZA 4NUJB 3VE0A 3QS3A 1L6XA 4P23C 2ADJB 2PWGA 5EORH 4DZBA 3U0TB 2OX5B 2Q7YB 5EA0L 4ALAC 5F3FA 4X99B 4NZTL 4IOFC 1E5UI 2CO4A 1KJ2A 3FUKA 3DETD 1CG9B 3D25B 1GTFA 1F1AA 1HH9A 2EXYD 1CTNA 4GXUM 1CXLA 4FXGC 4LP4A 2FJFB 4GRWF 2NZ1A 4IBZA 1ID5I 5EBMB 4K3JH 3U4BL 2A74B 4BDVA 5I19H 2XQ0A 5ID0B 3NIGF 2QMJA 3RPIB 1I1YB 3NSJA 4P5TD 5D96B 5IIEA 5K59F 1BF2A 4HUVB 1SJVA 5C86A 5AVWB 4FKKA 1UKSA 3FT4B 5EUOE 2CK0L 3P9MB 4K3EH 3GEWB 4BUGA 1JHTA 2B1AH 2VUKA 3FRPB 3QJFB 3EYOB 1S9YA 1F4AA 2EEFA 4ZS7L 5DJCA 2HJLB 5C0EB 1MCOL 1QLFB 2ZSWB 4PS7A 1MIMH 1U8QA 5E6IC 1A9EB 1DBAL 1A6AA 1FH5L 2NTFB 2XWTB 5JPMB 1N0XL 4KHTL 1A6TB 2JJUA 3HPJB 1G7LA 5AW8B 2H9GB 3NPZB 4K3GA 4BSVA 3EHBC 1AGBA 4XP6L 1NL0L 5SWSD 2W81C 2VIRB 2ZOKA 4L9DA 4LDLB 1HHKA 3INUH 1S4IA 1DN2A 3GMQB 3KBFA 4TQIA 4NQCD 5E56A 3WD5L 1BX2B 1U8HB 2PCYA 1SNRA 1YMHB 4PRNB 4EI6B 1Z5LA 2JIXB 3IS0X 3WIIL 3MRMA 2P1YA 3JWDH 2QDWA 3ROLA 1FGNL 2FIKB 2CGZA 4N3TA 2CRMA 2HA1A 4I0PB 5B39A 5AVRB 1HDMB 3UTPE 2KZ1B 2PKDA 1FFQA 2H5UA 1SHSA 5CJQH 5CSGA 3S5YA 1OAUH 1T21B 1HE8A 1CFQB 3C5JB 4HKBB 4LHUG 2W8CA 4LPVA 4N2EA 4YXKH 4F33A 1TU2A 3L3JA 1TMQA 4UV7H 3UERA 5IB3A 1GGBH 1KELL 2GIMA 1XV8A 3KHQA 3FQ2A 3OXRB 3BMVA 2X2YA 3ARVA 3BUBA 2CQVA 3NABL 4P2QD 5I75C 2G75B 2D9CA 4BA0A 2QSCL 5L8KB 1AYOA 3EOYG 3S9DB 4LPTA 2P24A 3L6FA 1CFVH 2R2BA 4FLOA 2DQCL 4KXBA 2JKIS 1AGCB 1HQ4B 4I2XB 3DX8A 4JL1A 2XJKA 3X3FL 3EOAB 3CX2A 2DOCA 4XAWL 3RU8H 4I9WE 4UU9A 1AGFA 3BGMA 2LAAA 4HAGA 3B56A 4N2OA 4JUTA 1AQKL 4XVUC 3V5HB 4AGPA 2L7QA 3OHXB 4XMTA 2HB0A 1PYWB 3BAEL 3VVVA 2CLRA 3RFRA 2D03H 2VSKB 4B9FA 4RFEB 4KXZI 4L4VB 4NIKB 3AS2A 2XN0A 4K94H 1A25A 2ICWA 3ZKND 4XOAA 4HIIA 4R26H 2Q1EA 4KRPB 1GKOA 3K6NA 4W9KC 4LIQE 1T2QL 5E2WL 1UZGA 1BF8A 1OAZL 2E75C 1KXVC 3IMSA 3RHWF 2EICA 2HMIC 4QLWA 4N2CA 3OQ3B 1F58L 3R19A 1E27B 1HNGA 1PQZB 1WC7A 4L37B 1E4JA 2W65B 5ADPL 3LIZH 3HBZA 3HC0A 4N5ED 3P0VL 3MFGB 3GMMB 3B9AA 2Q7NA 2DQTH 3Q01A 4TVPH 3D4ZA 5DJYB 5IVZB 3US9A 5B38A 4JFQB 3FRUB 4ZUSA 3VXTB 2R4SH 4HX1B 1OP5H 4M48H 1JDCA 2WP3O 1T5WB 5DZAA 1A1MA 2JCCF 3B9KC 4G6JL 2WO4A 4JRYB 3U9WA 4JHUA 1GGCL 4ODTL 3O0LA 4O9HL 3P4LA 3KW8A 1VEMA 3I50L 2ZCZA 3L9YA 1GPOH 3MODL 4WWOA 3LNDA 3RGVD 5DS8A 4NLHA 4PMEA 2OYKA 3LD8C 3CPLB 4OZHF 5TE7L 3QWRD 4FJ6A 3AG1B 4BK5C 1D5RA 5CEZL 1A4CA 4LVHB 5KOMC 2PTTA 4HF5L 2WVTA 4IYKA 2DQFB 2ROXA 1NC2B 4QXWA 5JZ7D 3S35X 5E1IA 3O4LA 4H1LB 4HFUH 4YHLL 4UYPA 5E6UB 5B3SB 5AFAA 3KGTA 3O3EB 4MD4A 3IJEB 4U1SA 3T6XA 1CDBA 1LDSA 4M8QA 2E6PA 1NBQA 2RHEA 1MNUH 1JRHH 5D2LE 3K1DA 5HI3C 2UWEA 4CN1A 2VNCA 5KUMA 3SBWA 1WD9A 5K39B 1AE6L 1EDQA 2XWBA 4X9IA 4D94A 1OWWA 4FA7B 1E28B 4L5FH 3NDYE 2A6KA 2VDLB 3HHMA 5FIEA 4YR6A 4G5ZL 4AWJC 1DQJB 3V95A 2H6OA 3RWJB 4GLRH 1J5OH 3TN0A 3LNGA 3O9WB 1IFHL 3DUSA 4X6EB 1BZDA 4OCSH 1PS3A 1A7PL 2HVKA 3S5LG 3ZW3A 3TU6A 1JE6A 3DX3A 5C6WH 2X44D 3GMNA 3V6ZA 4Y1AB 4AGMA 3UTPD 3CX5J 2XYBA 1JAEA 2HUEA 3HUJB 1FIGH 3RHWK 1TLKA 3QEUB 2OMTB 2LLNA 5T1KA 1AGDB 3L95B 5IG7B 5LCVH 1ACZA 2UXVA 4XHQA 2R0ZH 3CV5A 4X4XA 5ENWB 1YN7B 4R2GC 4OUOA 2XNAA 3APFA 3QQNA 1LEKA 1U0QA 2VXQH 3EYSH 3LEYL 5GGQH 2UZPA 4HMCA 3AUVA 3K2MC 3EGXB 4XI5C 3CLEH 3F7LA 5E2JA 1MNNA 3QIBD 5IQMA 1KGJA 1T66C 3LPGA 1UOWA 1SY6H 2Z3FA 2Y07L 3FO2B 3CHRA 1YPZF 5JNYA 4H26B 1G7IB 4B9KC 2DQDH 4I9WD 4MNGA 2X9WA 3ARBC 4LEOB 1SEBA 1S7TA 5LXGH 3TYGH 3V4VL 1VA9A 1NDGA 4OD2A 5BQDA 2MQ0A 4ES9A 4BZ1L 3TF7C 4NUMA 5KEZA 2XTJB 1F13A 5IM7B 2WLLA 1Z7JA 2BRQA 3TCXA 4N2KA 1E3XA 3CHXA 4UANA 5E2VL 4JFZL 3FB5B 2Z31D 3F62A 4EIUA 5DK2B 6PAZA 3VTAA 5F7LB 1KXQE 3P2TA 2OSXA 3F64A 1JFQL 3KVQA 1H3GA 2CRYA 1XTLA 4Y4FB 5D1ZB 3V0DA 5DA4A 1JGEB 4F93B 1AC6A 3LZLA 4D9QD 2HRLA 3NJGA 3KYOA 5CN3A 4NRYB 2AFNA 3FJTA 5I8OL 2NSMA 4KY1L 5HI4D 4AQZA 1QBMH 4LQFH 5ETUA 4F7EA 4MAZA 2IDQA 5EO0A 4ZUUA 3K8LA 5KJRL 4M6OL 3IXAB 4NO2B 2WQRA 4QOKE 3V7AG 1OL0A 4WO0A 2WZ5A 4ZFGL 1FSKC 2M83A 4H25A 2WIIB 1I9JL 5D4HA 1OGSA 5K9JH 4PRPE 1C5BH 2M26A 2O61B 2QPFA 3UC2A 2FYYB 2Z7YA 4ZI8A 4IW4C 1RZJH 2HX7A 1P9MC 4N2BA 4EUPG 3IE4A 4JQIA 1DZ0A 5I8EB 2B1OA 4YOKA 5DVPA 5I6MA 3PRZA 2WB7A 3GEFA 1ONQB 1N6VA 2CAKA 2GUOB 4IU2B 3OQRA 2XTLA 4Q6IB 4HHAB 1QQDB 2H26B 2WCGA 5DA0B 2HLAB 5T3XH 3UADA 1EMTH 4P8QA 2OYMA 3FXIC 3QORC 3H7BB 1DVZA 4AVJA 5AWNL 3HA0A 3UTQA 3ZT7A 2IADA 3A4DA 4LL1A 3QDMB 1UGNA 3DHPA 5EF0A 5DMGC 5LN8A 1RK1A 1BFOB 2FECL 2HVJB 4HEPG 4OJAA 2E59A 2V17L 5CZXD 4S1DD 4Z76A 5KBKA 5ILTH 1NUNB 5AKSA 4JHAH 4OZGA 3D2UA 3RA7L 1A3QA 2R29L 3KGSA 2DQJL 1BZ7A 5GGVL 1DL7H 4JG5A 1DZBA 1NBVL 4OJCA 4F2MB 4ES8A 4U0RB 2HFGL 1I4FB 4HISA 1NUDA 1IAIL 1E9OB 3QHFL 2AEPL 3WNKA 3WUWB 5L2JB 3H9HA 2D7OA 2VDQL 5E1HB 5FYKL 5LQBL 5EB9A 3HS0B 1RZGA 2QADD 2W07B 2HYMA 3VXME 1XR9A 4KROC 4MX7B 5CFHA 1E43A 4QYAA 4U2ZA 4HGKC 4QCIA 3P4MA 4QRQA 3RVVD 3O2WL 4JREC 1YYLL 3Q8EA 4JFFB 5F7EL 4UINH 3Q48A 1QWNA 1JZIA 4FFYH 4WUKL 1MFCH 5HVGB 1JPSL 1I3RA 1R19A 3QNYA 4AEIL 3IETA 2RCSH 5ELIA 4NKDB 5LLIC 3FSAA 2WUBH 2AK1H 4NHUB 1CFBA 1BJMA 2H3NA 3QIBA 1CU4H 3FDWA 5EIIA 1HL9A 2FATH 3VQMA 3OMAB 4S2SB 5KSVA 5KYYB 3TZVB 2GK0B 2X4RA 3GXIA 1EFXA 1PIGA 2QGCA 3WEBA 3SPCA 1NCBL 3U6XA 4NZRH 2EYTA 4M1GL 2EDNA 2K1MA 3EO0B 3VO0A 5DMKB 1JPTH 1MRCH 4A66A 2KYIA 3S7GA 4NP4L 3G3LA 2VR7A 1DDTA 1G7PA 1L0XA 4LL9A 1OK8A 1ULVA 2Y7OA 2RR3A 3N1PC 3Q0HA 1QRNE 2FQFA 2OXGB 2JKXA 3FQWA 1GA2A 3GO1L 4NPYB 5AOJA 2HFEA 4PJXF 4JQIL 3HLAB 3FQUA 3V9FA 4HIXH 4V1DB 5D7LB 3D0VA 5IOPA 1L6PA 4W6WB 5DYOA 2C1OA 1GZHC 4XX1G 1CLOL 4HJ0D 1ZAGA 3ULAB 4AJWA 2YQ3A 4K71B 2TSAA 3TFBA 4F8TA 4YDNA 2NDGA 4K8RD 4PJGA 5D1XA 2WAHA 4NM4H 2IVFC 3G6AA 3SJVE 1KDJA 5CNHA 3TBSA 5CJ5A 5KTEL 3CLFL 3C87A 3BEWB 4P4KC 4W9DC 4AMKH 1IGCL 3PY9A 3QE5A 3TCLB 1SFDA 5SX4H 1LL1A 2XVLA 3IS1X 3QIWA 1AO7B 1E4KC 5D1QE 1QKZH 5EOQL 5ICYB 3V4UL 3CK0H 4MSWA 4ZPTB 2YZ1A 2YPLB 5SX5K 2A4ZA 4GG8B 4JFDA 4JG0H 4QOKD 1P7QB 4PBXA 3F6LA 4QRPB 2X7LB 3UDWA 1QSFA 2VDKL 4YL4A 4HCGA 4QGYA 1KBKA 4FDWA 4FNSA 4PRPD 1W0VA 1FL6A 1HYSD 5TPWH 2NQCA 5JDSA 4OUUB 4HS6B 3ZKXB 3AM8C 4E5XB 5AZEH 3GC3A 5KYUB 2F0CA 1D5IH 4L18A 1EEYB 5BZDA 4AUUA 3IFNH 1DE4A 1WCBA 2HX8A 2OZNA 4UMSA 2XPZA 5K33A 5L9DH 3ASWA 4GP4B 3SQOL 2BHZA 2FJUB 3CN1A 3LXUX 3A6CH 3BQUA 1Z2KA 1NOAA 1TPXC 2VGLM 4XNYH 4PGEB 3DROB 4XC1L 4U1JB 2N7AA 3TJEH 1ASOA 3II3A 4E5XG 1YC7A 4UTBA 5HYJE 4JGMA 3MLZL 4L4TE 3VRJA 3QUYA 3UBHA 1UXWB 4GY4A 5JHMA 3JV6A 3CFMA 5DVMA 4X6DB 4LLDA 2VR8A 3D4CA 2Q86B 3N1GC 1HH6B 5DZLA 5ECGA 3MRCB 1JL8A 4PP1D 1G6VK 2XKUA 4PUBH 4KHXH 4MRBA 4HWEH 3ILEA 1NKRA 4KZCA 3MRQA 2L7JA 3C5ZA 3VRLF 4H88L 3GMOA 3AWGA 2H8PB 2XV3A 2Y25A 1OOWA 3GZPA 2EDWA 3G6JB 5C0CE 4CSSA 4TULL 2WWKT 3NPSB 2R1XA 2DM7A 2FR4B 4PJ5E 1O75A 1W6WA 3JWNC 4YHKL 3N85H 2XXGA 3VXMD 4A63A 3GLEA 5DD0L 1LEGB 4MZ2A 4FTVE 4X5WB 3MV11 12E8H 3BOVA 2IH9A 2H6PA 1QAWA 2YMXH 3SDYH 1IGIH 5F0JB 1PX8A 2X6AA 4XVTH 3BPNB 2LU3A 3PDGA 1NA8A 3SOBH 1ZK9A 5JQ6H 3QJXA 4U1GB 2G5RA 5HHXL 3E8UH 3BN3B 2VZSA 1D5XB 1WRFA 3MZGB 1QSEE 4JRXE 2IH3A 1O6SA 3FPXA 3NIDF 2WUCL 4FI8A 1FVDB 4EDXA 3NIFE 4RIRB 1EJOL 3KPPA 5CP3A 3EDEA 1QHPA 1FGVL 4AY0A 3BISA 1ADWA 1I8IB 3QPKA 1QFPA 1U8IA 2DH2A 2X4NB 4I77L 4AM0Q 4TVUA 3U9PH 3QHZL 5IZ7A 1CVRA 4PGZA 1NTDA 2BM3A 2CU9A 2F08A 5I0VA 4AMWA 1XZ0B 1XT5A 1I1AB 4QMEA 1CC3A 1U3HA 1JV5A 2ITFA 2YK1L 3UO1H 5CLYA 2OSLA 3SZKC 4PGCB 4BZYA 2W1NA 1CLYH 1NBYB 1BVZA 4I3GA 1O5DT 3GJEB 1HOCB 4G70B 2AAAA 5JW5B 3TO2B 2K8QA 3PV6A 2N1TE 3QEHA 3MCG1 4M7JL 5I1CL 5IV2B 3MJGX 4XZUB 3MPCA 3BUYB 3UPCA 4GAYB 4XPBL 1MUJA 2CKBH 4QRTA 2B3RA 4LSTH 2CE6A 2WVUA 5CHNA 3SJVD 4WI3A 2X10A 1F00I 4IIQB 5AD0B 1ZLSH 2F8OA 4JFOB 1WT5C 1EZVX 4G2AA 1G7QA 3GINA 3FONB 4JO2L 4DQOL 4ETQB 4WU5A 5IBTL 4Y8DC 3CDZA 1Z9SA 3B2XA 3D08A 5E1AA 2NPLX 2R2EB 2VISB 3GYRA 3L9EA 4ZSOE 1E8XA 1J10A 1E6OL 2ZWZA 3TT3H 1MHHB 1F4YH 3D06A 3EOBA 2ZIDA 4WO4A 2MNJB 4OD1L 4DKEH 1QFWI 2VDPB 3MYJA 2KQNA 2GBAA 3MGTA 1TSHA 3FB8A 3NAAH 4KKPA 4UUJB 5HHOB 5KS9E 3K5SA 5BUAA 1HXMA 3BD5A 4LASH 5JPNA 3H9SD 2NUPB 3ZYOA 2M1KA 2IXQA 5FCUL 2F54B 4HUXA 2Y3AA 5DMIH 3WXWH 3ZDXB 4A68A 4V2CB 1W9XA 5CCJA 1KCUL 2RBLA 1T2XA 3JTBA 3ULVH 1O6TA 1UZ8A 1M7IB 5CZKA 2XXFA 1NFDB 3DDGA 3LHPL 4XNUH 5HYJD 2LVCA 4L4TD 2OQJA 2PYFA 1AJ7L 1AQMA 3NA9L 4B9PA 2GIYA 3WE6A 4Y5VB 3RL2A 4XPTH 1KJMA 3IGAB 4HKZA 4KKZA 4QRRD 2YAHA 3DPBA 3PAUA 5CZVH 3H53A 1GOFA 2QL1A 1AG6A 4QYOB 5AUMA 3LPFA 2F8XC 1L7IH 2BSTB 2DMBA 1TFPA 4JE0A 3TOPA 2CGRH 5CJOH 5KSUB 1H8NA 1BGXL 2JWYA 5E08L 2ZXGA 5C0CD 4N5EC 2VLRD 4Z1PA 2KQMA 5IB2A 2OL3A 4FC3E 3BAIA 4JQVC 4QJ5B 2DLTA 3TBYA 3L3HA 1PZ3A 1UA6H 1CE6A 2ZOTA 1ASPA 35C8L 3GRBA 3VSTA 3ZHLA 1YEDA 3F8UB 5KSBB 2NMSA 4FTVD 4PJBE 2I07A 1OM3L 5ANMA 1DJSA 3RVWC 2CMRL 1QI5A 4MAYB 1T83C 5F96L 4DP7X 3K6SA 3DGCR 5ACMA 5B1KA 4DCQB 1IC1A 2O6EA 3MUGB 3LN5B 1RJYB 3R7QA 3G9AB 4P46D 3S48A 1YEWA 5H94B 4EQ3A 4L8BA 5E8EB 1Q9LA 4HJ1A 1KCSL 4PW3A 4K3HA 4UZGA 1KTRL 3ES6A 2AGJH 5FYKU 1DP0A 4R8WL 5DZJA 3VFVB 5EEYA 4MB1A 4BFKA 1J0JA 43C9A 1TDQA 4F5CE 2FE0A 4P9MH 3FT3B 1ZLEA 5E4OA 3QZWG 3I84A 2PR4H 3V0VA 1T80A 2XKSA 1QA9B 4U6YA 4M3HA 4M62H 1CLZL 2YO3A 4WW2C 1HQRB 2DJMA 4HYTB 2W0PA 4EJ1C 5I76A 2A73B 3ULSA 5CM1A 1PY4A 1AH1A 1TR7A 2FX7H 2VDOH 2VLJE 3QXDB 4ZOAA 1YUKB 4IRSB 3QJVB 3V5DA 1JUFA 4I2XE 2H2PD 4N2AA 3F7QA 1G4MA 3T4AB 3W37A 2ZP8A 3MXVH 4LGRB 2EDBA 2NCEA 4QXUH 2WANA 4URTB 4XVJH 4BFGA 1RCYA 2VLLB 1HEHC 4LCYB 2FX9L 1HESA 2FYVA 1RFDH 1IKOP 4RGOH 1B9KA 3B6SB 2AERT 4GH7B 4FQIL 2NNCA 1ED3A 4ZW3A 1U8NB 2OFQA 2Z91B 4D8PA 4OZFA 1K8DB 4AG4L 3NFPA 3Q5YA 2E7LC 1ET8A 1LGVA 4WI6A 3AFLA 2F7PA 4KDTC 4BSWA 2XQBH 3EZJB 4EKJA 3JVFC 1IBZA 3K8MA 5DEGA 1J48A 1M71A 1Q1JL 5F1IA 4YHNA 2B9BA 5IQNA 3X14A 1JHLH 5EU3A 4OCWH 3ARUA 1I75A 1FNGA 3EXJA 3Q2CA 2JKJA 5C3LD 2R9HD 1X5LA 2F58H 4PYHA 3ASNB 4OZ4B 2E27L 1D9KC 2AJZB 4UAHA 1TQBB 1G1OA 4ZMLA 4C4KO 2F53A 3RGBA 2Z0UA 4LMQE 4ZFOB 5EEVA 1ML0A 4FLRA 4ONHA 1CF8H 3CDCA 3OLEA 5IHLB 3OG4B 4G9FA 1A14L 2K7QA 4QXTA 2ESVB 4PCTA 4FFZH 1QLEL 5DZPA 3MOAH 2MQCA 5ADOL 4EIZC 2FBJH 5LB1A 1KXTA 1UM6L 4NENB 2V37A 1MJ8L 3IJHB 4M6MH 2BW5A 2UWEF 4AE1A 1WEJH 2XQYK 4LCCA 5DJ8A 1FF5A 5KBDA 3SYPA 1NCOA 2CO7A 4RFNB 2A7BA 1LILA 3TYFB 4U7KA 9CGTA 4TQEL 1UOLA 2Z31C 2KI6A 1T0MA 1DLFL 3LQAC 3GSVA 4PIBA 5FGCB 1DVFB 1L3WA 1YEHH 1RK7A 1IZKA 4PJIF 5J7CC 3I9GL 5KYWA 3AGVA 3UAFA 3G5ZA 4PHZA 4X6FB 3PWJA 5DZNA 1KENH 3KLDA 1LMKA 4MA3A 2DM4A 5KANI 4R0LC 4YDVA 4M56A 2XWRA 3KG5A 4KX7A 5EZOL 3VFRA 4DK6A 3OG6B 1CF1A 3RAJH 1E8YA 4NC0B 4PRHA 4CKVX 1UD6A 4YSAA 4ZNCD 5IVNA 2A9BA 3D5OF 5F7KC 3KE0A 2ERJC 4W9HC 3B7SA 3UZQA 1J11A 4C56A 1L0PA 3ESVF 3IT8D 4G8IA 3VH8A 3HZVA 3KWWB 1S9KC 1J0HA 1NGPL 4OLWL 4HETA 3QR2A 5HDRA 4JS7A 4XCCL 1T3FA 3QJSB 5D7EA 3RVTD 4O02H 4UWQB 1ZTXH 1DUYA 5DS1A 1W2KT 1X9UA 1HZHL 2FO4A 5GGRA 3OAYK 3G9VA 1IC4H 2R0LH 5HHQA 1FYTB 3AMLA 1NWOA 4F9PA 1WIOA 3IMUA 4I0PD 5TGBA 4I3RH 4EIGB 3N1FC 4MCYB 4LLWB 5J3HC 3HUJE 5BV7H 3T71A 4ELDA 1W0YT 5BVPH 2FH6A 3PGFH 5BW7A 4NQUA 1N26A 1SN0A 3OSKA 4MJ5B 1LE9B 3KBPA 1SXBA 5JORB 2DMCA 1Q72H 2ZD0A 5CZXC 3W5NA 3RWIB 4S1DC 4QJ3B 1H5BB 1TETL 2PCPB 1F3JA 2ZXDA 2H3KA 3W39A 2X89A 5IW1A 1MFEL 2VSMB 1G6RA 1RXLA 3OLDA 3LEVH 4KKLD 1TZGL 5E94A 1GZQB 2VLJD 3RNQB 3NBNA 3GSNH 4M93C 4LOUD 1SDAB 1URZA 2PW1A 5CU9A 1YNKL 4YSQA 3US0A 2HWZH 4GI9A 3SDAA 5FF6B 3OSVA 1QZNA 1LWHA 3CMOL 3HE6C 1T1ZA 5LGJA 3JTSA 3Q6GL 1NIBA 1FQ9C 4PJ8C 2EE6A 4TUJB 2EO1A 3U4KA 4DPRA 4L8CA 1MY7A 1F11A 2IWFA 2W0LA 4X9YA 5DXWA 4KNTA 4AQEA 1ET5A 1EV2E 1C16B 1CDCA 3RVVC 3WTYA 4PTUA 2CO2A 3O8XC 1K5NA 1LM8V 1U8JB 2XTJE 5E7BA 4L4VD 1EAOA 1OAYL 1HI6B 4XP1H 5GRYA 5FOBB 1INQA 4JANA 3T2QA 2XX1A 1E2VA 2AJSH 5DFAA 2NNRA 4KRPD 4X0NA 1JWSB 1DQIA 4AQOA 1T7YA 3V7AE 4Y1SA 1X9LA 4NUJA 1KV3A 3SE3C 2QKIA 4ZTEA 1ETZA 3SPVB 1TJHL 3VX1A 4G1MB 2OX5A 4FQQA 2Y2YA 2H3XC 3HR5A 3BPCA 4F9LA 5E23A 2R0WL 4D0BB 3UTTA 1CG9A 2C1PB 4MCMA 1VLXA 4GINA 3HJEA 4H5SA 1MH5B 3F5WB 4AUYA 1BBDH 4PLJD 3KPTA 4XT1C 2YAQA 4MBOA 4UIKH 4XOCA 1GYUA 2ATAA 1RURH 4Y7OC 5EBMA 3IN0A 1IT9L 4JRYD 1C7TA 2B4CL 1OAXL 3RPIA 1M7DA 3LNIA 3MLWH 4XWGL 1NMCB 1HCFX 5GGSA 1A2YB 5AAPA 2JNZA 3X1NA 6PCYA 3FT4A 4OZGF 4PRIB 3DIDA 5JHLA 3MR9A 4UNUA 4N0UB 3TFKD 3FRPA 1ZA3A 3S8WA 1TJXA 2IQAA 3QWOB 5D55A 1TYJA 4P5KB 5FO7A 5DD1L 1EZVY 3K74B 4BCYA 5CJXA 1NC2D 3NCMA 5F1SA 2HJLA 1TQVA 4WK4B 4A2EA 5C0EA 4K8RC 4N2IA 2FNWA 2ZSWA 4J8RB 2BIHA 5EHFA 1UCBL 3QDME 4LLQB 4MMXC 3L9RB 4LBEA 4DGYH 3IGLA 2H9GA 3BN9D 5GRVL 4ALAH 5LGHH 3RI5K 4PREB 3DJTA 1X9RA 5AYTA 4YBHA 1G6RL 3AQDA 3R0NA 2X88A 3QPXH 4F2ME 4I18A 2YRLA 3SODB 2GTWA 4XO4A 2ZOWA 1HYSC 1BYOA 4KXCA 3UX9B 4RWYL 3AVEA 1UB5A 3N42B 3OC8A 4LOFA 2YAFA 5IROC 2J20A 2J1ZA 2IPKA 2JIXA 3OKKB 3WY2A 1FZMB 4HH8A 1W6LA 3O9WD 5D7JB 1OGAA 2GT9B 3LZFH 4PV9A 5DD6B 4DUVA 5F88B 1S9XA 3PQYB 1NUFA 4DQAA 3PFUA 1HDMA 2AV1A 3SPJA 4Z5RB 4U31A 4Q56A 3IMVA 4K73A 2QSVA 4JFFE 1DHKA 1SXZA 3QO0B 2P80D 1CFQA 2BOLA 4I89A 1Z0NA 4A04A 4OZFG 4HKBA 1Q90A 3C6LB 1QOKA 1RLWA 2AITA 1CT8B 2NZ9D 2AJVH 5DJXB 1PD1A 2HFFB 2A0LD 2J88H 4ZS6C 2EVGA 3NJVA 1FVEB 3L17A 3VXNA 4X9FA 2C9VA 1TO5A 4D3CH 5B21A 5LXVA 4B53A 1BECA 2E8ZA 4LCWE 4XTRC 5AVQB 4OIIH 4YLBA 3PLYA 4YHPB 2JQAA 3ARGA 3MRNB 5EC1B 3MNVA 1JMXA 1AGCA 4NWUH 4HIPA 1T6BX 1R5IB 2ADYA 2V9QA 4GMTH 1NCDH 4IOIB 4WZ9A 3BC9A 3ARZA 1MKFA 5PCYA 3UJIH 4Z9KB 4XX1E 1A5FH 1W8OA 3EDKA 5D7KE 3VVWA 1WAAE 2CHXA 5A6MA 4BRJA 2YD1A 5TE6H 2QV4A 3IU4L 3TPKA 2YD2A 3VACA 3MLRL 4QRUA 3ROOB 2Y9RT 4QXVA 3Q6FA 3VB9A 4X4YA 2XTJD 1T7XA 4Y2DC 4P2RB 3RLSA 1RZ8B 3BVTA 4DUWA 2WGNB 2OMVA 1ZV2A 5FYLE 3ATAA 1TKWB 3GLZA 1MN4A 5D1ZD 4Y4FD 4CC4A 5GIRA 2YGOA 1P2CB 2XWJA 1TEYA 2Y36L 4YDJB 5JW4Q 4JFQA 5EU6A 1HZKA 4N1EA 3ZL4L 1MEXH 5HXMA 2NQDA 2ITCB 3FT2B 1U3YA 2ZCKL 1C08B 4KTYA 2EEAA 1U58B 4NDMB 4YZFE 4JRYA 4U4IA 4QXGL 2V7HA 4XNQB 5C08B 4B97A 3GBDA 5TTRA 1VRSA 2DMGA 3H85A 2WHVA 3V52L 2WZ6A 5ICZA 4F8QA 3DJSA 5D2LF 1P4BL 2ZF9A 3MRGA 2D73A 1RMFL 1CGWA 3H9ZA 5JIIA 3SOTA 1KCLA 4KU1A 3LPOA 2WZ0A 2G0KA 4IGBB 4AQAB 1R3JA 5LWYL 4H1LA 1QUNB 3QRLA 4XCEB 4FLHA 5KW9L 1UOVA 3IDXL 2VZVA 4P2AA 4L9LB 2NSXA 3ZR5A 3F04A 3O3DA 2VMJA 4DGUA 3QDMD 1WP6A 4M5ZL 3GK8L 5SX5H 1JG9A 4FL4C 1IVLA 4UTAA 4RRPM 5FYKE 3TIDA 4UQBA 4Z7OB 1RZPA 5D1QC 1TTFA 3HRZC 5F2FA 3RZCA 1PX4A 3ARQA 5K39A 2NY5H 5C0AA 3SQBB 1HINH 2CPUA 2KT6A 4KJPC 1OAKL 2QDVA 3D39B 3UPAA 2GITB 1NMAL 3QAZB 3RWCB 4KK6D 4K9EL 4ZO6A 4N0YH 3FTVA 4BBWA 1KJVA 1NC4A 2Y6SD 3DIFB 4UAOB 4YNYB 2NUTB 5L4MA 3SE4C 3SBRA 4DGVH 4NCC2 2PO6C 1I3VA 4YIQA 2WYTA 4B95C 5GGTH 4PG2A 3T3MB 1FV1B 1JOIA 1VGEL 5J12B 1F42A 4Y1AA 1AIFA 3L1FA 3VFPA 4Z7QB 4I1RA 4HDIB 1AQDA 3FT0A 1V7MH 1KN2L 4JFFD 1P53A 3S0PA 5AZ2H 3QEQB 4XMXA 2W0KA 3D69A 1IEAB 4UYQA 3WKML 1MFAH 1R1CA 4YO0A 2WYZA 3RRQA 1YN7A 5D5MA 4PJ7F 3SDDA 3QNFA 3G5WA 1WE5A 4G7YL 3E8VA 4F58L 4DPAX 2YKLL 3RDTA 2HT3C 4YVUA 1N59B 3U2IA 1YJDC 1XHHA 4AMXA 4U6HB 3HFML 1XH0A 3NZUA 2QKSA 2BSRA 2ZCHH 5JQHC 2Z0BA 1OP3K 4TSBH 4Z78B 7FABL 4BK8A 3AREA 5J8OA 3LRSB 3ZHDA 5I17B 1UEYA 2FD6L 2O5NA 3CZGA 3N41B 3TNNB 3POCA 2OLDA 1JFHA 5C0DB 4W4OC 3ME0A 3ARFA 4QHUB 3SE9L 1UFGA 3QQXA 1JJUA 2V2WA 2R59A 2CG9X 3G5VB 3GRWA 4QLRA 4XHJD 5H37H 4F2FA 2E9WA 4OJFH 4NIYE 1XH2A 2KMWA 4YE0A 2FX8L 5KBLA 3ZLQC 4AITA 3QUXC 5GZNA 1IGFH 4V1DD 4HZLB 4TS6A 1J8KA 1XF2A 4M6NH 1MW2A 3BEVB 4FG2A 4KRLB 3VGDA 3MCYA 5FYLD 1NAMH 1ZT1B 5T1LA 4NBYB 6FABH 5KYXB 1WFMA 1M42A 3VW3H 2GG1A 4PCKA 1FYHB 1ACYL 5FOJA 4NRYA 4GQ9L 1GGIL 4JDZB 1OM9A 1BVLB 1SJEA 4DKFL 4FQ2L 2XV2A 5IMKA 3MQIA 4PJCA 3ILPB 1A3RH 1H3PH 4JDTH 4BELD 4OB5H 2H47C 2Q8BH 3VG0H 4KZEL 3IXAA 1AO7D 4X4ZA 4IDLA 4L1DA 4Q6KA 3C08H 3GJFK 5CN2A 2YPLD 1UJ3A 3TJPA 4EBQH 1P7QD 4HWZA 1JGIA 4POUB 3NZSA 2O61A 5G2NA 4N20A 4B5ZA 2XZAH 9PCYA 2YWZA 4AZ8A 1QBAA 3LPWA 3TT1H 3ESUF 5HY9A 2A1WH 1JERA 2FEDD 1FZOA 4L1LA 2BINA 2P8MA 3ZDYB 5IMMA 3C8KA 5I8EA 1NEZB 1AMYA 2CKBB 2XU9A 4YSUA 3P4OB 1BQRA 1UD3A 1KY6A 2GUOA 5FFGA 5ESQB 4E41A 1HHIA 1XGZA 5MHSE 2F54E 2BP3A 1MLCB 3U25A 1DQQA 1SDDB 2WXHA 3KPRE 3H7BA 1JZGA 2R2HB 3EFOA 3ZZ1A 1S9WB 3WIFB 4Z7WB 1GXEA 1NFDE 1WJ3A 1NEZG 3NTCH 4PU2A 5HPOA 2HVJA 1E6JL 1T5XB 2AI0H 4K7FA 4LKXA 1CDYA 2Z93A 2YHGA 4LVOC 4J23A 4KZ0A 3IKKA 3IU3B 4AEHH 1ZK5A 3DX6B 1J9SA 2FUQA 3P30L 4S0TD 4XE0A 5CIPB 2WXQA 2YJLA 3PWUB 4WI8A 3NZHL 4P2OD 3L54A 5F9WB 5TK4A 3BXNA 2IH1B 3OR6B 1CE1H 1GRWA 3WUWA 4KK8D 2DEWX 1YEIH 3AG3B 3HJ0A 1CFSA 2HKFH 4KO7A 4AH2B 3QFDB 2V3DA 2C34A 3UTZA 4EOWH 3GRWL 5GHWH 3L5XL 5J6GB 1KCVL 5AVTB 4N8VG 1HWHB 2IC2A 5D1XE 3DVGA 5D72H 3OPZH 3TC9A 2APTA 3S37X 2G60L 5KSBE 3FU7A 2F5AL 4IQHA 4N4YB 4X5QA 3BAYA 2MHAB 2BIMA 4ANKA 1B4JH 3T8MA 4ZDHB 4ISVA 5I8KL 2E86A 2OJEB 3CFKA 3CJJA 3M07A 1U9KA 3F7VB 4W81A 2BNUB 3O6FC 1V3MA 2WTRB 1QTSA 1A1OA 4JFYB 1KJ3L 1D6EA 3ATDA 4JFDE 3L5HA 1QSFE 4KV5F 1KLUA 3QJZA 4KVCH 4LU5H 3S34L 4AGLA 2Y23A 4QY8B 4EKXA 4ZNEA 3FW6A 3I75A 2Z64C 5BS0A 4S2SA 1CYXA 3TZVA 1NWPA 3E9TA 5CEYB 3C09B 3ABZA 3Q3GB 3UIYA 4AENA 1JNLL 1X7TA 4IDJL 3RFZA 2GFBA 2XIBA 1AQHA 3FU6A 2XVGA 5F9OL 1CDUA 4DP9X 1JHKL 3H6AA 4J3UA 1FZJA 1JGVH 1WZ1L 3FOLB 4D8OA 4FXKA 3QJRB 3VDBA 4OKVA 1R3IL 3HC3L 1I1AD 5JPMC 5K9QG 4KJWC 1ETJA 3DRTA 2APBA 3GXTA 5I30H 3C6EA 1DO6A 1ZHNB 2NX5B 4GI6A 2O5ZL 3RY5A 5D7LA 1MSPA 3O45A 3HMXA 3TLRA 5LDUA 3L1GA 3FCTA 1S5HB 3K0WA 4Y4HB 2A6JA 3IEAA 2FGWL 3HAEH 3ULUL 4WNQA 1TYEB 2BJML 3GSXA 4FS0A 4I88A 2Z4QA 3RVTC 2ZKHH 3GXNA 4HV8A 3QCVL 1F4HA 4HPOH 3W1ZA 3SKNA 4IRJB 4H8QA 1WQVT 2XN2A 3MJ8A 5CFAA 2E56A 1KPRA 3GB7B 1P5UC 4LAJH 4X0KB 3TCLA 4DEWA 1NLDL 2E7CA 5FWQA 3WFBH 3LB6C 1YCSA 4I0PC 3KYNB 3ZZLA 1DSFH 3DOIA 4N5UA 3NN8A 2BVPB 4MLIA 15C8H 1W72H 3NCWA 4QRPA 4NO3A 4PJAB 2Z1KA 1QVOB 3DVFA 3SDCA 4OLXH 3IDIA 2Y7SA 5GS2H 5DK0B 2R69H 4RGNB 1G9EA 2EIZA 4POZC 4RDQG 5CEXB 1IGJB 3JTTB 1JZHA 5HD8D 4ZW5A 4JR9L 2D7MA 2XZCL 3EFDL 5EUKB 4WV1C 1SN5A 1GYWA 1THCA 4PJDB 5HHOD 1KN4H 1WPCA 3MJ7B 2N0MA 4KKLC 4IMKC 5DUML 2AV7A 1ZDQA 4JCMA 4N22A 5CGTA 3AQXA 3BIBX 1U4FA 3LTVA 4MD0A 5MHSD 2F54D 1UT2A 1XF5A 4XO3A 5LJYH 1N0LA 2EYSA 4JPIA 3K6IA 3SGKC 1B2WH 2CLVA 4EI5B 4XCFL 3BAKA 1OGPA 5TQ0H 4FQCH 4XNMB 2VQ4A 1TT6A 4E9YA 5HHNB 3O6KL 5GZOA 3P11L 2UZYB 2AEQH 1MRFH 2ZUYA 4HIHB 3MLUL 2ZAHA 1AP2B 2XN9A 2OCFD 1RIVH 4X6DA 1XD0A 3NH7L 3H2QA 4L05A 2VC2L 3DRQB 3F00A 4LSVH 1Q0XH 4KRPC 4HT1L 2YD8A 1GR7A 1NCCL 1U3NA 1WBYA 1B2YA 4ZAKA 5I66A 1A4BA 5DQDL 5IHUL 3RQ3A 5FGCE 2HJKA 4PW9A 5JW4N 3LPPA 2NCMA 1P4UA 3AU1B 5G4NA 2EUZA 2AEOA 2C4XA 2FJSA 1JNHB 3VJ6A 5GJSL 1LEIA 2RA1A 3NJHA 1ES0A 4HS8H 1DJZA 1MPAH 2RAMA 4PLJC 3S3SA 3HI1B 3HMXL 4IBQA 5IFAH 3LRMA 3MV7B 5INCA 2OMWB 3BP5B 4FP8H 3EFFA 2XG4B 3OHMB 4MAYD 4NWTH 3U7YH 5D71H 1MAML 1E0OB 3ATBA 3GKWL 1RZFL 2ZPKH 3MRKA 4JBSA 3BKYL 3TNMB 1T4WA 1J8HB 2PXYB 4GI8A 5BZWA 3TV3L 1ITBB 2PPFA 4QHLA 1TJIH 3WTVA 1MIEL 1ZHLB 2YQGA 4YDMA 5FHBL 4LSPH 1UWEL 1PX3A 3TFKC 1FYTE 2GC4C 5DLLA 1HJBC 5F6IB 4Y9EA 2PUQT 1AFVL 2FL5A 2GTZA 2MKLC 4NX0A 4AIEA 5JLZA 1GY2A 1MHEA 3FHAA 1JD7A 3IJ8A 4ODVH 1NMBH 5IBUG 2WNGA 2QTVA 5IEKA 4UTCA 2R1YB 4S0HA 3BCDA 3U7WH 3SYQA 5T1MA 1OSPL 1JPGB 4PS3A 4J6IA 2LOEA 2W38A 3BN9C 4LARH 4O02B 3MNWB 1U42A 1QI4A 3IF1A 3QXVA 5AW1B 4MHHI 3FU3A 2CO6B 4PWJA 1QG3A 2PETA 3JWNH 3QCTL 4G72B 4GG6B 2Y5EA 4ZXBB 2GSGB 2P5EA 4C54A 3ZK0A 5FDYA 4IRSD 4CN4A 3OAYH 3Q7JA 2QLYA 3T0XA 3LKRB 4W9ZA 5KVGH 2WN3A 4PLNC 2AC0A 4PBVC 5BV7B 3LKSB 5I8CA 2CJUL 1UUNA 2XT1B 1J0IA 1ZHBB 3QUZA 4MNHA 3LKQB 4K3DH 3W9DA 3FMGH 1CBVL 3L4UA 4BFEA 3MFFA 4YN3A 4EIBA 3EYUL 4ZD3H 2HTLC 2UX7A 3VXPA 3LVEA 4OLYL 4UQ2A 2NR6A 1HKFA 4NSKA 3HG0A 4N2DA 3UAJD 5D70L 2FB4H 3KW7A 4PQXA 2R2EA 3OTTA 1LO3H 1N4XL 4TXVB 5ICXA 1HT6A 2NZ9C 3WIHH 5FDWA 5ANME 2A0LC 2W91A 2HG5B 4YBQD 4G3YH 3B3BA 4XPHL 5K1JA 1AXTH 1U8PB 3HHSA 3HVNA 1XGPB 3Q2LA 2IAMB 1FO0H 4WTQA 1ZV9A 4YPJA 1N5AB 4R9HA 3COOA 2OPCA 5DI8A 4D9LL 1ZXKA 5FYJL 3TXAA 4HLJA 1J86A 3Q2WA 1FNHA 2NUPA 4YHZH 4JPVL 3RZWA 1AI1L 3V0AC 4NFBA 2B59B 3BWUC 4K23H 4PWIA 4B9JA 1U92A 5FUZL 4XZ4A 3L08A 2BPBA 1MHCA 3MBXH 1MREL 4Z8FL 4APQB 1P7KA 2J12B 5DQJB 5J1AB 4F3FB 3ZKMC 3HE7A 4HGMA 2ESVD 3PWLA 4HCRL 4KK9D 1SF5A 3W0WB 5EZIH 3NMEA 1E9PB 4DGIH 1KIUB 2WBJB 3BH9A 4WEMB 1Z9PA 2YUWA 5EO9B 2DQGH 3TWYA 3CDYA 4Q9QH 1OTTD 2PPEA 5CCKH 3AG2B 2GIXA 2X28A 4I13B 3SD2A 3U36B 3IGAA 4N0UE 1M3JA 2YFOA 5C0JA 4TVPD 4G8GB 4JY4B 3T0EB 1BQSA 2MCPH 2EYRB 3UEQA 3TO4B 2COVD 3UPRB 1DVFD 2ITEA 1BLNA 1MRDH 3CZNA 3GHEL 1HKLH 4O51B 4KO6A 3VFTB 1M05B 2WQVA 2ORBL 4FZ8H 4OQTA 1CGTA 1LO5B 2YQ2A 3EDJA 4YAQB 2ADIB 4PD4J 2VJ0A 4JZOA 2VO5A 2UVEA 4JKMA 4ELKA 4KAQL 3GFUA 1BM3H 1S78C 5D6DA 2E46A 1F86A 3SCMB 4F7TA 5INDA 3RB5A 4YSOA 1DCLA 2HN7A 1CI3M 2VXUL 4DCQA 3IK2A 4O5LH 2J5WA 3VI3A 2DWEB 1GOHA 5G4OA 2C7FA 3GBEA 4N28A 4O2FA 4X4MA 3FOMA 1BXUA 4Y2NA 2N59A 3BJ91 2EC8A 2N01B 3IWUA 4Q9BA 2KLSA 4NQEB 3PQYE 1FYTD 4QTHB 4UV4L 3VXSB 4DP8X 3FU9A 4KKQA 3QXTA 4JG1L 1PAMA 3DIVA 2YSSA 2F18A 4P23B 5SWZA 1PKQB 2WVVA 1LTXA 1QO3B 3SHSA 3CFDA 5IMLB 3WYRA 1K4CB 2UZXA 4PRAB 4XRCA 1S46A 3ZL2A 3GDCA 4ZUWA 3KJ4C 4RMSA 5F3HA 2BNQB 2F53E 3HI6H 4OV5A 2YLHA 3I6KA 3NRQA 1JBJA 5C07A 2YXFA 3IFPA 2LU7A 4FXGB 1M53A 2DWDA 2EIKB 2VDPL 4PV8A 3NACL 1HVXA 5DMYA 2A73A 1IM9B 2O5XH 4QT5A 1YMMB 1BIHA 3LZNA 1F97A 1FAIH 3PGDA 4Z3JA 3GSQB 3Q8FA 3CVIL 2LU4A 1A8ZA 3DO4A 1T1XB 3QH3A 4NZ8A 3AROA 3OVUB 5DD5H 3OKNB 1MCDA 2B9AA 1UJTA 1Q9OB 4FZEH 1OO2A 2EQDA 2PTUA 4P4RA 4Y16A 1D7DA 4KKBD 4HCFA 3V9EA 3HNTL 4OLUH 4M5TA 1V54B 2ICCA 5ISZB 4CBPA 3DO3A 4HIEB 4EN2A 2NW3A 4HC1H 1U8NA 5E6IB 5IK3B 4Y4KA 1NOFA 4P2RE 2IEPA 5EN2B 5CGBA 1R46A 1KIPB 1D5MB 3MRBB 3IJ9A 4NZJA 3FUIA 2BS9A 1WHOA 5GSRA 4C56E 2RFXB 1PZUB 2PCFA 2XCMC 5AB9A 4J3OF 1YDPA 1KTBA 4XBEH 3KGUA 2CUHA 1MXGA 4K3JL 3BDBA 4OZ4A 5I19L 2JKTM 3CSGA 3STZA 2VXVH 4YC2C 3HN8A 1BEXA 3BIKA 4B50A 3ZE1E 3LMJH 3QZOA 4TOYH 3DC0A 1DSWA 2VB5A 4FMFA 3D34A 2X4QB 4K3EL 4QHKI 3HPLA 2NY4C 2B1AL 2ZSVA 1ZHKB 4OI9A 3TTYA 3X1BA 1EH9A 4CW1A 1L0YA 3S2CA 5C08E 1RULH 1VGKA 2VITB 3T3PB 4DTGH 1S7VA 5MENB 1CR9H 5FA4B 4Q0XH 5C70A 5IB1B 2R56H 3DXAB 4OZIA 1WDAA 4H8VA 1MIML 1T6VN 3LIZA 4FG0A 5D2NA 4W9GC 4PRID 1DDHA 4JJOA 3TBTB 4G11A 4HKJB 4D0CB 2V3EA 2YAMA 3LKOA 1X3DA 5AKRA 1YZZA 3L3DA 4RNRB 3INUL 4KI5E 2YKKA 4OGXH 1G7MB 4U1IB 3ZTNH 2JJSA 2B0SH 4PW4A 3KXFA 4PSRA 4P3DB 2GEQA 4YPGA 1CD0A 4JVWA 4L3AA 5TDNA 5KVEE 1ZT7B 4X2UA 2KLTA 3JWDL 1PFOA 4DN3H 4A37A 3LH8A 3BWSA 4O2CB 2AABH 2HLEB 5F71A 4G80A 4DT2A 4WUUB 1TJGH 1PSKH 4M29A 2UX6A 5CJQL 3CZUB 2FEDC 1OAUL 1TQTA 5CKGA 4BEIA 5T3XD 3ZKXC 4U1LA 4LRIA 5F7DB 4YXKL 1H6FA 1ERNA 3T8VA 4UV7L 3ECWA 2HSIA 1GGBL 2Z7WA 4X42A 5D7JD 3T3ME 3GSOB 4MMYB 1T7ZA 3EGDA 3K2UH 3JBG7 1QPPA 3PQYD 4MB4A 4GKNB 3BT2H 3BWUF 4BFNA 4Z7QE 1JMZA 2J56A 1FFNB 4FYTA 4KOCA 4Z0BH 4H0GA 1KNOA 4MXWH 1RJLB 1AD0B 2A9NH 3LJ3A 2KBGA 1N5YH 2X4UA 5E8NA 1CFVL 4LIQH 2OZ4H 4YEFA 2PPAA 3KCWA 3C6LD 1FFPB 4FLSA 3LQAH 2G9HB 4Z95H 4PPTA 4JM2A 2ATKB 1QBLH 3RU8L 4HS3B 3RWIA 2R51A 3NK3A 1H5BA 4AIZB 3ZUCA 4YHNB 3GD1C 3B9KB 2X2HA 3SZ6A 2YZ8A 2XZQH 3JUYA 2G2NA 1Q9KA 2AZAA 4B7IA 1UXSB 1TTUA 1BZ9B 1H3UA 2D03L 2PMZA 3CU7A 4P2OC 2QGEA 4D9RD 1AOZA 5ALCH 4K94L 2GJ6B 3LD8B 3MV8A 1SVBA 3QC6X 1TMCB 3MGOB 4X6BB 1RD6A 2VUOA 4XBGA 4XB8A 2H1PH 4R26L 2V0AA 2XPGB 2Q6WB 1T0NA 3T2LA 1QR1B 3EJQA 4KDWA 2BSSA 2CUMA 2J3SA 4MCZB 5AW5B 3NPSC 1BG1A 2OI9C 3N2JA 3WDHA 4N0FB 4C57C 4HJEA 1K6QH 5GSVA 4Z7VA 1I7UA 1QLRA 1YC8A 5DO8A 2WV3A 2G4EA 3LIZL 3MRPA 4TF4A 5I18H 1UC6A 4Z77A 1CQKA 4FCHA 4NP9A 4NPJA 4NZDA 5AW2B 3TJHD 2Z65C 2YMTA 4P2RD 3ZE0E 2DQTL 2B8OT 2WLNA 4TVPL 3WKPA 3UO8B 1SY6A 4FRWA 4FN0A 5ITBH 1NKOA 1CDGA 2R4SL 4LKCA 5HHPB 2YBGA 4BRVA 1XGYH 4M48L 3SPVA 3CXHJ 1OP3H 1RJZB 3DWTA 2W60A 2ZKYA 5FO9B 5FLUA 1SMDA 1HAUA 4I48B 1D7CA 4Q4IA 3GPEA 2P5WB 3X1FA 1RIHH 4DP1X 1GPOL 3RBGA 1WYJA 4ZX6A 1JTTA 2FWUA 1YHPA 4GXVH 4JFTA 2Z6FA 2XICA 4P57B 1RSYA 3VM5A 1FNFA 2BW4A 4LQ1A 1K5WA 3CN2A 1OW0C 1P7BA 3PWPA 2PN5A 4M4RB 5C08D 2KL6A 3KLAA 3BRGC 4ELMB 4WWNA 2GBUA 1DLHB 4PFEA 4HFUL 1MCWM 1T1YA 4YSDA 4C58B 1NAMB 4ZMZA 4ODWB 4WHTA 4Y8AA 1OF2A 4TNWK 3I6GB 1BIIA 2OTUB 4PJHE 4P59H 4NQDA 4R2GB 5FWRA 1MNUL 1JRHL 4P5KA 1R5WB 4NN7C 3SGDH 2HAZA 3TBVB 1F2QA 1U8KB 5FYJU 3RVUD 3WNIA 4WGWB 1FNSH 4LEXH 2XLLA 3GUTB 1U33A 5C0GB 3HR6A 4BQ6A 4L5FL 2GQHA 5IWLC 4NI6A 2VM3A 3QDGE 3VCLA 1MCSA 1BM7A 2FLMA 3U46A 2DYSB 3GJFH 1IAOB 3JV4B 3NA4A 3RWEA 2NYYD 5GJTH 1BQUA 3NG5A 3GDBA 1F6FB 1J5OL 3AW5A 4TTDC 4JM0A 1WBXB 2RJMA 2DEXX 4OCSL 4OT1H 3W3BA 4KQ4L 3EYFA 4A2HA 1G43A 1PNCA 3D39D 2LABA 3RWGB 3ENEA 4K5MA 1TNMA 5KVFE 1FIGL 1PLCA 2OMZA 2JB5H 1QX1A 5AW4B 4C83A 2YGNA 4YSTA 3OKKA 3FSVA 5LCVL 2OP4H 1FZMA 2R0ZL 2UUDK 1E5CA 1FJ1B 5ITFB 5C3TA 1QABA 3EYSL 2J21A 4WY7L 4OF8A 5GGQL 3DTUB 5ESAB 5HP5A 4RH4A 2MOVA 3ERXA 3V0HA 2Z34A 4GRMA 3RWFB 3CLEL 3PHQA 3V4PB 4LCIL 3UBXI 3K71A 1MFVA 1CVSC 1LNUA 1SY6L 1UQSA 2VN7A 3QEQD 4HJGB 5EU6E 2X70B 1OCOB 2VXSH 3MAWA 3F12A 2BC4B 2ZT9C 3KPLA 1P1ZA 3S2AA 1FN4A 2E4TA 1FVEA 2P4AB 4K8RH 3QI9A 5E00B 4F7CA 1C9SA 1SJHB 4JFVA 4R4BA 2DQDL 1FSKB 3QUKB 4N8CH 1X4ZA 2X6MA 3IBEA 3TYGL 4PJEB 4WHCA 5LXGL 1AXSB 1JZ5A 4N8PA 2KERA 1HHGB 2QGBA 1N64H 2MTAA 1QFHA 2V8LA 3CSYA 1J87A 2MWCA 3FU8A 3E9UA 5BMFH 3UBFA 3TA3B 7CGTA 2V7NA 3PIQA 4JHVA 3J8F7 4AQ8A 1L9RA 3D3VA 1N68A 3MRFA 4FFYA 3DO7A 2GHWB 3NRFA 5C8JB 1BDYA 1ECZA 1V10A 4NNYB 4AW4A 3CIQA 2CIKB 5D1XC 4KQ3H 2JFCA 3VXUA 4LLMA 3FFCB 1Y6KR 2NLJA 1X4YA 3EO1B 4G42A 3E6HB 2NX5E 4LLVB 4QTFA 3QORB 1TFHA 1WZAA 4N8UA 3L1EA 3S96A 3ZO0A 1QBML 2A9AA 2YR3A 1F4WL 4LQFL 4MAYC 4XVSH 3EOTH 1NKGA 3AJ7A 4M3KB 4NO0A 4WWPA 1CS6A 4Z0XB 2V5MA 5C0AE 5CD5D 4WAFA 3EJZC 5IGXH 1W0WA 3CVCA 3UDWC 2VDMH 5D7IB 1XL6A 4DP0X 5K9JL 3GM8A 3OWEA 1EJ6A 1QEWA 1C5BL 5JIKA 3S4SB 5GS0D 3PP3K 1IB5A 3CQQA 3RG1C 3FPYA 3ZTCC 1OSZA 4KITB 1RZJL 4JAMB 1IQWH 2X3CA 4Z7UA 1XO8A 1FVCA 2VZ1A 4NM8H 3FT2A 3C9NB 4AM0A 4DP4X 8FABB 4PJAE 4KROB 5FGBA 1BJ8A 3CDGB 4H8HA 3VFUA 1VPOH 2YBRB 2BVOB 4TL5A 5F7BA 1UHVA 4RGNE 1JXFA 5AW7B 5T3XL 3S4SG 4JREB 3T2PA 1UWGH 5CKAA 2I9TB 5I1LA 1EMTL 1Q9WA 3B9EA 4X6DF 5D5ME 1UWFA 2JB6A 1ZGLM 1I8KA 5EULV 1KIQB 4JPKH 1ANUA 4FFTA 2RH0A 3S36H 2E9IA 4EE2A 3NSCA 4IGBA 3DK2A 1YAIA 4IRSC 4J7RA 1GIGH 4MA8L 5ILTL 4W6YB 4JHAL 4ZMAT 2BVYA 4H0IA 3GI8H 1M6OA 4K5NA 1W72B 2FWOB 4L9LA 2WO3B 3WL9A 3DMMA 3G6JF 2AQSA 3FB7A 3UAEA 4GUPA 3O2VH 1ZT4A 1HCZA 4J4PA 4WIQA 3C5ZC 5KANG 1PG7H 3QDGD 3KLHD 3ZZQA 1I1CA 3PNRB 3ALWA 5EOCH 4MZ3A 1ICTA 1ODAA 3EDDA 3WO4C 5K1VA 2E7HA 4M7LT 2NY6C 4CL7A 1R3LB 2F19H 1HCYA 2GITA 1PLBA 5GRWA 3KLQA 5LG1A 3L16A 4WWKB 1BAGA 2K9UA 3DIFA 4UINL 3U2JA 3WS6A 1HYRC 2KZWA 4LLUB 1LDPH 4FFYL 3JZYA 3L13A 1MFCL 5EU5B 5DHMC 4ZTPH 4DO5A 4J1UB 4YDZA 3U83A 2WZPD 2RCSL 2BS8A 2BHUA 2WUBL 2AK1L 2ZX6A 3QULB 1BF5A 4Y89A 1OPGL 1HS6A 3DURB 3FTGB 5DHYB 1CU4L 4XH2B 2FATL 4PJCE 1Z3RA 5JHDA 4P4KB 4TN9A 3ORJA 2VDNB 2FRGP 3MV9B 1KF9B 4JFXA 1URIA 3D0AA 5DRWB 4NZRL 3EUDA 4DW2H 2FSEB 4DWHA 2ICWI 1JPTL 1MRCL 3IDYC 4P07A 2FT6A 1OTTC 3LH2H 1J5HA 3UZVB 2OYPA 2XG5B 5E8OA 2BOCB 1YN6B 5JOPE 4RFNC 3CN4A 2NNFA 5AW3B 1X5YA 1NCJA 4ZO8A 4HIXL 2M8XA 4UQ3A 1LK2A 3UGEA 3P9LA 1DVFC 4NAQA 4E41E 3GNMH 4X98B 1SHXA 3OJMB 2Q3AA 2EDFA 3PWVA 5E24E 1OY3B 1QTPA 3ZGHA 4X7DC 1FFOB 4PVLA 4JKNA 1TPXB 1ZE3C 1OGTA 4OD3H 4PEEA 3IAPA 3VWKB 4I5BB 4NM4L 4ECNA 1G9NC 4HD5A 1M9WA 1J05A 4RDBA 1KBBA 1JP5A 2NX5D 3AADB 4OM0H 4EDWH 4AMKL 4GG6E 3LRGA 3V6FB 4EVNA 1PZSA 1TZOA 4Y9GA 5C2BH 4Y4HD 1KMGA 3BUIA 5FK9A 1J9CT 4WJ5B 1QKZL 4LSRH 3WFZA 1OZUA 5TFSH 3CK0L 3R4RA 1V3KA 2BNRA 4JG0L 3UG4A 1E3ZA 4IRJD 5H4YA 1I8MB 1BVLA 1KYAA 1OARH 3O41B 1BFVL 5TPWL 4YUEH 5HGAA 3X3GH 1PFCA 5AB2A 4LEBA 5AZEL 1YJDH 1D5IL 3ZDXF 1YUHA 3IFNL 3FFOA 4ONFH 3UTSB 5JPNC 2P44B 5L9DL 2FZ3A 1BSIA 5TDOA 2G2RA 1NFDF 2VYRE 4XXWA 3A6CL 4FYQA 5C71A 5HYSB 2FK9A 2Z9TA 4N86A 2R7EB 4RGND 3WLWD 4CMMB 4QWWD 4XNYL 3EYVB 1SBSH 1MZYA 4S0SD 3TJEL 4XB3A 2PWEA 2XHNA 3P4OA 1GMEA 5B7EA 4MS8C 5E2UH 4ZMPA 2K3TA 3O3BA 3F01A 1OLLA 2WXOA 1S5IH 4LCUB 3BO8A 1XMWA 3ECVA 1FLTX 4KZDH 3GPSA 2C7UA 3D33A 5BS0E 3AXLB 2JELH 1AS6A 1ZPLA 1HHHB 4EI5D 3WJJC 4NT6B 5F7WC 4PUBL 4HWEL 4KHXL 3BLPX 3VXRA 2X4TB 3T9WA 1OCZB 2H32B 1WZKA 2YQBA 4WJKB 1VFAB 4A55A 4HKXB 2R1WA 5C9KA 4L29A 1MDAA 3AMKA 3NCYP 5KSBF 4UOJA 1FO0B 1C12A 3AY4A 3RJOA 1I82A 3DHUA 3V6BR 5IW6B 3KPNB 5HGDB 4QJ4B 3N85L 3QS2A 4YHIB 3FH8A 5C0BB 4OSUH 4MD5A 1KIRB 5FPIA 12E8L 4QO1B 2WQSA 1IARB 2FECI 3T0EE 3MN8A 2UVFA 3SDYL 2YMXL 4PBDA 4TUOB 1IGIL 1E7VA 1HWWA 2MIZA 4XVTL 2PWDA 1QPXA 3SOBL 1PZ5A 1I1FA 1MVUA 5ABDE 3WU1A 2GHZA 3GIZH 4PP2B 5FA3A 5JQ6L 3MMEA 2VWEE 2DIBA 3E8UL 5ACLA 4E9XA 4NQCB 1N18A 1ORSA 4KK5C 2R8SH 1K85A 1GC1C 1ADQH 4K7PY 1IAII 2HX9A 3WLBB 1A4AA 2KPNA 2JI3A 3O3AB 1GGTA 1UASA 2I9LB 4HK3J 1YG9A 3WJMB 1REIA 4IOSD 1JWUB 1NDMB 2G9KA 2ZWNA 4OLZH 2JK5B 3Q8AA 2C3VB 4I8DA 1HNYA 3U9PL 1H15A 1J8HD 2PXYD 2WQUA 1NMCC 3DI2B 4B41A 4XMWA 4GRLA 3AAZB 3FUDA 3QT2A 5IVXB 1KBGH 1VIWA 5CU5A 4GO9A 3EGSA 3L8QA 2FJGB 3UO1L 2R2CA 5JOPD 2OTWB 1YEFH 3OX8B 1N7MH 2WKOA 2ED7A 4GMSH 1J5DA 1CLYL 2AKRB 5FV2A 4Y7MA 3OF6D 5HDBF 3RUGA 3UBGA 3ZMNA 2ZG1A 4G8EB 3CH1B 2W92A 4G7SB 4V33A 3PP4H 2BNQE 4YSSA 2W59A 3RWDB 1CUOA 4F7MA 4OCRH 3ATFA 3X1EA 1ZHNA 2CKBL 4KNQA 2Q9OA 4LSTL 5CP7A 4AYFB 4PJ9A 3DV6A 4ZFZA 2XN9E 1YMME 3FUFA 2WO2B 4RAVA 1MCWW 3ARDA 4ZXBD 1ZLSL 1GS6X 2J8UA 1HSAA 3SYAA 1W8NA 5FKAA 4HAFA 3CVBA 2NW2B 3KPOB 1YO4A 1S7SA 5IFJA 3KYKH 4ODUA 4E42B 2HRPH 4X0KA 4GO6B 5F7FA 5D7JC 4N87A 2ZXWB 4PAZA 1AHWA 3TT3L 5ID1B 1TITA 1F4YL 4DKEL 2BP0A 3OB0K 2C3HA 4ENED 5D8JH 1ZSDA 3WNMA 2E7MA 4MNQA 1G94A 1D5BB 1LD9A 3NAAL 1AOHA 3GRGA 3QJQB 1S7WB 1K72A 5E9DB 5DZOA 4LASL 4PH8A 1BBJA 2VLKA 1HFUA 1OKEA 4P9HC 3C6LC 5I26A 1I85A 1M1XA 4LRNH 5E70A 5B22A 4IEFB 1HN1A 1RHHA 5DMIL 5EZJA 1TZHA 1FNEA 3WXWL 3NFNA 5JXAH 3CQPA 4PGDB 4XBPB 2UY6A 5EH1A 4BFIA 1RK0A 3ULVL 2IAMD 4JN1H 1SVCP 3DA0A 3SBQA 4X8JA 2MTPA 4WCYH 1XB8A 5IJKC 2WP3T 3HN5A 4XNUL 5ERWA 5IKCA 2A38A 2DL9A 2EP6A 1A7QH 2W5PA 1IKNA 3HN3A 1KGUA 3MCLH 1EVUA 2APXA 2WLIA 4LCCC 4XPTL 1MWAB 5EUOB 5FKPA 3UFIA 5F3BA 4WTZA 1J1XL 1JYXA 5HHNA 4OH2A 5A3IC 1WWCA 1G87A 1EAPB 2UZYA 5BQ7B 1L7IL 3BZDA 3W0WD 1R3HB 3MA9H 3SO3B 1OT4A 1TQCC 2CGRL 4FYSA 5CJOL 2DBLL 3U9UA 2O5YH 3UGXA 2WBJD 1O0VA 1JZ7A 3DSFH 2G30A 1T89A 2DPKA 1L9QA 3TJHC 3CFIC 1UA6L 3TONA 2R23B 3CLWA 3MLPA 2Q2EB 4WW2B 4ZMNA 2E9GA 3TVMB 1EHLH 3SE8H 3FYEB 4G8GD 3T0ED 2P5EE 4OR1A 5DVKA 3TO4D 3ETSA 2AXGA 3WJLA 5JOFA 4CNIB 4OF0A 3S37H 2AF2A 2WOBA 3NJIA 1IM3A 4FFZA 5J6HB 1FCGA 4BKLB 5HGHA 2QSQA 3HI1A 1IL1B 1VFOA 4G1EB 4XNXH 3SE6A 3OPUA 3MV7A 1H3XA 1V5JA 3X13B 1Y1DA 3CFEB 1XWVA 1IEHA 3ZRCC 5CINH 2AGJL 5E1QA 3SCMD 1X5ZA 3DKHA 3AU0A 2XWDA 3DGDA 1AZCA 3M7OA 4BJLA 3N40F 4PYGA 3L3OA 2A6IB 3L7EB 4P9ML 1XIWD 2Q7AA 1BWWA 4JM2F 1RPKA 1G0XA 5BW7C 4LPYA 5EU4B 2HLFC 2PR4L 3IRPX 4UQ9A 3L3GB 1YRKA 1XGTA 2CRZA 1T0OA 1TVHA 4LAQH 4Y2OB 4NQED 4DH2A 4M62L 3WTXA 3VXSD 1JGLH 1L5GB 1ODUA 4P23D 1P4LB 4P2YA 2R1YA 3QNXB 3D85B 4U3SB 2BOBB 4IOFD 2VDOL 2FX7L 3NZ8A 1D9KB 2IIJA 3WMPA 4KI5C 3F58H 2BNQD 4OFIA 3MXVL 1EO8H 3SDAC 5IB5B 2D4DA 2NYYC 3LQMA 3MNWA 4QXUL 4XVJL 4U1KB 5FM5M 3U7AA 2X4PB 5DZVA 1A1NA 1VCBC 2A77H 2CO1A 4RMBA 3FQRB 4W93A 1MLBB 1JN6B 2XY1A 4HFWB 4JO4H 4OIFA 1YMMD 4QPEA 1RFDL 4EAEA 3OAUH 3IB4A 2GJ6E 1AXIB 4S1RH 4ZUVA 2CK0H 2Q76A 3MRJB 1AS8A 3KCPA 4BFRA 3E3QE 4KFMA 4NJ9H 3TH4T 1FP5A 2W80C 4Y1TA 1MCJA 4XXCC 3LKPB 4FFWC 1VSCA 2XQBL 5BZZA 1PVHA 2Z31B 1IC5H 3SGEH 1MCOH 2VL4A 3H8NA 4JFEA 1U8CA 5J12C 5DTFA 5ISZD 5E6YA 2QV2A 1JHLL 4FKEA 1T5KA 4OCWL 1KZYA 1U95A 4DZ8B 4F9LC 5DSCB 5DWPA 3ZXAC 5AAMC 3L45A 4OAWB 5FO2A 2F58L 3QIUB 3QZNA 2LV4A 5I5RA 5KN5B 3UH8A 3D6GA 2HG5A 3GSNA 5D4JA 1XGPA 1LP9E 3MZTA 4BQ9A 1FRGH 4R3SA 1CF8L 3CX5K 5CD3A 2ERJB 1B9ZA 5DEFB 1N5AA 2A2QT 4XN1A 3ZT5A 2CIIA 2P5WE 4FFZL 2ARWA 3MOAL 3QQ4A 2Y24A 4DF9A 2FBJL 4ZW6A 4FQXB 4M6ML 4G9DB 3WIIH 1TUPA 4NOBA 2W0FA 4ZTOH 4APQA 3CQFA 4ILDA 5DK3A 4KO9A 2WZAA 3HBQA 5FM5O 4AYID 5CWSA 2D2OA 3OKOA 5CJXC 4R7DB 1NFIB 5KVDL 2CR6A 2VN5A 1EO5A 4HSQA 5F89B 4A39A 1E9PA 4ELME 2VDLH 4KX9A 1BD2E 2VZTA 1YEHL 4L1TA 1T20A 3EZ8A 3DXAD 2G3MA 1JYWA 3V0GA 2JCCA 5EMYA 2VW6A 1KENL 4IS6B 1CBJA 3U36A 1KELH 4WI2A 5C07E 5HYEA 3KDMA 1KFGA 4J5VA 4G6MH 1WAEA 5CSZA 3X11B 1CFNB 3FKUS 3BVXA 1ZWIB 3QJHB 4Y5XC 1NCWH 3RAJL 3UOAB 1DN0B 3GGWA 3EXLA 2EYRA 1WUNT 3L5IA 4GKOA 2MCMA 3LV3B 1E8ZA 1VDGA 1KJ2H 3N42F 2HPTA 2O6DA