3VW4A

Crystal structure of the dna-binding domain of cole2-p9 rep in complex with the replication origin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
HHHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPLSPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSARSLKPWEALGISRATYYRKLKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
molecule keywords Rep
total genus 39
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.50 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3vw4A01
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vw4A02
1MYKA 1BDTA 1BAZA 1ARRA 2WVCA 2BJ3A 1IRQA 1P94A 1U9PA 2JXGA 4D8JA 3FT7A 2BJ9A 3VEAA 3GXQA 2H1OE 1Q5VA 2WVBA 1EA4A 1BDVA 2BNWA 1MYLA 2CAJA 2WVEA 2KELA 4ME7E 2BA3A 3OD2A 2CAXA 1ARQA 2K9IA 2WVFA 1X93A 2CA9A 1B28A 2HZAA 4FXEA 3H87C 4HV0A 2GPEA 2K6LA 2JXIA 1MNTA 3LGHA 1QTGA 2BSQE 2JXHA 2BJ7A 1PARA 2HZVA 2CADA 3QOQA 3FMTA 2AY0A 2RBFA 2WVDA 1NLAA 3VEBA 1B01A 2BNZA 2BJ1A 2BJ8A 2K29A 2CPGA 2K5JA 2K1OA 3VW4A
chains in the Genus database with same CATH superfamily
3H5XA 4UNFA 3NNEA 1XQPA 4ZTJA 3LCNA 3G0QA 1P94A 1VRLA 2YG9A 3FT7A 2BJ9A 1PVSA 3SFUA 1Q5VA 3KNTA 2YG8A 5AN4A 3OYGA 4BE1A 4E7KA 3IR7A 2KELA 2BA3A 3L2WA 3CVSA 3S6IA 2NOFA 3UQSA 4E9GA 1PU8A 1U84A 2WVFA 1B28A 2B43A 4EA4A 4E9EA 4FXEA 3IHOA 3OGDA 3FHFA 2GPEA 4E7JA 2JXIA 4E7IA 3N5NX 5KN8A 1KG5A 3BSNA 1SH2A 3FHGA 3L2VA 3L2RA 3I0WA 3CWTA 4QPXA 1PARA 2W03A 2CADA 2OFKA 4B23A 1DIZA 2JG6A 2AY0A 1KG3A 3SFGA 1EBMA 1XG7A 3OH9A 3F10A 2BNZA 1LMZA 2K29A 3CVTA 4NZGA 4E7LA 2K5JA 4NRUA 1MYKA 1B01A 3OYIA 1BDTA 1ARRA 3NAHA 2BJ3A 4NRTA 3QIDA 1N39A 3OYJA 2H56A 4BDZA 2V75A 2UUTA 3UR0A 3VEAA 4IKFA 2H1OE 2NOBA 5CHZA 2WVBA 1BDVA 1Q16A 2BNWA 4EVVA 1MYLA 2CAJA 4ME7E 1NKUA 3NAIA 2CAXA 1ARQA 3OS1A 1X93A 2CA9A 2I5WA 4AI4A 2JPSA 3NNQA 3OS0A 4ZTFA 2H3AA 1KG2A 4OFEA 1ORPA 1KG6A 2A2BA 4EJYA 2K6LA 3OH6A 5FRNA 2NOLA 1MNTA 1SIWA 2WK4A 3LGHA 1QTGA 5FRMA 5KN9A 3S3MA 2BJ7A 2NOZA 3QOQA 2UUWA 2RBFA 4O4RA 4AI5A 4AIAA 3L2QA 1KEAA 4EJZA 3VEBA 1LWWA 3OS2A 3I0XA 2KOEA 2JBVA 1YQRA 1MUNA 1BAZA 2WVCA 4EW4A 1IRQA 1KO9A 1U9PA 4LQ3A 2NOIA 2NOEA 1KG4A 3CW7A 1OG7A 2KKEA 2WVEA 1NGNA 3OD2A 2ABKA 1KQJA 3OYAA 3OYKA 2K9IA 3OYFA 4B24A 4E9HA 1YQKA 5FROA 4OFHA 1LWVA 3UPFA 1P7MA 3KTUA 2XHIA 1RRSA 4B22A 4HSBA 1WEIA 2AN7A 3H87C 3LJPA 4HV0A 4B21A 4MJWA 1MUYA 4BDYA 3CWSA 1HU0A 3OYHA 3D4VA 1ORNA 2JXHA 3CWUA 3S3OA 2JHJA 1MPGA 4UOBA 3FMTA 1FN7A 3OYDA 1PU7A 1WEFA 4EA5A 2OFIA 4BE2A 1YQMA 3F0ZA 2BJ1A 1N3AA 2BJ8A 3OYLA 4BACA 4E9FA 2CPGA 3OYBA 2Q2KA 2JHNA 1M3QA 1SH0A 4D8JA 2JXGA 1M3HA 1OHNA 2CKWA 3GXQA 4OFAA 4YPHA 1LWYA 3OYNA 5DPKA 1EA4A 4EW0A 3G5OA 3L2UA 4YPRA 1WEGA 4LRVA 3IH7A 3CWAA 3OYMA 4LQ9A 3BSOA 2HZAA 3NO7A 1KG7A 4BE0A 3N0UA 2BSQE 4PIIA 2NOHA 4YOQA 1MUDA 4DK9A 2W04A 4E7HA 1SH3A 2ADLA 2HZVA 1P59A 1PU6A 1XQOA 3R2XC 2WVDA 4AAIA 1NLAA 3OYEA 3OY9A 1YQLA 1RRQA 3FSPA 3OYCA 1N3CA 3H5YA 3S3NA 2K1OA 3VW4A
chains in the Genus database with same CATH topology
4ZTJA 3LCNA 1P94A 3FT7A 2BJ9A 1Q5VA 3OYGA 4BE1A 4E7KA 2KELA 2BA3A 3L2WA 2WVFA 1B28A 4FXEA 2JXIA 2GPEA 4E7JA 4E7IA 3L2VA 3L2RA 1PARA 2W03A 2CADA 2AY0A 2BNZA 2K29A 2K5JA 4NZGA 4E7LA 1B01A 1MYKA 3OYIA 1BDTA 1ARRA 2BJ3A 3OYJA 4BDZA 2V75A 3VEAA 4IKFA 2H1OE 1BDVA 2WVBA 2BNWA 1MYLA 2CAJA 4ME7E 2CAXA 1ARQA 3OS1A 1X93A 2CA9A 4ZTFA 3NNQA 2JPSA 3OS0A 2K6LA 5FRNA 1MNTA 3LGHA 1QTGA 5FRMA 3S3MA 2BJ7A 3QOQA 2RBFA 3L2QA 3VEBA 3OS2A 1BAZA 2WVCA 1IRQA 1U9PA 2WVEA 3OD2A 2K9IA 3OYAA 3OYKA 3OYFA 5FROA 4HV0A 3H87C 4BDYA 3OYHA 2JXHA 3S3OA 3FMTA 3OYDA 4BE2A 2BJ1A 2BJ8A 4BACA 3OYLA 2CPGA 3OYBA 4D8JA 2JXGA 3GXQA 1EA4A 3OYNA 3L2UA 3OYMA 2HZAA 4BE0A 2BSQE 2HZVA 2W04A 4E7HA 2WVDA 1NLAA 3OYEA 3OY9A 3OYCA 3S3NA 2K1OA 3VW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYK A;  1BDT A;  1BAZ A;  1ARR A;  2WVC A;  2BJ3 A;  1IRQ A;  1P94 A;  1U9P A;  2JXG A;  4D8J A;  3FT7 A;  2BJ9 A;  3VEA A;  3GXQ A;  2H1O E;  1Q5V A;  2WVB A;  1EA4 A;  1BDV A;  2BNW A;  1MYL A;  2CAJ A;  2WVE A;  2KEL A;  4ME7 E;  2BA3 A;  3OD2 A;  2CAX A;  1ARQ A;  2K9I A;  2WVF A;  1X93 A;  2CA9 A;  1B28 A;  2HZA A;  4FXE A;  3H87 C;  4HV0 A;  2GPE A;  2K6L A;  2JXI A;  1MNT A;  3LGH A;  1QTG A;  2BSQ E;  2JXH A;  2BJ7 A;  1PAR A;  2HZV A;  2CAD A;  3QOQ A;  3FMT A;  2AY0 A;  2RBF A;  2WVD A;  1NLA A;  3VEB A;  1B01 A;  2BNZ A;  2BJ1 A;  2BJ8 A;  2K29 A;  2CPG A;  2K5J A;  2K1O A;  3VW4 A; 
#chains in the Genus database with same CATH topology
 3H5X A;  4UNF A;  3NNE A;  1XQP A;  4ZTJ A;  3LCN A;  3G0Q A;  1P94 A;  1VRL A;  2YG9 A;  3FT7 A;  2BJ9 A;  1PVS A;  3SFU A;  1Q5V A;  3KNT A;  2YG8 A;  5AN4 A;  3OYG A;  4BE1 A;  4E7K A;  3IR7 A;  2KEL A;  2BA3 A;  3L2W A;  3CVS A;  3S6I A;  2NOF A;  3UQS A;  4E9G A;  1PU8 A;  1U84 A;  2WVF A;  1B28 A;  2B43 A;  4EA4 A;  4E9E A;  4FXE A;  3IHO A;  3OGD A;  3FHF A;  2GPE A;  4E7J A;  2JXI A;  4E7I A;  3N5N X;  5KN8 A;  1KG5 A;  3BSN A;  1SH2 A;  3FHG A;  3L2V A;  3L2R A;  3I0W A;  3CWT A;  4QPX A;  1PAR A;  2W03 A;  2CAD A;  2OFK A;  4B23 A;  1DIZ A;  2JG6 A;  2AY0 A;  1KG3 A;  3SFG A;  1EBM A;  1XG7 A;  3OH9 A;  3F10 A;  2BNZ A;  1LMZ A;  2K29 A;  3CVT A;  4NZG A;  4E7L A;  2K5J A;  4NRU A;  1MYK A;  1B01 A;  3OYI A;  1BDT A;  1ARR A;  3NAH A;  2BJ3 A;  4NRT A;  3QID A;  1N39 A;  3OYJ A;  2H56 A;  4BDZ A;  2V75 A;  2UUT A;  3UR0 A;  3VEA A;  4IKF A;  2H1O E;  2NOB A;  5CHZ A;  2WVB A;  1BDV A;  1Q16 A;  2BNW A;  4EVV A;  1MYL A;  2CAJ A;  4ME7 E;  1NKU A;  3NAI A;  2CAX A;  1ARQ A;  3OS1 A;  1X93 A;  2CA9 A;  2I5W A;  4AI4 A;  2JPS A;  3NNQ A;  3OS0 A;  4ZTF A;  2H3A A;  1KG2 A;  4OFE A;  1ORP A;  1KG6 A;  2A2B A;  4EJY A;  2K6L A;  3OH6 A;  5FRN A;  2NOL A;  1MNT A;  1SIW A;  2WK4 A;  3LGH A;  1QTG A;  5FRM A;  5KN9 A;  3S3M A;  2BJ7 A;  2NOZ A;  3QOQ A;  2UUW A;  2RBF A;  4O4R A;  4AI5 A;  4AIA A;  3L2Q A;  1KEA A;  4EJZ A;  3VEB A;  1LWW A;  3OS2 A;  3I0X A;  2KOE A;  2JBV A;  1YQR A;  1MUN A;  1BAZ A;  2WVC A;  4EW4 A;  1IRQ A;  1KO9 A;  1U9P A;  4LQ3 A;  2NOI A;  2NOE A;  1KG4 A;  3CW7 A;  1OG7 A;  2KKE A;  2WVE A;  1NGN A;  3OD2 A;  2ABK A;  1KQJ A;  3OYA A;  3OYK A;  2K9I A;  3OYF A;  4B24 A;  4E9H A;  1YQK A;  5FRO A;  4OFH A;  1LWV A;  3UPF A;  1P7M A;  3KTU A;  2XHI A;  1RRS A;  4B22 A;  4HSB A;  1WEI A;  2AN7 A;  3H87 C;  3LJP A;  4HV0 A;  4B21 A;  4MJW A;  1MUY A;  4BDY A;  3CWS A;  1HU0 A;  3OYH A;  3D4V A;  1ORN A;  2JXH A;  3CWU A;  3S3O A;  2JHJ A;  1MPG A;  4UOB A;  3FMT A;  1FN7 A;  3OYD A;  1PU7 A;  1WEF A;  4EA5 A;  2OFI A;  4BE2 A;  1YQM A;  3F0Z A;  2BJ1 A;  1N3A A;  2BJ8 A;  3OYL A;  4BAC A;  4E9F A;  2CPG A;  3OYB A;  2Q2K A;  2JHN A;  1M3Q A;  1SH0 A;  4D8J A;  2JXG A;  1M3H A;  1OHN A;  2CKW A;  3GXQ A;  4OFA A;  4YPH A;  1LWY A;  3OYN A;  5DPK A;  1EA4 A;  4EW0 A;  3G5O A;  3L2U A;  4YPR A;  1WEG A;  4LRV A;  3IH7 A;  3CWA A;  3OYM A;  4LQ9 A;  3BSO A;  2HZA A;  3NO7 A;  1KG7 A;  4BE0 A;  3N0U A;  2BSQ E;  4PII A;  2NOH A;  4YOQ A;  1MUD A;  4DK9 A;  2W04 A;  4E7H A;  1SH3 A;  2ADL A;  2HZV A;  1P59 A;  1PU6 A;  1XQO A;  3R2X C;  2WVD A;  4AAI A;  1NLA A;  3OYE A;  3OY9 A;  1YQL A;  1RRQ A;  3FSP A;  3OYC A;  1N3C A;  3H5Y A;  3S3N A;  2K1O A;  3VW4 A; 
#chains in the Genus database with same CATH homology
 4ZTJ A;  3LCN A;  1P94 A;  3FT7 A;  2BJ9 A;  1Q5V A;  3OYG A;  4BE1 A;  4E7K A;  2KEL A;  2BA3 A;  3L2W A;  2WVF A;  1B28 A;  4FXE A;  2JXI A;  2GPE A;  4E7J A;  4E7I A;  3L2V A;  3L2R A;  1PAR A;  2W03 A;  2CAD A;  2AY0 A;  2BNZ A;  2K29 A;  2K5J A;  4NZG A;  4E7L A;  1B01 A;  1MYK A;  3OYI A;  1BDT A;  1ARR A;  2BJ3 A;  3OYJ A;  4BDZ A;  2V75 A;  3VEA A;  4IKF A;  2H1O E;  1BDV A;  2WVB A;  2BNW A;  1MYL A;  2CAJ A;  4ME7 E;  2CAX A;  1ARQ A;  3OS1 A;  1X93 A;  2CA9 A;  4ZTF A;  3NNQ A;  2JPS A;  3OS0 A;  2K6L A;  5FRN A;  1MNT A;  3LGH A;  1QTG A;  5FRM A;  3S3M A;  2BJ7 A;  3QOQ A;  2RBF A;  3L2Q A;  3VEB A;  3OS2 A;  1BAZ A;  2WVC A;  1IRQ A;  1U9P A;  2WVE A;  3OD2 A;  2K9I A;  3OYA A;  3OYK A;  3OYF A;  5FRO A;  4HV0 A;  3H87 C;  4BDY A;  3OYH A;  2JXH A;  3S3O A;  3FMT A;  3OYD A;  4BE2 A;  2BJ1 A;  2BJ8 A;  4BAC A;  3OYL A;  2CPG A;  3OYB A;  4D8J A;  2JXG A;  3GXQ A;  1EA4 A;  3OYN A;  3L2U A;  3OYM A;  2HZA A;  4BE0 A;  2BSQ E;  2HZV A;  2W04 A;  4E7H A;  2WVD A;  1NLA A;  3OYE A;  3OY9 A;  3OYC A;  3S3N A;  2K1O A;  3VW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...