3VW4A

Crystal structure of the dna-binding domain of cole2-p9 rep in complex with the replication origin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
HHHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPLSPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSARSLKPWEALGISRATYYRKLKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rep
publication title Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 39
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.50 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3vw4A01
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vw4A02
1NLAA 4ME7E 2CPGA 2RBFA 2K29A 2CA9A 1Q5VA 2WVBA 2BA3A 2HZVA 3QOQA 3FT7A 2BSQE 1X93A 2JXHA 4D8JA 1B01A 2CAJA 2K9IA 2AY0A 1PARA 3GXQA 2BNWA 3VEAA 2K6LA 3LGHA 2BJ3A 2BJ7A 1MNTA 2GPEA 2H1OE 1QTGA 2K5JA 1MYKA 2BJ1A 3VW4A 4FXEA 2WVDA 2BNZA 1ARQA 2JXGA 1EA4A 2WVFA 2WVCA 2BJ9A 2CAXA 2JXIA 1P94A 1U9PA 4HV0A 3FMTA 1MYLA 2CADA 1B28A 1ARRA 3H87C 1BDTA 3OD2A 2WVEA 1IRQA 1BAZA 2K1OA 2KELA 1BDVA 2HZAA 3VEBA 2BJ8A
chains in the Genus database with same CATH superfamily
4ME7E 3FHGA 4E7HA 4O4RA 4AI5A 4AAIA 1NKUA 4PIIA 2WVBA 2KOEA 3UPFA 2OFKA 3FT7A 2Q2KA 3LJPA 4E9FA 3OYGA 3L2QA 1XQPA 3OYDA 1DIZA 3SFGA 1YQKA 1FN7A 2BNWA 3NAIA 1MNTA 1SH3A 2H1OE 2K5JA 3NNQA 1ARQA 1M3QA 4FXEA 4YPRA 3CVTA 3KNTA 4IKFA 2WVCA 4NRUA 3UQSA 2JXIA 1U9PA 4E7KA 3OYHA 3FMTA 3OS0A 1ARRA 3OYJA 3G5OA 5AN4A 1MUNA 1SIWA 2K1OA 4EA5A 4HSBA 4UOBA 3OYMA 4NRTA 3OYLA 3OH6A 3VEBA 4E9HA 1KQJA 2NOBA 2BJ9A 2BJ8A 3L2VA 2JBVA 2K29A 2CA9A 3OYIA 1LWVA 2BA3A 1PU7A 1Q16A 3OS1A 4QPXA 4D8JA 4NZGA 2W03A 3OYAA 3L2RA 3QOQA 4OFHA 2K9IA 3KTUA 4B21A 4BE1A 3OGDA 3S3MA 5FRMA 1PARA 3OYBA 1PU6A 1P7MA 4BDYA 3LCNA 2JHJA 1KG3A 3D4VA 3CVSA 4BDZA 4EA4A 1VRLA 1KG2A 1LWWA 4EJZA 2K6LA 3N5NX 3G0QA 2BJ3A 3LGHA 3H5YA 3OYEA 1QTGA 3FSPA 4AIAA 4UNFA 3OYKA 1N3AA 2WVFA 1MUYA 2JHNA 1YQRA 3S3NA 2CAXA 3FHFA 4YOQA 3R2XC 1OG7A 1P94A 1SH0A 2CADA 4LRVA 1KG7A 2H56A 2NOZA 1B28A 4E7IA 1BDTA 2HZAA 3L2UA 1NGNA 1KG6A 2WVEA 5KN9A 3I0WA 4MJWA 1YQMA 1KO9A 1XQOA 2ABKA 1OHNA 2KELA 3SFUA 2NOIA 1XG7A 1BDVA 1HU0A 3NAHA 1NLAA 1P59A 5CHZA 2RBFA 1N3CA 4B24A 2W04A 1LWYA 1Q5VA 1M3HA 3IR7A 2JXHA 2AY0A 1U84A 3IHOA 3S3OA 2BSQE 3CW7A 2KKEA 4BACA 3GXQA 4OFEA 2B43A 3H5XA 3CWSA 3BSOA 2AN7A 2BJ7A 2GPEA 3F10A 2BNZA 2BJ1A 3VW4A 1PU8A 2NOEA 5FROA 2JXGA 2JPSA 1RRQA 2NOHA 2UUTA 3NO7A 2H3AA 3H87C 2CKWA 3OYFA 3CWUA 1ORPA 3OH9A 1IRQA 1MPGA 5FRNA 2ADLA 3QIDA 3L2WA 2I5WA 1KG4A 2V75A 1MUDA 1ORNA 5KN8A 2NOLA 4E9EA 2CPGA 3OY9A 3OYCA 1LMZA 4B22A 4B23A 2HZVA 4EW4A 1X93A 3UR0A 4BE0A 4YPHA 2NOFA 2CAJA 1B01A 4DK9A 3BSNA 1KEAA 2JG6A 1SH2A 4HV0A 2WK4A 3CWAA 4LQ9A 3F0ZA 3VEAA 1WEFA 2YG8A 2A2BA 4EJYA 4E7JA 3CWTA 1MYKA 3S6IA 1N39A 1PVSA 3OS2A 1KG5A 2OFIA 2WVDA 4E9GA 1EA4A 1YQLA 3IH7A 1WEGA 4BE2A 4ZTJA 2YG9A 2XHIA 3I0XA 1MYLA 2UUWA 4EVVA 3OYNA 5DPKA 3OD2A 4OFAA 1RRSA 1BAZA 4ZTFA 4AI4A 4LQ3A 4E7LA 1WEIA 1EBMA 3NNEA 3N0UA 4EW0A
chains in the Genus database with same CATH topology
4ME7E 4E7HA 2WVBA 3FT7A 3OYGA 3L2QA 3OYDA 2BNWA 1MNTA 2H1OE 2K5JA 3NNQA 1ARQA 4FXEA 4IKFA 2WVCA 2JXIA 1U9PA 4E7KA 3OYHA 3FMTA 3OS0A 1ARRA 3OYJA 2K1OA 3OYMA 3OYLA 3VEBA 2BJ8A 2BJ9A 3L2VA 2K29A 2CA9A 3OYIA 2BA3A 3QOQA 2BSQE 3OS1A 4D8JA 3OYAA 4NZGA 2W03A 3L2RA 2K9IA 3S3MA 4BE1A 1PARA 5FRMA 3OYBA 4BDYA 3LCNA 4BDZA 2K6LA 3LGHA 2BJ3A 3OYEA 1QTGA 3OYKA 2WVFA 2CAXA 3S3NA 1P94A 4HV0A 1B28A 2CADA 4E7IA 1BDTA 3L2UA 2WVEA 2KELA 1BDVA 1NLAA 2RBFA 2W04A 1Q5VA 2JXHA 2AY0A 3S3OA 4BACA 3GXQA 2BJ7A 2GPEA 2BNZA 2BJ1A 3VW4A 5FROA 2JXGA 2JPSA 3H87C 3OYFA 1IRQA 5FRNA 3L2WA 2V75A 2CPGA 3OY9A 3OYCA 2HZVA 1X93A 1B01A 4BE0A 2CAJA 3VEAA 4E7JA 1MYKA 2WVDA 3OS2A 1EA4A 4BE2A 4ZTJA 1MYLA 3OYNA 3OD2A 1BAZA 4ZTFA 4E7LA 2HZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NLA A;  4ME7 E;  2CPG A;  2RBF A;  2K29 A;  2CA9 A;  1Q5V A;  2WVB A;  2BA3 A;  2HZV A;  3QOQ A;  3FT7 A;  2BSQ E;  1X93 A;  2JXH A;  4D8J A;  1B01 A;  2CAJ A;  2K9I A;  2AY0 A;  1PAR A;  3GXQ A;  2BNW A;  3VEA A;  2K6L A;  3LGH A;  2BJ3 A;  2BJ7 A;  1MNT A;  2GPE A;  2H1O E;  1QTG A;  2K5J A;  1MYK A;  2BJ1 A;  3VW4 A;  4FXE A;  2WVD A;  2BNZ A;  1ARQ A;  2JXG A;  1EA4 A;  2WVF A;  2WVC A;  2BJ9 A;  2CAX A;  2JXI A;  1P94 A;  1U9P A;  4HV0 A;  3FMT A;  1MYL A;  2CAD A;  1B28 A;  1ARR A;  3H87 C;  1BDT A;  3OD2 A;  2WVE A;  1IRQ A;  1BAZ A;  2K1O A;  2KEL A;  1BDV A;  2HZA A;  3VEB A;  2BJ8 A; 
#chains in the Genus database with same CATH topology
 4ME7 E;  3FHG A;  4E7H A;  4O4R A;  4AI5 A;  4AAI A;  1NKU A;  4PII A;  2WVB A;  2KOE A;  3UPF A;  2OFK A;  3FT7 A;  2Q2K A;  3LJP A;  4E9F A;  3OYG A;  3L2Q A;  1XQP A;  3OYD A;  1DIZ A;  3SFG A;  1YQK A;  1FN7 A;  2BNW A;  3NAI A;  1MNT A;  1SH3 A;  2H1O E;  2K5J A;  3NNQ A;  1ARQ A;  1M3Q A;  4FXE A;  4YPR A;  3CVT A;  3KNT A;  4IKF A;  2WVC A;  4NRU A;  3UQS A;  2JXI A;  1U9P A;  4E7K A;  3OYH A;  3FMT A;  3OS0 A;  1ARR A;  3OYJ A;  3G5O A;  5AN4 A;  1MUN A;  1SIW A;  2K1O A;  4EA5 A;  4HSB A;  4UOB A;  3OYM A;  4NRT A;  3OYL A;  3OH6 A;  3VEB A;  4E9H A;  1KQJ A;  2NOB A;  2BJ9 A;  2BJ8 A;  3L2V A;  2JBV A;  2K29 A;  2CA9 A;  3OYI A;  1LWV A;  2BA3 A;  1PU7 A;  1Q16 A;  3OS1 A;  4QPX A;  4D8J A;  4NZG A;  2W03 A;  3OYA A;  3L2R A;  3QOQ A;  4OFH A;  2K9I A;  3KTU A;  4B21 A;  4BE1 A;  3OGD A;  3S3M A;  5FRM A;  1PAR A;  3OYB A;  1PU6 A;  1P7M A;  4BDY A;  3LCN A;  2JHJ A;  1KG3 A;  3D4V A;  3CVS A;  4BDZ A;  4EA4 A;  1VRL A;  1KG2 A;  1LWW A;  4EJZ A;  2K6L A;  3N5N X;  3G0Q A;  2BJ3 A;  3LGH A;  3H5Y A;  3OYE A;  1QTG A;  3FSP A;  4AIA A;  4UNF A;  3OYK A;  1N3A A;  2WVF A;  1MUY A;  2JHN A;  1YQR A;  3S3N A;  2CAX A;  3FHF A;  4YOQ A;  3R2X C;  1OG7 A;  1P94 A;  1SH0 A;  2CAD A;  4LRV A;  1KG7 A;  2H56 A;  2NOZ A;  1B28 A;  4E7I A;  1BDT A;  2HZA A;  3L2U A;  1NGN A;  1KG6 A;  2WVE A;  5KN9 A;  3I0W A;  4MJW A;  1YQM A;  1KO9 A;  1XQO A;  2ABK A;  1OHN A;  2KEL A;  3SFU A;  2NOI A;  1XG7 A;  1BDV A;  1HU0 A;  3NAH A;  1NLA A;  1P59 A;  5CHZ A;  2RBF A;  1N3C A;  4B24 A;  2W04 A;  1LWY A;  1Q5V A;  1M3H A;  3IR7 A;  2JXH A;  2AY0 A;  1U84 A;  3IHO A;  3S3O A;  2BSQ E;  3CW7 A;  2KKE A;  4BAC A;  3GXQ A;  4OFE A;  2B43 A;  3H5X A;  3CWS A;  3BSO A;  2AN7 A;  2BJ7 A;  2GPE A;  3F10 A;  2BNZ A;  2BJ1 A;  3VW4 A;  1PU8 A;  2NOE A;  5FRO A;  2JXG A;  2JPS A;  1RRQ A;  2NOH A;  2UUT A;  3NO7 A;  2H3A A;  3H87 C;  2CKW A;  3OYF A;  3CWU A;  1ORP A;  3OH9 A;  1IRQ A;  1MPG A;  5FRN A;  2ADL A;  3QID A;  3L2W A;  2I5W A;  1KG4 A;  2V75 A;  1MUD A;  1ORN A;  5KN8 A;  2NOL A;  4E9E A;  2CPG A;  3OY9 A;  3OYC A;  1LMZ A;  4B22 A;  4B23 A;  2HZV A;  4EW4 A;  1X93 A;  3UR0 A;  4BE0 A;  4YPH A;  2NOF A;  2CAJ A;  1B01 A;  4DK9 A;  3BSN A;  1KEA A;  2JG6 A;  1SH2 A;  4HV0 A;  2WK4 A;  3CWA A;  4LQ9 A;  3F0Z A;  3VEA A;  1WEF A;  2YG8 A;  2A2B A;  4EJY A;  4E7J A;  3CWT A;  1MYK A;  3S6I A;  1N39 A;  1PVS A;  3OS2 A;  1KG5 A;  2OFI A;  2WVD A;  4E9G A;  1EA4 A;  1YQL A;  3IH7 A;  1WEG A;  4BE2 A;  4ZTJ A;  2YG9 A;  2XHI A;  3I0X A;  1MYL A;  2UUW A;  4EVV A;  3OYN A;  5DPK A;  3OD2 A;  4OFA A;  1RRS A;  1BAZ A;  4ZTF A;  4AI4 A;  4LQ3 A;  4E7L A;  1WEI A;  1EBM A;  3NNE A;  3N0U A;  4EW0 A; 
#chains in the Genus database with same CATH homology
 4ME7 E;  4E7H A;  2WVB A;  3FT7 A;  3OYG A;  3L2Q A;  3OYD A;  2BNW A;  1MNT A;  2H1O E;  2K5J A;  3NNQ A;  1ARQ A;  4FXE A;  4IKF A;  2WVC A;  2JXI A;  1U9P A;  4E7K A;  3OYH A;  3FMT A;  3OS0 A;  1ARR A;  3OYJ A;  2K1O A;  3OYM A;  3OYL A;  3VEB A;  2BJ8 A;  2BJ9 A;  3L2V A;  2K29 A;  2CA9 A;  3OYI A;  2BA3 A;  3QOQ A;  2BSQ E;  3OS1 A;  4D8J A;  3OYA A;  4NZG A;  2W03 A;  3L2R A;  2K9I A;  3S3M A;  4BE1 A;  1PAR A;  5FRM A;  3OYB A;  4BDY A;  3LCN A;  4BDZ A;  2K6L A;  3LGH A;  2BJ3 A;  3OYE A;  1QTG A;  3OYK A;  2WVF A;  2CAX A;  3S3N A;  1P94 A;  4HV0 A;  1B28 A;  2CAD A;  4E7I A;  1BDT A;  3L2U A;  2WVE A;  2KEL A;  1BDV A;  1NLA A;  2RBF A;  2W04 A;  1Q5V A;  2JXH A;  2AY0 A;  3S3O A;  4BAC A;  3GXQ A;  2BJ7 A;  2GPE A;  2BNZ A;  2BJ1 A;  3VW4 A;  5FRO A;  2JXG A;  2JPS A;  3H87 C;  3OYF A;  1IRQ A;  5FRN A;  3L2W A;  2V75 A;  2CPG A;  3OY9 A;  3OYC A;  2HZV A;  1X93 A;  1B01 A;  4BE0 A;  2CAJ A;  3VEA A;  4E7J A;  1MYK A;  2WVD A;  3OS2 A;  1EA4 A;  4BE2 A;  4ZTJ A;  1MYL A;  3OYN A;  3OD2 A;  1BAZ A;  4ZTF A;  4E7L A;  2HZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...