3VW4A

Crystal structure of the dna-binding domain of cole2-p9 rep in complex with the replication origin
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
122
structure length
122
Chain Sequence
HHHHHRNYHLFEKVRKWAYRAIRQGWPVFSQWLDAVIQRVEMYNASLPVPLSPAECRAIGKSIAKYTHRKFSPEGFSAVQAARGRKGGTKSKRAAVPTSARSLKPWEALGISRATYYRKLKC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Rep
publication title Structural Basis for Replication Origin Unwinding by An Initiator-Primase of Plasmid ColE2-P9: Duplex DNA Unwinding by A Single Protein
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein/dna
total genus 39
structure length 122
sequence length 122
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.340.50 Mainly Alpha Orthogonal Bundle Endonuclease III; domain 1 Endonuclease III; domain 1 3vw4A01
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3vw4A02
3VW4A 4D8JA 3QOQA 1MYLA 2CPGA 1X93A 2BJ3A 2WVCA 2K1OA 2HZAA 2K9IA 2HZVA 2K5JA 3H87C 2BJ1A 2H1OE 1EA4A 1B01A 3GXQA 2KELA 1MNTA 3VEAA 2WVBA 2K29A 1BDTA 2BNWA 1ARQA 1IRQA 3VEBA 4FXEA 1QTGA 2WVEA 1NLAA 1MYKA 2BJ7A 2JXGA 3OD2A 4ME7E 4HV0A 2RBFA 3FT7A 2WVFA 1PARA 3FMTA 2GPEA 2BSQE 2BJ9A 2WVDA 1P94A 1ARRA 2CAJA 2CAXA 2K6LA 3LGHA 2CADA 2BNZA 1U9PA 1BAZA 1Q5VA 2BJ8A 1BDVA 2CA9A 2JXHA 1B28A 2BA3A 2JXIA 2AY0A
chains in the Genus database with same CATH superfamily
3VW4A 3H5XA 1MYLA 2H3AA 4E7LA 5AN4A 3OYLA 1SH2A 4E9GA 1MUDA 2NOHA 3I0WA 4B23A 4EVVA 2ADLA 3OYCA 1KO9A 1HU0A 2K29A 3NNEA 3S6IA 1IRQA 3OH9A 4BE2A 1PU6A 2WVEA 3OD2A 4ME7E 1KG3A 2A2BA 3QIDA 1KG2A 2WVDA 4B21A 3G5OA 3OGDA 3LJPA 1NGNA 3SFUA 3LCNA 1OG7A 3OS0A 4E7HA 4QPXA 2CAXA 3NAIA 1KG4A 2YG8A 3OYMA 4PIIA 3KNTA 4EA5A 2AN7A 1RRQA 3R2XC 3I0XA 3BSOA 4UOBA 1WEGA 1WEFA 2W04A 1Q5VA 4LQ3A 2OFIA 1YQLA 2JBVA 2HZAA 2NOLA 2AY0A 2CKWA 2WK4A 2XHIA 4BDZA 4LRVA 3QOQA 2V75A 2BJ3A 3OYGA 2WVCA 3H5YA 1U84A 1ORNA 4MJWA 3CWAA 1KQJA 1B01A 3L2RA 3BSNA 5FRMA 1YQRA 1MNTA 3FHFA 1Q16A 1RRSA 1M3QA 4BACA 2I5WA 2BNWA 3NAHA 1YQKA 3VEBA 4EA4A 2JXGA 4EJZA 4NRUA 2JHJA 3UQSA 1P7MA 3IHOA 3FT7A 2UUTA 1KG7A 2WVFA 1FN7A 4NZGA 5FRNA 1XQPA 3CW7A 1ARRA 2H56A 1P94A 2CAJA 3F10A 2K6LA 4BDYA 4OFEA 3KTUA 2NOFA 1XG7A 1SIWA 4E9EA 3IR7A 4YPHA 1MPGA 3OYJA 1BDVA 2JXHA 3OYHA 2BA3A 4O4RA 4YOQA 4D8JA 3OS2A 1NKUA 2JHNA 1N3AA 3D4VA 4ZTFA 1LWVA 3OYBA 2OFKA 4LQ9A 3L2VA 3CVTA 2K5JA 2K9IA 1P59A 2JPSA 2H1OE 1LWWA 5KN8A 3F0ZA 3GXQA 5CHZA 3CVSA 4B24A 3OS1A 2B43A 1BDTA 1ARQA 4EW0A 4E7JA 4FXEA 1QTGA 2BJ7A 1MYKA 4BE0A 2RBFA 1M3HA 2NOBA 2KOEA 1PU7A 1N3CA 2KKEA 4OFAA 5DPKA 3FMTA 3OYFA 1MUNA 3OY9A 4DK9A 2BJ9A 1XQOA 1MUYA 4IKFA 1DIZA 3FSPA 3UR0A 4E9FA 3L2WA 3S3OA 3NNQA 2JG6A 1U9PA 3OYAA 5KN9A 3L2UA 3UPFA 4E9HA 2BJ8A 2CA9A 1B28A 1KG5A 4YPRA 3OYEA 4E7KA 2CPGA 1X93A 2NOZA 2K1OA 3FHGA 3S3MA 2HZVA 1ORPA 3H87C 4EW4A 2BJ1A 4AIAA 3OYKA 2NOEA 1EA4A 4E7IA 3S3NA 5FROA 2KELA 1SH3A 2WVBA 4OFHA 2UUWA 2Q2KA 1LWYA 1LMZA 2ABKA 3OYNA 1NLAA 4UNFA 4NRTA 3SFGA 4HV0A 1KEAA 3N5NX 3CWTA 3OH6A 4EJYA 1OHNA 1VRLA 1PARA 3OYIA 3G0QA 1EBMA 2GPEA 4AAIA 4AI5A 2W03A 2BSQE 1PVSA 1SH0A 2JXIA 3CWUA 1WEIA 1YQMA 4BE1A 4ZTJA 3LGHA 4AI4A 3IH7A 4HSBA 2CADA 2BNZA 1N39A 1BAZA 2NOIA 1KG6A 3N0UA 4B22A 3CWSA 1PU8A 3OYDA 2YG9A 3NO7A 3L2QA 3VEAA
chains in the Genus database with same CATH topology
3VW4A 1MYLA 4E7LA 3OYLA 3OYCA 2K29A 1IRQA 4BE2A 2WVEA 3OD2A 4ME7E 2WVDA 3LCNA 3OS0A 4E7HA 2CAXA 3OYMA 2W04A 1Q5VA 2HZAA 2AY0A 3QOQA 4BDZA 2V75A 2BJ3A 3OYGA 2WVCA 1B01A 3L2RA 5FRMA 1MNTA 4BACA 2BNWA 3VEBA 2JXGA 3FT7A 2WVFA 4NZGA 5FRNA 1P94A 1ARRA 2CAJA 2K6LA 4BDYA 3OYJA 1BDVA 2JXHA 2BA3A 3OYHA 4D8JA 3OS2A 4ZTFA 3OYBA 3L2VA 2K9IA 2K5JA 2JPSA 2H1OE 3GXQA 3OS1A 1BDTA 1ARQA 4E7JA 4FXEA 1QTGA 2BJ7A 1MYKA 4BE0A 2RBFA 3FMTA 3OYFA 2BJ9A 3OY9A 4IKFA 3L2WA 3S3OA 3NNQA 1U9PA 3OYAA 3L2UA 2BJ8A 2CA9A 1B28A 3OYEA 4E7KA 2CPGA 1X93A 2K1OA 3S3MA 2HZVA 3H87C 2BJ1A 3OYKA 1EA4A 4E7IA 3S3NA 5FROA 2KELA 2WVBA 4HV0A 3OYNA 1NLAA 1PARA 3OYIA 2GPEA 2BSQE 2W03A 2JXIA 4BE1A 4ZTJA 3LGHA 2CADA 2BNZA 1BAZA 3OYDA 3L2QA 3VEAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VW4 A;  4D8J A;  3QOQ A;  1MYL A;  2CPG A;  1X93 A;  2BJ3 A;  2WVC A;  2K1O A;  2HZA A;  2K9I A;  2HZV A;  2K5J A;  3H87 C;  2BJ1 A;  2H1O E;  1EA4 A;  1B01 A;  3GXQ A;  2KEL A;  1MNT A;  3VEA A;  2WVB A;  2K29 A;  1BDT A;  2BNW A;  1ARQ A;  1IRQ A;  3VEB A;  4FXE A;  1QTG A;  2WVE A;  1NLA A;  1MYK A;  2BJ7 A;  2JXG A;  3OD2 A;  4ME7 E;  4HV0 A;  2RBF A;  3FT7 A;  2WVF A;  1PAR A;  3FMT A;  2GPE A;  2BSQ E;  2BJ9 A;  2WVD A;  1P94 A;  1ARR A;  2CAJ A;  2CAX A;  2K6L A;  3LGH A;  2CAD A;  2BNZ A;  1U9P A;  1BAZ A;  1Q5V A;  2BJ8 A;  1BDV A;  2CA9 A;  2JXH A;  1B28 A;  2BA3 A;  2JXI A;  2AY0 A; 
#chains in the Genus database with same CATH topology
 3VW4 A;  3H5X A;  1MYL A;  2H3A A;  4E7L A;  5AN4 A;  3OYL A;  1SH2 A;  4E9G A;  1MUD A;  2NOH A;  3I0W A;  4B23 A;  4EVV A;  2ADL A;  3OYC A;  1KO9 A;  1HU0 A;  2K29 A;  3NNE A;  3S6I A;  1IRQ A;  3OH9 A;  4BE2 A;  1PU6 A;  2WVE A;  3OD2 A;  4ME7 E;  1KG3 A;  2A2B A;  3QID A;  1KG2 A;  2WVD A;  4B21 A;  3G5O A;  3OGD A;  3LJP A;  1NGN A;  3SFU A;  3LCN A;  1OG7 A;  3OS0 A;  4E7H A;  4QPX A;  2CAX A;  3NAI A;  1KG4 A;  2YG8 A;  3OYM A;  4PII A;  3KNT A;  4EA5 A;  2AN7 A;  1RRQ A;  3R2X C;  3I0X A;  3BSO A;  4UOB A;  1WEG A;  1WEF A;  2W04 A;  1Q5V A;  4LQ3 A;  2OFI A;  1YQL A;  2JBV A;  2HZA A;  2NOL A;  2AY0 A;  2CKW A;  2WK4 A;  2XHI A;  4BDZ A;  4LRV A;  3QOQ A;  2V75 A;  2BJ3 A;  3OYG A;  2WVC A;  3H5Y A;  1U84 A;  1ORN A;  4MJW A;  3CWA A;  1KQJ A;  1B01 A;  3L2R A;  3BSN A;  5FRM A;  1YQR A;  1MNT A;  3FHF A;  1Q16 A;  1RRS A;  1M3Q A;  4BAC A;  2I5W A;  2BNW A;  3NAH A;  1YQK A;  3VEB A;  4EA4 A;  2JXG A;  4EJZ A;  4NRU A;  2JHJ A;  3UQS A;  1P7M A;  3IHO A;  3FT7 A;  2UUT A;  1KG7 A;  2WVF A;  1FN7 A;  4NZG A;  5FRN A;  1XQP A;  3CW7 A;  1ARR A;  2H56 A;  1P94 A;  2CAJ A;  3F10 A;  2K6L A;  4BDY A;  4OFE A;  3KTU A;  2NOF A;  1XG7 A;  1SIW A;  4E9E A;  3IR7 A;  4YPH A;  1MPG A;  3OYJ A;  1BDV A;  2JXH A;  3OYH A;  2BA3 A;  4O4R A;  4YOQ A;  4D8J A;  3OS2 A;  1NKU A;  2JHN A;  1N3A A;  3D4V A;  4ZTF A;  1LWV A;  3OYB A;  2OFK A;  4LQ9 A;  3L2V A;  3CVT A;  2K5J A;  2K9I A;  1P59 A;  2JPS A;  2H1O E;  1LWW A;  5KN8 A;  3F0Z A;  3GXQ A;  5CHZ A;  3CVS A;  4B24 A;  3OS1 A;  2B43 A;  1BDT A;  1ARQ A;  4EW0 A;  4E7J A;  4FXE A;  1QTG A;  2BJ7 A;  1MYK A;  4BE0 A;  2RBF A;  1M3H A;  2NOB A;  2KOE A;  1PU7 A;  1N3C A;  2KKE A;  4OFA A;  5DPK A;  3FMT A;  3OYF A;  1MUN A;  3OY9 A;  4DK9 A;  2BJ9 A;  1XQO A;  1MUY A;  4IKF A;  1DIZ A;  3FSP A;  3UR0 A;  4E9F A;  3L2W A;  3S3O A;  3NNQ A;  2JG6 A;  1U9P A;  3OYA A;  5KN9 A;  3L2U A;  3UPF A;  4E9H A;  2BJ8 A;  2CA9 A;  1B28 A;  1KG5 A;  4YPR A;  3OYE A;  4E7K A;  2CPG A;  1X93 A;  2NOZ A;  2K1O A;  3FHG A;  3S3M A;  2HZV A;  1ORP A;  3H87 C;  4EW4 A;  2BJ1 A;  4AIA A;  3OYK A;  2NOE A;  1EA4 A;  4E7I A;  3S3N A;  5FRO A;  2KEL A;  1SH3 A;  2WVB A;  4OFH A;  2UUW A;  2Q2K A;  1LWY A;  1LMZ A;  2ABK A;  3OYN A;  1NLA A;  4UNF A;  4NRT A;  3SFG A;  4HV0 A;  1KEA A;  3N5N X;  3CWT A;  3OH6 A;  4EJY A;  1OHN A;  1VRL A;  1PAR A;  3OYI A;  3G0Q A;  1EBM A;  2GPE A;  4AAI A;  4AI5 A;  2W03 A;  2BSQ E;  1PVS A;  1SH0 A;  2JXI A;  3CWU A;  1WEI A;  1YQM A;  4BE1 A;  4ZTJ A;  3LGH A;  4AI4 A;  3IH7 A;  4HSB A;  2CAD A;  2BNZ A;  1N39 A;  1BAZ A;  2NOI A;  1KG6 A;  3N0U A;  4B22 A;  3CWS A;  1PU8 A;  3OYD A;  2YG9 A;  3NO7 A;  3L2Q A;  3VEA A; 
#chains in the Genus database with same CATH homology
 3VW4 A;  1MYL A;  4E7L A;  3OYL A;  3OYC A;  2K29 A;  1IRQ A;  4BE2 A;  2WVE A;  3OD2 A;  4ME7 E;  2WVD A;  3LCN A;  3OS0 A;  4E7H A;  2CAX A;  3OYM A;  2W04 A;  1Q5V A;  2HZA A;  2AY0 A;  3QOQ A;  4BDZ A;  2V75 A;  2BJ3 A;  3OYG A;  2WVC A;  1B01 A;  3L2R A;  5FRM A;  1MNT A;  4BAC A;  2BNW A;  3VEB A;  2JXG A;  3FT7 A;  2WVF A;  4NZG A;  5FRN A;  1P94 A;  1ARR A;  2CAJ A;  2K6L A;  4BDY A;  3OYJ A;  1BDV A;  2JXH A;  2BA3 A;  3OYH A;  4D8J A;  3OS2 A;  4ZTF A;  3OYB A;  3L2V A;  2K9I A;  2K5J A;  2JPS A;  2H1O E;  3GXQ A;  3OS1 A;  1BDT A;  1ARQ A;  4E7J A;  4FXE A;  1QTG A;  2BJ7 A;  1MYK A;  4BE0 A;  2RBF A;  3FMT A;  3OYF A;  2BJ9 A;  3OY9 A;  4IKF A;  3L2W A;  3S3O A;  3NNQ A;  1U9P A;  3OYA A;  3L2U A;  2BJ8 A;  2CA9 A;  1B28 A;  3OYE A;  4E7K A;  2CPG A;  1X93 A;  2K1O A;  3S3M A;  2HZV A;  3H87 C;  2BJ1 A;  3OYK A;  1EA4 A;  4E7I A;  3S3N A;  5FRO A;  2KEL A;  2WVB A;  4HV0 A;  3OYN A;  1NLA A;  1PAR A;  3OYI A;  2GPE A;  2BSQ E;  2W03 A;  2JXI A;  4BE1 A;  4ZTJ A;  3LGH A;  2CAD A;  2BNZ A;  1BAZ A;  3OYD A;  3L2Q A;  3VEA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...