3VW7A

Crystal structure of human protease-activated receptor 1 (par1) bound with antagonist vorapaxar at 2.2 angstrom
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
447
structure length
442
Chain Sequence
DASGYLTSSWLTLFVPSVYTGVFVVSLPLNIMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTAAFYCNMYASILLMTVISIDRFLAVVYPMRTLGRASFTCLAIWALAIAGVVPLLLKEQTIQVPGLGITTCHDVLSETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSANIFEMLRIDEGLRLKIYKNTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDAYANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVSSISCCIDPLIYYYASSEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of human protease-activated receptor 1
pubmed doi rcsb
molecule keywords Proteinase-activated receptor 1, Lysozyme
molecule tags Signaling protein/antagonist
source organism Homo sapiens
total genus 165
structure length 442
sequence length 447
ec nomenclature ec 3.2.1.17: Lysozyme.
pdb deposition date 2012-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00959 Phage_lysozyme Phage lysozyme
A PF00001 7tm_1 7 transmembrane receptor (rhodopsin family)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.530.40 Mainly Alpha Orthogonal Bundle Lysozyme Lysozyme 3vw7A02
1.20.1070.10 Mainly Alpha Up-down Bundle Rhopdopsin 7-helix transmembrane proteins Rhopdopsin 7-helix transmembrane proteins 3vw7A01
1L52A 3CAPA 4ARLA 1L42A 1H2SA 4I7LA 1VGOA 4FA7B 258LA 1LGUA 252LA 4W54A 2KSAA 4GBRA 1C6GA 1L93A 1E0PA 4I7KA 236LA 4NC3A 1C6CA 2I21A 3DMVA 1Q5IA 1L80A 3OE9A 107LA 165LA 4W57A 4W58A 1L09A 2JAFA 210LA 1TN5A 1JTMA 2OTYX 1M0KA 2HPYA 6LZMA 4A4MA 2YCWA 5JJNA 5I14A 3AYNA 3C9MA 1L33A 3HH3A 1M0LA 1G06A 1S53A 2NTHA 3UZCA 4BVNA 3HTDA 3DQBA 4UHRA 129LA 1ZYTA 5AX1A 217LA 5B6VA 1XJUA 1LYIA 4BEZA 150LA 2OTZX 1L72A 3C8RA 4DKLA 125LA 1C6LA 1G1VA 197LA 1P64A 3SBAA 1KMEA 4G71B 2RBRA 4JQ6A 1C6QA 1LWKA 234LA 243LA 5H2MA 3S8GB 1QT5A 1R2NA 1L36A 118LA 1E12A 161LA 3NS0A 141LA 4MD1A 3DN6A 4XTOA 1L11A 3CDRA 1QKOA 5AHZA 1L28A 1C67A 2LCBA 1OWZA 156LA 4I7NA 4J4QA 3T45A 1QM8A 3UG9A 4GP5B 2Y01A 3HU8A 2Q9EA 3DNAA 3PWHA 3UTXA 2OU9A 211LA 2O7AA 2Y02A 1S54A 2Y03A 3ZPRA 1XJIA 1SX7A 4JR8A 5BR2A 1C6HA 2R4SA 151LA 3OE6A 254LA 2F95A 1P8IA 3SB5A 1L60A 1PQDA 1KW7A 3QBIA 2X72A 3S3BB 181LA 3COCA 1DYFA 2LZMA 2QB0B 2ANVA 3CDTA 4I7TA 4G70B 4BV0A 3QJRB 130LA 2BRDA 5J7AA 4ZPUA 1QSQA 1SWZA 1F4ZA 1L49A 1QUHA 232LA 1L0JA 4X32A 1LWGA 2RB0X 1T8AA 1UCQA 178LA 1QSBA 3DN2A 3K2RA 1BRRA 259LA 5AX0A 157LA 224LA 1FBKA 1BRXA 1L26A 1OV7A 2Z6BA 5G2CA 1QUDA 1Q5JA 1AP9A 4XTLA 222LA 2B73A 2B7XA 2RBOA 4UG2A 1O0AA 111LA 1D3JA 1G0KA 1L02A 1PQJA 1SSWA 3FADA 3ZEVA 4I7SA 4I7MA 4EPFA 1P37A 1XJTA 5ITEA 3WQJA 1L96A 3P0GA 3AYMA 3QBGA 1L62A 5B6WA 1BRDA 2LNLA 1L51A 4OV0A 1P6YA 5DHHA 1ZURA 1G1WA 4LDLA 1L71A 2I20A 3VW7A 3QBKA 1T8FA 4IB4A 5B6ZA 3UONA 219LA 3D4SA 4GP8B 250LA 3PXOA 159LA 5DYSA 3QBLA 120LA 2Q9DA 5ETZA 2B75A 4AQNA 1X0K1 1XMEB 233LA 1SWYA 3HANA 3G3VA 4YXAC 3DN4A 4N4WA 4ARQA 230LA 2ANXA 1L83A 1X0I1 1H68A 2OE7X 1KNIA 3HUQA 1L57A 3HAPA 163LA 1LW9A 1C8SA 2YDOA 4FPDA 1L69A 1LPYA 1LYGA 3OE0A 158LA 1QHJA 3L2XA 195LA 4EKSA 2NTWA 3FI5A 1JQUA 1G0QA 4PXKA 1QS9A 1QTZA 172LA 1JV6A 1OV5A 229LA 4KLYA 185LA 4IAPA 1KG9A 245LA 2F32A 3HTBA 1C6BA 4TL3A 1DZEA 1G07A 4MD2A 253LA 1PQMA 1QT6A 2Z55A 3DMZA 138LA 119LA 3HUAA 1L73A 1SSYA 1L76A 126LA 173LA 4W52A 1C61A 1L97A 1P2LA 225LA 3SB8A 1L38A 1L45A 140LA 1S52A 216LA 1KY1A 1CV6A 7LZMA 1ZWNA 3PQRA 4FBZA 3HH6A 3JR6A 2YCXA 3HT9A 1L00A 4GYCA 4JKVA 3G3WA 4LZMA 4OO9A 2YCZA 127LA 1L79A 2F47A 3C83A 4IAQA 1HZXA 1CWQA 2RBQA 1P5CA 187LA 5G53A 2RAZX 1C6FA 3REYA 3ODUA 4EKRA 4W55A 1L74A 1QTBA 226LA 1PQOA 1QTCA 257LA 1T6HA 2IGCA 1PXSA 1I6SA 1OVJA 2RBNA 1P56A 5H2NA 1CX6A 1LI3A 5B6YA 2OE4X 5FJGA 5C1MA 1QS5A 1MGYA 1KG8A 108LA 3HH5A 1QTVA 201LA 1CV0A 1LYDA 3OAXA 3GUMA 213LA 4EKQA 3PBLA 1L0MA 1L92A 1L9HA 3DN8A 3ABWA 1K28A 1L56A 1KW5A 260LA 1CUQA 4G7SB 5KKHA 4DJHA 2RH1A 3HTFA 1C6MA 1OWYA 4ARMB 1L20A 3G3XA 3QJQB 1G0LA 182LA 1L39A 4HYXA 1CVKA 3HASA 212LA 2WJKA 4DAJA 5G28A 1PXRA 3SB9A 3MBVA 5EN0A 1C65A 1DYAA 4PJZA 3GUJA 3X3BA 1P8UA 1L16A 3HARA 1PQIA 1L66A 1L43A 1T8GA 246LA 1CV4A 1XIOA 5AHYA 3HT6A 1VJMA 109LA 191LA 1OVKA 2R4RA 1DYBA 1L29A 3HTGA 3SN6R 3C7WA 4EPIA 3GUKA 4G72B 1LI6A 160LA 248LA 2B74A 5G36A 4XT1A 184LA 1L54A 2OEAX 162LA 2Z73A 1X0SA 4QI1A 2KSBA 1P8HA 2KSYA 1C69A 114LA 4GBRB 3QJUB 110LA 3RUNA 5LWEA 3S8FB 1BM1A 4PK0A 5AWZA 1JTNA 1L35A 2QARC 3HU9A 1JV7A 4XT3A 1L08A 1OYUA 4MQTA 3DN3A 1L94A 192LA 3NY8A 1TN0A 2B6TA 4W59A 1C6NA 209LA 1L85A 205LA 4K5YA 3QJVB 3NSBA 3VVKA 112LA 3CDVA 1C60A 1IW6A 1XEPA 1LYHA 1DYDA 4AMIA 171LA 1L22A 3EH3B 1D3NA 1CV5A 1L06A 2LC9A 155LA 5B34A 1LYJA 1L48A 1CTWA 1CU2A 1C64A 1QUOA 4GPOA 5G54A 5H2KA 3CDQA 5TGZA 1P7SA 4W56A 102LA 1DYGA 2HULA 1EPYA 223LA 1QTHA 5H2JA 2NTGA 3EH4B 1LN6A 1L41A 4IARA 4PXFA 1C68A 1L91A 4EIYA 3HDEA 261LA 221LA 247LA 143LA 251LA 3RZEA 3DN0A 3PDSA 1PQKA 4ARJA 3V2YA 1M0MA 1LGXA 3SBBC 3C8SA 2YDVA 1L44A 2L6XA 4I7JA 1WTHA 148LE 1L07A 2G87A 147LA 3QAKA 164LA 199LA 3S3CB 167LA 4W53A 4EKPA 231LA 5H2HA 3HWLA 3LZMA 4QIDA 1CU0A 4MBSA 1S8JA 149LA 1L14A 198LA 3SB7A 5A44A 3BVDB 166LA 3DN1A 1NHBA 262LA 1L50A 1PY6A 131LA 4I7RA 1QKPA 1C6IA 3HDFA 3NYAA 2I35A 1L10A 188LA 1LYEA 2QPEB 180LA 3HAOA 1P3NA 4MQSA 139LA 2NTUA 3UTWA 1DYCA 235LA 2A4TA 1L95A 4EA3A 1L59A 1C6JA 4AMJA 1L65A 1L61A 4L6RA 1L67A 2Y04A 1G0PA 169LA 3C81A 2B6WA 4WAVA 3HT7A 5H2OA 3RFMA 1L81A 2B6YA 2RB1X 1C3WA 5F8UA 177LA 5A8EA 103LA 249LA 2L78A 1L03A 1D2WA 1L34A 4XXJA 2O4WA 1TLAA 1L37A 4HYJA 144LA 1KS3A 1B6IA 2OE9X 3VGAA 189LA 113LA 1KY0A 1L46A 1C6DA 4WW3A 1R84A 3A7KA 220LA 4FAAB 3GUNA 5A45A 5LZMA 2ZZLA 2Y00A 1L17A 1LI2A 1QT3A 3QDCA 4XTNA 1L53A 5B6XA 1L86A 3GULA 1GU8A 1L15A 2HUKA 1CX7A 4HWLA 3HUKA 4LDOA 3QAPA 1CU3A 1C62A 1L12A 3CDOA 215LA 1L19A 1G0JA 2F2QA 4ARQB 3X3CA 1L64A 1L88A 214LA 1S51A 228LA 5B35A 3UTYA 4YX7C 128LA 3SB6A 3S3DB 1CV3A 3NY9A 3GUPA 170LA 1LYFA 4ARPA 2B6XA 1G0MA 237LA 1QT4A 4X1HA 4I7OA 186LA 104LA 5BR5A 1QTDA 1L13A 1QUGA 1SX2A 2OU8A 1LGWA 183LA 5H2IA 1S8LA 1LLHA 1JFPA 242LA 1CUPA 3EMLA 5B0WA 1L18A 239LA 1C6TA 2JAGA 1L98A 3C8QA 1AT9A 5G2DA 1U19A 2WJLA 1C66A 5ITCA 1L30A 1QT8A 1C6EA 3L64A 1L27A 1L63A 218LA 2RB2X 4YXCA 5AZDA 123LA 1QT7A 4S0WA 1CU6A 2B72A 2RBSA 3DMXA 2VT4A 2AT9A 1L99A 1L58A 1C63A 2HUMA 3VHZA 175LA 1D3MA 3OE8A 255LA 5G2AA 1L55A 2RBPA 1DYEA 137LA 3C82A 1IXFA 1C6AA 1C6KA 1L05A 3V2WA 4EXMA 3CODA 240LA 1CU5A 1CV1A 4G7RB 2B6ZA 2OU0X 4QRYA 1L90A 3ZPQA 4X31A 122LA 4KNFA 3GUIA 1L47A 1L87A 200LA 4G7QB 4E97A 115LA 1L77A 1KGBA 3VG9A 1L01A 3C7YA 1L82A 2F93A 3UZAA 142LA 1L89A 1C8RA 4I7PA 4BEYA 1L0KA 5DHGA 1G0GA 5JJJA 3HH4A 1D2YA 238LA 4N4YB 1P46A 1L84A 227LA 145LA 2QPDB 152LA 1L31A 1D3FA 241LA 3HT8A 3KJ6A 2M3GA 2YCYA 3C9LA 3QJSB 1IW9A 190LA 3UTVA 4BUOA 1UAZA 1L75A 5B2NA 4Y9HA 1P2RA 244LA 1L70A 1L68A 1OVHA 256LA 1D9WA 4ARMA 3VI0A 4BWBA 2PEDA 4N6HA 2I1XA 2B70A 4L35A 3DKEX 1F88A 1C6PA 2J4YA 5H2PA 1L04A 2O79A 2EI4A 2ZFEA 1F50A 206LA 174LA 1EHKB 3HAQA 5JJEA 1P36A 1L23A 1FBBA 1GZMA 168LA 3FA0A 4EJ4A 1L32A 4GP4B 5H2LA 3C7ZA 4GRVA 2RAYX 4I7QA 3QJTB 1JGJA 4LDEA 1GUEA 1L25A 3F8VA 2ZIYA 1T97A 3GUOA 146LA 3EH5B 196LA 3F9LA 4W51A 2KS9A 3C80A 1L40A 176LA 3AM6A 1L24A 1L21A 3DDLA 2CUUA
chains in the Genus database with same CATH superfamily
1IC5Y 4ZEEA 4AGAA 4ET8A 2KSAA 1L93A 236LA 1GBOA 1GB2A 1GXV2 4W58A 2JAFA 3RU5A 210LA 1LZAA 1JTMA 3WPLA 4A4MA 2YCWA 4HV1A 5I14A 3AYNA 1OUAA 4FDYA 3WW6A 1S53A 3P65A 1WVUA 4HTQA 129LA 1GE1A 1LYIA 1XJUA 2G4QA 3C8RA 3T36A 1LZ6A 197LA 2BQMA 3ATNA 3SBAA 1JKBA 3A6CY 3CDRA 4DC4A 1G7HC 4LYZA 1QKOA 2VB1A 2MEIA 2LCBA 156LA 1GEVA 3T45A 3UG9A 4CJ2A 4MCKA 1GDXA 2CGIA 2O7AA 2Y02A 2Y03A 2MEFA 1SX7A 1C6HA 1VDQA 3N9AA 151LA 1OUCA 1HSXA 2Z12A 1LZCA 4KPMA 1PQDA 1DKKA 1O23A 3COCA 2I6ZA 4H8XA 4G70B 5J7AA 4ML7A 1AKIA 1B7MA 232LA 1L0JA 2CJLA 1OQMA 3AW6A 3K2RA 1BRRA 259LA 224LA 1FBKA 1BRXA 4TTDA 1Q5JA 4XTLA 2B73A 1WVVA 4XJHA 3ZEVA 3WVXA 3B0IA 4EPFA 1XJTA 4TUNA 2Z2FA 5APEA 4OV0A 5DHHA 1G1WA 2I20A 3QBKA 1LMTA 1T8FA 3MGWA 3RNXA 3QNGA 4XJFA 3D4SA 1IWTA 1LJHA 2Q9DA 1XMEB 1X0K1 3DN4A 3LYTA 1X0I1 1EQ4A 4Z98A 1H68A 5APCA 5DLAA 3B72A 4LT1A 2YDOA 4FPDA 4I8SA 1QHJA 1LYOA 4J1BA 4H1PA 2ZNWY 1JQUA 5KKIA 172LA 1JV6A 229LA 1KG9A 1C6BA 4G4HA 4WM2A 1A4VA 1BHZA 1HEPA 3DMZA 1LOZA 1VFBC 1YIKA 1XEJA 1L73A 4EOFA 126LA 4W52A 3SB8A 1HFZA 140LA 1Z55A 1H87A 4RW1A 1B5UA 1ZWNA 3JR6A 1D6PA 3G3WA 127LA 3C83A 1HZXA 187LA 1C6FA 1L74A 1PQOA 5H2NA 1CX6A 2B5ZA 1LI3A 1MGYA 1KG8A 4YEMA 4N1EI 1YKXX 2BQLA 3D3DA 3GUMA 4XJBA 213LA 1NBYC 4LFXA 5LVKA 1GFJA 1JHLA 1L56A 3BKVA 5JENB 1KW5A 1ZVYB 2MEBA 5K7OA 2RH1A 1LZTA 3QJQB 7LYZA 2BQOA 1LZ5A 3G3BB 4WL7A 4DAJA 4H91A 4PJZA 3GUJA 1IP4A 4DD1A 3GXKA 1L66A 4OOOA 1CV4A 1WQNA 5IDDA 5AHYA 109LA 2YSSC 1DYBA 1IY3A 4EPIA 248LA 2B74A 5G36A 4XT1A 4H8YA 4II8A 2Z73A 4GCDA 4CFPA 1X0SA 207LA 1P8HA 1C69A 1J1XY 3QJUB 4KT3A 5LWEA 1IR8A 1BM1A 1D0MA 4XT3A 1L08A 1HSWA 3NY8A 1TN0A 4W59A 1LZYA 1CKGA 2HECA 3B0OA 5KY1A 4K5YA 4O34A 2BQIA 2BQBA 1FLWA 4NGJA 1J1PY 171LA 3QY4A 5LA8A 1D3NA 1UBZA 2LC9A 3EXDA 1VDTA 3CSRA 5B34A 2FYDA 1LYJA 3AB6A 1C64A 4XYYA 1QUOA 5KXNA 5G54A 5H2KA 1JJ3A 1UC0A 1P7SA 4W56A 223LA 2NTGA 3EH4B 1C68A 1L91A 4NHSA 1NDGC 3HDEA 4Z3MA 261LA 3PDSA 1LJ3A 1PQKA 5F9XA 3CQLA 1M0MA 2G4PA 1MLCE 2A7FA 2L6XA 148LE 2G87A 3QAKA 4NGOA 164LA 3S3CB 5H2HA 4MBSA 1S8JA 1I20A 198LA 3SB7A 3TMUA 1NHBA 2DBTA 3W6DA 1QKPA 1C6IA 1FKQA 4NGZA 4PRQA 2QPEB 5KKJA 2NTUA 3UTWA 1GF0A 1L67A 2Y04A 2B6WA 3AGIA 2YBLA 1GF6A 5EBHA 1GWDA 103LA 4H9CA 1P2CC 1TAYA 1D2WA 1L34A 1LYYA 1FLUA 1GF7A 2WARA 1LPIA 1KS3A 1BB7A 189LA 113LA 1LMPA 1MELL 4WW3A 220LA 4FAAB 1XGUC 2Y00A 1IOTA 1LI2A 1QT3A 1UIHA 3QDCA 1L53A 5B6XA 1L15A 1CKCA 1B7RA 4HWLA 1JISA 5KXLA 1CU3A 1G0JA 1LMOA 1DZBX 1L64A 4H93A 4E3UA 1L88A 214LA 1HEMA 228LA 128LA 1F6SA 1BB4A 1B5ZA 1YROA 5LVJA 1LYFA 4ARPA 1LMAA 3WU9A 1OUFA 4I7OA 186LA 5HLLA 4KL7A 1LGWA 5B05A 5H2IA 1S8LA 1CUPA 1L18A 4R6CA 5LYMA 1C6TA 2JAGA 4Z41A 6LYTA 5G2DA 4B4JA 1QT8A 1C6EA 2RB2X 3LHMA 4YXCA 5AZDA 123LA 2EPEA 4S0WA 4KXIA 1GD6A 1UIDA 2F4GA 4B49A 1JKAA 4WM5A 1DYEA 4DDCA 1LJJA 1IXFA 1GBSA 1LJKA 4LT3A 1CV1A 2B6ZA 4IATA 5FDJA 4KNFA 1GF3A 4E97A 2ZQ4A 4GN3A 5B59A 1L0KA 5JJJA 1D2YA 238LA 1L84A 3HFMY 145LA 4XJDA 1L31A 3HT8A 2YCYA 4DD7A 3WVYA 3WU7A 2YBHA 1L75A 4LT2A 1L70A 4OWCA 4ARMA 3P66A 3A95A 1GPQC 4L35A 1GB3A 4G49A 1L04A 2O79A 1LZNA 1F50A 206LA 5JJEA 4ETAA 4HPIA 1P36A 1FBBA 1DI4A 1L32A 1OUBA 4GRVA 5LA5A 2D4KA 3QJTB 1L25A 3A6BY 4WL6A 3LZ2A 196LA 3F9LA 1KIQC 4W51A 4G4BA 2CUUA 1L52A 1VGOA 4FA7B 252LA 1VEDA 2W1LA 1N4FA 4HJVA 1GB0A 5II3A 1Q5IA 1KXXA 4GCFA 4OWEA 2MEDA 2HPYA 1M0KA 4H94A 1LYSA 1LSYA 4J7VA 5JJNA 3C9MA 2DQIY 1M0LA 1B7PA 3HTDA 3DQBA 5AX1A 150LA 4W94A 1L72A 1GB5A 1C6LA 4G71B 2RBRA 1C6QA 1LWKA 5H2MA 4DWXA 1ZV5L 1E12A 3NS0A 141LA 3DN6A 1OWZA 5APDA 1QM8A 1LSBA 2Y01A 3HU8A 1QTEA 4XADA 1S54A 5T3FA 5BR2A 2R4SA 5E4PA 1WQOA 2F95A 2Z19A 3QBIA 4B4IA 2LZMA 2QB0B 3CDTA 4BV0A 130LA 4NIJA 3WU8A 4BAFA 2BRDA 1SWZA 1LHLA 4M6DA 4CHXA 2RB0X 1T8AA 1LZ1A 1L26A 4Z46A 3W3EA 2N5ZA 222LA 111LA 1IC7Y 1SSWA 3ZVQA 1LSFA 6LYZA 2BPUA 2DQDY 2DKVA 5J7CA 5ITEA 3TXIA 3AYMA 1IWYA 1L62A 1BRDA 1JTPL 2C8OA 1ZURA 4LDLA 1EQEA 1L71A 5F16A 4GCBA 1CKHA 250LA 4N8ZA 2YDGA 5DYSA 5ETZA 2B75A 1DQJC 4YXAC 3TXKA 4HTNA 1WQRA 4ARQA 1L83A 3AZ4A 1SLYA 2OE7X 3HUQA 1IWZA 3HAPA 4WMGA 2X0AA 3OE0A 195LA 1HNLA 5ILCA 2NTWA 4NFVA 1G0QA 1LAAA 4DD3A 1QS9A 4GN4A 4KLYA 185LA 4IAPA 245LA 1LSEA 3CB7A 1G07A 2YBJA 1QT6A 1IP1A 4NSHA 4WM4A 119LA 3HUAA 1JITA 1L76A 225LA 1L38A 1S52A 4BS7A 1CV6A 1GFUA 3PQRA 3HH6A 2YCXA 4GYCA 1LCNA 1IP6A 2YCZA 2F47A 1HF4A 4ANRA 4DT3A 1WTNA 3A67Y 1LSZA 2ZIKA 5G53A 1LJFA 2RAZX 4MSTA 2I25L 1CKDA 4EKRA 1QTBA 5KXKA 257LA 1T6HA 1PXSA 1I6SA 2HTXA 2RBNA 1P56A 5FJGA 1CJ8A 201LA 3OAXA 2BQEA 3PBLA 1L9HA 1L92A 1IP7A 2F2NA 2Z18A 2DQAA 1YL0X 4HP0A 5KKHA 1C6MA 1OWYA 1CJ7A 1JIYA 5KXZA 5B1FA 1LZ9A 1YANA 1G0LA 4HYXA 1HEOA 3B0KA 1BGIA 1REYA 1XSFA 3KAMA 3WPJA 1AM7A 2F30A 4DS7E 4HSFA 246LA 1XIOA 4N9RA 4NSIA 191LA 1IIZA 1OVKA 3SN6R 4G72B 3C7WA 162LA 1WQMA 4OWAA 2BQHA 2KSBA 114LA 4GBRB 1BQLY 3RUNA 2C8PA 5AWZA 1JTNA 1L35A 3HU9A 3RW8A 1LZSA 134LA 1L94A 4H90A 4DDAA 205LA 3QJVB 1LTMA 1IW6A 1DYDA 3WXUA 1L22A 3IJUA 2HEAA 2DQFC 1CU2A 4GPOA 3CDQA 5TGZA 1HHLA 1REXA 1LZRA 1QTHA 5H2JA 4WLTA 1XGRC 1LN6A 1LMQA 251LA 1IEEA 3AJNA 1QIOA 1KIPC 5M1YA 4H8ZA 3SBBC 1EQ5A 1L07A 1G7MC 1GDWA 199LA 2AUBA 4W53A 4H9BA 4P2EA 3LZMA 1CU0A 1L14A 5A44A 3EBAB 1GF4A 3A92A 4XENA 1OUGA 4RLNA 3HDFA 5LVGA 3WPKA 5KJ9A 1L10A 4EA3A 1L61A 4WAVA 1YAOA 4J0LA 169LA 1FLYA 4WM3A 5H2OA 1IWXA 1YKYX 1LHJA 1C7PA 5A8EA 1L03A 4XXJA 2Y8PA 1FKVA 1LSAA 144LA 1LKSA 3VGAA 4LT0A 1EL1A 1KY0A 5B06A 1LHHA 5L3HA 3GUNA 5A45A 4XTNA 1GEZA 5DN4A 1GU8A 1CX7A 2IFFY 2Z39A 4NGWA 3HUKA 3QAPA 4ET9A 1L12A 215LA 2F2QA 4DYGA 2ZQ3A 1JJ0A 5B35A 3UTYA 4YX7C 3S3DB 1QDTA 1C43A 1HERA 1BWJA 3NY9A 5A3EA 3GUPA 4H92A 1D0KA 1G0MA 1WQPA 3GXRA 1LHIA 5KXWA 1L13A 1SX2A 1JFPA 242LA 3EMLA 239LA 1W6ZA 4GCCA 1AT9A 1QUSA 1U19A 5ITCA 3A3RX 1LKRA 1GBYA 1GAYA 218LA 3TXJA 1SQ2L 2B72A 3TXHA 2VT4A 3A8ZA 1OUHA 1BVXA 1L58A 1C63A 2DQCY 175LA 4NHTA 2LYMA 2BQNA 1GAZA 3QE8A 4TSCA 1IWVA 5FSTA 1L05A 4PRUA 240LA 4HV2A 1IX0A 3WH1A 3AGHA 4QRYA 3LYMA 3ZPQA 2HU1A 3W6EA 1L01A 3UZAA 4ETBA 5LXWA 1LZ8A 4NWHA 1D3FA 2M3GA 4GLVA 1IORA 1OVHA 256LA 4BWBA 1GE0A 2PEDA 2B70A 1LZGA 3DKEX 5D5FA 1C6PA 5H2PA 2EI4A 2ZFEA 4X3BA 1L23A 5LAGA 3FA0A 1BB6A 3RT5X 1RFPA 5H2LA 2FBBA 1NKHA 4LDEA 1T97A 5C6JA 146LA 3EH5B 5DN5A 3WMKA 4YM8A 3DDLA 3CAPA 1NF5A 5AMYA 4ARLA 1L42A 1GB8A 4I7LA 1H2SA 258LA 1LGUA 3AGGG 1J1OY 1C6GA 1E0PA 4I7KA 4WO9A 2I21A 3DMVA 1IC4Y 1UIGA 1C08C 1L80A 4W57A 107LA 165LA 1LSCA 3CSZA 1TN5A 6LZMA 1G06A 3UZCA 2NTHA 4UHRA 1PS5A 5LYZA 1ZYTA 1NDMC 217LA 1GFEA 5FHWA 4NG8A 1P64A 4JQ6A 2HEEA 243LA 3LZTA 1R2NA 1L36A 1LJ4A 118LA 2HUBA 161LA 4XTOA 5AHZA 4N5RA 1TCYA 1C67A 4GP5B 2MEHA 3DNAA 3TXDA 3PWHA 2G4NA 1BB5A 4JR8A 4NY5A 1YQVY 2DQJY 3HBDA 1P8IA 4WOAA 2X72A 1REMA 3FI7A 2Z38A 1D9UA 1IP3A 1QDRA 4DD2A 1HFXA 4NGVA 5DL9A 1QSQA 1L49A 4X32A 1LWGA 5HNCA 1B7QA 1UCQA 4YEOA 157LA 1QUDA 1AP9A 2B7XA 2RBOA 1O0AA 2H9JA 1D3JA 1GXXA 1L02A 3ATOA 4I7SA 1BB3A 1IP2A 4I7MA 4OWHA 1LSPA 4WG7A 5B6WA 3CSQA 3P0GA 3QBGA 2LNLA 1REZA 4BADA 2ZYPA 4NGYA 4ETDA 4IB4A 5B6ZA 4LYMA 3PXOA 159LA 3TXEA 3QBLA 120LA 4AQNA 1B2KA 5HMVA 1VATA 1C45A 2D4IA 3G3VA 5F9UA 4N4WA 1F10A 5E9RA 230LA 3G3AB 1KNIA 1L57A 1TDYA 1LW9A 1C8SA 1LYGA 4NGIA 3L2XA 2LHMA 4EKSA 4NWEA 3FI5A 2HEDA 1QTZA 1B7LA 1DZEA 1PQMA 2HEBA 4LGKA 138LA 1KXYA 1JKDA 2W1XA 4WG1A 1DPXA 173LA 1C46A 1L97A 1UACY 4DD0A 1JJ1A 4FBZA 3HT9A 1L00A 1W08A 4IAQA 4OO9A 1L79A 1GFHA 2H9KA 2EKSC 1KIRC 4DDBA 1F6RA 4W55A 226LA 1QTCA 3OJPA 3A93A 2DQHY 2BQAA 1OVJA 1XGPC 4DD9A 5C1MA 4NG1A 1QS5A 3HH5A 5KXOA 1QTVA 1YKZX 1CV0A 1IY4A 4EKQA 1INUA 1L0MA 3DN8A 3ABWA 1K28A 4H9EA 5I4WA 3HBHA 4G7SB 4DJHA 3HTFA 4H9AA 1OUEA 1KXWA 1IO5A 1GHLA 1L39A 182LA 1CVKA 3HASA 2WJKA 5G28A 4YENA 5HMJA 1LMNA 5EN0A 4NGLA 4NHPA 5LVHA 3X3BA 1L16A 4ETEA 4TWSA 2LZ2A 2W1YA 5C6LA 5I4YA 1VJMA 3HTGA 3GUKA 1LI6A 1NQIA 160LA 1RE2A 2EIZC 3ULRA 184LA 1L54A 3HBEX 4QI1A 1HEWA 4ZFPA 110LA 2D4JA 2ZWBA 1BWIA 4YOPA 4HJZA 4BAPA 2QARC 1OYUA 3DN3A 3W6CA 2H5ZA 2B6TA 2XBSA 5LAFA 1C6NA 208LA 5A3ZA 1L85A 4LYOA 3NSBA 112LA 1XEPA 3EH3B 1L06A 4ETCA 155LA 1L48A 1CTWA 4QEQA 3P64A 1GB9A 1JUGA 102LA 2BQKA 1DYGA 2HULA 3CT1A 4PXFA 1QSAA 2ZIJA 221LA 1HENA 1XGQC 3RZEA 3DN0A 3N9CA 3F6ZA 3TMVA 1XEKA 4ARJA 1B7OA 1LGXA 5ILFA 2YDVA 4NEBA 4I7JA 2HU3A 147LA 1F0WA 1WTMA 4QGZA 1UA6Y 3HWLA 4UWVA 4QIDA 1V7TA 149LA 1G7JC 3DN1A 262LA 1PY6A 4G4CA 4DQ7A 4I7RA 1TEWA 3P68A 1ZMYL 2W1MA 3A90A 188LA 1LYEA 3HAOA 1P3NA 1DYCA 1GFGA 1NMMA 2A4TA 1L59A 1C6JA 1GFRA 1L65A 1G0PA 3FE0A 1L81A 2Q0MX 5F8UA 1B0DA 1IOSA 5HNLA 249LA 2L78A 2O4WA 1L37A 4HYJA 4PJ2C 4M4OA 4YF2A 1BVKC 1R84A 2F4AA 3CT5A 3J4GA 3AW7A 4TX7A 1AT6A 1L86A 2HUKA 1YILA 1GF9A 4OWBA 4LDOA 5IELA 5I4XA 1C62A 1L19A 1S51A 1CJ9A 3SB6A 1CV3A 170LA 2B6XA 3M18B 1QT4A 4WLXA 4X1HA 104LA 1QTDA 183LA 1LLHA 3K3TA 1OP9B 4WO6A 1L98A 2DQGY 4G9SA 4NSGA 1L63A 5B1GA 1QT7A 1CU6A 1GB7A 2RBSA 5LVIA 4FJRA 5HQ1A 2AT9A 2HUMA 3W6BA 1JPOA 2HEFA 3OE8A 2D91A 4GLAA 5G2AA 5LINA 1L55A 2RBPA 1T6VL 4N0JA 5FELA 3C82A 2BQCA 3V2WA 4EXMA 3CODA 1CU5A 1UICA 4G7RB 3TXFA 122LA 2MEAA 1L47A 1L87A 115LA 1RI8B 3C7YA 1L82A 2F93A 142LA 1OUDA 4I7PA 4BEYA 1G0GA 3HH4A 1DKJA 1P46A 2QPDB 3C9LA 3QJSB 190LA 3UTVA 4CGEA 1DXJA 4BUOA 1UAZA 1GFKA 5B2NA 1RJCB 4Y9HA 1P2RA 3WUAA 1IWWA 1E8LA 3ZEKA 4LYTA 1AT5A 1QUTA 1CKFA 2DQEY 1F88A 2J4YA 4GN5C 174LA 4C3WA 3WXTA 3HAQA 3AYQA 5F14A 168LA 1GFVA 1HFYA 4I7QA 1JGJA 1AZFA 3GUOA 2KS9A 2CDSA 3C80A 1GBWA 3AM6A 3P4ZA 1L24A 1L21A 4HPEA 1V7SA 4W54A 4GBRA 4NC3A 1C6CA 3IWRA 1B5WA 1LZ4A 3OE9A 1L09A 2OTYX 3EMSA 1GFTA 1L33A 3HH3A 4BVNA 1C10A 5B6VA 2GV0A 5B07A 4BEZA 2OTZX 4DKLA 5L9JA 125LA 4H9HA 5KXSA 1B5XA 1G1VA 3EO5A 1KMEA 2BAAA 234LA 3S8GB 1QT5A 1ALCA 4MD1A 3RZ4A 5D5CA 135LA 1L11A 1L28A 2YVBA 1XEIA 3J6KA 4I7NA 4J4QA 1HELA 2Q9EA 3UTXA 1LHMA 2OU9A 211LA 4UWUA 3ZPRA 1LZDA 1XJIA 2BQJA 1GBZA 3OE6A 1B7SA 254LA 3SB5A 5C6IA 1QTKA 1L60A 1KW7A 3LN2A 3TXGA 1NBZC 3S3BB 1QSWA 181LA 1DYFA 2ANVA 4I7TA 2ZILA 3QJRB 1LSMA 2XTHA 1UIFA 4ZPUA 1F4ZA 1QUHA 3LYZA 1LSNA 4N1CC 2Z2EA 5KXPA 178LA 1QSBA 3DN2A 5AX0A 4UWNA 5G2CA 1OV7A 2Z6BA 2MEEA 4UG2A 1G0KA 1PQJA 3FADA 4PPOA 3WUNA 1A2YC 3WL2A 1P37A 1OUJA 3WQJA 1L96A 4LZTA 1L51A 1P6YA 2ZNXY 4XJIA 3VW7A 3CT0A 3UONA 4PGJB 219LA 4GP8B 1YAQA 1B9OA 3WW5A 1IVMA 1ZVHL 233LA 1SWYA 3HANA 3AZ7A 2LYZA 2IHLA 2ANXA 4WM6A 4WLYA 163LA 1L69A 1LPYA 3WULA 158LA 3LYOA 4LYCA 1VAUA 1WQQA 4PXKA 1LYZA 3B6LA 1OV5A 2YBNA 2F32A 3HTBA 4TL3A 1I1ZA 4OW1A 4MD2A 253LA 2Z55A 1FBIX 3N9EA 1JSFA 5LYTA 4OOTA 5FEKA 5KXMA 1SSYA 1UUZC 1IOQA 4H9IA 1C61A 1P2LA 1D6QA 5KXYA 1L45A 216LA 1KY1A 7LZMA 1IP5A 4DQJA 4JKVA 4LZMA 1LSDA 2BLYA 1CWQA 1HMLA 2YBIA 2RBQA 1FN5A 1P5CA 3E3DA 1RCMA 1HMKA 1JEFA 3REYA 2XBRA 3ODUA 1LJNA 2IGCA 5I53A 5B6YA 2OE4X 4XN6A 1FLQA 108LA 4HTKA 1LYDA 1UIBA 2CWIA 260LA 4MR1A 1CUQA 9LYZA 4ARMB 4B1AA 1L20A 3G3XA 2NWDX 5I54A 5KXRA 3M3UA 1XGTC 212LA 1PXRA 3SB9A 3MBVA 1YAMA 1C65A 1DYAA 2ZYCA 1QQYA 4TSBA 1P8UA 3HARA 1PQIA 3A34A 4R0FA 1L43A 1T8GA 2BQGA 3HT6A 2R4RA 1L29A 1LJEA 4LYBA 3VWOA 2OEAX 8LYZA 4NGKA 153LA 4W96A 2KSYA 1NHEA 4RDSA 3S8FB 1B5YA 2BLXA 2D6BA 1LJGA 1VDPA 4PK0A 1JV7A 3TMWA 4MQTA 192LA 2PC2A 209LA 4J1AA 1PZYA 4HJYA 3VVKA 1I56A 1VDSA 3CDVA 1C60A 1T3PA 1LYHA 2Z37A 4AMIA 1B7NA 5IHGA 1CV5A 4ZIXA 3A3QA 1IOCA 4NHIA 1FDLY 2YBMA 2LZTA 1EPYA 1JTOL 1JSEA 4XJGA 3A91A 4IARA 1L41A 1UIEA 2RSCA 4EIYA 1LJIA 247LA 1JWRA 5F81A 143LA 1G7IC 3V2YA 3C8SA 1L44A 1WTHA 1DI3A 4B4EA 167LA 5KXTA 4EKPA 4D9ZA 231LA 2A7DA 166LA 3BVDB 4L41A 1L50A 3TMXA 131LA 5LIOA 4U3XB 2XJWA 4C5FA 4WLDA 3NYAA 2I35A 2FBDA 180LA 4RLMA 139LA 1IWUA 154LA 4MQSA 3AZ5A 235LA 1L95A 4I0CA 4AMJA 1YAPA 1GE3A 4L6RA 194LA 3C81A 3RFMA 3HT7A 1LZEA 2B6YA 2RB1X 1C3WA 4IASA 177LA 3ZVQB 1TLAA 3T6UA 4H9FA 2LYOA 1DPWA 4LFPA 1B6IA 2OE9X 3WUMA 1L46A 1C6DA 1D0LA 3TXBA 3A7KA 5LZMA 2ZZLA 1CJ6A 1L17A 133LA 3W6FA 4A7DA 4WM1A 3GULA 1XFPL 4PHIA 2FYCA 3CDOA 4ARQB 3X3CA 5I5QA 4NSJA 2BQDA 4QY9A 2XQOA 1LHKA 237LA 3WYHA 1IR7A 1QUGA 5BR5A 2OU8A 3SP3A 5B0WA 5FCPA 1NWGA 3AZ6A 3C8QA 1GBXA 2WJLA 3D9AC 1C66A 1L30A 1GF8A 3L64A 1L27A 4EMNA 5L3IA 3DMXA 1L99A 3VHZA 1D3MA 255LA 1H6MA 137LA 1C6AA 1C6KA 1YL1X 3OK0A 1HEQA 4QDNA 1LSGA 2I26L 5APFA 2OU0X 1DI5A 1L90A 3BKHA 4X31A 193LA 3GUIA 200LA 4G7QB 1KGBA 1L77A 1JTTL 2EQLA 3VG9A 4B0DA 1L89A 1C8RA 4CFOA 1JKCA 5DHGA 4N4YB 1LZBA 227LA 1IR9A 1UIAA 3A96A 152LA 2MEGA 241LA 3KJ6A 1HC0A 2MECA 1IW9A 4AXTA 244LA 1GF5A 1L68A 4IJ4A 1D9WA 3VI0A 1GE4A 4N6HA 2I1XA 1OUIA 1BWHA 1CNSA 1EHKB 3A94A 1GB6A 3W6AA 1TBYA 5KXXA 4RW2A 1GZMA 1LMCA 4EJ4A 4DQ5A 4GP4B 4NHQA 1B5VA 2BQFA 3C7ZA 2RAYX 132LA 1GE2A 1GUEA 3F8VA 2ZIYA 5DM9A 1GFAA 1L40A 176LA 3IJVA 1UCOA 1G7LC 4GCEA
chains in the Genus database with same CATH topology
1IC5Y 4ZEEA 4AGAA 4ET8A 2KSAA 1L93A 236LA 1GBOA 1GB2A 1GXV2 4W58A 2JAFA 3RU5A 210LA 1LZAA 1JTMA 3WPLA 4A4MA 2YCWA 4HV1A 5I14A 3AYNA 1OUAA 4FDYA 3WW6A 1S53A 3P65A 1WVUA 4HTQA 129LA 1GE1A 1LYIA 1XJUA 2G4QA 3C8RA 3T36A 1LZ6A 197LA 2BQMA 3ATNA 3SBAA 1JKBA 3A6CY 3CDRA 4DC4A 1G7HC 4LYZA 1QKOA 2VB1A 2MEIA 2LCBA 156LA 1GEVA 3T45A 3UG9A 4CJ2A 4MCKA 1GDXA 2CGIA 2O7AA 2Y02A 2Y03A 2MEFA 1SX7A 1C6HA 1VDQA 3N9AA 151LA 1OUCA 1HSXA 2Z12A 1LZCA 4KPMA 1PQDA 1DKKA 1O23A 3COCA 2I6ZA 4H8XA 4G70B 5J7AA 4ML7A 1AKIA 1B7MA 232LA 1L0JA 2CJLA 1OQMA 3AW6A 3K2RA 1BRRA 259LA 224LA 1FBKA 1BRXA 4TTDA 1Q5JA 4XTLA 2B73A 1WVVA 4XJHA 3ZEVA 3WVXA 3B0IA 4EPFA 1XJTA 4TUNA 2Z2FA 5APEA 4OV0A 5DHHA 1G1WA 2I20A 3QBKA 1LMTA 1T8FA 3MGWA 3RNXA 3QNGA 4XJFA 3D4SA 1IWTA 1LJHA 2Q9DA 1XMEB 1X0K1 3DN4A 3LYTA 1X0I1 1EQ4A 4Z98A 1H68A 5APCA 5DLAA 3B72A 4LT1A 2YDOA 4FPDA 4I8SA 1QHJA 1LYOA 4J1BA 4H1PA 2ZNWY 1JQUA 5KKIA 172LA 1JV6A 229LA 1KG9A 1C6BA 4G4HA 4WM2A 1A4VA 1BHZA 1HEPA 3DMZA 1LOZA 1VFBC 1YIKA 1XEJA 1L73A 4EOFA 126LA 4W52A 3SB8A 1HFZA 140LA 1Z55A 1H87A 4RW1A 1B5UA 1ZWNA 3JR6A 1D6PA 3G3WA 127LA 3C83A 1HZXA 187LA 1C6FA 1L74A 1PQOA 5H2NA 1CX6A 2B5ZA 1LI3A 1MGYA 1KG8A 4YEMA 4N1EI 1YKXX 2BQLA 3D3DA 3GUMA 4XJBA 213LA 1NBYC 4LFXA 5LVKA 1GFJA 1JHLA 1L56A 3BKVA 5JENB 1KW5A 1ZVYB 2MEBA 5K7OA 2RH1A 1LZTA 3QJQB 7LYZA 2BQOA 1LZ5A 3G3BB 4WL7A 4DAJA 4H91A 4PJZA 3GUJA 1IP4A 4DD1A 3GXKA 1L66A 4OOOA 1CV4A 1WQNA 5IDDA 5AHYA 109LA 2YSSC 1DYBA 1IY3A 4EPIA 248LA 2B74A 5G36A 4XT1A 4H8YA 4II8A 2Z73A 4GCDA 4CFPA 1X0SA 207LA 1P8HA 1C69A 1J1XY 3QJUB 4KT3A 5LWEA 1IR8A 1BM1A 1D0MA 4XT3A 1L08A 1HSWA 3NY8A 1TN0A 4W59A 1LZYA 1CKGA 2HECA 3B0OA 5KY1A 4K5YA 4O34A 2BQIA 2BQBA 1FLWA 4NGJA 1J1PY 171LA 3QY4A 5LA8A 1D3NA 1UBZA 2LC9A 3EXDA 1VDTA 3CSRA 5B34A 2FYDA 1LYJA 3AB6A 1C64A 4XYYA 1QUOA 5KXNA 5G54A 5H2KA 1JJ3A 1UC0A 1P7SA 4W56A 223LA 2NTGA 3EH4B 1C68A 1L91A 4NHSA 1NDGC 3HDEA 4Z3MA 261LA 3PDSA 1LJ3A 1PQKA 5F9XA 3CQLA 1M0MA 2G4PA 1MLCE 2A7FA 2L6XA 148LE 2G87A 3QAKA 4NGOA 164LA 3S3CB 5H2HA 4MBSA 1S8JA 1I20A 198LA 3SB7A 3TMUA 1NHBA 2DBTA 3W6DA 1QKPA 1C6IA 1FKQA 4NGZA 4PRQA 2QPEB 5KKJA 2NTUA 3UTWA 1GF0A 1L67A 2Y04A 2B6WA 3AGIA 2YBLA 1GF6A 5EBHA 1GWDA 103LA 4H9CA 1P2CC 1TAYA 1D2WA 1L34A 1LYYA 1FLUA 1GF7A 2WARA 1LPIA 1KS3A 1BB7A 189LA 113LA 1LMPA 1MELL 4WW3A 220LA 4FAAB 1XGUC 2Y00A 1IOTA 1LI2A 1QT3A 1UIHA 3QDCA 1L53A 5B6XA 1L15A 1CKCA 1B7RA 4HWLA 1JISA 5KXLA 1CU3A 1G0JA 1LMOA 1DZBX 1L64A 4H93A 4E3UA 1L88A 214LA 1HEMA 228LA 128LA 1F6SA 1BB4A 1B5ZA 1YROA 5LVJA 1LYFA 4ARPA 1LMAA 3WU9A 1OUFA 4I7OA 186LA 5HLLA 4KL7A 1LGWA 5B05A 5H2IA 1S8LA 1CUPA 1L18A 4R6CA 5LYMA 1C6TA 2JAGA 4Z41A 6LYTA 5G2DA 4B4JA 1QT8A 1C6EA 2RB2X 3LHMA 4YXCA 5AZDA 123LA 2EPEA 4S0WA 4KXIA 1GD6A 1UIDA 2F4GA 4B49A 1JKAA 4WM5A 1DYEA 4DDCA 1LJJA 1IXFA 1GBSA 1LJKA 4LT3A 1CV1A 2B6ZA 4IATA 5FDJA 4KNFA 1GF3A 4E97A 2ZQ4A 4GN3A 5B59A 1L0KA 5JJJA 1D2YA 238LA 1L84A 3HFMY 145LA 4XJDA 1L31A 3HT8A 2YCYA 4DD7A 3WVYA 3WU7A 2YBHA 1L75A 4LT2A 1L70A 4OWCA 4ARMA 3P66A 3A95A 1GPQC 4L35A 1GB3A 4G49A 1L04A 2O79A 1LZNA 1F50A 206LA 5JJEA 4ETAA 4HPIA 1P36A 1FBBA 1DI4A 1L32A 1OUBA 4GRVA 5LA5A 2D4KA 3QJTB 1L25A 3A6BY 4WL6A 3LZ2A 196LA 3F9LA 1KIQC 4W51A 4G4BA 2CUUA 1L52A 1VGOA 4FA7B 252LA 1VEDA 2W1LA 1N4FA 4HJVA 1GB0A 5II3A 1Q5IA 1KXXA 4GCFA 4OWEA 2MEDA 2HPYA 1M0KA 4H94A 1LYSA 1LSYA 4J7VA 5JJNA 3C9MA 2DQIY 1M0LA 1B7PA 3HTDA 3DQBA 5AX1A 150LA 4W94A 1L72A 1GB5A 1C6LA 4G71B 2RBRA 1C6QA 1LWKA 5H2MA 4DWXA 1ZV5L 1E12A 3NS0A 141LA 3DN6A 1OWZA 5APDA 1QM8A 1LSBA 2Y01A 3HU8A 1QTEA 4XADA 1S54A 5T3FA 5BR2A 2R4SA 5E4PA 1WQOA 2F95A 2Z19A 3QBIA 4B4IA 2LZMA 2QB0B 3CDTA 4BV0A 130LA 4NIJA 3WU8A 4BAFA 2BRDA 1SWZA 1LHLA 4M6DA 4CHXA 2RB0X 1T8AA 1LZ1A 1L26A 4Z46A 3W3EA 2N5ZA 222LA 111LA 1IC7Y 1SSWA 3ZVQA 1LSFA 6LYZA 2BPUA 2DQDY 2DKVA 5J7CA 5ITEA 3TXIA 3AYMA 1IWYA 1L62A 1BRDA 1JTPL 2C8OA 1ZURA 4LDLA 1EQEA 1L71A 5F16A 4GCBA 1CKHA 250LA 4N8ZA 2YDGA 5DYSA 5ETZA 2B75A 1DQJC 4YXAC 3TXKA 4HTNA 1WQRA 4ARQA 1L83A 3AZ4A 1SLYA 2OE7X 3HUQA 1IWZA 3HAPA 4WMGA 2X0AA 3OE0A 195LA 1HNLA 5ILCA 2NTWA 4NFVA 1G0QA 1LAAA 4DD3A 1QS9A 4GN4A 4KLYA 185LA 4IAPA 245LA 1LSEA 3CB7A 1G07A 2YBJA 1QT6A 1IP1A 4NSHA 4WM4A 119LA 3HUAA 1JITA 1L76A 225LA 1L38A 1S52A 4BS7A 1CV6A 1GFUA 3PQRA 3HH6A 2YCXA 4GYCA 1LCNA 1IP6A 2YCZA 2F47A 1HF4A 4ANRA 4DT3A 1WTNA 3A67Y 1LSZA 2ZIKA 5G53A 1LJFA 2RAZX 4MSTA 2I25L 1CKDA 4EKRA 1QTBA 5KXKA 257LA 1T6HA 1PXSA 1I6SA 2HTXA 2RBNA 1P56A 5FJGA 1CJ8A 201LA 3OAXA 2BQEA 3PBLA 1L9HA 1L92A 1IP7A 2F2NA 2Z18A 2DQAA 1YL0X 4HP0A 5KKHA 1C6MA 1OWYA 1CJ7A 1JIYA 5KXZA 5B1FA 1LZ9A 1YANA 1G0LA 4HYXA 1HEOA 3B0KA 1BGIA 1REYA 1XSFA 3KAMA 3WPJA 1AM7A 2F30A 4DS7E 4HSFA 246LA 1XIOA 4N9RA 4NSIA 191LA 1IIZA 1OVKA 3SN6R 4G72B 3C7WA 162LA 1WQMA 4OWAA 2BQHA 2KSBA 114LA 4GBRB 1BQLY 3RUNA 2C8PA 5AWZA 1JTNA 1L35A 3HU9A 3RW8A 1LZSA 134LA 1L94A 4H90A 4DDAA 205LA 3QJVB 1LTMA 1IW6A 1DYDA 3WXUA 1L22A 3IJUA 2HEAA 2DQFC 1CU2A 4GPOA 3CDQA 5TGZA 1HHLA 1REXA 1LZRA 1QTHA 5H2JA 4WLTA 1XGRC 1LN6A 1LMQA 251LA 1IEEA 3AJNA 1QIOA 1KIPC 5M1YA 4H8ZA 3SBBC 1EQ5A 1L07A 1G7MC 1GDWA 199LA 2AUBA 4W53A 4H9BA 4P2EA 3LZMA 1CU0A 1L14A 5A44A 3EBAB 1GF4A 3A92A 4XENA 1OUGA 4RLNA 3HDFA 5LVGA 3WPKA 5KJ9A 1L10A 4EA3A 1L61A 4WAVA 1YAOA 4J0LA 169LA 1FLYA 4WM3A 5H2OA 1IWXA 1YKYX 1LHJA 1C7PA 5A8EA 1L03A 4XXJA 2Y8PA 1FKVA 1LSAA 144LA 1LKSA 3VGAA 4LT0A 1EL1A 1KY0A 5B06A 1LHHA 5L3HA 3GUNA 5A45A 4XTNA 1GEZA 5DN4A 1GU8A 1CX7A 2IFFY 2Z39A 4NGWA 3HUKA 3QAPA 4ET9A 1L12A 215LA 2F2QA 4DYGA 2ZQ3A 1JJ0A 5B35A 3UTYA 4YX7C 3S3DB 1QDTA 1C43A 1HERA 1BWJA 3NY9A 5A3EA 3GUPA 4H92A 1D0KA 1G0MA 1WQPA 3GXRA 1LHIA 5KXWA 1L13A 1SX2A 1JFPA 242LA 3EMLA 239LA 1W6ZA 4GCCA 1AT9A 1QUSA 1U19A 5ITCA 3A3RX 1LKRA 1GBYA 1GAYA 218LA 3TXJA 1SQ2L 2B72A 3TXHA 2VT4A 3A8ZA 1OUHA 1BVXA 1L58A 1C63A 2DQCY 175LA 4NHTA 2LYMA 2BQNA 1GAZA 3QE8A 4TSCA 1IWVA 5FSTA 1L05A 4PRUA 240LA 4HV2A 1IX0A 3WH1A 3AGHA 4QRYA 3LYMA 3ZPQA 2HU1A 3W6EA 1L01A 3UZAA 4ETBA 5LXWA 1LZ8A 4NWHA 1D3FA 2M3GA 4GLVA 1IORA 1OVHA 256LA 4BWBA 1GE0A 2PEDA 2B70A 1LZGA 3DKEX 5D5FA 1C6PA 5H2PA 2EI4A 2ZFEA 4X3BA 1L23A 5LAGA 3FA0A 1BB6A 3RT5X 1RFPA 5H2LA 2FBBA 1NKHA 4LDEA 1T97A 5C6JA 146LA 3EH5B 5DN5A 3WMKA 4YM8A 3DDLA 3CAPA 1NF5A 5AMYA 4ARLA 1L42A 1GB8A 4I7LA 1H2SA 258LA 1LGUA 3AGGG 1J1OY 1C6GA 1E0PA 4I7KA 4WO9A 2I21A 3DMVA 1IC4Y 1UIGA 1C08C 1L80A 4W57A 107LA 165LA 1LSCA 3CSZA 1TN5A 6LZMA 1G06A 3UZCA 2NTHA 4UHRA 1PS5A 5LYZA 1ZYTA 1NDMC 217LA 1GFEA 5FHWA 4NG8A 1P64A 4JQ6A 2HEEA 243LA 3LZTA 1R2NA 1L36A 1LJ4A 118LA 2HUBA 161LA 4XTOA 5AHZA 4N5RA 1TCYA 1C67A 4GP5B 2MEHA 3DNAA 3TXDA 3PWHA 2G4NA 1BB5A 4JR8A 4NY5A 1YQVY 2DQJY 3HBDA 1P8IA 4WOAA 2X72A 1REMA 3FI7A 2Z38A 1D9UA 1IP3A 1QDRA 4DD2A 1HFXA 4NGVA 5DL9A 1QSQA 1L49A 4X32A 1LWGA 5HNCA 1B7QA 1UCQA 4YEOA 157LA 1QUDA 1AP9A 2B7XA 2RBOA 1O0AA 2H9JA 1D3JA 1GXXA 1L02A 3ATOA 4I7SA 1BB3A 1IP2A 4I7MA 4OWHA 1LSPA 4WG7A 5B6WA 3CSQA 3P0GA 3QBGA 2LNLA 1REZA 4BADA 2ZYPA 4NGYA 4ETDA 4IB4A 5B6ZA 4LYMA 3PXOA 159LA 3TXEA 3QBLA 120LA 4AQNA 1B2KA 5HMVA 1VATA 1C45A 2D4IA 3G3VA 5F9UA 4N4WA 1F10A 5E9RA 230LA 3G3AB 1KNIA 1L57A 1TDYA 1LW9A 1C8SA 1LYGA 4NGIA 3L2XA 2LHMA 4EKSA 4NWEA 3FI5A 2HEDA 1QTZA 1B7LA 1DZEA 1PQMA 2HEBA 4LGKA 138LA 1KXYA 1JKDA 2W1XA 4WG1A 1DPXA 173LA 1C46A 1L97A 1UACY 4DD0A 1JJ1A 4FBZA 3HT9A 1L00A 1W08A 4IAQA 4OO9A 1L79A 1GFHA 2H9KA 2EKSC 1KIRC 4DDBA 1F6RA 4W55A 226LA 1QTCA 3OJPA 3A93A 2DQHY 2BQAA 1OVJA 1XGPC 4DD9A 5C1MA 4NG1A 1QS5A 3HH5A 5KXOA 1QTVA 1YKZX 1CV0A 1IY4A 4EKQA 1INUA 1L0MA 3DN8A 3ABWA 1K28A 4H9EA 5I4WA 3HBHA 4G7SB 4DJHA 3HTFA 4H9AA 1OUEA 1KXWA 1IO5A 1GHLA 1L39A 182LA 1CVKA 3HASA 2WJKA 5G28A 4YENA 5HMJA 1LMNA 5EN0A 4NGLA 4NHPA 5LVHA 3X3BA 1L16A 4ETEA 4TWSA 2LZ2A 2W1YA 5C6LA 5I4YA 1VJMA 3HTGA 3GUKA 1LI6A 1NQIA 160LA 1RE2A 2EIZC 3ULRA 184LA 1L54A 3HBEX 4QI1A 1HEWA 4ZFPA 110LA 2D4JA 2ZWBA 1BWIA 4YOPA 4HJZA 4BAPA 2QARC 1OYUA 3DN3A 3W6CA 2H5ZA 2B6TA 2XBSA 5LAFA 1C6NA 208LA 5A3ZA 1L85A 4LYOA 3NSBA 112LA 1XEPA 3EH3B 1L06A 4ETCA 155LA 1L48A 1CTWA 4QEQA 3P64A 1GB9A 1JUGA 102LA 2BQKA 1DYGA 2HULA 3CT1A 4PXFA 1QSAA 2ZIJA 221LA 1HENA 1XGQC 3RZEA 3DN0A 3N9CA 3F6ZA 3TMVA 1XEKA 4ARJA 1B7OA 1LGXA 5ILFA 2YDVA 4NEBA 4I7JA 2HU3A 147LA 1F0WA 1WTMA 4QGZA 1UA6Y 3HWLA 4UWVA 4QIDA 1V7TA 149LA 1G7JC 3DN1A 262LA 1PY6A 4G4CA 4DQ7A 4I7RA 1TEWA 3P68A 1ZMYL 2W1MA 3A90A 188LA 1LYEA 3HAOA 1P3NA 1DYCA 1GFGA 1NMMA 2A4TA 1L59A 1C6JA 1GFRA 1L65A 1G0PA 3FE0A 1L81A 2Q0MX 5F8UA 1B0DA 1IOSA 5HNLA 249LA 2L78A 2O4WA 1L37A 4HYJA 4PJ2C 4M4OA 4YF2A 1BVKC 1R84A 2F4AA 3CT5A 3J4GA 3AW7A 4TX7A 1AT6A 1L86A 2HUKA 1YILA 1GF9A 4OWBA 4LDOA 5IELA 5I4XA 1C62A 1L19A 1S51A 1CJ9A 3SB6A 1CV3A 170LA 2B6XA 3M18B 1QT4A 4WLXA 4X1HA 104LA 1QTDA 183LA 1LLHA 3K3TA 1OP9B 4WO6A 1L98A 2DQGY 4G9SA 4NSGA 1L63A 5B1GA 1QT7A 1CU6A 1GB7A 2RBSA 5LVIA 4FJRA 5HQ1A 2AT9A 2HUMA 3W6BA 1JPOA 2HEFA 3OE8A 2D91A 4GLAA 5G2AA 5LINA 1L55A 2RBPA 1T6VL 4N0JA 5FELA 3C82A 2BQCA 3V2WA 4EXMA 3CODA 1CU5A 1UICA 4G7RB 3TXFA 122LA 2MEAA 1L47A 1L87A 115LA 1RI8B 3C7YA 1L82A 2F93A 142LA 1OUDA 4I7PA 4BEYA 1G0GA 3HH4A 1DKJA 1P46A 2QPDB 3C9LA 3QJSB 190LA 3UTVA 4CGEA 1DXJA 4BUOA 1UAZA 1GFKA 5B2NA 1RJCB 4Y9HA 1P2RA 3WUAA 1IWWA 1E8LA 3ZEKA 4LYTA 1AT5A 1QUTA 1CKFA 2DQEY 1F88A 2J4YA 4GN5C 174LA 4C3WA 3WXTA 3HAQA 3AYQA 5F14A 168LA 1GFVA 1HFYA 4I7QA 1JGJA 1AZFA 3GUOA 2KS9A 2CDSA 3C80A 1GBWA 3AM6A 3P4ZA 1L24A 1L21A 4HPEA 1V7SA 4W54A 4GBRA 4NC3A 1C6CA 3IWRA 1B5WA 1LZ4A 3OE9A 1L09A 2OTYX 3EMSA 1GFTA 1L33A 3HH3A 4BVNA 1C10A 5B6VA 2GV0A 5B07A 4BEZA 2OTZX 4DKLA 5L9JA 125LA 4H9HA 5KXSA 1B5XA 1G1VA 3EO5A 1KMEA 2BAAA 234LA 3S8GB 1QT5A 1ALCA 4MD1A 3RZ4A 5D5CA 135LA 1L11A 1L28A 2YVBA 1XEIA 3J6KA 4I7NA 4J4QA 1HELA 2Q9EA 3UTXA 1LHMA 2OU9A 211LA 4UWUA 3ZPRA 1LZDA 1XJIA 2BQJA 1GBZA 3OE6A 1B7SA 254LA 3SB5A 5C6IA 1QTKA 1L60A 1KW7A 3LN2A 3TXGA 1NBZC 3S3BB 1QSWA 181LA 1DYFA 2ANVA 4I7TA 2ZILA 3QJRB 1LSMA 2XTHA 1UIFA 4ZPUA 1F4ZA 1QUHA 3LYZA 1LSNA 4N1CC 2Z2EA 5KXPA 178LA 1QSBA 3DN2A 5AX0A 4UWNA 5G2CA 1OV7A 2Z6BA 2MEEA 4UG2A 1G0KA 1PQJA 3FADA 4PPOA 3WUNA 1A2YC 3WL2A 1P37A 1OUJA 3WQJA 1L96A 4LZTA 1L51A 1P6YA 2ZNXY 4XJIA 3VW7A 3CT0A 3UONA 4PGJB 219LA 4GP8B 1YAQA 1B9OA 3WW5A 1IVMA 1ZVHL 233LA 1SWYA 3HANA 3AZ7A 2LYZA 2IHLA 2ANXA 4WM6A 4WLYA 163LA 1L69A 1LPYA 3WULA 158LA 3LYOA 4LYCA 1VAUA 1WQQA 4PXKA 1LYZA 3B6LA 1OV5A 2YBNA 2F32A 3HTBA 4TL3A 1I1ZA 4OW1A 4MD2A 253LA 2Z55A 1FBIX 3N9EA 1JSFA 5LYTA 4OOTA 5FEKA 5KXMA 1SSYA 1UUZC 1IOQA 4H9IA 1C61A 1P2LA 1D6QA 5KXYA 1L45A 216LA 1KY1A 7LZMA 1IP5A 4DQJA 4JKVA 4LZMA 1LSDA 2BLYA 1CWQA 1HMLA 2YBIA 2RBQA 1FN5A 1P5CA 3E3DA 1RCMA 1HMKA 1JEFA 3REYA 2XBRA 3ODUA 1LJNA 2IGCA 5I53A 5B6YA 2OE4X 4XN6A 1FLQA 108LA 4HTKA 1LYDA 1UIBA 2CWIA 260LA 4MR1A 1CUQA 9LYZA 4ARMB 4B1AA 1L20A 3G3XA 2NWDX 5I54A 5KXRA 3M3UA 1XGTC 212LA 1PXRA 3SB9A 3MBVA 1YAMA 1C65A 1DYAA 2ZYCA 1QQYA 4TSBA 1P8UA 3HARA 1PQIA 3A34A 4R0FA 1L43A 1T8GA 2BQGA 3HT6A 2R4RA 1L29A 1LJEA 4LYBA 3VWOA 2OEAX 8LYZA 4NGKA 153LA 4W96A 2KSYA 1NHEA 4RDSA 3S8FB 1B5YA 2BLXA 2D6BA 1LJGA 1VDPA 4PK0A 1JV7A 3TMWA 4MQTA 192LA 2PC2A 209LA 4J1AA 1PZYA 4HJYA 3VVKA 1I56A 1VDSA 3CDVA 1C60A 1T3PA 1LYHA 2Z37A 4AMIA 1B7NA 5IHGA 1CV5A 4ZIXA 3A3QA 1IOCA 4NHIA 1FDLY 2YBMA 2LZTA 1EPYA 1JTOL 1JSEA 4XJGA 3A91A 4IARA 1L41A 1UIEA 2RSCA 4EIYA 1LJIA 247LA 1JWRA 5F81A 143LA 1G7IC 3V2YA 3C8SA 1L44A 1WTHA 1DI3A 4B4EA 167LA 5KXTA 4EKPA 4D9ZA 231LA 2A7DA 166LA 3BVDB 4L41A 1L50A 3TMXA 131LA 5LIOA 4U3XB 2XJWA 4C5FA 4WLDA 3NYAA 2I35A 2FBDA 180LA 4RLMA 139LA 1IWUA 154LA 4MQSA 3AZ5A 235LA 1L95A 4I0CA 4AMJA 1YAPA 1GE3A 4L6RA 194LA 3C81A 3RFMA 3HT7A 1LZEA 2B6YA 2RB1X 1C3WA 4IASA 177LA 3ZVQB 1TLAA 3T6UA 4H9FA 2LYOA 1DPWA 4LFPA 1B6IA 2OE9X 3WUMA 1L46A 1C6DA 1D0LA 3TXBA 3A7KA 5LZMA 2ZZLA 1CJ6A 1L17A 133LA 3W6FA 4A7DA 4WM1A 3GULA 1XFPL 4PHIA 2FYCA 3CDOA 4ARQB 3X3CA 5I5QA 4NSJA 2BQDA 4QY9A 2XQOA 1LHKA 237LA 3WYHA 1IR7A 1QUGA 5BR5A 2OU8A 3SP3A 5B0WA 5FCPA 1NWGA 3AZ6A 3C8QA 1GBXA 2WJLA 3D9AC 1C66A 1L30A 1GF8A 3L64A 1L27A 4EMNA 5L3IA 3DMXA 1L99A 3VHZA 1D3MA 255LA 1H6MA 137LA 1C6AA 1C6KA 1YL1X 3OK0A 1HEQA 4QDNA 1LSGA 2I26L 5APFA 2OU0X 1DI5A 1L90A 3BKHA 4X31A 193LA 3GUIA 200LA 4G7QB 1KGBA 1L77A 1JTTL 2EQLA 3VG9A 4B0DA 1L89A 1C8RA 4CFOA 1JKCA 5DHGA 4N4YB 1LZBA 227LA 1IR9A 1UIAA 3A96A 152LA 2MEGA 241LA 3KJ6A 1HC0A 2MECA 1IW9A 4AXTA 244LA 1GF5A 1L68A 4IJ4A 1D9WA 3VI0A 1GE4A 4N6HA 2I1XA 1OUIA 1BWHA 1CNSA 1EHKB 3A94A 1GB6A 3W6AA 1TBYA 5KXXA 4RW2A 1GZMA 1LMCA 4EJ4A 4DQ5A 4GP4B 4NHQA 1B5VA 2BQFA 3C7ZA 2RAYX 132LA 1GE2A 1GUEA 3F8VA 2ZIYA 5DM9A 1GFAA 1L40A 176LA 3IJVA 1UCOA 1G7LC 4GCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L52 A;  3CAP A;  4ARL A;  1L42 A;  1H2S A;  4I7L A;  1VGO A;  4FA7 B;  258L A;  1LGU A;  252L A;  4W54 A;  2KSA A;  4GBR A;  1C6G A;  1L93 A;  1E0P A;  4I7K A;  236L A;  4NC3 A;  1C6C A;  2I21 A;  3DMV A;  1Q5I A;  1L80 A;  3OE9 A;  107L A;  165L A;  4W57 A;  4W58 A;  1L09 A;  2JAF A;  210L A;  1TN5 A;  1JTM A;  2OTY X;  1M0K A;  2HPY A;  6LZM A;  4A4M A;  2YCW A;  5JJN A;  5I14 A;  3AYN A;  3C9M A;  1L33 A;  3HH3 A;  1M0L A;  1G06 A;  1S53 A;  2NTH A;  3UZC A;  4BVN A;  3HTD A;  3DQB A;  4UHR A;  129L A;  1ZYT A;  5AX1 A;  217L A;  5B6V A;  1XJU A;  1LYI A;  4BEZ A;  150L A;  2OTZ X;  1L72 A;  3C8R A;  4DKL A;  125L A;  1C6L A;  1G1V A;  197L A;  1P64 A;  3SBA A;  1KME A;  4G71 B;  2RBR A;  4JQ6 A;  1C6Q A;  1LWK A;  234L A;  243L A;  5H2M A;  3S8G B;  1QT5 A;  1R2N A;  1L36 A;  118L A;  1E12 A;  161L A;  3NS0 A;  141L A;  4MD1 A;  3DN6 A;  4XTO A;  1L11 A;  3CDR A;  1QKO A;  5AHZ A;  1L28 A;  1C67 A;  2LCB A;  1OWZ A;  156L A;  4I7N A;  4J4Q A;  3T45 A;  1QM8 A;  3UG9 A;  4GP5 B;  2Y01 A;  3HU8 A;  2Q9E A;  3DNA A;  3PWH A;  3UTX A;  2OU9 A;  211L A;  2O7A A;  2Y02 A;  1S54 A;  2Y03 A;  3ZPR A;  1XJI A;  1SX7 A;  4JR8 A;  5BR2 A;  1C6H A;  2R4S A;  151L A;  3OE6 A;  254L A;  2F95 A;  1P8I A;  3SB5 A;  1L60 A;  1PQD A;  1KW7 A;  3QBI A;  2X72 A;  3S3B B;  181L A;  3COC A;  1DYF A;  2LZM A;  2QB0 B;  2ANV A;  3CDT A;  4I7T A;  4G70 B;  4BV0 A;  3QJR B;  130L A;  2BRD A;  5J7A A;  4ZPU A;  1QSQ A;  1SWZ A;  1F4Z A;  1L49 A;  1QUH A;  232L A;  1L0J A;  4X32 A;  1LWG A;  2RB0 X;  1T8A A;  1UCQ A;  178L A;  1QSB A;  3DN2 A;  3K2R A;  1BRR A;  259L A;  5AX0 A;  157L A;  224L A;  1FBK A;  1BRX A;  1L26 A;  1OV7 A;  2Z6B A;  5G2C A;  1QUD A;  1Q5J A;  1AP9 A;  4XTL A;  222L A;  2B73 A;  2B7X A;  2RBO A;  4UG2 A;  1O0A A;  111L A;  1D3J A;  1G0K A;  1L02 A;  1PQJ A;  1SSW A;  3FAD A;  3ZEV A;  4I7S A;  4I7M A;  4EPF A;  1P37 A;  1XJT A;  5ITE A;  3WQJ A;  1L96 A;  3P0G A;  3AYM A;  3QBG A;  1L62 A;  5B6W A;  1BRD A;  2LNL A;  1L51 A;  4OV0 A;  1P6Y A;  5DHH A;  1ZUR A;  1G1W A;  4LDL A;  1L71 A;  2I20 A;  3VW7 A;  3QBK A;  1T8F A;  4IB4 A;  5B6Z A;  3UON A;  219L A;  3D4S A;  4GP8 B;  250L A;  3PXO A;  159L A;  5DYS A;  3QBL A;  120L A;  2Q9D A;  5ETZ A;  2B75 A;  4AQN A;  1X0K 1;  1XME B;  233L A;  1SWY A;  3HAN A;  3G3V A;  4YXA C;  3DN4 A;  4N4W A;  4ARQ A;  230L A;  2ANX A;  1L83 A;  1X0I 1;  1H68 A;  2OE7 X;  1KNI A;  3HUQ A;  1L57 A;  3HAP A;  163L A;  1LW9 A;  1C8S A;  2YDO A;  4FPD A;  1L69 A;  1LPY A;  1LYG A;  3OE0 A;  158L A;  1QHJ A;  3L2X A;  195L A;  4EKS A;  2NTW A;  3FI5 A;  1JQU A;  1G0Q A;  4PXK A;  1QS9 A;  1QTZ A;  172L A;  1JV6 A;  1OV5 A;  229L A;  4KLY A;  185L A;  4IAP A;  1KG9 A;  245L A;  2F32 A;  3HTB A;  1C6B A;  4TL3 A;  1DZE A;  1G07 A;  4MD2 A;  253L A;  1PQM A;  1QT6 A;  2Z55 A;  3DMZ A;  138L A;  119L A;  3HUA A;  1L73 A;  1SSY A;  1L76 A;  126L A;  173L A;  4W52 A;  1C61 A;  1L97 A;  1P2L A;  225L A;  3SB8 A;  1L38 A;  1L45 A;  140L A;  1S52 A;  216L A;  1KY1 A;  1CV6 A;  7LZM A;  1ZWN A;  3PQR A;  4FBZ A;  3HH6 A;  3JR6 A;  2YCX A;  3HT9 A;  1L00 A;  4GYC A;  4JKV A;  3G3W A;  4LZM A;  4OO9 A;  2YCZ A;  127L A;  1L79 A;  2F47 A;  3C83 A;  4IAQ A;  1HZX A;  1CWQ A;  2RBQ A;  1P5C A;  187L A;  5G53 A;  2RAZ X;  1C6F A;  3REY A;  3ODU A;  4EKR A;  4W55 A;  1L74 A;  1QTB A;  226L A;  1PQO A;  1QTC A;  257L A;  1T6H A;  2IGC A;  1PXS A;  1I6S A;  1OVJ A;  2RBN A;  1P56 A;  5H2N A;  1CX6 A;  1LI3 A;  5B6Y A;  2OE4 X;  5FJG A;  5C1M A;  1QS5 A;  1MGY A;  1KG8 A;  108L A;  3HH5 A;  1QTV A;  201L A;  1CV0 A;  1LYD A;  3OAX A;  3GUM A;  213L A;  4EKQ A;  3PBL A;  1L0M A;  1L92 A;  1L9H A;  3DN8 A;  3ABW A;  1K28 A;  1L56 A;  1KW5 A;  260L A;  1CUQ A;  4G7S B;  5KKH A;  4DJH A;  2RH1 A;  3HTF A;  1C6M A;  1OWY A;  4ARM B;  1L20 A;  3G3X A;  3QJQ B;  1G0L A;  182L A;  1L39 A;  4HYX A;  1CVK A;  3HAS A;  212L A;  2WJK A;  4DAJ A;  5G28 A;  1PXR A;  3SB9 A;  3MBV A;  5EN0 A;  1C65 A;  1DYA A;  4PJZ A;  3GUJ A;  3X3B A;  1P8U A;  1L16 A;  3HAR A;  1PQI A;  1L66 A;  1L43 A;  1T8G A;  246L A;  1CV4 A;  1XIO A;  5AHY A;  3HT6 A;  1VJM A;  109L A;  191L A;  1OVK A;  2R4R A;  1DYB A;  1L29 A;  3HTG A;  3SN6 R;  3C7W A;  4EPI A;  3GUK A;  4G72 B;  1LI6 A;  160L A;  248L A;  2B74 A;  5G36 A;  4XT1 A;  184L A;  1L54 A;  2OEA X;  162L A;  2Z73 A;  1X0S A;  4QI1 A;  2KSB A;  1P8H A;  2KSY A;  1C69 A;  114L A;  4GBR B;  3QJU B;  110L A;  3RUN A;  5LWE A;  3S8F B;  1BM1 A;  4PK0 A;  5AWZ A;  1JTN A;  1L35 A;  2QAR C;  3HU9 A;  1JV7 A;  4XT3 A;  1L08 A;  1OYU A;  4MQT A;  3DN3 A;  1L94 A;  192L A;  3NY8 A;  1TN0 A;  2B6T A;  4W59 A;  1C6N A;  209L A;  1L85 A;  205L A;  4K5Y A;  3QJV B;  3NSB A;  3VVK A;  112L A;  3CDV A;  1C60 A;  1IW6 A;  1XEP A;  1LYH A;  1DYD A;  4AMI A;  171L A;  1L22 A;  3EH3 B;  1D3N A;  1CV5 A;  1L06 A;  2LC9 A;  155L A;  5B34 A;  1LYJ A;  1L48 A;  1CTW A;  1CU2 A;  1C64 A;  1QUO A;  4GPO A;  5G54 A;  5H2K A;  3CDQ A;  5TGZ A;  1P7S A;  4W56 A;  102L A;  1DYG A;  2HUL A;  1EPY A;  223L A;  1QTH A;  5H2J A;  2NTG A;  3EH4 B;  1LN6 A;  1L41 A;  4IAR A;  4PXF A;  1C68 A;  1L91 A;  4EIY A;  3HDE A;  261L A;  221L A;  247L A;  143L A;  251L A;  3RZE A;  3DN0 A;  3PDS A;  1PQK A;  4ARJ A;  3V2Y A;  1M0M A;  1LGX A;  3SBB C;  3C8S A;  2YDV A;  1L44 A;  2L6X A;  4I7J A;  1WTH A;  148L E;  1L07 A;  2G87 A;  147L A;  3QAK A;  164L A;  199L A;  3S3C B;  167L A;  4W53 A;  4EKP A;  231L A;  5H2H A;  3HWL A;  3LZM A;  4QID A;  1CU0 A;  4MBS A;  1S8J A;  149L A;  1L14 A;  198L A;  3SB7 A;  5A44 A;  3BVD B;  166L A;  3DN1 A;  1NHB A;  262L A;  1L50 A;  1PY6 A;  131L A;  4I7R A;  1QKP A;  1C6I A;  3HDF A;  3NYA A;  2I35 A;  1L10 A;  188L A;  1LYE A;  2QPE B;  180L A;  3HAO A;  1P3N A;  4MQS A;  139L A;  2NTU A;  3UTW A;  1DYC A;  235L A;  2A4T A;  1L95 A;  4EA3 A;  1L59 A;  1C6J A;  4AMJ A;  1L65 A;  1L61 A;  4L6R A;  1L67 A;  2Y04 A;  1G0P A;  169L A;  3C81 A;  2B6W A;  4WAV A;  3HT7 A;  5H2O A;  3RFM A;  1L81 A;  2B6Y A;  2RB1 X;  1C3W A;  5F8U A;  177L A;  5A8E A;  103L A;  249L A;  2L78 A;  1L03 A;  1D2W A;  1L34 A;  4XXJ A;  2O4W A;  1TLA A;  1L37 A;  4HYJ A;  144L A;  1KS3 A;  1B6I A;  2OE9 X;  3VGA A;  189L A;  113L A;  1KY0 A;  1L46 A;  1C6D A;  4WW3 A;  1R84 A;  3A7K A;  220L A;  4FAA B;  3GUN A;  5A45 A;  5LZM A;  2ZZL A;  2Y00 A;  1L17 A;  1LI2 A;  1QT3 A;  3QDC A;  4XTN A;  1L53 A;  5B6X A;  1L86 A;  3GUL A;  1GU8 A;  1L15 A;  2HUK A;  1CX7 A;  4HWL A;  3HUK A;  4LDO A;  3QAP A;  1CU3 A;  1C62 A;  1L12 A;  3CDO A;  215L A;  1L19 A;  1G0J A;  2F2Q A;  4ARQ B;  3X3C A;  1L64 A;  1L88 A;  214L A;  1S51 A;  228L A;  5B35 A;  3UTY A;  4YX7 C;  128L A;  3SB6 A;  3S3D B;  1CV3 A;  3NY9 A;  3GUP A;  170L A;  1LYF A;  4ARP A;  2B6X A;  1G0M A;  237L A;  1QT4 A;  4X1H A;  4I7O A;  186L A;  104L A;  5BR5 A;  1QTD A;  1L13 A;  1QUG A;  1SX2 A;  2OU8 A;  1LGW A;  183L A;  5H2I A;  1S8L A;  1LLH A;  1JFP A;  242L A;  1CUP A;  3EML A;  5B0W A;  1L18 A;  239L A;  1C6T A;  2JAG A;  1L98 A;  3C8Q A;  1AT9 A;  5G2D A;  1U19 A;  2WJL A;  1C66 A;  5ITC A;  1L30 A;  1QT8 A;  1C6E A;  3L64 A;  1L27 A;  1L63 A;  218L A;  2RB2 X;  4YXC A;  5AZD A;  123L A;  1QT7 A;  4S0W A;  1CU6 A;  2B72 A;  2RBS A;  3DMX A;  2VT4 A;  2AT9 A;  1L99 A;  1L58 A;  1C63 A;  2HUM A;  3VHZ A;  175L A;  1D3M A;  3OE8 A;  255L A;  5G2A A;  1L55 A;  2RBP A;  1DYE A;  137L A;  3C82 A;  1IXF A;  1C6A A;  1C6K A;  1L05 A;  3V2W A;  4EXM A;  3COD A;  240L A;  1CU5 A;  1CV1 A;  4G7R B;  2B6Z A;  2OU0 X;  4QRY A;  1L90 A;  3ZPQ A;  4X31 A;  122L A;  4KNF A;  3GUI A;  1L47 A;  1L87 A;  200L A;  4G7Q B;  4E97 A;  115L A;  1L77 A;  1KGB A;  3VG9 A;  1L01 A;  3C7Y A;  1L82 A;  2F93 A;  3UZA A;  142L A;  1L89 A;  1C8R A;  4I7P A;  4BEY A;  1L0K A;  5DHG A;  1G0G A;  5JJJ A;  3HH4 A;  1D2Y A;  238L A;  4N4Y B;  1P46 A;  1L84 A;  227L A;  145L A;  2QPD B;  152L A;  1L31 A;  1D3F A;  241L A;  3HT8 A;  3KJ6 A;  2M3G A;  2YCY A;  3C9L A;  3QJS B;  1IW9 A;  190L A;  3UTV A;  4BUO A;  1UAZ A;  1L75 A;  5B2N A;  4Y9H A;  1P2R A;  244L A;  1L70 A;  1L68 A;  1OVH A;  256L A;  1D9W A;  4ARM A;  3VI0 A;  4BWB A;  2PED A;  4N6H A;  2I1X A;  2B70 A;  4L35 A;  3DKE X;  1F88 A;  1C6P A;  2J4Y A;  5H2P A;  1L04 A;  2O79 A;  2EI4 A;  2ZFE A;  1F50 A;  206L A;  174L A;  1EHK B;  3HAQ A;  5JJE A;  1P36 A;  1L23 A;  1FBB A;  1GZM A;  168L A;  3FA0 A;  4EJ4 A;  1L32 A;  4GP4 B;  5H2L A;  3C7Z A;  4GRV A;  2RAY X;  4I7Q A;  3QJT B;  1JGJ A;  4LDE A;  1GUE A;  1L25 A;  3F8V A;  2ZIY A;  1T97 A;  3GUO A;  146L A;  3EH5 B;  196L A;  3F9L A;  4W51 A;  2KS9 A;  3C80 A;  1L40 A;  176L A;  3AM6 A;  1L24 A;  1L21 A;  3DDL A;  2CUU A; 
#chains in the Genus database with same CATH topology
 1IC5 Y;  4ZEE A;  4AGA A;  4ET8 A;  2KSA A;  1L93 A;  236L A;  1GBO A;  1GB2 A;  1GXV 2;  4W58 A;  2JAF A;  3RU5 A;  210L A;  1LZA A;  1JTM A;  3WPL A;  4A4M A;  2YCW A;  4HV1 A;  5I14 A;  3AYN A;  1OUA A;  4FDY A;  3WW6 A;  1S53 A;  3P65 A;  1WVU A;  4HTQ A;  129L A;  1GE1 A;  1LYI A;  1XJU A;  2G4Q A;  3C8R A;  3T36 A;  1LZ6 A;  197L A;  2BQM A;  3ATN A;  3SBA A;  1JKB A;  3A6C Y;  3CDR A;  4DC4 A;  1G7H C;  4LYZ A;  1QKO A;  2VB1 A;  2MEI A;  2LCB A;  156L A;  1GEV A;  3T45 A;  3UG9 A;  4CJ2 A;  4MCK A;  1GDX A;  2CGI A;  2O7A A;  2Y02 A;  2Y03 A;  2MEF A;  1SX7 A;  1C6H A;  1VDQ A;  3N9A A;  151L A;  1OUC A;  1HSX A;  2Z12 A;  1LZC A;  4KPM A;  1PQD A;  1DKK A;  1O23 A;  3COC A;  2I6Z A;  4H8X A;  4G70 B;  5J7A A;  4ML7 A;  1AKI A;  1B7M A;  232L A;  1L0J A;  2CJL A;  1OQM A;  3AW6 A;  3K2R A;  1BRR A;  259L A;  224L A;  1FBK A;  1BRX A;  4TTD A;  1Q5J A;  4XTL A;  2B73 A;  1WVV A;  4XJH A;  3ZEV A;  3WVX A;  3B0I A;  4EPF A;  1XJT A;  4TUN A;  2Z2F A;  5APE A;  4OV0 A;  5DHH A;  1G1W A;  2I20 A;  3QBK A;  1LMT A;  1T8F A;  3MGW A;  3RNX A;  3QNG A;  4XJF A;  3D4S A;  1IWT A;  1LJH A;  2Q9D A;  1XME B;  1X0K 1;  3DN4 A;  3LYT A;  1X0I 1;  1EQ4 A;  4Z98 A;  1H68 A;  5APC A;  5DLA A;  3B72 A;  4LT1 A;  2YDO A;  4FPD A;  4I8S A;  1QHJ A;  1LYO A;  4J1B A;  4H1P A;  2ZNW Y;  1JQU A;  5KKI A;  172L A;  1JV6 A;  229L A;  1KG9 A;  1C6B A;  4G4H A;  4WM2 A;  1A4V A;  1BHZ A;  1HEP A;  3DMZ A;  1LOZ A;  1VFB C;  1YIK A;  1XEJ A;  1L73 A;  4EOF A;  126L A;  4W52 A;  3SB8 A;  1HFZ A;  140L A;  1Z55 A;  1H87 A;  4RW1 A;  1B5U A;  1ZWN A;  3JR6 A;  1D6P A;  3G3W A;  127L A;  3C83 A;  1HZX A;  187L A;  1C6F A;  1L74 A;  1PQO A;  5H2N A;  1CX6 A;  2B5Z A;  1LI3 A;  1MGY A;  1KG8 A;  4YEM A;  4N1E I;  1YKX X;  2BQL A;  3D3D A;  3GUM A;  4XJB A;  213L A;  1NBY C;  4LFX A;  5LVK A;  1GFJ A;  1JHL A;  1L56 A;  3BKV A;  5JEN B;  1KW5 A;  1ZVY B;  2MEB A;  5K7O A;  2RH1 A;  1LZT A;  3QJQ B;  7LYZ A;  2BQO A;  1LZ5 A;  3G3B B;  4WL7 A;  4DAJ A;  4H91 A;  4PJZ A;  3GUJ A;  1IP4 A;  4DD1 A;  3GXK A;  1L66 A;  4OOO A;  1CV4 A;  1WQN A;  5IDD A;  5AHY A;  109L A;  2YSS C;  1DYB A;  1IY3 A;  4EPI A;  248L A;  2B74 A;  5G36 A;  4XT1 A;  4H8Y A;  4II8 A;  2Z73 A;  4GCD A;  4CFP A;  1X0S A;  207L A;  1P8H A;  1C69 A;  1J1X Y;  3QJU B;  4KT3 A;  5LWE A;  1IR8 A;  1BM1 A;  1D0M A;  4XT3 A;  1L08 A;  1HSW A;  3NY8 A;  1TN0 A;  4W59 A;  1LZY A;  1CKG A;  2HEC A;  3B0O A;  5KY1 A;  4K5Y A;  4O34 A;  2BQI A;  2BQB A;  1FLW A;  4NGJ A;  1J1P Y;  171L A;  3QY4 A;  5LA8 A;  1D3N A;  1UBZ A;  2LC9 A;  3EXD A;  1VDT A;  3CSR A;  5B34 A;  2FYD A;  1LYJ A;  3AB6 A;  1C64 A;  4XYY A;  1QUO A;  5KXN A;  5G54 A;  5H2K A;  1JJ3 A;  1UC0 A;  1P7S A;  4W56 A;  223L A;  2NTG A;  3EH4 B;  1C68 A;  1L91 A;  4NHS A;  1NDG C;  3HDE A;  4Z3M A;  261L A;  3PDS A;  1LJ3 A;  1PQK A;  5F9X A;  3CQL A;  1M0M A;  2G4P A;  1MLC E;  2A7F A;  2L6X A;  148L E;  2G87 A;  3QAK A;  4NGO A;  164L A;  3S3C B;  5H2H A;  4MBS A;  1S8J A;  1I20 A;  198L A;  3SB7 A;  3TMU A;  1NHB A;  2DBT A;  3W6D A;  1QKP A;  1C6I A;  1FKQ A;  4NGZ A;  4PRQ A;  2QPE B;  5KKJ A;  2NTU A;  3UTW A;  1GF0 A;  1L67 A;  2Y04 A;  2B6W A;  3AGI A;  2YBL A;  1GF6 A;  5EBH A;  1GWD A;  103L A;  4H9C A;  1P2C C;  1TAY A;  1D2W A;  1L34 A;  1LYY A;  1FLU A;  1GF7 A;  2WAR A;  1LPI A;  1KS3 A;  1BB7 A;  189L A;  113L A;  1LMP A;  1MEL L;  4WW3 A;  220L A;  4FAA B;  1XGU C;  2Y00 A;  1IOT A;  1LI2 A;  1QT3 A;  1UIH A;  3QDC A;  1L53 A;  5B6X A;  1L15 A;  1CKC A;  1B7R A;  4HWL A;  1JIS A;  5KXL A;  1CU3 A;  1G0J A;  1LMO A;  1DZB X;  1L64 A;  4H93 A;  4E3U A;  1L88 A;  214L A;  1HEM A;  228L A;  128L A;  1F6S A;  1BB4 A;  1B5Z A;  1YRO A;  5LVJ A;  1LYF A;  4ARP A;  1LMA A;  3WU9 A;  1OUF A;  4I7O A;  186L A;  5HLL A;  4KL7 A;  1LGW A;  5B05 A;  5H2I A;  1S8L A;  1CUP A;  1L18 A;  4R6C A;  5LYM A;  1C6T A;  2JAG A;  4Z41 A;  6LYT A;  5G2D A;  4B4J A;  1QT8 A;  1C6E A;  2RB2 X;  3LHM A;  4YXC A;  5AZD A;  123L A;  2EPE A;  4S0W A;  4KXI A;  1GD6 A;  1UID A;  2F4G A;  4B49 A;  1JKA A;  4WM5 A;  1DYE A;  4DDC A;  1LJJ A;  1IXF A;  1GBS A;  1LJK A;  4LT3 A;  1CV1 A;  2B6Z A;  4IAT A;  5FDJ A;  4KNF A;  1GF3 A;  4E97 A;  2ZQ4 A;  4GN3 A;  5B59 A;  1L0K A;  5JJJ A;  1D2Y A;  238L A;  1L84 A;  3HFM Y;  145L A;  4XJD A;  1L31 A;  3HT8 A;  2YCY A;  4DD7 A;  3WVY A;  3WU7 A;  2YBH A;  1L75 A;  4LT2 A;  1L70 A;  4OWC A;  4ARM A;  3P66 A;  3A95 A;  1GPQ C;  4L35 A;  1GB3 A;  4G49 A;  1L04 A;  2O79 A;  1LZN A;  1F50 A;  206L A;  5JJE A;  4ETA A;  4HPI A;  1P36 A;  1FBB A;  1DI4 A;  1L32 A;  1OUB A;  4GRV A;  5LA5 A;  2D4K A;  3QJT B;  1L25 A;  3A6B Y;  4WL6 A;  3LZ2 A;  196L A;  3F9L A;  1KIQ C;  4W51 A;  4G4B A;  2CUU A;  1L52 A;  1VGO A;  4FA7 B;  252L A;  1VED A;  2W1L A;  1N4F A;  4HJV A;  1GB0 A;  5II3 A;  1Q5I A;  1KXX A;  4GCF A;  4OWE A;  2MED A;  2HPY A;  1M0K A;  4H94 A;  1LYS A;  1LSY A;  4J7V A;  5JJN A;  3C9M A;  2DQI Y;  1M0L A;  1B7P A;  3HTD A;  3DQB A;  5AX1 A;  150L A;  4W94 A;  1L72 A;  1GB5 A;  1C6L A;  4G71 B;  2RBR A;  1C6Q A;  1LWK A;  5H2M A;  4DWX A;  1ZV5 L;  1E12 A;  3NS0 A;  141L A;  3DN6 A;  1OWZ A;  5APD A;  1QM8 A;  1LSB A;  2Y01 A;  3HU8 A;  1QTE A;  4XAD A;  1S54 A;  5T3F A;  5BR2 A;  2R4S A;  5E4P A;  1WQO A;  2F95 A;  2Z19 A;  3QBI A;  4B4I A;  2LZM A;  2QB0 B;  3CDT A;  4BV0 A;  130L A;  4NIJ A;  3WU8 A;  4BAF A;  2BRD A;  1SWZ A;  1LHL A;  4M6D A;  4CHX A;  2RB0 X;  1T8A A;  1LZ1 A;  1L26 A;  4Z46 A;  3W3E A;  2N5Z A;  222L A;  111L A;  1IC7 Y;  1SSW A;  3ZVQ A;  1LSF A;  6LYZ A;  2BPU A;  2DQD Y;  2DKV A;  5J7C A;  5ITE A;  3TXI A;  3AYM A;  1IWY A;  1L62 A;  1BRD A;  1JTP L;  2C8O A;  1ZUR A;  4LDL A;  1EQE A;  1L71 A;  5F16 A;  4GCB A;  1CKH A;  250L A;  4N8Z A;  2YDG A;  5DYS A;  5ETZ A;  2B75 A;  1DQJ C;  4YXA C;  3TXK A;  4HTN A;  1WQR A;  4ARQ A;  1L83 A;  3AZ4 A;  1SLY A;  2OE7 X;  3HUQ A;  1IWZ A;  3HAP A;  4WMG A;  2X0A A;  3OE0 A;  195L A;  1HNL A;  5ILC A;  2NTW A;  4NFV A;  1G0Q A;  1LAA A;  4DD3 A;  1QS9 A;  4GN4 A;  4KLY A;  185L A;  4IAP A;  245L A;  1LSE A;  3CB7 A;  1G07 A;  2YBJ A;  1QT6 A;  1IP1 A;  4NSH A;  4WM4 A;  119L A;  3HUA A;  1JIT A;  1L76 A;  225L A;  1L38 A;  1S52 A;  4BS7 A;  1CV6 A;  1GFU A;  3PQR A;  3HH6 A;  2YCX A;  4GYC A;  1LCN A;  1IP6 A;  2YCZ A;  2F47 A;  1HF4 A;  4ANR A;  4DT3 A;  1WTN A;  3A67 Y;  1LSZ A;  2ZIK A;  5G53 A;  1LJF A;  2RAZ X;  4MST A;  2I25 L;  1CKD A;  4EKR A;  1QTB A;  5KXK A;  257L A;  1T6H A;  1PXS A;  1I6S A;  2HTX A;  2RBN A;  1P56 A;  5FJG A;  1CJ8 A;  201L A;  3OAX A;  2BQE A;  3PBL A;  1L9H A;  1L92 A;  1IP7 A;  2F2N A;  2Z18 A;  2DQA A;  1YL0 X;  4HP0 A;  5KKH A;  1C6M A;  1OWY A;  1CJ7 A;  1JIY A;  5KXZ A;  5B1F A;  1LZ9 A;  1YAN A;  1G0L A;  4HYX A;  1HEO A;  3B0K A;  1BGI A;  1REY A;  1XSF A;  3KAM A;  3WPJ A;  1AM7 A;  2F30 A;  4DS7 E;  4HSF A;  246L A;  1XIO A;  4N9R A;  4NSI A;  191L A;  1IIZ A;  1OVK A;  3SN6 R;  4G72 B;  3C7W A;  162L A;  1WQM A;  4OWA A;  2BQH A;  2KSB A;  114L A;  4GBR B;  1BQL Y;  3RUN A;  2C8P A;  5AWZ A;  1JTN A;  1L35 A;  3HU9 A;  3RW8 A;  1LZS A;  134L A;  1L94 A;  4H90 A;  4DDA A;  205L A;  3QJV B;  1LTM A;  1IW6 A;  1DYD A;  3WXU A;  1L22 A;  3IJU A;  2HEA A;  2DQF C;  1CU2 A;  4GPO A;  3CDQ A;  5TGZ A;  1HHL A;  1REX A;  1LZR A;  1QTH A;  5H2J A;  4WLT A;  1XGR C;  1LN6 A;  1LMQ A;  251L A;  1IEE A;  3AJN A;  1QIO A;  1KIP C;  5M1Y A;  4H8Z A;  3SBB C;  1EQ5 A;  1L07 A;  1G7M C;  1GDW A;  199L A;  2AUB A;  4W53 A;  4H9B A;  4P2E A;  3LZM A;  1CU0 A;  1L14 A;  5A44 A;  3EBA B;  1GF4 A;  3A92 A;  4XEN A;  1OUG A;  4RLN A;  3HDF A;  5LVG A;  3WPK A;  5KJ9 A;  1L10 A;  4EA3 A;  1L61 A;  4WAV A;  1YAO A;  4J0L A;  169L A;  1FLY A;  4WM3 A;  5H2O A;  1IWX A;  1YKY X;  1LHJ A;  1C7P A;  5A8E A;  1L03 A;  4XXJ A;  2Y8P A;  1FKV A;  1LSA A;  144L A;  1LKS A;  3VGA A;  4LT0 A;  1EL1 A;  1KY0 A;  5B06 A;  1LHH A;  5L3H A;  3GUN A;  5A45 A;  4XTN A;  1GEZ A;  5DN4 A;  1GU8 A;  1CX7 A;  2IFF Y;  2Z39 A;  4NGW A;  3HUK A;  3QAP A;  4ET9 A;  1L12 A;  215L A;  2F2Q A;  4DYG A;  2ZQ3 A;  1JJ0 A;  5B35 A;  3UTY A;  4YX7 C;  3S3D B;  1QDT A;  1C43 A;  1HER A;  1BWJ A;  3NY9 A;  5A3E A;  3GUP A;  4H92 A;  1D0K A;  1G0M A;  1WQP A;  3GXR A;  1LHI A;  5KXW A;  1L13 A;  1SX2 A;  1JFP A;  242L A;  3EML A;  239L A;  1W6Z A;  4GCC A;  1AT9 A;  1QUS A;  1U19 A;  5ITC A;  3A3R X;  1LKR A;  1GBY A;  1GAY A;  218L A;  3TXJ A;  1SQ2 L;  2B72 A;  3TXH A;  2VT4 A;  3A8Z A;  1OUH A;  1BVX A;  1L58 A;  1C63 A;  2DQC Y;  175L A;  4NHT A;  2LYM A;  2BQN A;  1GAZ A;  3QE8 A;  4TSC A;  1IWV A;  5FST A;  1L05 A;  4PRU A;  240L A;  4HV2 A;  1IX0 A;  3WH1 A;  3AGH A;  4QRY A;  3LYM A;  3ZPQ A;  2HU1 A;  3W6E A;  1L01 A;  3UZA A;  4ETB A;  5LXW A;  1LZ8 A;  4NWH A;  1D3F A;  2M3G A;  4GLV A;  1IOR A;  1OVH A;  256L A;  4BWB A;  1GE0 A;  2PED A;  2B70 A;  1LZG A;  3DKE X;  5D5F A;  1C6P A;  5H2P A;  2EI4 A;  2ZFE A;  4X3B A;  1L23 A;  5LAG A;  3FA0 A;  1BB6 A;  3RT5 X;  1RFP A;  5H2L A;  2FBB A;  1NKH A;  4LDE A;  1T97 A;  5C6J A;  146L A;  3EH5 B;  5DN5 A;  3WMK A;  4YM8 A;  3DDL A;  3CAP A;  1NF5 A;  5AMY A;  4ARL A;  1L42 A;  1GB8 A;  4I7L A;  1H2S A;  258L A;  1LGU A;  3AGG G;  1J1O Y;  1C6G A;  1E0P A;  4I7K A;  4WO9 A;  2I21 A;  3DMV A;  1IC4 Y;  1UIG A;  1C08 C;  1L80 A;  4W57 A;  107L A;  165L A;  1LSC A;  3CSZ A;  1TN5 A;  6LZM A;  1G06 A;  3UZC A;  2NTH A;  4UHR A;  1PS5 A;  5LYZ A;  1ZYT A;  1NDM C;  217L A;  1GFE A;  5FHW A;  4NG8 A;  1P64 A;  4JQ6 A;  2HEE A;  243L A;  3LZT A;  1R2N A;  1L36 A;  1LJ4 A;  118L A;  2HUB A;  161L A;  4XTO A;  5AHZ A;  4N5R A;  1TCY A;  1C67 A;  4GP5 B;  2MEH A;  3DNA A;  3TXD A;  3PWH A;  2G4N A;  1BB5 A;  4JR8 A;  4NY5 A;  1YQV Y;  2DQJ Y;  3HBD A;  1P8I A;  4WOA A;  2X72 A;  1REM A;  3FI7 A;  2Z38 A;  1D9U A;  1IP3 A;  1QDR A;  4DD2 A;  1HFX A;  4NGV A;  5DL9 A;  1QSQ A;  1L49 A;  4X32 A;  1LWG A;  5HNC A;  1B7Q A;  1UCQ A;  4YEO A;  157L A;  1QUD A;  1AP9 A;  2B7X A;  2RBO A;  1O0A A;  2H9J A;  1D3J A;  1GXX A;  1L02 A;  3ATO A;  4I7S A;  1BB3 A;  1IP2 A;  4I7M A;  4OWH A;  1LSP A;  4WG7 A;  5B6W A;  3CSQ A;  3P0G A;  3QBG A;  2LNL A;  1REZ A;  4BAD A;  2ZYP A;  4NGY A;  4ETD A;  4IB4 A;  5B6Z A;  4LYM A;  3PXO A;  159L A;  3TXE A;  3QBL A;  120L A;  4AQN A;  1B2K A;  5HMV A;  1VAT A;  1C45 A;  2D4I A;  3G3V A;  5F9U A;  4N4W A;  1F10 A;  5E9R A;  230L A;  3G3A B;  1KNI A;  1L57 A;  1TDY A;  1LW9 A;  1C8S A;  1LYG A;  4NGI A;  3L2X A;  2LHM A;  4EKS A;  4NWE A;  3FI5 A;  2HED A;  1QTZ A;  1B7L A;  1DZE A;  1PQM A;  2HEB A;  4LGK A;  138L A;  1KXY A;  1JKD A;  2W1X A;  4WG1 A;  1DPX A;  173L A;  1C46 A;  1L97 A;  1UAC Y;  4DD0 A;  1JJ1 A;  4FBZ A;  3HT9 A;  1L00 A;  1W08 A;  4IAQ A;  4OO9 A;  1L79 A;  1GFH A;  2H9K A;  2EKS C;  1KIR C;  4DDB A;  1F6R A;  4W55 A;  226L A;  1QTC A;  3OJP A;  3A93 A;  2DQH Y;  2BQA A;  1OVJ A;  1XGP C;  4DD9 A;  5C1M A;  4NG1 A;  1QS5 A;  3HH5 A;  5KXO A;  1QTV A;  1YKZ X;  1CV0 A;  1IY4 A;  4EKQ A;  1INU A;  1L0M A;  3DN8 A;  3ABW A;  1K28 A;  4H9E A;  5I4W A;  3HBH A;  4G7S B;  4DJH A;  3HTF A;  4H9A A;  1OUE A;  1KXW A;  1IO5 A;  1GHL A;  1L39 A;  182L A;  1CVK A;  3HAS A;  2WJK A;  5G28 A;  4YEN A;  5HMJ A;  1LMN A;  5EN0 A;  4NGL A;  4NHP A;  5LVH A;  3X3B A;  1L16 A;  4ETE A;  4TWS A;  2LZ2 A;  2W1Y A;  5C6L A;  5I4Y A;  1VJM A;  3HTG A;  3GUK A;  1LI6 A;  1NQI A;  160L A;  1RE2 A;  2EIZ C;  3ULR A;  184L A;  1L54 A;  3HBE X;  4QI1 A;  1HEW A;  4ZFP A;  110L A;  2D4J A;  2ZWB A;  1BWI A;  4YOP A;  4HJZ A;  4BAP A;  2QAR C;  1OYU A;  3DN3 A;  3W6C A;  2H5Z A;  2B6T A;  2XBS A;  5LAF A;  1C6N A;  208L A;  5A3Z A;  1L85 A;  4LYO A;  3NSB A;  112L A;  1XEP A;  3EH3 B;  1L06 A;  4ETC A;  155L A;  1L48 A;  1CTW A;  4QEQ A;  3P64 A;  1GB9 A;  1JUG A;  102L A;  2BQK A;  1DYG A;  2HUL A;  3CT1 A;  4PXF A;  1QSA A;  2ZIJ A;  221L A;  1HEN A;  1XGQ C;  3RZE A;  3DN0 A;  3N9C A;  3F6Z A;  3TMV A;  1XEK A;  4ARJ A;  1B7O A;  1LGX A;  5ILF A;  2YDV A;  4NEB A;  4I7J A;  2HU3 A;  147L A;  1F0W A;  1WTM A;  4QGZ A;  1UA6 Y;  3HWL A;  4UWV A;  4QID A;  1V7T A;  149L A;  1G7J C;  3DN1 A;  262L A;  1PY6 A;  4G4C A;  4DQ7 A;  4I7R A;  1TEW A;  3P68 A;  1ZMY L;  2W1M A;  3A90 A;  188L A;  1LYE A;  3HAO A;  1P3N A;  1DYC A;  1GFG A;  1NMM A;  2A4T A;  1L59 A;  1C6J A;  1GFR A;  1L65 A;  1G0P A;  3FE0 A;  1L81 A;  2Q0M X;  5F8U A;  1B0D A;  1IOS A;  5HNL A;  249L A;  2L78 A;  2O4W A;  1L37 A;  4HYJ A;  4PJ2 C;  4M4O A;  4YF2 A;  1BVK C;  1R84 A;  2F4A A;  3CT5 A;  3J4G A;  3AW7 A;  4TX7 A;  1AT6 A;  1L86 A;  2HUK A;  1YIL A;  1GF9 A;  4OWB A;  4LDO A;  5IEL A;  5I4X A;  1C62 A;  1L19 A;  1S51 A;  1CJ9 A;  3SB6 A;  1CV3 A;  170L A;  2B6X A;  3M18 B;  1QT4 A;  4WLX A;  4X1H A;  104L A;  1QTD A;  183L A;  1LLH A;  3K3T A;  1OP9 B;  4WO6 A;  1L98 A;  2DQG Y;  4G9S A;  4NSG A;  1L63 A;  5B1G A;  1QT7 A;  1CU6 A;  1GB7 A;  2RBS A;  5LVI A;  4FJR A;  5HQ1 A;  2AT9 A;  2HUM A;  3W6B A;  1JPO A;  2HEF A;  3OE8 A;  2D91 A;  4GLA A;  5G2A A;  5LIN A;  1L55 A;  2RBP A;  1T6V L;  4N0J A;  5FEL A;  3C82 A;  2BQC A;  3V2W A;  4EXM A;  3COD A;  1CU5 A;  1UIC A;  4G7R B;  3TXF A;  122L A;  2MEA A;  1L47 A;  1L87 A;  115L A;  1RI8 B;  3C7Y A;  1L82 A;  2F93 A;  142L A;  1OUD A;  4I7P A;  4BEY A;  1G0G A;  3HH4 A;  1DKJ A;  1P46 A;  2QPD B;  3C9L A;  3QJS B;  190L A;  3UTV A;  4CGE A;  1DXJ A;  4BUO A;  1UAZ A;  1GFK A;  5B2N A;  1RJC B;  4Y9H A;  1P2R A;  3WUA A;  1IWW A;  1E8L A;  3ZEK A;  4LYT A;  1AT5 A;  1QUT A;  1CKF A;  2DQE Y;  1F88 A;  2J4Y A;  4GN5 C;  174L A;  4C3W A;  3WXT A;  3HAQ A;  3AYQ A;  5F14 A;  168L A;  1GFV A;  1HFY A;  4I7Q A;  1JGJ A;  1AZF A;  3GUO A;  2KS9 A;  2CDS A;  3C80 A;  1GBW A;  3AM6 A;  3P4Z A;  1L24 A;  1L21 A;  4HPE A;  1V7S A;  4W54 A;  4GBR A;  4NC3 A;  1C6C A;  3IWR A;  1B5W A;  1LZ4 A;  3OE9 A;  1L09 A;  2OTY X;  3EMS A;  1GFT A;  1L33 A;  3HH3 A;  4BVN A;  1C10 A;  5B6V A;  2GV0 A;  5B07 A;  4BEZ A;  2OTZ X;  4DKL A;  5L9J A;  125L A;  4H9H A;  5KXS A;  1B5X A;  1G1V A;  3EO5 A;  1KME A;  2BAA A;  234L A;  3S8G B;  1QT5 A;  1ALC A;  4MD1 A;  3RZ4 A;  5D5C A;  135L A;  1L11 A;  1L28 A;  2YVB A;  1XEI A;  3J6K A;  4I7N A;  4J4Q A;  1HEL A;  2Q9E A;  3UTX A;  1LHM A;  2OU9 A;  211L A;  4UWU A;  3ZPR A;  1LZD A;  1XJI A;  2BQJ A;  1GBZ A;  3OE6 A;  1B7S A;  254L A;  3SB5 A;  5C6I A;  1QTK A;  1L60 A;  1KW7 A;  3LN2 A;  3TXG A;  1NBZ C;  3S3B B;  1QSW A;  181L A;  1DYF A;  2ANV A;  4I7T A;  2ZIL A;  3QJR B;  1LSM A;  2XTH A;  1UIF A;  4ZPU A;  1F4Z A;  1QUH A;  3LYZ A;  1LSN A;  4N1C C;  2Z2E A;  5KXP A;  178L A;  1QSB A;  3DN2 A;  5AX0 A;  4UWN A;  5G2C A;  1OV7 A;  2Z6B A;  2MEE A;  4UG2 A;  1G0K A;  1PQJ A;  3FAD A;  4PPO A;  3WUN A;  1A2Y C;  3WL2 A;  1P37 A;  1OUJ A;  3WQJ A;  1L96 A;  4LZT A;  1L51 A;  1P6Y A;  2ZNX Y;  4XJI A;  3VW7 A;  3CT0 A;  3UON A;  4PGJ B;  219L A;  4GP8 B;  1YAQ A;  1B9O A;  3WW5 A;  1IVM A;  1ZVH L;  233L A;  1SWY A;  3HAN A;  3AZ7 A;  2LYZ A;  2IHL A;  2ANX A;  4WM6 A;  4WLY A;  163L A;  1L69 A;  1LPY A;  3WUL A;  158L A;  3LYO A;  4LYC A;  1VAU A;  1WQQ A;  4PXK A;  1LYZ A;  3B6L A;  1OV5 A;  2YBN A;  2F32 A;  3HTB A;  4TL3 A;  1I1Z A;  4OW1 A;  4MD2 A;  253L A;  2Z55 A;  1FBI X;  3N9E A;  1JSF A;  5LYT A;  4OOT A;  5FEK A;  5KXM A;  1SSY A;  1UUZ C;  1IOQ A;  4H9I A;  1C61 A;  1P2L A;  1D6Q A;  5KXY A;  1L45 A;  216L A;  1KY1 A;  7LZM A;  1IP5 A;  4DQJ A;  4JKV A;  4LZM A;  1LSD A;  2BLY A;  1CWQ A;  1HML A;  2YBI A;  2RBQ A;  1FN5 A;  1P5C A;  3E3D A;  1RCM A;  1HMK A;  1JEF A;  3REY A;  2XBR A;  3ODU A;  1LJN A;  2IGC A;  5I53 A;  5B6Y A;  2OE4 X;  4XN6 A;  1FLQ A;  108L A;  4HTK A;  1LYD A;  1UIB A;  2CWI A;  260L A;  4MR1 A;  1CUQ A;  9LYZ A;  4ARM B;  4B1A A;  1L20 A;  3G3X A;  2NWD X;  5I54 A;  5KXR A;  3M3U A;  1XGT C;  212L A;  1PXR A;  3SB9 A;  3MBV A;  1YAM A;  1C65 A;  1DYA A;  2ZYC A;  1QQY A;  4TSB A;  1P8U A;  3HAR A;  1PQI A;  3A34 A;  4R0F A;  1L43 A;  1T8G A;  2BQG A;  3HT6 A;  2R4R A;  1L29 A;  1LJE A;  4LYB A;  3VWO A;  2OEA X;  8LYZ A;  4NGK A;  153L A;  4W96 A;  2KSY A;  1NHE A;  4RDS A;  3S8F B;  1B5Y A;  2BLX A;  2D6B A;  1LJG A;  1VDP A;  4PK0 A;  1JV7 A;  3TMW A;  4MQT A;  192L A;  2PC2 A;  209L A;  4J1A A;  1PZY A;  4HJY A;  3VVK A;  1I56 A;  1VDS A;  3CDV A;  1C60 A;  1T3P A;  1LYH A;  2Z37 A;  4AMI A;  1B7N A;  5IHG A;  1CV5 A;  4ZIX A;  3A3Q A;  1IOC A;  4NHI A;  1FDL Y;  2YBM A;  2LZT A;  1EPY A;  1JTO L;  1JSE A;  4XJG A;  3A91 A;  4IAR A;  1L41 A;  1UIE A;  2RSC A;  4EIY A;  1LJI A;  247L A;  1JWR A;  5F81 A;  143L A;  1G7I C;  3V2Y A;  3C8S A;  1L44 A;  1WTH A;  1DI3 A;  4B4E A;  167L A;  5KXT A;  4EKP A;  4D9Z A;  231L A;  2A7D A;  166L A;  3BVD B;  4L41 A;  1L50 A;  3TMX A;  131L A;  5LIO A;  4U3X B;  2XJW A;  4C5F A;  4WLD A;  3NYA A;  2I35 A;  2FBD A;  180L A;  4RLM A;  139L A;  1IWU A;  154L A;  4MQS A;  3AZ5 A;  235L A;  1L95 A;  4I0C A;  4AMJ A;  1YAP A;  1GE3 A;  4L6R A;  194L A;  3C81 A;  3RFM A;  3HT7 A;  1LZE A;  2B6Y A;  2RB1 X;  1C3W A;  4IAS A;  177L A;  3ZVQ B;  1TLA A;  3T6U A;  4H9F A;  2LYO A;  1DPW A;  4LFP A;  1B6I A;  2OE9 X;  3WUM A;  1L46 A;  1C6D A;  1D0L A;  3TXB A;  3A7K A;  5LZM A;  2ZZL A;  1CJ6 A;  1L17 A;  133L A;  3W6F A;  4A7D A;  4WM1 A;  3GUL A;  1XFP L;  4PHI A;  2FYC A;  3CDO A;  4ARQ B;  3X3C A;  5I5Q A;  4NSJ A;  2BQD A;  4QY9 A;  2XQO A;  1LHK A;  237L A;  3WYH A;  1IR7 A;  1QUG A;  5BR5 A;  2OU8 A;  3SP3 A;  5B0W A;  5FCP A;  1NWG A;  3AZ6 A;  3C8Q A;  1GBX A;  2WJL A;  3D9A C;  1C66 A;  1L30 A;  1GF8 A;  3L64 A;  1L27 A;  4EMN A;  5L3I A;  3DMX A;  1L99 A;  3VHZ A;  1D3M A;  255L A;  1H6M A;  137L A;  1C6A A;  1C6K A;  1YL1 X;  3OK0 A;  1HEQ A;  4QDN A;  1LSG A;  2I26 L;  5APF A;  2OU0 X;  1DI5 A;  1L90 A;  3BKH A;  4X31 A;  193L A;  3GUI A;  200L A;  4G7Q B;  1KGB A;  1L77 A;  1JTT L;  2EQL A;  3VG9 A;  4B0D A;  1L89 A;  1C8R A;  4CFO A;  1JKC A;  5DHG A;  4N4Y B;  1LZB A;  227L A;  1IR9 A;  1UIA A;  3A96 A;  152L A;  2MEG A;  241L A;  3KJ6 A;  1HC0 A;  2MEC A;  1IW9 A;  4AXT A;  244L A;  1GF5 A;  1L68 A;  4IJ4 A;  1D9W A;  3VI0 A;  1GE4 A;  4N6H A;  2I1X A;  1OUI A;  1BWH A;  1CNS A;  1EHK B;  3A94 A;  1GB6 A;  3W6A A;  1TBY A;  5KXX A;  4RW2 A;  1GZM A;  1LMC A;  4EJ4 A;  4DQ5 A;  4GP4 B;  4NHQ A;  1B5V A;  2BQF A;  3C7Z A;  2RAY X;  132L A;  1GE2 A;  1GUE A;  3F8V A;  2ZIY A;  5DM9 A;  1GFA A;  1L40 A;  176L A;  3IJV A;  1UCO A;  1G7L C;  4GCE A; 
#chains in the Genus database with same CATH homology
 1IC5 Y;  4ZEE A;  4AGA A;  4ET8 A;  2KSA A;  1L93 A;  236L A;  1GBO A;  1GB2 A;  1GXV 2;  4W58 A;  2JAF A;  3RU5 A;  210L A;  1LZA A;  1JTM A;  3WPL A;  4A4M A;  2YCW A;  4HV1 A;  5I14 A;  3AYN A;  1OUA A;  4FDY A;  3WW6 A;  1S53 A;  3P65 A;  1WVU A;  4HTQ A;  129L A;  1GE1 A;  1LYI A;  1XJU A;  2G4Q A;  3C8R A;  3T36 A;  1LZ6 A;  197L A;  2BQM A;  3ATN A;  3SBA A;  1JKB A;  3A6C Y;  3CDR A;  4DC4 A;  1G7H C;  4LYZ A;  1QKO A;  2VB1 A;  2MEI A;  2LCB A;  156L A;  1GEV A;  3T45 A;  3UG9 A;  4CJ2 A;  4MCK A;  1GDX A;  2CGI A;  2O7A A;  2Y02 A;  2Y03 A;  2MEF A;  1SX7 A;  1C6H A;  1VDQ A;  3N9A A;  151L A;  1OUC A;  1HSX A;  2Z12 A;  1LZC A;  4KPM A;  1PQD A;  1DKK A;  1O23 A;  3COC A;  2I6Z A;  4H8X A;  4G70 B;  5J7A A;  4ML7 A;  1AKI A;  1B7M A;  232L A;  1L0J A;  2CJL A;  1OQM A;  3AW6 A;  3K2R A;  1BRR A;  259L A;  224L A;  1FBK A;  1BRX A;  4TTD A;  1Q5J A;  4XTL A;  2B73 A;  1WVV A;  4XJH A;  3ZEV A;  3WVX A;  3B0I A;  4EPF A;  1XJT A;  4TUN A;  2Z2F A;  5APE A;  4OV0 A;  5DHH A;  1G1W A;  2I20 A;  3QBK A;  1LMT A;  1T8F A;  3MGW A;  3RNX A;  3QNG A;  4XJF A;  3D4S A;  1IWT A;  1LJH A;  2Q9D A;  1XME B;  1X0K 1;  3DN4 A;  3LYT A;  1X0I 1;  1EQ4 A;  4Z98 A;  1H68 A;  5APC A;  5DLA A;  3B72 A;  4LT1 A;  2YDO A;  4FPD A;  4I8S A;  1QHJ A;  1LYO A;  4J1B A;  4H1P A;  2ZNW Y;  1JQU A;  5KKI A;  172L A;  1JV6 A;  229L A;  1KG9 A;  1C6B A;  4G4H A;  4WM2 A;  1A4V A;  1BHZ A;  1HEP A;  3DMZ A;  1LOZ A;  1VFB C;  1YIK A;  1XEJ A;  1L73 A;  4EOF A;  126L A;  4W52 A;  3SB8 A;  1HFZ A;  140L A;  1Z55 A;  1H87 A;  4RW1 A;  1B5U A;  1ZWN A;  3JR6 A;  1D6P A;  3G3W A;  127L A;  3C83 A;  1HZX A;  187L A;  1C6F A;  1L74 A;  1PQO A;  5H2N A;  1CX6 A;  2B5Z A;  1LI3 A;  1MGY A;  1KG8 A;  4YEM A;  4N1E I;  1YKX X;  2BQL A;  3D3D A;  3GUM A;  4XJB A;  213L A;  1NBY C;  4LFX A;  5LVK A;  1GFJ A;  1JHL A;  1L56 A;  3BKV A;  5JEN B;  1KW5 A;  1ZVY B;  2MEB A;  5K7O A;  2RH1 A;  1LZT A;  3QJQ B;  7LYZ A;  2BQO A;  1LZ5 A;  3G3B B;  4WL7 A;  4DAJ A;  4H91 A;  4PJZ A;  3GUJ A;  1IP4 A;  4DD1 A;  3GXK A;  1L66 A;  4OOO A;  1CV4 A;  1WQN A;  5IDD A;  5AHY A;  109L A;  2YSS C;  1DYB A;  1IY3 A;  4EPI A;  248L A;  2B74 A;  5G36 A;  4XT1 A;  4H8Y A;  4II8 A;  2Z73 A;  4GCD A;  4CFP A;  1X0S A;  207L A;  1P8H A;  1C69 A;  1J1X Y;  3QJU B;  4KT3 A;  5LWE A;  1IR8 A;  1BM1 A;  1D0M A;  4XT3 A;  1L08 A;  1HSW A;  3NY8 A;  1TN0 A;  4W59 A;  1LZY A;  1CKG A;  2HEC A;  3B0O A;  5KY1 A;  4K5Y A;  4O34 A;  2BQI A;  2BQB A;  1FLW A;  4NGJ A;  1J1P Y;  171L A;  3QY4 A;  5LA8 A;  1D3N A;  1UBZ A;  2LC9 A;  3EXD A;  1VDT A;  3CSR A;  5B34 A;  2FYD A;  1LYJ A;  3AB6 A;  1C64 A;  4XYY A;  1QUO A;  5KXN A;  5G54 A;  5H2K A;  1JJ3 A;  1UC0 A;  1P7S A;  4W56 A;  223L A;  2NTG A;  3EH4 B;  1C68 A;  1L91 A;  4NHS A;  1NDG C;  3HDE A;  4Z3M A;  261L A;  3PDS A;  1LJ3 A;  1PQK A;  5F9X A;  3CQL A;  1M0M A;  2G4P A;  1MLC E;  2A7F A;  2L6X A;  148L E;  2G87 A;  3QAK A;  4NGO A;  164L A;  3S3C B;  5H2H A;  4MBS A;  1S8J A;  1I20 A;  198L A;  3SB7 A;  3TMU A;  1NHB A;  2DBT A;  3W6D A;  1QKP A;  1C6I A;  1FKQ A;  4NGZ A;  4PRQ A;  2QPE B;  5KKJ A;  2NTU A;  3UTW A;  1GF0 A;  1L67 A;  2Y04 A;  2B6W A;  3AGI A;  2YBL A;  1GF6 A;  5EBH A;  1GWD A;  103L A;  4H9C A;  1P2C C;  1TAY A;  1D2W A;  1L34 A;  1LYY A;  1FLU A;  1GF7 A;  2WAR A;  1LPI A;  1KS3 A;  1BB7 A;  189L A;  113L A;  1LMP A;  1MEL L;  4WW3 A;  220L A;  4FAA B;  1XGU C;  2Y00 A;  1IOT A;  1LI2 A;  1QT3 A;  1UIH A;  3QDC A;  1L53 A;  5B6X A;  1L15 A;  1CKC A;  1B7R A;  4HWL A;  1JIS A;  5KXL A;  1CU3 A;  1G0J A;  1LMO A;  1DZB X;  1L64 A;  4H93 A;  4E3U A;  1L88 A;  214L A;  1HEM A;  228L A;  128L A;  1F6S A;  1BB4 A;  1B5Z A;  1YRO A;  5LVJ A;  1LYF A;  4ARP A;  1LMA A;  3WU9 A;  1OUF A;  4I7O A;  186L A;  5HLL A;  4KL7 A;  1LGW A;  5B05 A;  5H2I A;  1S8L A;  1CUP A;  1L18 A;  4R6C A;  5LYM A;  1C6T A;  2JAG A;  4Z41 A;  6LYT A;  5G2D A;  4B4J A;  1QT8 A;  1C6E A;  2RB2 X;  3LHM A;  4YXC A;  5AZD A;  123L A;  2EPE A;  4S0W A;  4KXI A;  1GD6 A;  1UID A;  2F4G A;  4B49 A;  1JKA A;  4WM5 A;  1DYE A;  4DDC A;  1LJJ A;  1IXF A;  1GBS A;  1LJK A;  4LT3 A;  1CV1 A;  2B6Z A;  4IAT A;  5FDJ A;  4KNF A;  1GF3 A;  4E97 A;  2ZQ4 A;  4GN3 A;  5B59 A;  1L0K A;  5JJJ A;  1D2Y A;  238L A;  1L84 A;  3HFM Y;  145L A;  4XJD A;  1L31 A;  3HT8 A;  2YCY A;  4DD7 A;  3WVY A;  3WU7 A;  2YBH A;  1L75 A;  4LT2 A;  1L70 A;  4OWC A;  4ARM A;  3P66 A;  3A95 A;  1GPQ C;  4L35 A;  1GB3 A;  4G49 A;  1L04 A;  2O79 A;  1LZN A;  1F50 A;  206L A;  5JJE A;  4ETA A;  4HPI A;  1P36 A;  1FBB A;  1DI4 A;  1L32 A;  1OUB A;  4GRV A;  5LA5 A;  2D4K A;  3QJT B;  1L25 A;  3A6B Y;  4WL6 A;  3LZ2 A;  196L A;  3F9L A;  1KIQ C;  4W51 A;  4G4B A;  2CUU A;  1L52 A;  1VGO A;  4FA7 B;  252L A;  1VED A;  2W1L A;  1N4F A;  4HJV A;  1GB0 A;  5II3 A;  1Q5I A;  1KXX A;  4GCF A;  4OWE A;  2MED A;  2HPY A;  1M0K A;  4H94 A;  1LYS A;  1LSY A;  4J7V A;  5JJN A;  3C9M A;  2DQI Y;  1M0L A;  1B7P A;  3HTD A;  3DQB A;  5AX1 A;  150L A;  4W94 A;  1L72 A;  1GB5 A;  1C6L A;  4G71 B;  2RBR A;  1C6Q A;  1LWK A;  5H2M A;  4DWX A;  1ZV5 L;  1E12 A;  3NS0 A;  141L A;  3DN6 A;  1OWZ A;  5APD A;  1QM8 A;  1LSB A;  2Y01 A;  3HU8 A;  1QTE A;  4XAD A;  1S54 A;  5T3F A;  5BR2 A;  2R4S A;  5E4P A;  1WQO A;  2F95 A;  2Z19 A;  3QBI A;  4B4I A;  2LZM A;  2QB0 B;  3CDT A;  4BV0 A;  130L A;  4NIJ A;  3WU8 A;  4BAF A;  2BRD A;  1SWZ A;  1LHL A;  4M6D A;  4CHX A;  2RB0 X;  1T8A A;  1LZ1 A;  1L26 A;  4Z46 A;  3W3E A;  2N5Z A;  222L A;  111L A;  1IC7 Y;  1SSW A;  3ZVQ A;  1LSF A;  6LYZ A;  2BPU A;  2DQD Y;  2DKV A;  5J7C A;  5ITE A;  3TXI A;  3AYM A;  1IWY A;  1L62 A;  1BRD A;  1JTP L;  2C8O A;  1ZUR A;  4LDL A;  1EQE A;  1L71 A;  5F16 A;  4GCB A;  1CKH A;  250L A;  4N8Z A;  2YDG A;  5DYS A;  5ETZ A;  2B75 A;  1DQJ C;  4YXA C;  3TXK A;  4HTN A;  1WQR A;  4ARQ A;  1L83 A;  3AZ4 A;  1SLY A;  2OE7 X;  3HUQ A;  1IWZ A;  3HAP A;  4WMG A;  2X0A A;  3OE0 A;  195L A;  1HNL A;  5ILC A;  2NTW A;  4NFV A;  1G0Q A;  1LAA A;  4DD3 A;  1QS9 A;  4GN4 A;  4KLY A;  185L A;  4IAP A;  245L A;  1LSE A;  3CB7 A;  1G07 A;  2YBJ A;  1QT6 A;  1IP1 A;  4NSH A;  4WM4 A;  119L A;  3HUA A;  1JIT A;  1L76 A;  225L A;  1L38 A;  1S52 A;  4BS7 A;  1CV6 A;  1GFU A;  3PQR A;  3HH6 A;  2YCX A;  4GYC A;  1LCN A;  1IP6 A;  2YCZ A;  2F47 A;  1HF4 A;  4ANR A;  4DT3 A;  1WTN A;  3A67 Y;  1LSZ A;  2ZIK A;  5G53 A;  1LJF A;  2RAZ X;  4MST A;  2I25 L;  1CKD A;  4EKR A;  1QTB A;  5KXK A;  257L A;  1T6H A;  1PXS A;  1I6S A;  2HTX A;  2RBN A;  1P56 A;  5FJG A;  1CJ8 A;  201L A;  3OAX A;  2BQE A;  3PBL A;  1L9H A;  1L92 A;  1IP7 A;  2F2N A;  2Z18 A;  2DQA A;  1YL0 X;  4HP0 A;  5KKH A;  1C6M A;  1OWY A;  1CJ7 A;  1JIY A;  5KXZ A;  5B1F A;  1LZ9 A;  1YAN A;  1G0L A;  4HYX A;  1HEO A;  3B0K A;  1BGI A;  1REY A;  1XSF A;  3KAM A;  3WPJ A;  1AM7 A;  2F30 A;  4DS7 E;  4HSF A;  246L A;  1XIO A;  4N9R A;  4NSI A;  191L A;  1IIZ A;  1OVK A;  3SN6 R;  4G72 B;  3C7W A;  162L A;  1WQM A;  4OWA A;  2BQH A;  2KSB A;  114L A;  4GBR B;  1BQL Y;  3RUN A;  2C8P A;  5AWZ A;  1JTN A;  1L35 A;  3HU9 A;  3RW8 A;  1LZS A;  134L A;  1L94 A;  4H90 A;  4DDA A;  205L A;  3QJV B;  1LTM A;  1IW6 A;  1DYD A;  3WXU A;  1L22 A;  3IJU A;  2HEA A;  2DQF C;  1CU2 A;  4GPO A;  3CDQ A;  5TGZ A;  1HHL A;  1REX A;  1LZR A;  1QTH A;  5H2J A;  4WLT A;  1XGR C;  1LN6 A;  1LMQ A;  251L A;  1IEE A;  3AJN A;  1QIO A;  1KIP C;  5M1Y A;  4H8Z A;  3SBB C;  1EQ5 A;  1L07 A;  1G7M C;  1GDW A;  199L A;  2AUB A;  4W53 A;  4H9B A;  4P2E A;  3LZM A;  1CU0 A;  1L14 A;  5A44 A;  3EBA B;  1GF4 A;  3A92 A;  4XEN A;  1OUG A;  4RLN A;  3HDF A;  5LVG A;  3WPK A;  5KJ9 A;  1L10 A;  4EA3 A;  1L61 A;  4WAV A;  1YAO A;  4J0L A;  169L A;  1FLY A;  4WM3 A;  5H2O A;  1IWX A;  1YKY X;  1LHJ A;  1C7P A;  5A8E A;  1L03 A;  4XXJ A;  2Y8P A;  1FKV A;  1LSA A;  144L A;  1LKS A;  3VGA A;  4LT0 A;  1EL1 A;  1KY0 A;  5B06 A;  1LHH A;  5L3H A;  3GUN A;  5A45 A;  4XTN A;  1GEZ A;  5DN4 A;  1GU8 A;  1CX7 A;  2IFF Y;  2Z39 A;  4NGW A;  3HUK A;  3QAP A;  4ET9 A;  1L12 A;  215L A;  2F2Q A;  4DYG A;  2ZQ3 A;  1JJ0 A;  5B35 A;  3UTY A;  4YX7 C;  3S3D B;  1QDT A;  1C43 A;  1HER A;  1BWJ A;  3NY9 A;  5A3E A;  3GUP A;  4H92 A;  1D0K A;  1G0M A;  1WQP A;  3GXR A;  1LHI A;  5KXW A;  1L13 A;  1SX2 A;  1JFP A;  242L A;  3EML A;  239L A;  1W6Z A;  4GCC A;  1AT9 A;  1QUS A;  1U19 A;  5ITC A;  3A3R X;  1LKR A;  1GBY A;  1GAY A;  218L A;  3TXJ A;  1SQ2 L;  2B72 A;  3TXH A;  2VT4 A;  3A8Z A;  1OUH A;  1BVX A;  1L58 A;  1C63 A;  2DQC Y;  175L A;  4NHT A;  2LYM A;  2BQN A;  1GAZ A;  3QE8 A;  4TSC A;  1IWV A;  5FST A;  1L05 A;  4PRU A;  240L A;  4HV2 A;  1IX0 A;  3WH1 A;  3AGH A;  4QRY A;  3LYM A;  3ZPQ A;  2HU1 A;  3W6E A;  1L01 A;  3UZA A;  4ETB A;  5LXW A;  1LZ8 A;  4NWH A;  1D3F A;  2M3G A;  4GLV A;  1IOR A;  1OVH A;  256L A;  4BWB A;  1GE0 A;  2PED A;  2B70 A;  1LZG A;  3DKE X;  5D5F A;  1C6P A;  5H2P A;  2EI4 A;  2ZFE A;  4X3B A;  1L23 A;  5LAG A;  3FA0 A;  1BB6 A;  3RT5 X;  1RFP A;  5H2L A;  2FBB A;  1NKH A;  4LDE A;  1T97 A;  5C6J A;  146L A;  3EH5 B;  5DN5 A;  3WMK A;  4YM8 A;  3DDL A;  3CAP A;  1NF5 A;  5AMY A;  4ARL A;  1L42 A;  1GB8 A;  4I7L A;  1H2S A;  258L A;  1LGU A;  3AGG G;  1J1O Y;  1C6G A;  1E0P A;  4I7K A;  4WO9 A;  2I21 A;  3DMV A;  1IC4 Y;  1UIG A;  1C08 C;  1L80 A;  4W57 A;  107L A;  165L A;  1LSC A;  3CSZ A;  1TN5 A;  6LZM A;  1G06 A;  3UZC A;  2NTH A;  4UHR A;  1PS5 A;  5LYZ A;  1ZYT A;  1NDM C;  217L A;  1GFE A;  5FHW A;  4NG8 A;  1P64 A;  4JQ6 A;  2HEE A;  243L A;  3LZT A;  1R2N A;  1L36 A;  1LJ4 A;  118L A;  2HUB A;  161L A;  4XTO A;  5AHZ A;  4N5R A;  1TCY A;  1C67 A;  4GP5 B;  2MEH A;  3DNA A;  3TXD A;  3PWH A;  2G4N A;  1BB5 A;  4JR8 A;  4NY5 A;  1YQV Y;  2DQJ Y;  3HBD A;  1P8I A;  4WOA A;  2X72 A;  1REM A;  3FI7 A;  2Z38 A;  1D9U A;  1IP3 A;  1QDR A;  4DD2 A;  1HFX A;  4NGV A;  5DL9 A;  1QSQ A;  1L49 A;  4X32 A;  1LWG A;  5HNC A;  1B7Q A;  1UCQ A;  4YEO A;  157L A;  1QUD A;  1AP9 A;  2B7X A;  2RBO A;  1O0A A;  2H9J A;  1D3J A;  1GXX A;  1L02 A;  3ATO A;  4I7S A;  1BB3 A;  1IP2 A;  4I7M A;  4OWH A;  1LSP A;  4WG7 A;  5B6W A;  3CSQ A;  3P0G A;  3QBG A;  2LNL A;  1REZ A;  4BAD A;  2ZYP A;  4NGY A;  4ETD A;  4IB4 A;  5B6Z A;  4LYM A;  3PXO A;  159L A;  3TXE A;  3QBL A;  120L A;  4AQN A;  1B2K A;  5HMV A;  1VAT A;  1C45 A;  2D4I A;  3G3V A;  5F9U A;  4N4W A;  1F10 A;  5E9R A;  230L A;  3G3A B;  1KNI A;  1L57 A;  1TDY A;  1LW9 A;  1C8S A;  1LYG A;  4NGI A;  3L2X A;  2LHM A;  4EKS A;  4NWE A;  3FI5 A;  2HED A;  1QTZ A;  1B7L A;  1DZE A;  1PQM A;  2HEB A;  4LGK A;  138L A;  1KXY A;  1JKD A;  2W1X A;  4WG1 A;  1DPX A;  173L A;  1C46 A;  1L97 A;  1UAC Y;  4DD0 A;  1JJ1 A;  4FBZ A;  3HT9 A;  1L00 A;  1W08 A;  4IAQ A;  4OO9 A;  1L79 A;  1GFH A;  2H9K A;  2EKS C;  1KIR C;  4DDB A;  1F6R A;  4W55 A;  226L A;  1QTC A;  3OJP A;  3A93 A;  2DQH Y;  2BQA A;  1OVJ A;  1XGP C;  4DD9 A;  5C1M A;  4NG1 A;  1QS5 A;  3HH5 A;  5KXO A;  1QTV A;  1YKZ X;  1CV0 A;  1IY4 A;  4EKQ A;  1INU A;  1L0M A;  3DN8 A;  3ABW A;  1K28 A;  4H9E A;  5I4W A;  3HBH A;  4G7S B;  4DJH A;  3HTF A;  4H9A A;  1OUE A;  1KXW A;  1IO5 A;  1GHL A;  1L39 A;  182L A;  1CVK A;  3HAS A;  2WJK A;  5G28 A;  4YEN A;  5HMJ A;  1LMN A;  5EN0 A;  4NGL A;  4NHP A;  5LVH A;  3X3B A;  1L16 A;  4ETE A;  4TWS A;  2LZ2 A;  2W1Y A;  5C6L A;  5I4Y A;  1VJM A;  3HTG A;  3GUK A;  1LI6 A;  1NQI A;  160L A;  1RE2 A;  2EIZ C;  3ULR A;  184L A;  1L54 A;  3HBE X;  4QI1 A;  1HEW A;  4ZFP A;  110L A;  2D4J A;  2ZWB A;  1BWI A;  4YOP A;  4HJZ A;  4BAP A;  2QAR C;  1OYU A;  3DN3 A;  3W6C A;  2H5Z A;  2B6T A;  2XBS A;  5LAF A;  1C6N A;  208L A;  5A3Z A;  1L85 A;  4LYO A;  3NSB A;  112L A;  1XEP A;  3EH3 B;  1L06 A;  4ETC A;  155L A;  1L48 A;  1CTW A;  4QEQ A;  3P64 A;  1GB9 A;  1JUG A;  102L A;  2BQK A;  1DYG A;  2HUL A;  3CT1 A;  4PXF A;  1QSA A;  2ZIJ A;  221L A;  1HEN A;  1XGQ C;  3RZE A;  3DN0 A;  3N9C A;  3F6Z A;  3TMV A;  1XEK A;  4ARJ A;  1B7O A;  1LGX A;  5ILF A;  2YDV A;  4NEB A;  4I7J A;  2HU3 A;  147L A;  1F0W A;  1WTM A;  4QGZ A;  1UA6 Y;  3HWL A;  4UWV A;  4QID A;  1V7T A;  149L A;  1G7J C;  3DN1 A;  262L A;  1PY6 A;  4G4C A;  4DQ7 A;  4I7R A;  1TEW A;  3P68 A;  1ZMY L;  2W1M A;  3A90 A;  188L A;  1LYE A;  3HAO A;  1P3N A;  1DYC A;  1GFG A;  1NMM A;  2A4T A;  1L59 A;  1C6J A;  1GFR A;  1L65 A;  1G0P A;  3FE0 A;  1L81 A;  2Q0M X;  5F8U A;  1B0D A;  1IOS A;  5HNL A;  249L A;  2L78 A;  2O4W A;  1L37 A;  4HYJ A;  4PJ2 C;  4M4O A;  4YF2 A;  1BVK C;  1R84 A;  2F4A A;  3CT5 A;  3J4G A;  3AW7 A;  4TX7 A;  1AT6 A;  1L86 A;  2HUK A;  1YIL A;  1GF9 A;  4OWB A;  4LDO A;  5IEL A;  5I4X A;  1C62 A;  1L19 A;  1S51 A;  1CJ9 A;  3SB6 A;  1CV3 A;  170L A;  2B6X A;  3M18 B;  1QT4 A;  4WLX A;  4X1H A;  104L A;  1QTD A;  183L A;  1LLH A;  3K3T A;  1OP9 B;  4WO6 A;  1L98 A;  2DQG Y;  4G9S A;  4NSG A;  1L63 A;  5B1G A;  1QT7 A;  1CU6 A;  1GB7 A;  2RBS A;  5LVI A;  4FJR A;  5HQ1 A;  2AT9 A;  2HUM A;  3W6B A;  1JPO A;  2HEF A;  3OE8 A;  2D91 A;  4GLA A;  5G2A A;  5LIN A;  1L55 A;  2RBP A;  1T6V L;  4N0J A;  5FEL A;  3C82 A;  2BQC A;  3V2W A;  4EXM A;  3COD A;  1CU5 A;  1UIC A;  4G7R B;  3TXF A;  122L A;  2MEA A;  1L47 A;  1L87 A;  115L A;  1RI8 B;  3C7Y A;  1L82 A;  2F93 A;  142L A;  1OUD A;  4I7P A;  4BEY A;  1G0G A;  3HH4 A;  1DKJ A;  1P46 A;  2QPD B;  3C9L A;  3QJS B;  190L A;  3UTV A;  4CGE A;  1DXJ A;  4BUO A;  1UAZ A;  1GFK A;  5B2N A;  1RJC B;  4Y9H A;  1P2R A;  3WUA A;  1IWW A;  1E8L A;  3ZEK A;  4LYT A;  1AT5 A;  1QUT A;  1CKF A;  2DQE Y;  1F88 A;  2J4Y A;  4GN5 C;  174L A;  4C3W A;  3WXT A;  3HAQ A;  3AYQ A;  5F14 A;  168L A;  1GFV A;  1HFY A;  4I7Q A;  1JGJ A;  1AZF A;  3GUO A;  2KS9 A;  2CDS A;  3C80 A;  1GBW A;  3AM6 A;  3P4Z A;  1L24 A;  1L21 A;  4HPE A;  1V7S A;  4W54 A;  4GBR A;  4NC3 A;  1C6C A;  3IWR A;  1B5W A;  1LZ4 A;  3OE9 A;  1L09 A;  2OTY X;  3EMS A;  1GFT A;  1L33 A;  3HH3 A;  4BVN A;  1C10 A;  5B6V A;  2GV0 A;  5B07 A;  4BEZ A;  2OTZ X;  4DKL A;  5L9J A;  125L A;  4H9H A;  5KXS A;  1B5X A;  1G1V A;  3EO5 A;  1KME A;  2BAA A;  234L A;  3S8G B;  1QT5 A;  1ALC A;  4MD1 A;  3RZ4 A;  5D5C A;  135L A;  1L11 A;  1L28 A;  2YVB A;  1XEI A;  3J6K A;  4I7N A;  4J4Q A;  1HEL A;  2Q9E A;  3UTX A;  1LHM A;  2OU9 A;  211L A;  4UWU A;  3ZPR A;  1LZD A;  1XJI A;  2BQJ A;  1GBZ A;  3OE6 A;  1B7S A;  254L A;  3SB5 A;  5C6I A;  1QTK A;  1L60 A;  1KW7 A;  3LN2 A;  3TXG A;  1NBZ C;  3S3B B;  1QSW A;  181L A;  1DYF A;  2ANV A;  4I7T A;  2ZIL A;  3QJR B;  1LSM A;  2XTH A;  1UIF A;  4ZPU A;  1F4Z A;  1QUH A;  3LYZ A;  1LSN A;  4N1C C;  2Z2E A;  5KXP A;  178L A;  1QSB A;  3DN2 A;  5AX0 A;  4UWN A;  5G2C A;  1OV7 A;  2Z6B A;  2MEE A;  4UG2 A;  1G0K A;  1PQJ A;  3FAD A;  4PPO A;  3WUN A;  1A2Y C;  3WL2 A;  1P37 A;  1OUJ A;  3WQJ A;  1L96 A;  4LZT A;  1L51 A;  1P6Y A;  2ZNX Y;  4XJI A;  3VW7 A;  3CT0 A;  3UON A;  4PGJ B;  219L A;  4GP8 B;  1YAQ A;  1B9O A;  3WW5 A;  1IVM A;  1ZVH L;  233L A;  1SWY A;  3HAN A;  3AZ7 A;  2LYZ A;  2IHL A;  2ANX A;  4WM6 A;  4WLY A;  163L A;  1L69 A;  1LPY A;  3WUL A;  158L A;  3LYO A;  4LYC A;  1VAU A;  1WQQ A;  4PXK A;  1LYZ A;  3B6L A;  1OV5 A;  2YBN A;  2F32 A;  3HTB A;  4TL3 A;  1I1Z A;  4OW1 A;  4MD2 A;  253L A;  2Z55 A;  1FBI X;  3N9E A;  1JSF A;  5LYT A;  4OOT A;  5FEK A;  5KXM A;  1SSY A;  1UUZ C;  1IOQ A;  4H9I A;  1C61 A;  1P2L A;  1D6Q A;  5KXY A;  1L45 A;  216L A;  1KY1 A;  7LZM A;  1IP5 A;  4DQJ A;  4JKV A;  4LZM A;  1LSD A;  2BLY A;  1CWQ A;  1HML A;  2YBI A;  2RBQ A;  1FN5 A;  1P5C A;  3E3D A;  1RCM A;  1HMK A;  1JEF A;  3REY A;  2XBR A;  3ODU A;  1LJN A;  2IGC A;  5I53 A;  5B6Y A;  2OE4 X;  4XN6 A;  1FLQ A;  108L A;  4HTK A;  1LYD A;  1UIB A;  2CWI A;  260L A;  4MR1 A;  1CUQ A;  9LYZ A;  4ARM B;  4B1A A;  1L20 A;  3G3X A;  2NWD X;  5I54 A;  5KXR A;  3M3U A;  1XGT C;  212L A;  1PXR A;  3SB9 A;  3MBV A;  1YAM A;  1C65 A;  1DYA A;  2ZYC A;  1QQY A;  4TSB A;  1P8U A;  3HAR A;  1PQI A;  3A34 A;  4R0F A;  1L43 A;  1T8G A;  2BQG A;  3HT6 A;  2R4R A;  1L29 A;  1LJE A;  4LYB A;  3VWO A;  2OEA X;  8LYZ A;  4NGK A;  153L A;  4W96 A;  2KSY A;  1NHE A;  4RDS A;  3S8F B;  1B5Y A;  2BLX A;  2D6B A;  1LJG A;  1VDP A;  4PK0 A;  1JV7 A;  3TMW A;  4MQT A;  192L A;  2PC2 A;  209L A;  4J1A A;  1PZY A;  4HJY A;  3VVK A;  1I56 A;  1VDS A;  3CDV A;  1C60 A;  1T3P A;  1LYH A;  2Z37 A;  4AMI A;  1B7N A;  5IHG A;  1CV5 A;  4ZIX A;  3A3Q A;  1IOC A;  4NHI A;  1FDL Y;  2YBM A;  2LZT A;  1EPY A;  1JTO L;  1JSE A;  4XJG A;  3A91 A;  4IAR A;  1L41 A;  1UIE A;  2RSC A;  4EIY A;  1LJI A;  247L A;  1JWR A;  5F81 A;  143L A;  1G7I C;  3V2Y A;  3C8S A;  1L44 A;  1WTH A;  1DI3 A;  4B4E A;  167L A;  5KXT A;  4EKP A;  4D9Z A;  231L A;  2A7D A;  166L A;  3BVD B;  4L41 A;  1L50 A;  3TMX A;  131L A;  5LIO A;  4U3X B;  2XJW A;  4C5F A;  4WLD A;  3NYA A;  2I35 A;  2FBD A;  180L A;  4RLM A;  139L A;  1IWU A;  154L A;  4MQS A;  3AZ5 A;  235L A;  1L95 A;  4I0C A;  4AMJ A;  1YAP A;  1GE3 A;  4L6R A;  194L A;  3C81 A;  3RFM A;  3HT7 A;  1LZE A;  2B6Y A;  2RB1 X;  1C3W A;  4IAS A;  177L A;  3ZVQ B;  1TLA A;  3T6U A;  4H9F A;  2LYO A;  1DPW A;  4LFP A;  1B6I A;  2OE9 X;  3WUM A;  1L46 A;  1C6D A;  1D0L A;  3TXB A;  3A7K A;  5LZM A;  2ZZL A;  1CJ6 A;  1L17 A;  133L A;  3W6F A;  4A7D A;  4WM1 A;  3GUL A;  1XFP L;  4PHI A;  2FYC A;  3CDO A;  4ARQ B;  3X3C A;  5I5Q A;  4NSJ A;  2BQD A;  4QY9 A;  2XQO A;  1LHK A;  237L A;  3WYH A;  1IR7 A;  1QUG A;  5BR5 A;  2OU8 A;  3SP3 A;  5B0W A;  5FCP A;  1NWG A;  3AZ6 A;  3C8Q A;  1GBX A;  2WJL A;  3D9A C;  1C66 A;  1L30 A;  1GF8 A;  3L64 A;  1L27 A;  4EMN A;  5L3I A;  3DMX A;  1L99 A;  3VHZ A;  1D3M A;  255L A;  1H6M A;  137L A;  1C6A A;  1C6K A;  1YL1 X;  3OK0 A;  1HEQ A;  4QDN A;  1LSG A;  2I26 L;  5APF A;  2OU0 X;  1DI5 A;  1L90 A;  3BKH A;  4X31 A;  193L A;  3GUI A;  200L A;  4G7Q B;  1KGB A;  1L77 A;  1JTT L;  2EQL A;  3VG9 A;  4B0D A;  1L89 A;  1C8R A;  4CFO A;  1JKC A;  5DHG A;  4N4Y B;  1LZB A;  227L A;  1IR9 A;  1UIA A;  3A96 A;  152L A;  2MEG A;  241L A;  3KJ6 A;  1HC0 A;  2MEC A;  1IW9 A;  4AXT A;  244L A;  1GF5 A;  1L68 A;  4IJ4 A;  1D9W A;  3VI0 A;  1GE4 A;  4N6H A;  2I1X A;  1OUI A;  1BWH A;  1CNS A;  1EHK B;  3A94 A;  1GB6 A;  3W6A A;  1TBY A;  5KXX A;  4RW2 A;  1GZM A;  1LMC A;  4EJ4 A;  4DQ5 A;  4GP4 B;  4NHQ A;  1B5V A;  2BQF A;  3C7Z A;  2RAY X;  132L A;  1GE2 A;  1GUE A;  3F8V A;  2ZIY A;  5DM9 A;  1GFA A;  1L40 A;  176L A;  3IJV A;  1UCO A;  1G7L C;  4GCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...