3VXCA

Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
398
structure length
398
Chain Sequence
TITAMVYGDDAVKVQDKAASRFNASAEAKKANAKVKMERIPASDYPAKLRTAMGSPNAPDIFFNWGGGSIKAYKEAGQLVDLTDVIKSDEVLSTGFLPSVVAAGSLDGHEYGIPMRGMQPVLLFYNKSVFAEHKLTPPTTWDQLLDNVAKLKKAGVTPFALGGVEIWPELMWLEYLVDRIGGPQVFDKIRNGDASGWGDPAVLKAAQTVKQLVDEGAFGKGFSSVSYNNGGAPALLAKGKAGMHLMGSWEYSTQLGKFPDFAKKDLGWCAFPSFEGGAGDIRNVVGNPCNYWSVNARTGNKDGAIAFLRDCASEAYTKDLIDNGDVPTTTIAENMLDSSPNPEFAKFQYQLVQKAPNFTLSWDQAVDPDWQQPMLTEINKLFVGKSSPEQFVSALKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Xylooligosaccharide-Binding Protein from Streptomyces thermoviolaceus OPC-520: Dramatic Conformational Change with Ligand binding
rcsb
source organism Streptomyces thermoviolaceus
molecule tags Sugar binding protein
molecule keywords Putative sugar-binding lipoprotein
total genus 145
structure length 398
sequence length 398
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vxcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vxcA02
2XD3A 1J1NA 2H25A 2XXWA 3MAMA 3S9NC 4XTCQ 3FXRA 1AMFA 1A8FA 3C9HA 3S9MC 3N26A 1H76A 3EHTA 3ZSFA 4PP0A 2R6GE 4JSDA 4YZZA 1OQHA 1P1QA 4FEBA 4GVOA 4R73A 3SERA 1GTKA 4DXBA 2A5TA 5CBRA 2Y7WA 4OMBA 5A5XA 1B3GA 4R2FA 1S50A 5FHNA 2O6AA 4R72A 3T9UA 3TQLA 1LBBA 2P2AA 3DM0A 3K4UA 3R6UA 5EHSA 4ZEDA 3V5AA 3PPRA 5ITPA 3MVXA 2E1SA 3SESA 3T22A 2QMXA 1B51A 1NNPA 2ONRA 2R71A 1H44A 3FV2A 4GXAA 5AA1A 3RQTA 4F3PA 4HW8A 4KCDA 4GRKA 3PMWA 3IOVA 4OFJA 1JQFA 4XIGQ 4GIZA 1A55A 3IOUA 3OSRA 3HSTA 3HN0A 3OENA 1O7TA 1GV8A 3H3GA 2XXRA 4U4XA 2AL4A 1EH3A 1FQDA 1YPNA 3FVKA 4U1OA 3T9HB 2YJPA 3LSWA 1XT8A 3E13X 4PETA 1ZU0A 3RY3A 2RCBA 2QJEA 3K1NA 1B9JA 2DWHA 2I3WA 2XX9A 4KD5A 1B1HA 4ESWA 3B7DA 1R9LA 2V84A 1A54A 3MWBA 1Y1ZA 2OCUA 2THIA 1QUIA 2F7BA 3TQWA 3FASA 4U1ZA 2I48A 4FJPA 4GL8A 3E3KA 1Y4TA 5L8DA 4XKNA 3KBRA 4ZZAA 3MVZA 4I9DA 3CRBA 4R6KA 5I59B 3C33A 1AL3A 4QHQA 3N6TA 2P0SA 4H5FA 1B5IA 2RF1A 3FJMA 5FHMA 3JYRA 3LC8A 4F1YA 1OQGA 2HFBA 5L9OA 1B3LA 2ZYMA 3OO7A 3TTMA 3U1OA 4QSCA 4C1TA 4IO6A 1OVBA 2PX1A 3EN3A 5BWJA 5DVJA 2RKMA 1IXCA 1A99A 1DPPA 1XVYA 2O51A 2GFEA 3BFUA 2D5WA 4M4GA 5H8SA 3TCFA 3L6GA 4Z7EA 3MVYA 5KDTB 5CMMA 4RJZA 1ZTYA 4LVQA 1FQAA 1S9TA 3H6UA 1P1UA 3TMGA 3QK6A 3VVFA 3TKDA 1H3DA 3UN6A 4AB5A 4N07A 5DVFA 3IJOB 1MQHA 1MXZA 2F6PA 3O6HA 3U94A 3MVWA 1BIYA 1MY4A 1BLFA 2CMOA 2OWTA 4IY6A 4KYEA 5TP9A 2ZNSA 2F97A 3MZBA 4ELQA 4ELPA 1LAHE 3U72A 3TTRA 1MRPA 3SEWA 4RA1A 1SW5A 1SDXA 1B7ZA 1MH3A 1UQWA 2V25A 1Y20A 2DSFA 3EF7A 3IR1A 3K6UA 3E4RA 4AQ4A 3ZS6A 4ELRA 4EQ7A 2RINA 3EPEA 1B2HA 3QIMA 4FEDA 2HAVA 4U21A 4EQBA 3CG3A 1UTHA 3TAJA 1UTBA 1JEUA 2ANJA 4FE8A 2REGA 4RY1A 4RPNA 2DS9A 3IORA 4RXLA 5AA2D 1JW1A 4GD5A 1LFHA 2ABHA 3PGFA 1IXIA 1NNTA 1OIBA 3A3CA 3H06B 1LLSA 2HXWA 1FTMA 2ZYNA 4JWXA 1ZJLA 4KYSA 1IUDA 4OHNA 4ZEIA 1UIVA 4DXUA 1TT1A 2XX7A 5H8NB 2Q88A 2H99A 4F1VA 1SW4A 2V3TA 3S9EA 5L9MA 1HSLA 1RKMA 3MQ9A 1POY1 1N76A 3TTKA 2I4CA 3FVOA 3K6VA 5CMKA 4QF9A 5JTYB 4LP2B 4G68B 4OFLA 2OZZA 2HQ0A 4IGTA 4IO7A 4OXVA 5H8QA 1ZKBA 4OEUA 4FAJA 4P0GA 2ZNTA 4X1DA 3LSXA 4AB6A 3MPLA 4U22A 4IO4A 5EHMA 2DVCA 2VGQA 1B4HA 4KCCA 4QFKA 3SEVA 3FXQA 1H45A 3CSBA 4DIGA 2D21A 1I6QA 1N04A 3K6XA 3MUQA 4OENA 1QJMA 4X9TA 4H8IA 1LAFE 2G29A 4ZEFA 1LB9A 3B6QA 2OK2A 3C36A 2X26A 3DLNA 3KN7A 3DP8A 5JK4A 5HBCA 1L5TA 5DEXA 1I69A 2AIXA 4G68C 4QFPA 1Y4CA 3USDA 4BDLA 4LQ5A 4NMYA 5H8QB 4F39A 1MQJA 4G68A 2IA4A 1LBCA 3ZKLA 3ODBA 4RYAA 2DWJA 5ISUA 3JV9A 4OVJA 1PB9A 4GF8A 3H4ZA 4FATA 1NNFA 3LSLA 4QFOA 1NKXA 1YCJA 4I1DA 1D3KA 4GFRA 4F29A 4YB5A 1DPEA 1XVXA 1VFDA 2YPNA 4R6YA 4ZS9A 2ZMBA 3G3IA 4EF1A 1A8EA 2DE2A 1ZMGA 2QSXA 4OESA 3RN8A 3K1PA 4YKJA 2QS1A 1HSEA 1LAXA 1PB7A 3EHUA 1IIWA 3GZGA 1QKBA 5TPAB 3TDJA 2Q2AA 4GL0A 3RPWA 4OFOA 3RGYA 1FQFA 1YTVA 2DWAA 4XKPA 4H65A 3RNNA 3Q28A 2QS4A 1POTA 4H67A 3IJXB 5ELVA 3V8XB 1SYHA 2XX8A 5BUUA 3TODA 4WKMA 5TU0A 3THIA 2HZLA 5DYHA 1JETA 1FQEA 4C0RA 1QW0A 4P11A 2Z23A 1JNFA 2PT1A 2REJA 2DXRA 2VD3A 3G3FA 4THIA 3TTLA 4ELOA 2F35A 2KLFA 1GGGA 2F8DA 3H6WA 1PBPA 4R2BA 5H8HB 4BLAA 3CI8A 3OSQA 1RYOA 2F7CA 3LUYA 3PD9A 3CG1A 3U92A 1BKAA 4EXLA 5ICTA 3KSXA 4BDQA 3D4GA 2Z8FA 3G3GA 3O97A 4RPOA 1M5BA 1O63A 1WVJA 3LSFB 5DEXB 2V3UA 1B32A 4KHZE 5I58A 2ONKE 1B3FA 4JWYA 1D4NA 4EQ9A 5I58B 3CFXA 4H8JA 4Q5TA 1TFAA 3EHSA 1B46A 1P1WA 1PEBA 1IEJA 3IX1A 4DE8A 1XC1A 4JSOA 4YMAA 4Q8RA 1US4A 1USYH 3KZGA 3G3KA 3QYTA 3KN8A 4XKQA 3UA8A 3GBAA 5CBSA 1N3XA 3M3KA 3TTNA 1B1XA 3OD7A 3MC2A 4G8NA 3MBPA 1PBQA 1MY3A 2F78A 3UK4A 1MY2A 5I56A 1B40A 1MXYA 5I59A 3TEPA 3PUVE 1WODA 2QS2A 2QMWA 5AA4A 1FTJA 2Y7KA 4OWDA 3A3UA 2DE4A 5H8NA 1ANFA 5TPAA 4H5GA 3PUYE 4EF2A 3TCHA 5FHOA 4OYVA 2O1LA 3PMXA 4IO3A 3W15C 2RCAA 3OOAA 1JVXA 3VXBA 1AOVA 5CC2A 3F11A 2Y7PA 1LSTA 1MPDA 1SBPA 1MS7A 3CIJA 1JW4A 2Z8EA 3FJGA 3HCQA 4JXIA 4N6PA 1DMBA 1DOTA 3MZ9A 4M1VA 1UTBB 1B7UA 3IB2A 3N6UA 4DXCA 3T93B 1URSA 3H6TA 4YU0A 1VR5A 3SEUA 3PUXE 3DELB 4HCYA 4LZ8A 4FIMA 4X1BA 1Y3NA 2LAOA 5HM4B 5I56B 1SD3A 1LAGE 4O3CA 2XXQA 3PPPA 5CI5A 1XHYA 1ATGA 2F6GA 3OO9A 3DP6A 1FTLA 2OJTA 3DP4A 3R26A 4LQ2A 3SEYA 3VVDA 3PPOA 4JWOA 4U4SA 4F19A 5A5XB 2YLNA 4DCYA 3K00A 4O3AA 3C31A 2HEUA 4U23A 1OLAA 4WEPA 3U93A 4K3FA 1NH8A 2FNCA 1MXWA 2UVGA 1QULA 2DE3A 3K2DA 3TCGA 3KG2A 3C35A 1MPCA 3IO6A 3M8UA 4HTGA 1MQIA 3W9VA 2B65A 2F5XA 3N5LA 2NXOA 5I2KA 1S7YA 3RT8A 1CE2A 3VVEA 4QSEA 1N7WA 1SYIA 3O9PA 4NF5B 5H8HA 3PV0E 3T96B 2DOJA 4O3BA 1A7LA 3W9WA 2UYFA 1URGA 2I6EA 3MJNA 1FQBA 1LCFA 3OO8A 4NF8B 2NUVA 3KOTA 3CR9A 4OERA 1MM6A 2Y7RA 2X7QA 5M2VA 3PD8A 3K01A 3KJ7A 4NF4B 1DTZA 1AIVA 5I2NA 4I8CA 3LBSA 4ISUA 4YKIA 5F1QA 1ZIUA 1QVSA 3B6TA 2UVHA 3KGCA 3OEKA 3Q25A 4LUBA 5EYFA 1EZPA 1MXVA 4RK2A 2HCAA 1MXXA 3OO6A 3IO4A 3HV1A 4E0XA 4R74A 1B52A 2XXYA 1M5CA 3KFMA 3KN3A 3LR1A 2ONSA 2FA7A 2OLBA 2X7PA 2HZKA 1F9BA 4IO5A 1VSOA 4F3BA 5I2NB 5I84A 4NF4A 3VV5A 4KI0E 1B05A 1MXUA 4POXA 1MQDA 2O84X 2QRYA 4ZEBA 2F34A 3CVGA 5H8FB 3FVGA 1GVCA 4EUOA 1MH4A 2Q8JA 3QAXA 3ECRA 4EXKA 2F7AA 3MP6A 1TFDA 4OQOA 4GOTA 1M5FA 2DQVA 1EU8A 1EZ9A 4QFLA 3CFLA 1B3HA 4JDFA 3ZKKA 1MDP1 4FECA 1B3EA 3Q26A 5FTHA 2NWJA 1A40A 5HPQA 1MY1A 2XXTA 3IAZA 4G2ZA 2P1SA 4H1XA 3ONMA 4KR5A 4QSDA 5CMCA 3O6GA 3ILTB 4QFNA 1VFEA 4PFTA 2H98A 4NWCA 1CB6A 1TWYA 1VE4A 4P0IA 3T9VA 1B7HA 2NVUB 2PYYA 1OMPA 4LA9A 3ILUB 3KSJA 1B0LA 1GR2A 3FIRA 5JTYA 3H03A 3IL1B 3T66A 4YMBA 2M8CA 4KPTA 5ICQA 4NEDA 4GWOA 1PC3A 2Y84A 3OEMA 2O7UA 3IB1A 3WAFA 3VXCA 3OXNA 2XXIA 4IY5A 3UORA 2ALUA 4IGRA 3E9XA 1TXFA 3RLFE 5KZTA 3VLUA 2GRVA 4I62A 4ZE9A 1URDA 2XXXA 4LONB 2ESNA 3T9XB 2VP1A 2Q2CA 3S2VA 1B0HA 3QXMA 1WDNA 4KYDA 4OEVA 2BJJX 3RTWB 1SI1A 2H9BA 3IOWA 3O6IA 4NE4A 3O2AA 3QSLA 1O64A 1I6AA 3A09A 3IOTA 3TFLA 2H5YA 3HHGA 4KFQA 1R9QA 4MBPA 1FTOA 2R9JA 4H0WA 4F3SA 1QUKA 1UTHB 2I0CA 5J1DA 4NF6B 3PMVA 1P1NA 3OELA 1ELJA 3PUWE 2XXHA 4MFIA 5CRYA 1T0KA 3FVNA 4E0WA 2WKYA 4GLIA 3L6HA 4RNSA 3PPQA 2G93A 2VOZA 3G3JA 5TP9B 3UGWA 3G7WA 4G8HA 4IB2A 4IO2A 4OZ9A 4PE5B 3K6WA 1P99A 4C1UA 5L9SA 2DYXA 1N0TA 1FW0A 1MPBA 1SW1A 1YAEA 2I49A 3FATA 3FZVA 4MLVA 1EZOA 3CFZA 1P1OA 3VDFA 4F18A 1M5DA 4ESXA 4GXSB 3U8QA 5JEIA 5DVIA 2D3IA 4POWA 1N3WA 4ECFA 4NF5A 2Q89A 1MQGA 4UA8A 2DVZA 2ZXTA 4BDOA 4NWDA 3O28A 1NFTA 3VLWA 3K0VA 3PUZE 4UACA 3C32A 4H6DA 1ZBMA 2V3QA 3GXAA 3VLVA 4LZ5A 2DXYA 2H4IA 5CMBA 3I5OA 2O7IA 2PBWA 4DZ1A 2RC7A 1JW5A 4G8MA 1QUJA 3N94A 4LATA 4G4PA 3SETA 4NF6A 3AXFA 2HAUA 3FUZA 3TZAA 5FTIA 5IKBA 1Q35A 3M3LA 3HHFA 4GQOA 3SEXA 1B5HA 1NNKA 4ND9A 1BP5A 1B5JA 2PT2A 2QL3A 2Z8DA 1FQCA 2B3BA 2IEEA 3C4MA 4N13A 4RK9A 4DDDA 4YAHX 4DLDA 1LB8A 2Q9TA 3FJ7A 2QPQA 3UP9A 2GHBA 3KOSA 4R9FA 2RC9A 4NTLA 1JVYA 3RT6B 1LFIA 2I4BA 3B6WA 2E0SA 1Y3PA 5CM6A 1LGBC 3FGSA 5F7VA 3R7XA 5DTBA 1II5A 3RUMA 5I57A 2O68A 1IXHA 4BDMA 1SQYA 3V89B 2A5TB 4R75A 4MF3A 1R1NA 1NMUA 2GHAA 1MG1A 2I58A 2PMSA 2ZNUA 4TLMB 4XXUA 1OVTA 2I0BA 3BKIB 4L17A 3TYHA 3KJTA 4PFUA 1IQ7A 1DSNA 3M3FA 5K2YA 4BDRA 5AE4A 3MP1A 4ZDMA 4ZEKA 5K2XA 5AA4B 2OWSA 3C34A 5B70A 2AL5A 3I3VA 1SVXB 2PVUA 1MM7A 1DTGA 2XXVA 3IK6B 4HS7A 5AA2A 3D4CA 1Q1KA 1AH5A 1OLCA 2UXAA 3SDFA 1SW2A 4G77A 4WXJA 3TELA 1N84A 2DP8A 2O1MA 1ZLQA 1FTKA 1R6ZA 2XHDA 4KQPA 5LOMA 4BDNA 4WEDA 3K1MA 3S9LC 3PPNA 1Z7NE 1PB8A 3EQ1A 1XS5A 4YB6A 2XXPA 3TPAA 1UIUA 1Z7ME 3FD3A 1LCTA 3PU5A 4YKKA 2QS3A 3SKPA 4FORA 4ZECA 2XXUA 4JB7A 4R9GA 1SI0A 3G3HA 1KWHA 4ZE8A 4F2OA 2B3FA 3OMBA 1IZ1A 4YB7A 5I57B 3HPIA 3GLBA 4ZZEA 3O29A 3HO7A 2I3VA 2UVJA 4X48A 3WAEA 1LFGA 5KCJA 1QKAA 4JBZA 1I6BA 1XOCA 5DT6A 2UYEA 2ZYKA 2V93A 5H8FA 3Q27A 2CZLA 4LZ7A 1M5EA 3I6VA 3MPKA 3V83A 2O69A 1USYE 4EDPA 3JZJA 1JEVA 4OETA 1RYXA 2AYSA 4MLQA 1Y3QA 4QRZA 4TLLB 1IXGA 4HCWA 2GH9A 3FXUA 4PFWA 4F2QA 2Y7IA 5AA3A 5B7DA 4ONYA 4OTEA 2UVIA 4U2RA 4Q0CA 4F22A 1H43A 4XKRA 4PFYA 2DWIA 3IB0A 4YICA 1NL5A 3UIFA 5IAIA 1Y1MA 2NOOA 3H6VA 1B58A 1B4ZA 1BTJA 1PDAA 3TUSA 2VHAA 1D9VA 5KCJB 4PQJA 5ITOA 3GBBA 3KEIA 3Q29A 4R6HA 3BFTA 1Y9UA 3MW0A 1IITA 1N7XA 2VD2A 3FV1A 3O66A 5KDTA 1MY0A 3RTFB 3VFJA 2XD2A 4YKPA 4DCXA 3CSGA 1NH7A 1FCKA 3MP8A 4F1UA 4NF8A 4F3GA 4Q30B 2F36A 1D9YA 2OBGA 3MZ1A 3BBRA 2W7YA 3S4UA 3QUJA 1B6HA 3K02A 3P7IA 1US5A 3H7MA 4TOZA 4MH5A 4TQUQ 3VE1B 2FYIA 3QUFA 1MDQA 4Z0IA 5AA2B 2A5SA 1HSJA 2ZYOA 2Z22A 4F31B 2RC8A 5I2KB
chains in the Genus database with same CATH superfamily
2XXWA 3S9NC 4PGPA 3C9HA 3HFUA 3N26A 3ZSFA 4YZZA 5IM2A 1OQHA 4DXBA 2A5TA 2Y7WA 1B3GA 5EHSA 2VPNA 5ITPA 3MVXA 4QXDA 2P3VA 1B51A 4F3PA 2R71A 2MKZA 4XIGQ 5T3JA 3HN0A 3TCHA 3T9HB 2AL4A 1YPNA 3K1NA 2XX9A 1B1HA 3B7DA 3MWBA 1QUIA 3TQWA 4U1ZA 4GL8A 1FPKA 1Y4TA 4I9DA 1AL3A 4QSCA 1OVBA 5DVJA 5LTCA 2D5WA 1S9TA 3H6UA 5DVFA 1MXZA 2F6PA 3O6HA 1BLFA 4ELPA 1MRPA 4RA1A 1B7ZA 4PDDA 2V25A 4EQ7A 3E4RA 4ELRA 2V4CA 4EQBA 3CG3A 1FJ6A 1UTBA 4FE8A 2REGA 2DS9A 1JW1A 4NN3A 3A3CA 4OHNA 1UIVA 2Q88A 1LEVA 1SW4A 2V3TA 3TTKA 3FVOA 3K6VA 4QF9A 4OFLA 5H8QA 2HQ0A 2P3NA 5EHMA 4QFKA 1B4HA 4DIGA 4PAFA 1LAFE 2G29A 4QFPA 4BDLA 4LQ5A 2XA5A 4NMYA 5H8QB 1MQJA 2IA4A 4RYAA 1PB9A 4QFOA 1YCJA 4GFRA 3LV0A 3RN8A 4YKJA 3EHUA 4QBAA 3TDJA 1QKBA 3RGYA 1YTVA 4XKPA 1FPJA 3Q28A 2QS4A 4H67A 5ELVA 1SYHA 5TU0A 1FQEA 2CEXA 3G3FA 2DXRA 1GGGA 2F8DA 4BLAA 1PBPA 3LUYA 3IFCA 5DEXB 4KHZE 1B3FA 1VDWA 4H8JA 3EHSA 1PEBA 4YMAA 4DE8A 1US4A 3UA8A 2F78A 2WYKA 5I56A 1FBPA 3E79A 5AA4A 1ANFA 5TPAA 4H5GA 4PTKA 1NV7A 4OYVA 2RCAA 3CIJA 1MPDA 1MS7A 1JW4A 2Z8EA 2QVRA 1DOTA 1B7UA 3IB2A 5ET7A 3QMFA 4HCYA 4FIMA 5I56B 4G61A 2XXQA 1XHYA 3DP6A 2OJTA 3SEYA 4U4SA 5EQAA 4F19A 2UVGA 3KG2A 3C35A 1S7YA 4QSEA 1SYIA 1EYIA 3O9PA 5EQ7A 2F3DA 5FBPA 4P9KA 2DOJA 2UYFA 4OERA 1MM6A 4NF4B 4MMPA 4GWSA 4N8YA 4DI3D 5I2NA 3LBSA 2VPOA 5F1QA 2QFLA 1QVSA 2UVHA 3Q25A 1MXVA 3IO4A 5IZ3B 4R74A 2XXYA 4JVDA 1NV1A 1F9BA 1VSOA 4F3BA 1MXUA 4POXA 2QRYA 4ZEBA 1GVCA 2F34A 3CVGA 3FVGA 3ECRA 2F7AA 3CFLA 4PFRA 1B3EA 5FTHA 2NWJA 5HPQA 1MY1A 3IAZA 4G2ZA 4HXVA 5CMCA 3ONMA 1IMDA 1TWYA 1VE4A 2PYYA 2B4LA 3KSJA 3H03A 3IL1B 3T66A 1FBGA 2Y84A 2O7UA 4P3LA 3UORA 3RLFE 2F3BA 3E9XA 1WDNA 1O64A 4MBPA 4KFQA 1DBZA 3T1BA 1IMCA 3OELA 3FVNA 2WKYA 4GLIA 1FRPA 4RNSA 2G93A 2VOZA 3UGWA 1NV3A 4OZ9A 3VDFA 1SPIA 4F18A 3U8QA 1N3WA 4ECFA 4NHBA 1FPIA 1MQGA 4UA8A 3O28A 1YYZA 3B50A 2ZZXA 4UACA 3C32A 1ZBMA 3VLVA 2DXYA 2H4IA 4X8RA 5CMBA 1Q9DA 3I5OA 2O7IA 1JW5A 1QUJA 4G4PA 5IKBA 3SEXA 4ND9A 2Z8DA 3C4MA 2XWIA 4RK9A 4O7IA 4YAHX 3FJ7A 2RC9A 4NTLA 1JVYA 4MX6A 3ISPA 3FGSA 3R7XA 3RUMA 1IXHA 4BDMA 4TLMB 2I58A 3BKIB 3KJTA 4PFUA 1IQ7A 1DSNA 3M3FA 3MP1A 3C34A 3I3VA 4HS7A 3D4CA 2VT5A 1Q1KA 1AH5A 2UXAA 4WXJA 1N84A 2DP8A 2O1MA 4HE1A 1R6ZA 3PPNA 4PE3A 2XXPA 3TPAA 2WEFA 4ZECA 3SKPA 2B4MA 4JB7A 1IZ1A 4ZZEA 4JBZA 2V93A 2CZLA 3I6VA 4EDPA 1JEVA 4MLQA 1Y3QA 4TLLB 1IXGA 1FPDA 4HCWA 4F2QA 2Y7IA 4OTEA 2UVIA 4U2RA 4F22A 4XKRA 4PFYA 4YICA 1NL5A 3UIFA 2NOOA 1B58A 5ITOA 1IITA 5KDTA 1RDYA 1MY0A 3VFJA 4YKPA 3CSGA 1NH7A 1IMEA 4Q30B 2F36A 1B6HA 3P7IA 4MH5A 2FYIA 1L5TA 1FBEA 5I2KB 4ZE9A 2XD3A 1J1NA 3FXRA 4R73A 1GTKA 5A5XA 4R2FA 3SZPA 3TQLA 2Y5LA 2P2AA 3K4UA 3R6UA 3V5AA 2E1SA 4P1LA 3RQTA 1H44A 3FV2A 4KCDA 3IOVA 1JQFA 4GIZA 1A55A 5H8NB 1EH3A 1FQDA 1XT8A 3E13X 3RY3A 1B9JA 1LBYA 1G0HA 3KBRA 2P0SA 1B5IA 1IMAA 3LC8A 4F1YA 1NUWA 2ZYMA 4C1TA 4IO6A 3EN3A 2RKMA 2O51A 1DPPA 2GFEA 3BFUA 5IZ1A 4M4GA 3TCFA 3MVYA 1FQAA 3KC0A 1P1UA 3TMGA 5ET5A 4KYEA 4MNCA 5TP9A 2F97A 3U72A 3TTRA 3SEWA 1SW5A 4DI4B 3K6UA 1Y20A 3EF7A 4O7MA 4AQ4A 2HHMA 2RINA 4FEDA 3TAJA 4RPNA 5AA2D 1IXIA 3H06B 1LLSA 2ZYNA 1FTMA 4JWXA 1ZJLA 4ZEIA 4F1VA 3S9EA 5CMKA 2BJIA 4G68B 4N6DA 5J16A 4OEUA 4P0GA 4O8MA 3MPLA 4U22A 3SEVA 2VGQA 1H45A 2D21A 1N04A 1QJMA 4ZEFA 3B6QA 3DLNA 1NUYA 5JK4A 2AIXA 3USDA 1Y4CA 3ZKLA 4G68A 4GBVA 4KXPA 4OVJA 4GF8A 4FATA 1NNFA 3LSLA 4F29A 4YB5A 1DPEA 4ZS9A 3G3IA 1A8EA 2DE2A 4OESA 3K1PA 1T0KA 2Q2AA 4OFOA 3RNNA 1FQFA 4JVIA 3IJXB 2XX8A 1NV6A 3TODA 1IMBA 1JETA 4N8GA 1QW0A 2Z23A 2OX3A 2VD3A 4ELOA 4R2BA 1QGXA 5ET8A 3OSQA 2F7CA 3KSXA 1G0IA 2QVUA 2Z8FA 4RPOA 3LSFB 4H46A 2V3UA 1TFAA 4X04A 4XKQA 3QYTA 3G3KA 5CBSA 3M3KA 3TTNA 1B1XA 3OD7A 3MC2A 4G8NA 3MBPA 2R8TA 4I40A 1KZ8A 3UK4A 1MY2A 5I59A 1FTJA 2Y7KA 4EF2A 5F24A 2O1LA 3PMXA 4IO3A 1JVXA 3VXBA 3F11A 5IAIA 1SBPA 3HCQA 4PFIA 3N6UA 4P1EA 3D1RA 4X1BA 1SD3A 4O3CA 5CI5A 3VVDA 2Q8MA 5A5XB 2YLNA 2HEUA 3U93A 1OLAA 3TCGA 1NH8A 2FNCA 1MXWA 1QULA 2DE3A 1MPCA 1MQIA 3W9VA 4GX6A 2B65A 2NXOA 5I2KA 4UABA 3RT8A 3KC1A 1CE2A 3VVEA 4NF5B 5H8HA 4O3BA 4N17A 5M2VA 4NAPA 3PD8A 4ISUA 4YKIA 2Q74A 1FBDA 5EQ9A 3HV1A 1B52A 3KFMA 2XWOA 2ONSA 2HZKA 5I2NB 1BK4A 2ZZVA 4KI0E 1INPA 1MQDA 2O84X 4EUOA 1MH4A 3QAXA 3MP6A 4GOTA 1M5FA 1EU8A 1EZ9A 1B3HA 3Q26A 4H1XA 1RDXA 3O6GA 3ILTB 4QFNA 2NVUB 1LBXA 4LA9A 1EYKA 4YMBA 2M8CA 3IB1A 1NV0A 4IY5A 2XXIA 2GRVA 4I62A 4LONB 1LBZA 3S2VA 4KYDA 4OEVA 4OVSA 3RTWB 1SI1A 3O2AA 1I6AA 4NF0A 1R9QA 1QUKA 2WX9A 4OVPA 4OVTA 3BIGA 1ELJA 3PUWE 2XXHA 4FBPA 3L6HA 3G3JA 5TP9B 4IB2A 1FBCA 1P99A 1FW0A 1MPBA 1YAEA 3FZVA 4GXSB 2D3IA 2DVZA 4NWDA 2V3QA 3GXAA 2PBWA 4LATA 3M3LA 4GQOA 4XEQA 1NNKA 4X9TA 2PT2A 2B3BA 2GQ1A 2IEEA 4DDDA 2Q9TA 3KOSA 5I3SA 3RT6B 2E0SA 1Y3PA 5F7VA 4AS4A 5DTBA 1II5A 1KA1A 2O68A 1SQYA 3UP9A 1AOVA 4OANA 4XXUA 4L17A 2I0BA 4ZDMA 4ZEKA 2OWSA 2AL5A 1NUXA 3IK6B 4G77A 1ZLQA 4KQPA 1Z7NE 1PB8A 4YB6A 5ET6A 4FORA 2XXUA 1LBVA 3OMBA 3WAEA 2I3VA 1QKAA 1I6BA 5DT6A 2UYEA 5EYHA 1M5EA 3MPKA 3V83A 1RYXA 3ROJA 4QRZA 5AA3A 1DCUA 5IZ3A 3H6VA 1B4ZA 1PDAA 2VHAA 3GBBA 3BFTA 3MW0A 2VD2A 4XFEA 2PFZA 1FCKA 4F3GA 3BBRA 3VE1B 5AA2B 1HSJA 4F31B 5LDZA 3MAMA 1A8FA 3S9MC 3EHTA 2R6GE 4JSDA 4GVOA 4FEBA 1NV4A 4P47A 5CBRA 4OMBA 2O6AA 4R72A 1LBBA 3DM0A 4MNPA 3B8BA 4ZEDA 3PPRA 3SESA 2QMXA 4GX4A 4HW8A 3FXBA 5AA1A 4GRKA 3PMWA 4OFJA 3HSTA 4NG7A 4U1OA 2YJPA 2RCBA 2QJEA 4KD5A 2DWHA 2I3WA 4ESWA 3MYUA 1R9LA 2THIA 2F7BA 3FASA 2I48A 4FJPA 3E3KA 3MVZA 4R6KA 3CRBA 3C33A 4QHQA 3FJMA 4OVQA 5FHMA 3JYRA 1OQGA 2HFBA 3OO7A 1FTAA 2PX1A 5BWJA 1IXCA 1A99A 1XVYA 5CMMA 4RJZA 1ZTYA 4LVQA 3QK6A 3VVFA 3UN6A 4AB5A 4GBWA 3IJOB 1MQHA 1MY4A 2CMOA 4IY6A 4ELQA 4JVCA 3EPEA 2KQZA 1UTHA 4N4UA 4RY1A 4RXLA 4GD5A 2ABHA 2DDKA 3PGFA 1OIBA 2HXWA 1D9QA 1TT1A 2XX7A 1N76A 2I4CA 5JTYB 4LP2B 4IGTA 2ZNTA 4AB6A 3LSXA 2DVCA 3FXQA 3CSBA 1I6QA 1LB9A 1FBHA 2OK2A 3KN7A 2X26A 1I69A 4F39A 5ISUA 2DWJA 3JV9A 1NKXA 1D3KA 1VFDA 4R6YA 2QS1A 1HSEA 1PB7A 4GL0A 3RPWA 1POTA 3THIA 2HZLA 4GWZA 3A29A 4PAIA 5I5PA 1JNFA 2REJA 4THIA 2KLFA 1RYOA 3PD9A 4EXLA 1BKAA 4BDQA 3O97A 1WVJA 5I58A 1B32A 1D4NA 2PCRA 1B46A 1P1WA 1IEJA 5A5LA 4Q8RA 2HXRA 1K9YA 1N3XA 1FPFA 4O94A 1MY3A 1MXYA 3TEPA 2QS2A 4OWDA 3EKIA 3A3UA 3PUYE 5CC2A 4N6PA 4M1VA 4DXCA 1EYJA 1URSA 3H6TA 4YU0A 1VR5A 4LZ8A 5HM4B 1Y3NA 2LAOA 4MCOA 3PPPA 1FTLA 3DP4A 3R26A 4LQ2A 4OA4A 1DK4A 3C31A 5B70A 3K2DA 3IO6A 1CNQA 2WBDA 3T96B 1URGA 2I6EA 3MJNA 1FQBA 3OO8A 4NF8B 2NUVA 4P8BA 2CZIA 2Y7RA 2X7QA 1DTZA 4I8CA 5K2YA 5EYFA 3KGCA 4LUBA 2HCAA 4MJOA 3LR1A 4MIJA 2OLBA 2X7PA 5I84A 2KR0A 4EXKA 3CHGA 1TFDA 4OQOA 4QFLA 2DQVA 3ZKKA 4JDFA 1MDP1 1NV5A 4FECA 2XXTA 2P1SA 4KR5A 4QSDA 3E78A 4PFTA 2H98A 4NWCA 1OMPA 1B0LA 3FIRA 5JTYA 4NEDA 4GWOA 1PC3A 3OEMA 3WAFA 3VXCA 3U65A 5KZTA 1TXFA 3VLUA 4PAKA 1NI9A 2ESNA 3T9XB 2Q2CA 1B0HA 3QXMA 2H9BA 2FIXA 3A09A 2FHYA 3HHGA 1FTOA 2R9JA 4H0WA 4F3SA 1UTHB 4NF6B 3PMVA 5CRYA 3G7WA 4G8HA 4IO2A 4PE5B 4C1UA 2DYXA 1SW1A 3FATA 4MLVA 1EZOA 2I49A 3FBPA 1P1OA 4ESXA 4PFBA 3KBZA 5DVIA 2Q89A 4BDOA 3VLWA 1FSAA 4MHFA 4PDHA 4G8MA 3SETA 3AXFA 2HAUA 5FTIA 1Q35A 1B5HA 1BP5A 1B5JA 1FQCA 4DLDA 4GX3A 4R9FA 1LFIA 5CM6A 1LGBC 1FPBA 5I57A 3V89B 2A5TB 4R75A 4MF3A 2ZNUA 2PMSA 1OVTA 4N6KA 4BDRA 5K2XA 5AA4B 1SVXB 2XXVA 5AA2A 4NGUA 2L5VA 3T0JA 1YZ0A 1FTKA 2XHDA 4NQ8A 1XI6A 3FD3A 1LCTA 3PU5A 1YXIA 4YKKA 4GWUA 2WYPA 4GWXA 4R9GA 3G3HA 4F2OA 4ZE8A 5I57B 3HPIA 3GLBA 3O29A 3HO7A 2UVJA 4X48A 1XOCA 2ZYKA 5H8FA 3Q27A 1USYE 3JZJA 2AYSA 4PFWA 2GH9A 3FXUA 4ONYA 4P56A 1AWBA 4Q0CA 1H43A 2FVZA 1Y1MA 1D9VA 5KCJB 4PQJA 4PF8A 4R6HA 1N7XA 4DCXA 4F1UA 2OBGA 3MZ1A 3S4UA 3K02A 3H7MA 4TOZA 3QUFA 2A5SA 4WKMA 4DXUA 5IGAA 2Z22A 2RC8A 2H25A 4XTCQ 1AMFA 1H76A 4PP0A 4PBQA 4PGNA 1P1QA 3SERA 3NOHA 5FHNA 1S50A 3T9UA 3T22A 1NNPA 2ONRA 4GXAA 3PTYA 3IOUA 3OSRA 3OENA 1O7TA 1GV8A 3H3GA 2XXRA 4U4XA 3FVKA 3LSWA 4PETA 1ZU0A 4AS5A 5DW8A 2HPGA 2CZHA 2V84A 1A54A 1Y1ZA 2OCUA 5L8DA 4XKNA 4ZZAA 5I59B 3N6TA 4H5FA 2RF1A 5L9OA 1B3LA 4PBHA 3TTMA 3U1OA 5KDTB 5H8SA 4Z7EA 3L6GA 3TKDA 1H3DA 4N07A 3U94A 5I7IA 3MVWA 1BIYA 2OWTA 4EQ9A 2ZNSA 3MZBA 1LAHE 1SDXA 1MH3A 1UQWA 2DSFA 3IR1A 3ZS6A 1B2HA 3QIMA 2HAVA 4U21A 1JEUA 2ANJA 4N15A 5ESYA 3IORA 1LFHA 4LN5A 1NNTA 4KYSA 1IUDA 4IR8A 2H99A 5L9MA 1HSLA 1RKMA 3MQ9A 1POY1 4N81A 2OZZA 4IO7A 4N91A 4OXVA 1KA0A 1NUZA 1ZKBA 1IMFA 4FAJA 4X1DA 4IO4A 4KCCA 4H45A 3K6XA 4OENA 1JP4A 4H8IA 3C36A 3DP8A 5HBCA 5DEXA 4G68C 1LBCA 3ODBA 3H4ZA 4I1DA 2YPNA 1XVXA 2ZMBA 4EF1A 2QSXA 4XF5A 1ZMGA 1LAXA 3GZGA 5TPAB 1IIWA 2DWAA 4H65A 1FBFA 3V8XB 5BUUA 4C0RA 5DYHA 4P11A 2PT1A 3TTLA 2F35A 3H6WA 5H8HB 3CI8A 3U92A 3CG1A 5ICTA 3D4GA 3G3GA 1M5BA 1O63A 2ONKE 4JWYA 5I58B 3CFXA 4Q5TA 3RPLA 3IX1A 1XC1A 1FPGA 4JSOA 3KZGA 1USYH 3KN8A 3GBAA 2WBBA 1PBQA 1B40A 2CZKA 3PUVE 1WODA 2QMWA 2DE4A 2ZZWA 5H8NA 5FHOA 2OWZA 3OOAA 3W15C 2Y7PA 1LSTA 3FJGA 4JXIA 1DMBA 3MZ9A 1LBWA 1UTBB 3T93B 3SEUA 3PUXE 3DELB 1LAGE 3IFAA 3OO9A 1ATGA 2F6GA 4MEVA 3PPOA 4JWOA 4DCYA 3K00A 4O3AA 4U23A 4K3FA 3M8UA 4HTGA 2F5XA 3N5LA 3RPLB 4OVRA 1N7WA 3PV0E 5IZZA 1A7LA 3W9WA 1LCFA 3KOTA 3CR9A 4MNIA 3K01A 3KJ7A 1AIVA 2FIEA 1ZIUA 3B6TA 3OEKA 1EZPA 4RK2A 1MXXA 3OO6A 4E0XA 1M5CA 2FBPA 3KN3A 2FA7A 4IO5A 2QVVA 4NF4A 3VV5A 1B05A 5H8FB 4PC9A 2Q8JA 1A40A 1VFEA 1CB6A 4P0IA 3T9VA 1B7HA 1FPLA 3ILUB 1GR2A 5ICQA 4KPTA 4I3EA 3OXNA 2ALUA 4IGRA 1URDA 2XXXA 2VP1A 2BJJX 3IOWA 3O6IA 4NE4A 3QSLA 3IOTA 3TFLA 2H5YA 2I0CA 5J1DA 1P1NA 4MFIA 4E0WA 5EYGA 1FJ9A 3PPQA 3TUSA 5L9SA 3K6WA 1N0TA 3CFZA 1M5DA 5JEIA 4POWA 4NF5A 2ZXTA 2XWVA 1NFTA 3LUZA 3K0VA 3PUZE 4H6DA 4LZ5A 2Y5KA 4DZ1A 2RC7A 1K9ZA 3N94A 4NF6A 3FUZA 3TZAA 3HHFA 3GYYA 3RYDA 2QL3A 4N13A 2PFYA 1LB8A 2QPQA 2GHBA 3B6WA 2I4BA 2XWKA 2CEYA 4HE0A 3BIHA 1R1NA 1NMUA 2GHAA 1MG1A 3MSTA 4PCDA 3TYHA 5AE4A 2JJKA 2PVUA 1MM7A 1DTGA 1OLCA 2XXKA 3SDFA 1NV2A 1SW2A 3TELA 5LOMA 4BDNA 4WEDA 3K1MA 3S9LC 3EQ1A 1XS5A 4I3YA 4PF6A 1UIUA 1Z7ME 2QS3A 1SI0A 4GWYA 1KWHA 2B3FA 4YB7A 1LFGA 5KCJA 4LZ7A 2O69A 4GWWA 4OETA 5B7DA 4NX1A 4MAGA 2DWIA 3IB0A 1BTJA 1RDZA 5EQ8A 3KEIA 3Q29A 1Y9UA 3FV1A 3O66A 3RTFB 2XD2A 3MP8A 4NF8A 1D9YA 2W7YA 3QUJA 1US5A 4TQUQ 4Z0IA 1MDQA 4HE2A 1FPEA 4WEPA 2ZYOA 3MUQA
chains in the Genus database with same CATH topology
2XD3A 1J1NA 2H25A 2XXWA 3MAMA 3S9NC 4XTCQ 3FXRA 1AMFA 1A8FA 3C9HA 3S9MC 3N26A 1H76A 3EHTA 3ZSFA 4PP0A 2R6GE 4JSDA 4YZZA 1OQHA 1P1QA 4FEBA 4GVOA 4R73A 3SERA 1GTKA 4DXBA 2A5TA 5CBRA 2Y7WA 4OMBA 5A5XA 1B3GA 4R2FA 1S50A 5FHNA 2O6AA 4R72A 3T9UA 3TQLA 1LBBA 2P2AA 3DM0A 3K4UA 3R6UA 5EHSA 4ZEDA 3V5AA 3PPRA 5ITPA 3MVXA 2E1SA 3SESA 3T22A 2QMXA 1B51A 1NNPA 2ONRA 2R71A 1H44A 3FV2A 4GXAA 5AA1A 3RQTA 4F3PA 4HW8A 4KCDA 4GRKA 3PMWA 3IOVA 4OFJA 1JQFA 4XIGQ 4GIZA 1A55A 3IOUA 3OSRA 3HSTA 3HN0A 3OENA 1O7TA 1GV8A 3H3GA 2XXRA 4U4XA 2AL4A 1EH3A 1FQDA 1YPNA 3FVKA 4U1OA 3T9HB 2YJPA 3LSWA 1XT8A 3E13X 4PETA 1ZU0A 3RY3A 2RCBA 2QJEA 3K1NA 1B9JA 2DWHA 2I3WA 2XX9A 4KD5A 1B1HA 4ESWA 3B7DA 1R9LA 2V84A 1A54A 3MWBA 1Y1ZA 2OCUA 2THIA 1QUIA 2F7BA 3TQWA 3FASA 4U1ZA 2I48A 4FJPA 4GL8A 3E3KA 1Y4TA 5L8DA 4XKNA 3KBRA 4ZZAA 3MVZA 4I9DA 3CRBA 4R6KA 5I59B 3C33A 1AL3A 4QHQA 3N6TA 2P0SA 4H5FA 1B5IA 2RF1A 3FJMA 5FHMA 3JYRA 3LC8A 4F1YA 1OQGA 2HFBA 5L9OA 1B3LA 2ZYMA 3OO7A 3TTMA 3U1OA 4QSCA 4C1TA 4IO6A 1OVBA 2PX1A 3EN3A 5BWJA 5DVJA 2RKMA 1IXCA 1A99A 1DPPA 1XVYA 2O51A 2GFEA 3BFUA 2D5WA 4M4GA 5H8SA 3TCFA 3L6GA 4Z7EA 3MVYA 5KDTB 5CMMA 4RJZA 1ZTYA 4LVQA 1FQAA 1S9TA 3H6UA 1P1UA 3TMGA 3QK6A 3VVFA 3TKDA 1H3DA 3UN6A 4AB5A 4N07A 5DVFA 3IJOB 1MQHA 1MXZA 2F6PA 3O6HA 3U94A 3MVWA 1BIYA 1MY4A 1BLFA 2CMOA 2OWTA 4IY6A 4KYEA 5TP9A 2ZNSA 2F97A 3MZBA 4ELQA 4ELPA 1LAHE 3U72A 3TTRA 1MRPA 3SEWA 4RA1A 1SW5A 1SDXA 1B7ZA 1MH3A 1UQWA 2V25A 1Y20A 2DSFA 3EF7A 3IR1A 3K6UA 3E4RA 4AQ4A 3ZS6A 4ELRA 4EQ7A 2RINA 3EPEA 1B2HA 3QIMA 4FEDA 2HAVA 4U21A 4EQBA 3CG3A 1UTHA 3TAJA 1UTBA 1JEUA 2ANJA 4FE8A 2REGA 4RY1A 4RPNA 2DS9A 3IORA 4RXLA 5AA2D 1JW1A 4GD5A 1LFHA 2ABHA 3PGFA 1IXIA 1NNTA 1OIBA 3A3CA 3H06B 1LLSA 2HXWA 1FTMA 2ZYNA 4JWXA 1ZJLA 4KYSA 1IUDA 4OHNA 4ZEIA 1UIVA 4DXUA 1TT1A 2XX7A 5H8NB 2Q88A 2H99A 4F1VA 1SW4A 2V3TA 3S9EA 5L9MA 1HSLA 1RKMA 3MQ9A 1POY1 1N76A 3TTKA 2I4CA 3FVOA 3K6VA 5CMKA 4QF9A 5JTYB 4LP2B 4G68B 4OFLA 2OZZA 2HQ0A 4IGTA 4IO7A 4OXVA 5H8QA 1ZKBA 4OEUA 4FAJA 4P0GA 2ZNTA 4X1DA 3LSXA 4AB6A 3MPLA 4U22A 4IO4A 5EHMA 2DVCA 2VGQA 1B4HA 4KCCA 4QFKA 3SEVA 3FXQA 1H45A 3CSBA 4DIGA 2D21A 1I6QA 1N04A 3K6XA 3MUQA 4OENA 1QJMA 4X9TA 4H8IA 1LAFE 2G29A 4ZEFA 1LB9A 3B6QA 2OK2A 3C36A 2X26A 3DLNA 3KN7A 3DP8A 5JK4A 5HBCA 1L5TA 5DEXA 1I69A 2AIXA 4G68C 4QFPA 1Y4CA 3USDA 4BDLA 4LQ5A 4NMYA 5H8QB 4F39A 1MQJA 4G68A 2IA4A 1LBCA 3ZKLA 3ODBA 4RYAA 2DWJA 5ISUA 3JV9A 4OVJA 1PB9A 4GF8A 3H4ZA 4FATA 1NNFA 3LSLA 4QFOA 1NKXA 1YCJA 4I1DA 1D3KA 4GFRA 4F29A 4YB5A 1DPEA 1XVXA 1VFDA 2YPNA 4R6YA 4ZS9A 2ZMBA 3G3IA 4EF1A 1A8EA 2DE2A 1ZMGA 2QSXA 4OESA 3RN8A 3K1PA 4YKJA 2QS1A 1HSEA 1LAXA 1PB7A 3EHUA 1IIWA 3GZGA 1QKBA 5TPAB 3TDJA 2Q2AA 4GL0A 3RPWA 4OFOA 3RGYA 1FQFA 1YTVA 2DWAA 4XKPA 4H65A 3RNNA 3Q28A 2QS4A 1POTA 4H67A 3IJXB 5ELVA 3V8XB 1SYHA 2XX8A 5BUUA 3TODA 4WKMA 5TU0A 3THIA 2HZLA 5DYHA 1JETA 1FQEA 4C0RA 1QW0A 4P11A 2Z23A 1JNFA 2PT1A 2REJA 2DXRA 2VD3A 3G3FA 4THIA 3TTLA 4ELOA 2F35A 2KLFA 1GGGA 2F8DA 3H6WA 1PBPA 4R2BA 5H8HB 4BLAA 3CI8A 3OSQA 1RYOA 2F7CA 3LUYA 3PD9A 3CG1A 3U92A 1BKAA 4EXLA 5ICTA 3KSXA 4BDQA 3D4GA 2Z8FA 3G3GA 3O97A 4RPOA 1M5BA 1O63A 1WVJA 3LSFB 5DEXB 2V3UA 1B32A 4KHZE 5I58A 2ONKE 1B3FA 4JWYA 1D4NA 4EQ9A 5I58B 3CFXA 4H8JA 4Q5TA 1TFAA 3EHSA 1B46A 1P1WA 1PEBA 1IEJA 3IX1A 4DE8A 1XC1A 4JSOA 4YMAA 4Q8RA 1US4A 1USYH 3KZGA 3G3KA 3QYTA 3KN8A 4XKQA 3UA8A 3GBAA 5CBSA 1N3XA 3M3KA 3TTNA 1B1XA 3OD7A 3MC2A 4G8NA 3MBPA 1PBQA 1MY3A 2F78A 3UK4A 1MY2A 5I56A 1B40A 1MXYA 5I59A 3TEPA 3PUVE 1WODA 2QS2A 2QMWA 5AA4A 1FTJA 2Y7KA 4OWDA 3A3UA 2DE4A 5H8NA 1ANFA 5TPAA 4H5GA 3PUYE 4EF2A 3TCHA 5FHOA 4OYVA 2O1LA 3PMXA 4IO3A 3W15C 2RCAA 3OOAA 1JVXA 3VXBA 1AOVA 5CC2A 3F11A 2Y7PA 1LSTA 1MPDA 1SBPA 1MS7A 3CIJA 1JW4A 2Z8EA 3FJGA 3HCQA 4JXIA 4N6PA 1DMBA 1DOTA 3MZ9A 4M1VA 1UTBB 1B7UA 3IB2A 3N6UA 4DXCA 3T93B 1URSA 3H6TA 4YU0A 1VR5A 3SEUA 3PUXE 3DELB 4HCYA 4LZ8A 4FIMA 4X1BA 1Y3NA 2LAOA 5HM4B 5I56B 1SD3A 1LAGE 4O3CA 2XXQA 3PPPA 5CI5A 1XHYA 1ATGA 2F6GA 3OO9A 3DP6A 1FTLA 2OJTA 3DP4A 3R26A 4LQ2A 3SEYA 3VVDA 3PPOA 4JWOA 4U4SA 4F19A 5A5XB 2YLNA 4DCYA 3K00A 4O3AA 3C31A 2HEUA 4U23A 1OLAA 4WEPA 3U93A 4K3FA 1NH8A 2FNCA 1MXWA 2UVGA 1QULA 2DE3A 3K2DA 3TCGA 3KG2A 3C35A 1MPCA 3IO6A 3M8UA 4HTGA 1MQIA 3W9VA 2B65A 2F5XA 3N5LA 2NXOA 5I2KA 1S7YA 3RT8A 1CE2A 3VVEA 4QSEA 1N7WA 1SYIA 3O9PA 4NF5B 5H8HA 3PV0E 3T96B 2DOJA 4O3BA 1A7LA 3W9WA 2UYFA 1URGA 2I6EA 3MJNA 1FQBA 1LCFA 3OO8A 4NF8B 2NUVA 3KOTA 3CR9A 4OERA 1MM6A 2Y7RA 2X7QA 5M2VA 3PD8A 3K01A 3KJ7A 4NF4B 1DTZA 1AIVA 5I2NA 4I8CA 3LBSA 4ISUA 4YKIA 5F1QA 1ZIUA 1QVSA 3B6TA 2UVHA 3KGCA 3OEKA 3Q25A 4LUBA 5EYFA 1EZPA 1MXVA 4RK2A 2HCAA 1MXXA 3OO6A 3IO4A 3HV1A 4E0XA 4R74A 1B52A 2XXYA 1M5CA 3KFMA 3KN3A 3LR1A 2ONSA 2FA7A 2OLBA 2X7PA 2HZKA 1F9BA 4IO5A 1VSOA 4F3BA 5I2NB 5I84A 4NF4A 3VV5A 4KI0E 1B05A 1MXUA 4POXA 1MQDA 2O84X 2QRYA 4ZEBA 2F34A 3CVGA 5H8FB 3FVGA 1GVCA 4EUOA 1MH4A 2Q8JA 3QAXA 3ECRA 4EXKA 2F7AA 3MP6A 1TFDA 4OQOA 4GOTA 1M5FA 2DQVA 1EU8A 1EZ9A 4QFLA 3CFLA 1B3HA 4JDFA 3ZKKA 1MDP1 4FECA 1B3EA 3Q26A 5FTHA 2NWJA 1A40A 5HPQA 1MY1A 2XXTA 3IAZA 4G2ZA 2P1SA 4H1XA 3ONMA 4KR5A 4QSDA 5CMCA 3O6GA 3ILTB 4QFNA 1VFEA 4PFTA 2H98A 4NWCA 1CB6A 1TWYA 1VE4A 4P0IA 3T9VA 1B7HA 2NVUB 2PYYA 1OMPA 4LA9A 3ILUB 3KSJA 1B0LA 1GR2A 3FIRA 5JTYA 3H03A 3IL1B 3T66A 4YMBA 2M8CA 4KPTA 5ICQA 4NEDA 4GWOA 1PC3A 2Y84A 3OEMA 2O7UA 3IB1A 3WAFA 3VXCA 3OXNA 2XXIA 4IY5A 3UORA 2ALUA 4IGRA 3E9XA 1TXFA 3RLFE 5KZTA 3VLUA 2GRVA 4I62A 4ZE9A 1URDA 2XXXA 4LONB 2ESNA 3T9XB 2VP1A 2Q2CA 3S2VA 1B0HA 3QXMA 1WDNA 4KYDA 4OEVA 2BJJX 3RTWB 1SI1A 2H9BA 3IOWA 3O6IA 4NE4A 3O2AA 3QSLA 1O64A 1I6AA 3A09A 3IOTA 3TFLA 2H5YA 3HHGA 4KFQA 1R9QA 4MBPA 1FTOA 2R9JA 4H0WA 4F3SA 1QUKA 1UTHB 2I0CA 5J1DA 4NF6B 3PMVA 1P1NA 3OELA 1ELJA 3PUWE 2XXHA 4MFIA 5CRYA 1T0KA 3FVNA 4E0WA 2WKYA 4GLIA 3L6HA 4RNSA 3PPQA 2G93A 2VOZA 3G3JA 5TP9B 3UGWA 3G7WA 4G8HA 4IB2A 4IO2A 4OZ9A 4PE5B 3K6WA 1P99A 4C1UA 5L9SA 2DYXA 1N0TA 1FW0A 1MPBA 1SW1A 1YAEA 2I49A 3FATA 3FZVA 4MLVA 1EZOA 3CFZA 1P1OA 3VDFA 4F18A 1M5DA 4ESXA 4GXSB 3U8QA 5JEIA 5DVIA 2D3IA 4POWA 1N3WA 4ECFA 4NF5A 2Q89A 1MQGA 4UA8A 2DVZA 2ZXTA 4BDOA 4NWDA 3O28A 1NFTA 3VLWA 3K0VA 3PUZE 4UACA 3C32A 4H6DA 1ZBMA 2V3QA 3GXAA 3VLVA 4LZ5A 2DXYA 2H4IA 5CMBA 3I5OA 2O7IA 2PBWA 4DZ1A 2RC7A 1JW5A 4G8MA 1QUJA 3N94A 4LATA 4G4PA 3SETA 4NF6A 3AXFA 2HAUA 3FUZA 3TZAA 5FTIA 5IKBA 1Q35A 3M3LA 3HHFA 4GQOA 3SEXA 1B5HA 1NNKA 4ND9A 1BP5A 1B5JA 2PT2A 2QL3A 2Z8DA 1FQCA 2B3BA 2IEEA 3C4MA 4N13A 4RK9A 4DDDA 4YAHX 4DLDA 1LB8A 2Q9TA 3FJ7A 2QPQA 3UP9A 2GHBA 3KOSA 4R9FA 2RC9A 4NTLA 1JVYA 3RT6B 1LFIA 2I4BA 3B6WA 2E0SA 1Y3PA 5CM6A 1LGBC 3FGSA 5F7VA 3R7XA 5DTBA 1II5A 3RUMA 5I57A 2O68A 1IXHA 4BDMA 1SQYA 3V89B 2A5TB 4R75A 4MF3A 1R1NA 1NMUA 2GHAA 1MG1A 2I58A 2PMSA 2ZNUA 4TLMB 4XXUA 1OVTA 2I0BA 3BKIB 4L17A 3TYHA 3KJTA 4PFUA 1IQ7A 1DSNA 3M3FA 5K2YA 4BDRA 5AE4A 3MP1A 4ZDMA 4ZEKA 5K2XA 5AA4B 2OWSA 3C34A 5B70A 2AL5A 3I3VA 1SVXB 2PVUA 1MM7A 1DTGA 2XXVA 3IK6B 4HS7A 5AA2A 3D4CA 1Q1KA 1AH5A 1OLCA 2UXAA 3SDFA 1SW2A 4G77A 4WXJA 3TELA 1N84A 2DP8A 2O1MA 1ZLQA 1FTKA 1R6ZA 2XHDA 4KQPA 5LOMA 4BDNA 4WEDA 3K1MA 3S9LC 3PPNA 1Z7NE 1PB8A 3EQ1A 1XS5A 4YB6A 2XXPA 3TPAA 1UIUA 1Z7ME 3FD3A 1LCTA 3PU5A 4YKKA 2QS3A 3SKPA 4FORA 4ZECA 2XXUA 4JB7A 4R9GA 1SI0A 3G3HA 1KWHA 4ZE8A 4F2OA 2B3FA 3OMBA 1IZ1A 4YB7A 5I57B 3HPIA 3GLBA 4ZZEA 3O29A 3HO7A 2I3VA 2UVJA 4X48A 3WAEA 1LFGA 5KCJA 1QKAA 4JBZA 1I6BA 1XOCA 5DT6A 2UYEA 2ZYKA 2V93A 5H8FA 3Q27A 2CZLA 4LZ7A 1M5EA 3I6VA 3MPKA 3V83A 2O69A 1USYE 4EDPA 3JZJA 1JEVA 4OETA 1RYXA 2AYSA 4MLQA 1Y3QA 4QRZA 4TLLB 1IXGA 4HCWA 2GH9A 3FXUA 4PFWA 4F2QA 2Y7IA 5AA3A 5B7DA 4ONYA 4OTEA 2UVIA 4U2RA 4Q0CA 4F22A 1H43A 4XKRA 4PFYA 2DWIA 3IB0A 4YICA 1NL5A 3UIFA 5IAIA 1Y1MA 2NOOA 3H6VA 1B58A 1B4ZA 1BTJA 1PDAA 3TUSA 2VHAA 1D9VA 5KCJB 4PQJA 5ITOA 3GBBA 3KEIA 3Q29A 4R6HA 3BFTA 1Y9UA 3MW0A 1IITA 1N7XA 2VD2A 3FV1A 3O66A 5KDTA 1MY0A 3RTFB 3VFJA 2XD2A 4YKPA 4DCXA 3CSGA 1NH7A 1FCKA 3MP8A 4F1UA 4NF8A 4F3GA 4Q30B 2F36A 1D9YA 2OBGA 3MZ1A 3BBRA 2W7YA 3S4UA 3QUJA 1B6HA 3K02A 3P7IA 1US5A 3H7MA 4TOZA 4MH5A 4TQUQ 3VE1B 2FYIA 3QUFA 1MDQA 4Z0IA 5AA2B 2A5SA 1HSJA 2ZYOA 2Z22A 4F31B 2RC8A 5I2KB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XD3 A;  1J1N A;  2H25 A;  2XXW A;  3MAM A;  3S9N C;  4XTC Q;  3FXR A;  1AMF A;  1A8F A;  3C9H A;  3S9M C;  3N26 A;  1H76 A;  3EHT A;  3ZSF A;  4PP0 A;  2R6G E;  4JSD A;  4YZZ A;  1OQH A;  1P1Q A;  4FEB A;  4GVO A;  4R73 A;  3SER A;  1GTK A;  4DXB A;  2A5T A;  5CBR A;  2Y7W A;  4OMB A;  5A5X A;  1B3G A;  4R2F A;  1S50 A;  5FHN A;  2O6A A;  4R72 A;  3T9U A;  3TQL A;  1LBB A;  2P2A A;  3DM0 A;  3K4U A;  3R6U A;  5EHS A;  4ZED A;  3V5A A;  3PPR A;  5ITP A;  3MVX A;  2E1S A;  3SES A;  3T22 A;  2QMX A;  1B51 A;  1NNP A;  2ONR A;  2R71 A;  1H44 A;  3FV2 A;  4GXA A;  5AA1 A;  3RQT A;  4F3P A;  4HW8 A;  4KCD A;  4GRK A;  3PMW A;  3IOV A;  4OFJ A;  1JQF A;  4XIG Q;  4GIZ A;  1A55 A;  3IOU A;  3OSR A;  3HST A;  3HN0 A;  3OEN A;  1O7T A;  1GV8 A;  3H3G A;  2XXR A;  4U4X A;  2AL4 A;  1EH3 A;  1FQD A;  1YPN A;  3FVK A;  4U1O A;  3T9H B;  2YJP A;  3LSW A;  1XT8 A;  3E13 X;  4PET A;  1ZU0 A;  3RY3 A;  2RCB A;  2QJE A;  3K1N A;  1B9J A;  2DWH A;  2I3W A;  2XX9 A;  4KD5 A;  1B1H A;  4ESW A;  3B7D A;  1R9L A;  2V84 A;  1A54 A;  3MWB A;  1Y1Z A;  2OCU A;  2THI A;  1QUI A;  2F7B A;  3TQW A;  3FAS A;  4U1Z A;  2I48 A;  4FJP A;  4GL8 A;  3E3K A;  1Y4T A;  5L8D A;  4XKN A;  3KBR A;  4ZZA A;  3MVZ A;  4I9D A;  3CRB A;  4R6K A;  5I59 B;  3C33 A;  1AL3 A;  4QHQ A;  3N6T A;  2P0S A;  4H5F A;  1B5I A;  2RF1 A;  3FJM A;  5FHM A;  3JYR A;  3LC8 A;  4F1Y A;  1OQG A;  2HFB A;  5L9O A;  1B3L A;  2ZYM A;  3OO7 A;  3TTM A;  3U1O A;  4QSC A;  4C1T A;  4IO6 A;  1OVB A;  2PX1 A;  3EN3 A;  5BWJ A;  5DVJ A;  2RKM A;  1IXC A;  1A99 A;  1DPP A;  1XVY A;  2O51 A;  2GFE A;  3BFU A;  2D5W A;  4M4G A;  5H8S A;  3TCF A;  3L6G A;  4Z7E A;  3MVY A;  5KDT B;  5CMM A;  4RJZ A;  1ZTY A;  4LVQ A;  1FQA A;  1S9T A;  3H6U A;  1P1U A;  3TMG A;  3QK6 A;  3VVF A;  3TKD A;  1H3D A;  3UN6 A;  4AB5 A;  4N07 A;  5DVF A;  3IJO B;  1MQH A;  1MXZ A;  2F6P A;  3O6H A;  3U94 A;  3MVW A;  1BIY A;  1MY4 A;  1BLF A;  2CMO A;  2OWT A;  4IY6 A;  4KYE A;  5TP9 A;  2ZNS A;  2F97 A;  3MZB A;  4ELQ A;  4ELP A;  1LAH E;  3U72 A;  3TTR A;  1MRP A;  3SEW A;  4RA1 A;  1SW5 A;  1SDX A;  1B7Z A;  1MH3 A;  1UQW A;  2V25 A;  1Y20 A;  2DSF A;  3EF7 A;  3IR1 A;  3K6U A;  3E4R A;  4AQ4 A;  3ZS6 A;  4ELR A;  4EQ7 A;  2RIN A;  3EPE A;  1B2H A;  3QIM A;  4FED A;  2HAV A;  4U21 A;  4EQB A;  3CG3 A;  1UTH A;  3TAJ A;  1UTB A;  1JEU A;  2ANJ A;  4FE8 A;  2REG A;  4RY1 A;  4RPN A;  2DS9 A;  3IOR A;  4RXL A;  5AA2 D;  1JW1 A;  4GD5 A;  1LFH A;  2ABH A;  3PGF A;  1IXI A;  1NNT A;  1OIB A;  3A3C A;  3H06 B;  1LLS A;  2HXW A;  1FTM A;  2ZYN A;  4JWX A;  1ZJL A;  4KYS A;  1IUD A;  4OHN A;  4ZEI A;  1UIV A;  4DXU A;  1TT1 A;  2XX7 A;  5H8N B;  2Q88 A;  2H99 A;  4F1V A;  1SW4 A;  2V3T A;  3S9E A;  5L9M A;  1HSL A;  1RKM A;  3MQ9 A;  1POY 1;  1N76 A;  3TTK A;  2I4C A;  3FVO A;  3K6V A;  5CMK A;  4QF9 A;  5JTY B;  4LP2 B;  4G68 B;  4OFL A;  2OZZ A;  2HQ0 A;  4IGT A;  4IO7 A;  4OXV A;  5H8Q A;  1ZKB A;  4OEU A;  4FAJ A;  4P0G A;  2ZNT A;  4X1D A;  3LSX A;  4AB6 A;  3MPL A;  4U22 A;  4IO4 A;  5EHM A;  2DVC A;  2VGQ A;  1B4H A;  4KCC A;  4QFK A;  3SEV A;  3FXQ A;  1H45 A;  3CSB A;  4DIG A;  2D21 A;  1I6Q A;  1N04 A;  3K6X A;  3MUQ A;  4OEN A;  1QJM A;  4X9T A;  4H8I A;  1LAF E;  2G29 A;  4ZEF A;  1LB9 A;  3B6Q A;  2OK2 A;  3C36 A;  2X26 A;  3DLN A;  3KN7 A;  3DP8 A;  5JK4 A;  5HBC A;  1L5T A;  5DEX A;  1I69 A;  2AIX A;  4G68 C;  4QFP A;  1Y4C A;  3USD A;  4BDL A;  4LQ5 A;  4NMY A;  5H8Q B;  4F39 A;  1MQJ A;  4G68 A;  2IA4 A;  1LBC A;  3ZKL A;  3ODB A;  4RYA A;  2DWJ A;  5ISU A;  3JV9 A;  4OVJ A;  1PB9 A;  4GF8 A;  3H4Z A;  4FAT A;  1NNF A;  3LSL A;  4QFO A;  1NKX A;  1YCJ A;  4I1D A;  1D3K A;  4GFR A;  4F29 A;  4YB5 A;  1DPE A;  1XVX A;  1VFD A;  2YPN A;  4R6Y A;  4ZS9 A;  2ZMB A;  3G3I A;  4EF1 A;  1A8E A;  2DE2 A;  1ZMG A;  2QSX A;  4OES A;  3RN8 A;  3K1P A;  4YKJ A;  2QS1 A;  1HSE A;  1LAX A;  1PB7 A;  3EHU A;  1IIW A;  3GZG A;  1QKB A;  5TPA B;  3TDJ A;  2Q2A A;  4GL0 A;  3RPW A;  4OFO A;  3RGY A;  1FQF A;  1YTV A;  2DWA A;  4XKP A;  4H65 A;  3RNN A;  3Q28 A;  2QS4 A;  1POT A;  4H67 A;  3IJX B;  5ELV A;  3V8X B;  1SYH A;  2XX8 A;  5BUU A;  3TOD A;  4WKM A;  5TU0 A;  3THI A;  2HZL A;  5DYH A;  1JET A;  1FQE A;  4C0R A;  1QW0 A;  4P11 A;  2Z23 A;  1JNF A;  2PT1 A;  2REJ A;  2DXR A;  2VD3 A;  3G3F A;  4THI A;  3TTL A;  4ELO A;  2F35 A;  2KLF A;  1GGG A;  2F8D A;  3H6W A;  1PBP A;  4R2B A;  5H8H B;  4BLA A;  3CI8 A;  3OSQ A;  1RYO A;  2F7C A;  3LUY A;  3PD9 A;  3CG1 A;  3U92 A;  1BKA A;  4EXL A;  5ICT A;  3KSX A;  4BDQ A;  3D4G A;  2Z8F A;  3G3G A;  3O97 A;  4RPO A;  1M5B A;  1O63 A;  1WVJ A;  3LSF B;  5DEX B;  2V3U A;  1B32 A;  4KHZ E;  5I58 A;  2ONK E;  1B3F A;  4JWY A;  1D4N A;  4EQ9 A;  5I58 B;  3CFX A;  4H8J A;  4Q5T A;  1TFA A;  3EHS A;  1B46 A;  1P1W A;  1PEB A;  1IEJ A;  3IX1 A;  4DE8 A;  1XC1 A;  4JSO A;  4YMA A;  4Q8R A;  1US4 A;  1USY H;  3KZG A;  3G3K A;  3QYT A;  3KN8 A;  4XKQ A;  3UA8 A;  3GBA A;  5CBS A;  1N3X A;  3M3K A;  3TTN A;  1B1X A;  3OD7 A;  3MC2 A;  4G8N A;  3MBP A;  1PBQ A;  1MY3 A;  2F78 A;  3UK4 A;  1MY2 A;  5I56 A;  1B40 A;  1MXY A;  5I59 A;  3TEP A;  3PUV E;  1WOD A;  2QS2 A;  2QMW A;  5AA4 A;  1FTJ A;  2Y7K A;  4OWD A;  3A3U A;  2DE4 A;  5H8N A;  1ANF A;  5TPA A;  4H5G A;  3PUY E;  4EF2 A;  3TCH A;  5FHO A;  4OYV A;  2O1L A;  3PMX A;  4IO3 A;  3W15 C;  2RCA A;  3OOA A;  1JVX A;  3VXB A;  1AOV A;  5CC2 A;  3F11 A;  2Y7P A;  1LST A;  1MPD A;  1SBP A;  1MS7 A;  3CIJ A;  1JW4 A;  2Z8E A;  3FJG A;  3HCQ A;  4JXI A;  4N6P A;  1DMB A;  1DOT A;  3MZ9 A;  4M1V A;  1UTB B;  1B7U A;  3IB2 A;  3N6U A;  4DXC A;  3T93 B;  1URS A;  3H6T A;  4YU0 A;  1VR5 A;  3SEU A;  3PUX E;  3DEL B;  4HCY A;  4LZ8 A;  4FIM A;  4X1B A;  1Y3N A;  2LAO A;  5HM4 B;  5I56 B;  1SD3 A;  1LAG E;  4O3C A;  2XXQ A;  3PPP A;  5CI5 A;  1XHY A;  1ATG A;  2F6G A;  3OO9 A;  3DP6 A;  1FTL A;  2OJT A;  3DP4 A;  3R26 A;  4LQ2 A;  3SEY A;  3VVD A;  3PPO A;  4JWO A;  4U4S A;  4F19 A;  5A5X B;  2YLN A;  4DCY A;  3K00 A;  4O3A A;  3C31 A;  2HEU A;  4U23 A;  1OLA A;  4WEP A;  3U93 A;  4K3F A;  1NH8 A;  2FNC A;  1MXW A;  2UVG A;  1QUL A;  2DE3 A;  3K2D A;  3TCG A;  3KG2 A;  3C35 A;  1MPC A;  3IO6 A;  3M8U A;  4HTG A;  1MQI A;  3W9V A;  2B65 A;  2F5X A;  3N5L A;  2NXO A;  5I2K A;  1S7Y A;  3RT8 A;  1CE2 A;  3VVE A;  4QSE A;  1N7W A;  1SYI A;  3O9P A;  4NF5 B;  5H8H A;  3PV0 E;  3T96 B;  2DOJ A;  4O3B A;  1A7L A;  3W9W A;  2UYF A;  1URG A;  2I6E A;  3MJN A;  1FQB A;  1LCF A;  3OO8 A;  4NF8 B;  2NUV A;  3KOT A;  3CR9 A;  4OER A;  1MM6 A;  2Y7R A;  2X7Q A;  5M2V A;  3PD8 A;  3K01 A;  3KJ7 A;  4NF4 B;  1DTZ A;  1AIV A;  5I2N A;  4I8C A;  3LBS A;  4ISU A;  4YKI A;  5F1Q A;  1ZIU A;  1QVS A;  3B6T A;  2UVH A;  3KGC A;  3OEK A;  3Q25 A;  4LUB A;  5EYF A;  1EZP A;  1MXV A;  4RK2 A;  2HCA A;  1MXX A;  3OO6 A;  3IO4 A;  3HV1 A;  4E0X A;  4R74 A;  1B52 A;  2XXY A;  1M5C A;  3KFM A;  3KN3 A;  3LR1 A;  2ONS A;  2FA7 A;  2OLB A;  2X7P A;  2HZK A;  1F9B A;  4IO5 A;  1VSO A;  4F3B A;  5I2N B;  5I84 A;  4NF4 A;  3VV5 A;  4KI0 E;  1B05 A;  1MXU A;  4POX A;  1MQD A;  2O84 X;  2QRY A;  4ZEB A;  2F34 A;  3CVG A;  5H8F B;  3FVG A;  1GVC A;  4EUO A;  1MH4 A;  2Q8J A;  3QAX A;  3ECR A;  4EXK A;  2F7A A;  3MP6 A;  1TFD A;  4OQO A;  4GOT A;  1M5F A;  2DQV A;  1EU8 A;  1EZ9 A;  4QFL A;  3CFL A;  1B3H A;  4JDF A;  3ZKK A;  1MDP 1;  4FEC A;  1B3E A;  3Q26 A;  5FTH A;  2NWJ A;  1A40 A;  5HPQ A;  1MY1 A;  2XXT A;  3IAZ A;  4G2Z A;  2P1S A;  4H1X A;  3ONM A;  4KR5 A;  4QSD A;  5CMC A;  3O6G A;  3ILT B;  4QFN A;  1VFE A;  4PFT A;  2H98 A;  4NWC A;  1CB6 A;  1TWY A;  1VE4 A;  4P0I A;  3T9V A;  1B7H A;  2NVU B;  2PYY A;  1OMP A;  4LA9 A;  3ILU B;  3KSJ A;  1B0L A;  1GR2 A;  3FIR A;  5JTY A;  3H03 A;  3IL1 B;  3T66 A;  4YMB A;  2M8C A;  4KPT A;  5ICQ A;  4NED A;  4GWO A;  1PC3 A;  2Y84 A;  3OEM A;  2O7U A;  3IB1 A;  3WAF A;  3VXC A;  3OXN A;  2XXI A;  4IY5 A;  3UOR A;  2ALU A;  4IGR A;  3E9X A;  1TXF A;  3RLF E;  5KZT A;  3VLU A;  2GRV A;  4I62 A;  4ZE9 A;  1URD A;  2XXX A;  4LON B;  2ESN A;  3T9X B;  2VP1 A;  2Q2C A;  3S2V A;  1B0H A;  3QXM A;  1WDN A;  4KYD A;  4OEV A;  2BJJ X;  3RTW B;  1SI1 A;  2H9B A;  3IOW A;  3O6I A;  4NE4 A;  3O2A A;  3QSL A;  1O64 A;  1I6A A;  3A09 A;  3IOT A;  3TFL A;  2H5Y A;  3HHG A;  4KFQ A;  1R9Q A;  4MBP A;  1FTO A;  2R9J A;  4H0W A;  4F3S A;  1QUK A;  1UTH B;  2I0C A;  5J1D A;  4NF6 B;  3PMV A;  1P1N A;  3OEL A;  1ELJ A;  3PUW E;  2XXH A;  4MFI A;  5CRY A;  1T0K A;  3FVN A;  4E0W A;  2WKY A;  4GLI A;  3L6H A;  4RNS A;  3PPQ A;  2G93 A;  2VOZ A;  3G3J A;  5TP9 B;  3UGW A;  3G7W A;  4G8H A;  4IB2 A;  4IO2 A;  4OZ9 A;  4PE5 B;  3K6W A;  1P99 A;  4C1U A;  5L9S A;  2DYX A;  1N0T A;  1FW0 A;  1MPB A;  1SW1 A;  1YAE A;  2I49 A;  3FAT A;  3FZV A;  4MLV A;  1EZO A;  3CFZ A;  1P1O A;  3VDF A;  4F18 A;  1M5D A;  4ESX A;  4GXS B;  3U8Q A;  5JEI A;  5DVI A;  2D3I A;  4POW A;  1N3W A;  4ECF A;  4NF5 A;  2Q89 A;  1MQG A;  4UA8 A;  2DVZ A;  2ZXT A;  4BDO A;  4NWD A;  3O28 A;  1NFT A;  3VLW A;  3K0V A;  3PUZ E;  4UAC A;  3C32 A;  4H6D A;  1ZBM A;  2V3Q A;  3GXA A;  3VLV A;  4LZ5 A;  2DXY A;  2H4I A;  5CMB A;  3I5O A;  2O7I A;  2PBW A;  4DZ1 A;  2RC7 A;  1JW5 A;  4G8M A;  1QUJ A;  3N94 A;  4LAT A;  4G4P A;  3SET A;  4NF6 A;  3AXF A;  2HAU A;  3FUZ A;  3TZA A;  5FTI A;  5IKB A;  1Q35 A;  3M3L A;  3HHF A;  4GQO A;  3SEX A;  1B5H A;  1NNK A;  4ND9 A;  1BP5 A;  1B5J A;  2PT2 A;  2QL3 A;  2Z8D A;  1FQC A;  2B3B A;  2IEE A;  3C4M A;  4N13 A;  4RK9 A;  4DDD A;  4YAH X;  4DLD A;  1LB8 A;  2Q9T A;  3FJ7 A;  2QPQ A;  3UP9 A;  2GHB A;  3KOS A;  4R9F A;  2RC9 A;  4NTL A;  1JVY A;  3RT6 B;  1LFI A;  2I4B A;  3B6W A;  2E0S A;  1Y3P A;  5CM6 A;  1LGB C;  3FGS A;  5F7V A;  3R7X A;  5DTB A;  1II5 A;  3RUM A;  5I57 A;  2O68 A;  1IXH A;  4BDM A;  1SQY A;  3V89 B;  2A5T B;  4R75 A;  4MF3 A;  1R1N A;  1NMU A;  2GHA A;  1MG1 A;  2I58 A;  2PMS A;  2ZNU A;  4TLM B;  4XXU A;  1OVT A;  2I0B A;  3BKI B;  4L17 A;  3TYH A;  3KJT A;  4PFU A;  1IQ7 A;  1DSN A;  3M3F A;  5K2Y A;  4BDR A;  5AE4 A;  3MP1 A;  4ZDM A;  4ZEK A;  5K2X A;  5AA4 B;  2OWS A;  3C34 A;  5B70 A;  2AL5 A;  3I3V A;  1SVX B;  2PVU A;  1MM7 A;  1DTG A;  2XXV A;  3IK6 B;  4HS7 A;  5AA2 A;  3D4C A;  1Q1K A;  1AH5 A;  1OLC A;  2UXA A;  3SDF A;  1SW2 A;  4G77 A;  4WXJ A;  3TEL A;  1N84 A;  2DP8 A;  2O1M A;  1ZLQ A;  1FTK A;  1R6Z A;  2XHD A;  4KQP A;  5LOM A;  4BDN A;  4WED A;  3K1M A;  3S9L C;  3PPN A;  1Z7N E;  1PB8 A;  3EQ1 A;  1XS5 A;  4YB6 A;  2XXP A;  3TPA A;  1UIU A;  1Z7M E;  3FD3 A;  1LCT A;  3PU5 A;  4YKK A;  2QS3 A;  3SKP A;  4FOR A;  4ZEC A;  2XXU A;  4JB7 A;  4R9G A;  1SI0 A;  3G3H A;  1KWH A;  4ZE8 A;  4F2O A;  2B3F A;  3OMB A;  1IZ1 A;  4YB7 A;  5I57 B;  3HPI A;  3GLB A;  4ZZE A;  3O29 A;  3HO7 A;  2I3V A;  2UVJ A;  4X48 A;  3WAE A;  1LFG A;  5KCJ A;  1QKA A;  4JBZ A;  1I6B A;  1XOC A;  5DT6 A;  2UYE A;  2ZYK A;  2V93 A;  5H8F A;  3Q27 A;  2CZL A;  4LZ7 A;  1M5E A;  3I6V A;  3MPK A;  3V83 A;  2O69 A;  1USY E;  4EDP A;  3JZJ A;  1JEV A;  4OET A;  1RYX A;  2AYS A;  4MLQ A;  1Y3Q A;  4QRZ A;  4TLL B;  1IXG A;  4HCW A;  2GH9 A;  3FXU A;  4PFW A;  4F2Q A;  2Y7I A;  5AA3 A;  5B7D A;  4ONY A;  4OTE A;  2UVI A;  4U2R A;  4Q0C A;  4F22 A;  1H43 A;  4XKR A;  4PFY A;  2DWI A;  3IB0 A;  4YIC A;  1NL5 A;  3UIF A;  5IAI A;  1Y1M A;  2NOO A;  3H6V A;  1B58 A;  1B4Z A;  1BTJ A;  1PDA A;  3TUS A;  2VHA A;  1D9V A;  5KCJ B;  4PQJ A;  5ITO A;  3GBB A;  3KEI A;  3Q29 A;  4R6H A;  3BFT A;  1Y9U A;  3MW0 A;  1IIT A;  1N7X A;  2VD2 A;  3FV1 A;  3O66 A;  5KDT A;  1MY0 A;  3RTF B;  3VFJ A;  2XD2 A;  4YKP A;  4DCX A;  3CSG A;  1NH7 A;  1FCK A;  3MP8 A;  4F1U A;  4NF8 A;  4F3G A;  4Q30 B;  2F36 A;  1D9Y A;  2OBG A;  3MZ1 A;  3BBR A;  2W7Y A;  3S4U A;  3QUJ A;  1B6H A;  3K02 A;  3P7I A;  1US5 A;  3H7M A;  4TOZ A;  4MH5 A;  4TQU Q;  3VE1 B;  2FYI A;  3QUF A;  1MDQ A;  4Z0I A;  5AA2 B;  2A5S A;  1HSJ A;  2ZYO A;  2Z22 A;  4F31 B;  2RC8 A;  5I2K B; 
#chains in the Genus database with same CATH topology
 2XXW A;  3S9N C;  4PGP A;  3C9H A;  3HFU A;  3N26 A;  3ZSF A;  4YZZ A;  5IM2 A;  1OQH A;  4DXB A;  2A5T A;  2Y7W A;  1B3G A;  5EHS A;  2VPN A;  5ITP A;  3MVX A;  4QXD A;  2P3V A;  1B51 A;  4F3P A;  2R71 A;  2MKZ A;  4XIG Q;  5T3J A;  3HN0 A;  3TCH A;  3T9H B;  2AL4 A;  1YPN A;  3K1N A;  2XX9 A;  1B1H A;  3B7D A;  3MWB A;  1QUI A;  3TQW A;  4U1Z A;  4GL8 A;  1FPK A;  1Y4T A;  4I9D A;  1AL3 A;  4QSC A;  1OVB A;  5DVJ A;  5LTC A;  2D5W A;  1S9T A;  3H6U A;  5DVF A;  1MXZ A;  2F6P A;  3O6H A;  1BLF A;  4ELP A;  1MRP A;  4RA1 A;  1B7Z A;  4PDD A;  2V25 A;  4EQ7 A;  3E4R A;  4ELR A;  2V4C A;  4EQB A;  3CG3 A;  1FJ6 A;  1UTB A;  4FE8 A;  2REG A;  2DS9 A;  1JW1 A;  4NN3 A;  3A3C A;  4OHN A;  1UIV A;  2Q88 A;  1LEV A;  1SW4 A;  2V3T A;  3TTK A;  3FVO A;  3K6V A;  4QF9 A;  4OFL A;  5H8Q A;  2HQ0 A;  2P3N A;  5EHM A;  4QFK A;  1B4H A;  4DIG A;  4PAF A;  1LAF E;  2G29 A;  4QFP A;  4BDL A;  4LQ5 A;  2XA5 A;  4NMY A;  5H8Q B;  1MQJ A;  2IA4 A;  4RYA A;  1PB9 A;  4QFO A;  1YCJ A;  4GFR A;  3LV0 A;  3RN8 A;  4YKJ A;  3EHU A;  4QBA A;  3TDJ A;  1QKB A;  3RGY A;  1YTV A;  4XKP A;  1FPJ A;  3Q28 A;  2QS4 A;  4H67 A;  5ELV A;  1SYH A;  5TU0 A;  1FQE A;  2CEX A;  3G3F A;  2DXR A;  1GGG A;  2F8D A;  4BLA A;  1PBP A;  3LUY A;  3IFC A;  5DEX B;  4KHZ E;  1B3F A;  1VDW A;  4H8J A;  3EHS A;  1PEB A;  4YMA A;  4DE8 A;  1US4 A;  3UA8 A;  2F78 A;  2WYK A;  5I56 A;  1FBP A;  3E79 A;  5AA4 A;  1ANF A;  5TPA A;  4H5G A;  4PTK A;  1NV7 A;  4OYV A;  2RCA A;  3CIJ A;  1MPD A;  1MS7 A;  1JW4 A;  2Z8E A;  2QVR A;  1DOT A;  1B7U A;  3IB2 A;  5ET7 A;  3QMF A;  4HCY A;  4FIM A;  5I56 B;  4G61 A;  2XXQ A;  1XHY A;  3DP6 A;  2OJT A;  3SEY A;  4U4S A;  5EQA A;  4F19 A;  2UVG A;  3KG2 A;  3C35 A;  1S7Y A;  4QSE A;  1SYI A;  1EYI A;  3O9P A;  5EQ7 A;  2F3D A;  5FBP A;  4P9K A;  2DOJ A;  2UYF A;  4OER A;  1MM6 A;  4NF4 B;  4MMP A;  4GWS A;  4N8Y A;  4DI3 D;  5I2N A;  3LBS A;  2VPO A;  5F1Q A;  2QFL A;  1QVS A;  2UVH A;  3Q25 A;  1MXV A;  3IO4 A;  5IZ3 B;  4R74 A;  2XXY A;  4JVD A;  1NV1 A;  1F9B A;  1VSO A;  4F3B A;  1MXU A;  4POX A;  2QRY A;  4ZEB A;  1GVC A;  2F34 A;  3CVG A;  3FVG A;  3ECR A;  2F7A A;  3CFL A;  4PFR A;  1B3E A;  5FTH A;  2NWJ A;  5HPQ A;  1MY1 A;  3IAZ A;  4G2Z A;  4HXV A;  5CMC A;  3ONM A;  1IMD A;  1TWY A;  1VE4 A;  2PYY A;  2B4L A;  3KSJ A;  3H03 A;  3IL1 B;  3T66 A;  1FBG A;  2Y84 A;  2O7U A;  4P3L A;  3UOR A;  3RLF E;  2F3B A;  3E9X A;  1WDN A;  1O64 A;  4MBP A;  4KFQ A;  1DBZ A;  3T1B A;  1IMC A;  3OEL A;  3FVN A;  2WKY A;  4GLI A;  1FRP A;  4RNS A;  2G93 A;  2VOZ A;  3UGW A;  1NV3 A;  4OZ9 A;  3VDF A;  1SPI A;  4F18 A;  3U8Q A;  1N3W A;  4ECF A;  4NHB A;  1FPI A;  1MQG A;  4UA8 A;  3O28 A;  1YYZ A;  3B50 A;  2ZZX A;  4UAC A;  3C32 A;  1ZBM A;  3VLV A;  2DXY A;  2H4I A;  4X8R A;  5CMB A;  1Q9D A;  3I5O A;  2O7I A;  1JW5 A;  1QUJ A;  4G4P A;  5IKB A;  3SEX A;  4ND9 A;  2Z8D A;  3C4M A;  2XWI A;  4RK9 A;  4O7I A;  4YAH X;  3FJ7 A;  2RC9 A;  4NTL A;  1JVY A;  4MX6 A;  3ISP A;  3FGS A;  3R7X A;  3RUM A;  1IXH A;  4BDM A;  4TLM B;  2I58 A;  3BKI B;  3KJT A;  4PFU A;  1IQ7 A;  1DSN A;  3M3F A;  3MP1 A;  3C34 A;  3I3V A;  4HS7 A;  3D4C A;  2VT5 A;  1Q1K A;  1AH5 A;  2UXA A;  4WXJ A;  1N84 A;  2DP8 A;  2O1M A;  4HE1 A;  1R6Z A;  3PPN A;  4PE3 A;  2XXP A;  3TPA A;  2WEF A;  4ZEC A;  3SKP A;  2B4M A;  4JB7 A;  1IZ1 A;  4ZZE A;  4JBZ A;  2V93 A;  2CZL A;  3I6V A;  4EDP A;  1JEV A;  4MLQ A;  1Y3Q A;  4TLL B;  1IXG A;  1FPD A;  4HCW A;  4F2Q A;  2Y7I A;  4OTE A;  2UVI A;  4U2R A;  4F22 A;  4XKR A;  4PFY A;  4YIC A;  1NL5 A;  3UIF A;  2NOO A;  1B58 A;  5ITO A;  1IIT A;  5KDT A;  1RDY A;  1MY0 A;  3VFJ A;  4YKP A;  3CSG A;  1NH7 A;  1IME A;  4Q30 B;  2F36 A;  1B6H A;  3P7I A;  4MH5 A;  2FYI A;  1L5T A;  1FBE A;  5I2K B;  4ZE9 A;  2XD3 A;  1J1N A;  3FXR A;  4R73 A;  1GTK A;  5A5X A;  4R2F A;  3SZP A;  3TQL A;  2Y5L A;  2P2A A;  3K4U A;  3R6U A;  3V5A A;  2E1S A;  4P1L A;  3RQT A;  1H44 A;  3FV2 A;  4KCD A;  3IOV A;  1JQF A;  4GIZ A;  1A55 A;  5H8N B;  1EH3 A;  1FQD A;  1XT8 A;  3E13 X;  3RY3 A;  1B9J A;  1LBY A;  1G0H A;  3KBR A;  2P0S A;  1B5I A;  1IMA A;  3LC8 A;  4F1Y A;  1NUW A;  2ZYM A;  4C1T A;  4IO6 A;  3EN3 A;  2RKM A;  2O51 A;  1DPP A;  2GFE A;  3BFU A;  5IZ1 A;  4M4G A;  3TCF A;  3MVY A;  1FQA A;  3KC0 A;  1P1U A;  3TMG A;  5ET5 A;  4KYE A;  4MNC A;  5TP9 A;  2F97 A;  3U72 A;  3TTR A;  3SEW A;  1SW5 A;  4DI4 B;  3K6U A;  1Y20 A;  3EF7 A;  4O7M A;  4AQ4 A;  2HHM A;  2RIN A;  4FED A;  3TAJ A;  4RPN A;  5AA2 D;  1IXI A;  3H06 B;  1LLS A;  2ZYN A;  1FTM A;  4JWX A;  1ZJL A;  4ZEI A;  4F1V A;  3S9E A;  5CMK A;  2BJI A;  4G68 B;  4N6D A;  5J16 A;  4OEU A;  4P0G A;  4O8M A;  3MPL A;  4U22 A;  3SEV A;  2VGQ A;  1H45 A;  2D21 A;  1N04 A;  1QJM A;  4ZEF A;  3B6Q A;  3DLN A;  1NUY A;  5JK4 A;  2AIX A;  3USD A;  1Y4C A;  3ZKL A;  4G68 A;  4GBV A;  4KXP A;  4OVJ A;  4GF8 A;  4FAT A;  1NNF A;  3LSL A;  4F29 A;  4YB5 A;  1DPE A;  4ZS9 A;  3G3I A;  1A8E A;  2DE2 A;  4OES A;  3K1P A;  1T0K A;  2Q2A A;  4OFO A;  3RNN A;  1FQF A;  4JVI A;  3IJX B;  2XX8 A;  1NV6 A;  3TOD A;  1IMB A;  1JET A;  4N8G A;  1QW0 A;  2Z23 A;  2OX3 A;  2VD3 A;  4ELO A;  4R2B A;  1QGX A;  5ET8 A;  3OSQ A;  2F7C A;  3KSX A;  1G0I A;  2QVU A;  2Z8F A;  4RPO A;  3LSF B;  4H46 A;  2V3U A;  1TFA A;  4X04 A;  4XKQ A;  3QYT A;  3G3K A;  5CBS A;  3M3K A;  3TTN A;  1B1X A;  3OD7 A;  3MC2 A;  4G8N A;  3MBP A;  2R8T A;  4I40 A;  1KZ8 A;  3UK4 A;  1MY2 A;  5I59 A;  1FTJ A;  2Y7K A;  4EF2 A;  5F24 A;  2O1L A;  3PMX A;  4IO3 A;  1JVX A;  3VXB A;  3F11 A;  5IAI A;  1SBP A;  3HCQ A;  4PFI A;  3N6U A;  4P1E A;  3D1R A;  4X1B A;  1SD3 A;  4O3C A;  5CI5 A;  3VVD A;  2Q8M A;  5A5X B;  2YLN A;  2HEU A;  3U93 A;  1OLA A;  3TCG A;  1NH8 A;  2FNC A;  1MXW A;  1QUL A;  2DE3 A;  1MPC A;  1MQI A;  3W9V A;  4GX6 A;  2B65 A;  2NXO A;  5I2K A;  4UAB A;  3RT8 A;  3KC1 A;  1CE2 A;  3VVE A;  4NF5 B;  5H8H A;  4O3B A;  4N17 A;  5M2V A;  4NAP A;  3PD8 A;  4ISU A;  4YKI A;  2Q74 A;  1FBD A;  5EQ9 A;  3HV1 A;  1B52 A;  3KFM A;  2XWO A;  2ONS A;  2HZK A;  5I2N B;  1BK4 A;  2ZZV A;  4KI0 E;  1INP A;  1MQD A;  2O84 X;  4EUO A;  1MH4 A;  3QAX A;  3MP6 A;  4GOT A;  1M5F A;  1EU8 A;  1EZ9 A;  1B3H A;  3Q26 A;  4H1X A;  1RDX A;  3O6G A;  3ILT B;  4QFN A;  2NVU B;  1LBX A;  4LA9 A;  1EYK A;  4YMB A;  2M8C A;  3IB1 A;  1NV0 A;  4IY5 A;  2XXI A;  2GRV A;  4I62 A;  4LON B;  1LBZ A;  3S2V A;  4KYD A;  4OEV A;  4OVS A;  3RTW B;  1SI1 A;  3O2A A;  1I6A A;  4NF0 A;  1R9Q A;  1QUK A;  2WX9 A;  4OVP A;  4OVT A;  3BIG A;  1ELJ A;  3PUW E;  2XXH A;  4FBP A;  3L6H A;  3G3J A;  5TP9 B;  4IB2 A;  1FBC A;  1P99 A;  1FW0 A;  1MPB A;  1YAE A;  3FZV A;  4GXS B;  2D3I A;  2DVZ A;  4NWD A;  2V3Q A;  3GXA A;  2PBW A;  4LAT A;  3M3L A;  4GQO A;  4XEQ A;  1NNK A;  4X9T A;  2PT2 A;  2B3B A;  2GQ1 A;  2IEE A;  4DDD A;  2Q9T A;  3KOS A;  5I3S A;  3RT6 B;  2E0S A;  1Y3P A;  5F7V A;  4AS4 A;  5DTB A;  1II5 A;  1KA1 A;  2O68 A;  1SQY A;  3UP9 A;  1AOV A;  4OAN A;  4XXU A;  4L17 A;  2I0B A;  4ZDM A;  4ZEK A;  2OWS A;  2AL5 A;  1NUX A;  3IK6 B;  4G77 A;  1ZLQ A;  4KQP A;  1Z7N E;  1PB8 A;  4YB6 A;  5ET6 A;  4FOR A;  2XXU A;  1LBV A;  3OMB A;  3WAE A;  2I3V A;  1QKA A;  1I6B A;  5DT6 A;  2UYE A;  5EYH A;  1M5E A;  3MPK A;  3V83 A;  1RYX A;  3ROJ A;  4QRZ A;  5AA3 A;  1DCU A;  5IZ3 A;  3H6V A;  1B4Z A;  1PDA A;  2VHA A;  3GBB A;  3BFT A;  3MW0 A;  2VD2 A;  4XFE A;  2PFZ A;  1FCK A;  4F3G A;  3BBR A;  3VE1 B;  5AA2 B;  1HSJ A;  4F31 B;  5LDZ A;  3MAM A;  1A8F A;  3S9M C;  3EHT A;  2R6G E;  4JSD A;  4GVO A;  4FEB A;  1NV4 A;  4P47 A;  5CBR A;  4OMB A;  2O6A A;  4R72 A;  1LBB A;  3DM0 A;  4MNP A;  3B8B A;  4ZED A;  3PPR A;  3SES A;  2QMX A;  4GX4 A;  4HW8 A;  3FXB A;  5AA1 A;  4GRK A;  3PMW A;  4OFJ A;  3HST A;  4NG7 A;  4U1O A;  2YJP A;  2RCB A;  2QJE A;  4KD5 A;  2DWH A;  2I3W A;  4ESW A;  3MYU A;  1R9L A;  2THI A;  2F7B A;  3FAS A;  2I48 A;  4FJP A;  3E3K A;  3MVZ A;  4R6K A;  3CRB A;  3C33 A;  4QHQ A;  3FJM A;  4OVQ A;  5FHM A;  3JYR A;  1OQG A;  2HFB A;  3OO7 A;  1FTA A;  2PX1 A;  5BWJ A;  1IXC A;  1A99 A;  1XVY A;  5CMM A;  4RJZ A;  1ZTY A;  4LVQ A;  3QK6 A;  3VVF A;  3UN6 A;  4AB5 A;  4GBW A;  3IJO B;  1MQH A;  1MY4 A;  2CMO A;  4IY6 A;  4ELQ A;  4JVC A;  3EPE A;  2KQZ A;  1UTH A;  4N4U A;  4RY1 A;  4RXL A;  4GD5 A;  2ABH A;  2DDK A;  3PGF A;  1OIB A;  2HXW A;  1D9Q A;  1TT1 A;  2XX7 A;  1N76 A;  2I4C A;  5JTY B;  4LP2 B;  4IGT A;  2ZNT A;  4AB6 A;  3LSX A;  2DVC A;  3FXQ A;  3CSB A;  1I6Q A;  1LB9 A;  1FBH A;  2OK2 A;  3KN7 A;  2X26 A;  1I69 A;  4F39 A;  5ISU A;  2DWJ A;  3JV9 A;  1NKX A;  1D3K A;  1VFD A;  4R6Y A;  2QS1 A;  1HSE A;  1PB7 A;  4GL0 A;  3RPW A;  1POT A;  3THI A;  2HZL A;  4GWZ A;  3A29 A;  4PAI A;  5I5P A;  1JNF A;  2REJ A;  4THI A;  2KLF A;  1RYO A;  3PD9 A;  4EXL A;  1BKA A;  4BDQ A;  3O97 A;  1WVJ A;  5I58 A;  1B32 A;  1D4N A;  2PCR A;  1B46 A;  1P1W A;  1IEJ A;  5A5L A;  4Q8R A;  2HXR A;  1K9Y A;  1N3X A;  1FPF A;  4O94 A;  1MY3 A;  1MXY A;  3TEP A;  2QS2 A;  4OWD A;  3EKI A;  3A3U A;  3PUY E;  5CC2 A;  4N6P A;  4M1V A;  4DXC A;  1EYJ A;  1URS A;  3H6T A;  4YU0 A;  1VR5 A;  4LZ8 A;  5HM4 B;  1Y3N A;  2LAO A;  4MCO A;  3PPP A;  1FTL A;  3DP4 A;  3R26 A;  4LQ2 A;  4OA4 A;  1DK4 A;  3C31 A;  5B70 A;  3K2D A;  3IO6 A;  1CNQ A;  2WBD A;  3T96 B;  1URG A;  2I6E A;  3MJN A;  1FQB A;  3OO8 A;  4NF8 B;  2NUV A;  4P8B A;  2CZI A;  2Y7R A;  2X7Q A;  1DTZ A;  4I8C A;  5K2Y A;  5EYF A;  3KGC A;  4LUB A;  2HCA A;  4MJO A;  3LR1 A;  4MIJ A;  2OLB A;  2X7P A;  5I84 A;  2KR0 A;  4EXK A;  3CHG A;  1TFD A;  4OQO A;  4QFL A;  2DQV A;  3ZKK A;  4JDF A;  1MDP 1;  1NV5 A;  4FEC A;  2XXT A;  2P1S A;  4KR5 A;  4QSD A;  3E78 A;  4PFT A;  2H98 A;  4NWC A;  1OMP A;  1B0L A;  3FIR A;  5JTY A;  4NED A;  4GWO A;  1PC3 A;  3OEM A;  3WAF A;  3VXC A;  3U65 A;  5KZT A;  1TXF A;  3VLU A;  4PAK A;  1NI9 A;  2ESN A;  3T9X B;  2Q2C A;  1B0H A;  3QXM A;  2H9B A;  2FIX A;  3A09 A;  2FHY A;  3HHG A;  1FTO A;  2R9J A;  4H0W A;  4F3S A;  1UTH B;  4NF6 B;  3PMV A;  5CRY A;  3G7W A;  4G8H A;  4IO2 A;  4PE5 B;  4C1U A;  2DYX A;  1SW1 A;  3FAT A;  4MLV A;  1EZO A;  2I49 A;  3FBP A;  1P1O A;  4ESX A;  4PFB A;  3KBZ A;  5DVI A;  2Q89 A;  4BDO A;  3VLW A;  1FSA A;  4MHF A;  4PDH A;  4G8M A;  3SET A;  3AXF A;  2HAU A;  5FTI A;  1Q35 A;  1B5H A;  1BP5 A;  1B5J A;  1FQC A;  4DLD A;  4GX3 A;  4R9F A;  1LFI A;  5CM6 A;  1LGB C;  1FPB A;  5I57 A;  3V89 B;  2A5T B;  4R75 A;  4MF3 A;  2ZNU A;  2PMS A;  1OVT A;  4N6K A;  4BDR A;  5K2X A;  5AA4 B;  1SVX B;  2XXV A;  5AA2 A;  4NGU A;  2L5V A;  3T0J A;  1YZ0 A;  1FTK A;  2XHD A;  4NQ8 A;  1XI6 A;  3FD3 A;  1LCT A;  3PU5 A;  1YXI A;  4YKK A;  4GWU A;  2WYP A;  4GWX A;  4R9G A;  3G3H A;  4F2O A;  4ZE8 A;  5I57 B;  3HPI A;  3GLB A;  3O29 A;  3HO7 A;  2UVJ A;  4X48 A;  1XOC A;  2ZYK A;  5H8F A;  3Q27 A;  1USY E;  3JZJ A;  2AYS A;  4PFW A;  2GH9 A;  3FXU A;  4ONY A;  4P56 A;  1AWB A;  4Q0C A;  1H43 A;  2FVZ A;  1Y1M A;  1D9V A;  5KCJ B;  4PQJ A;  4PF8 A;  4R6H A;  1N7X A;  4DCX A;  4F1U A;  2OBG A;  3MZ1 A;  3S4U A;  3K02 A;  3H7M A;  4TOZ A;  3QUF A;  2A5S A;  4WKM A;  4DXU A;  5IGA A;  2Z22 A;  2RC8 A;  2H25 A;  4XTC Q;  1AMF A;  1H76 A;  4PP0 A;  4PBQ A;  4PGN A;  1P1Q A;  3SER A;  3NOH A;  5FHN A;  1S50 A;  3T9U A;  3T22 A;  1NNP A;  2ONR A;  4GXA A;  3PTY A;  3IOU A;  3OSR A;  3OEN A;  1O7T A;  1GV8 A;  3H3G A;  2XXR A;  4U4X A;  3FVK A;  3LSW A;  4PET A;  1ZU0 A;  4AS5 A;  5DW8 A;  2HPG A;  2CZH A;  2V84 A;  1A54 A;  1Y1Z A;  2OCU A;  5L8D A;  4XKN A;  4ZZA A;  5I59 B;  3N6T A;  4H5F A;  2RF1 A;  5L9O A;  1B3L A;  4PBH A;  3TTM A;  3U1O A;  5KDT B;  5H8S A;  4Z7E A;  3L6G A;  3TKD A;  1H3D A;  4N07 A;  3U94 A;  5I7I A;  3MVW A;  1BIY A;  2OWT A;  4EQ9 A;  2ZNS A;  3MZB A;  1LAH E;  1SDX A;  1MH3 A;  1UQW A;  2DSF A;  3IR1 A;  3ZS6 A;  1B2H A;  3QIM A;  2HAV A;  4U21 A;  1JEU A;  2ANJ A;  4N15 A;  5ESY A;  3IOR A;  1LFH A;  4LN5 A;  1NNT A;  4KYS A;  1IUD A;  4IR8 A;  2H99 A;  5L9M A;  1HSL A;  1RKM A;  3MQ9 A;  1POY 1;  4N81 A;  2OZZ A;  4IO7 A;  4N91 A;  4OXV A;  1KA0 A;  1NUZ A;  1ZKB A;  1IMF A;  4FAJ A;  4X1D A;  4IO4 A;  4KCC A;  4H45 A;  3K6X A;  4OEN A;  1JP4 A;  4H8I A;  3C36 A;  3DP8 A;  5HBC A;  5DEX A;  4G68 C;  1LBC A;  3ODB A;  3H4Z A;  4I1D A;  2YPN A;  1XVX A;  2ZMB A;  4EF1 A;  2QSX A;  4XF5 A;  1ZMG A;  1LAX A;  3GZG A;  5TPA B;  1IIW A;  2DWA A;  4H65 A;  1FBF A;  3V8X B;  5BUU A;  4C0R A;  5DYH A;  4P11 A;  2PT1 A;  3TTL A;  2F35 A;  3H6W A;  5H8H B;  3CI8 A;  3U92 A;  3CG1 A;  5ICT A;  3D4G A;  3G3G A;  1M5B A;  1O63 A;  2ONK E;  4JWY A;  5I58 B;  3CFX A;  4Q5T A;  3RPL A;  3IX1 A;  1XC1 A;  1FPG A;  4JSO A;  3KZG A;  1USY H;  3KN8 A;  3GBA A;  2WBB A;  1PBQ A;  1B40 A;  2CZK A;  3PUV E;  1WOD A;  2QMW A;  2DE4 A;  2ZZW A;  5H8N A;  5FHO A;  2OWZ A;  3OOA A;  3W15 C;  2Y7P A;  1LST A;  3FJG A;  4JXI A;  1DMB A;  3MZ9 A;  1LBW A;  1UTB B;  3T93 B;  3SEU A;  3PUX E;  3DEL B;  1LAG E;  3IFA A;  3OO9 A;  1ATG A;  2F6G A;  4MEV A;  3PPO A;  4JWO A;  4DCY A;  3K00 A;  4O3A A;  4U23 A;  4K3F A;  3M8U A;  4HTG A;  2F5X A;  3N5L A;  3RPL B;  4OVR A;  1N7W A;  3PV0 E;  5IZZ A;  1A7L A;  3W9W A;  1LCF A;  3KOT A;  3CR9 A;  4MNI A;  3K01 A;  3KJ7 A;  1AIV A;  2FIE A;  1ZIU A;  3B6T A;  3OEK A;  1EZP A;  4RK2 A;  1MXX A;  3OO6 A;  4E0X A;  1M5C A;  2FBP A;  3KN3 A;  2FA7 A;  4IO5 A;  2QVV A;  4NF4 A;  3VV5 A;  1B05 A;  5H8F B;  4PC9 A;  2Q8J A;  1A40 A;  1VFE A;  1CB6 A;  4P0I A;  3T9V A;  1B7H A;  1FPL A;  3ILU B;  1GR2 A;  5ICQ A;  4KPT A;  4I3E A;  3OXN A;  2ALU A;  4IGR A;  1URD A;  2XXX A;  2VP1 A;  2BJJ X;  3IOW A;  3O6I A;  4NE4 A;  3QSL A;  3IOT A;  3TFL A;  2H5Y A;  2I0C A;  5J1D A;  1P1N A;  4MFI A;  4E0W A;  5EYG A;  1FJ9 A;  3PPQ A;  3TUS A;  5L9S A;  3K6W A;  1N0T A;  3CFZ A;  1M5D A;  5JEI A;  4POW A;  4NF5 A;  2ZXT A;  2XWV A;  1NFT A;  3LUZ A;  3K0V A;  3PUZ E;  4H6D A;  4LZ5 A;  2Y5K A;  4DZ1 A;  2RC7 A;  1K9Z A;  3N94 A;  4NF6 A;  3FUZ A;  3TZA A;  3HHF A;  3GYY A;  3RYD A;  2QL3 A;  4N13 A;  2PFY A;  1LB8 A;  2QPQ A;  2GHB A;  3B6W A;  2I4B A;  2XWK A;  2CEY A;  4HE0 A;  3BIH A;  1R1N A;  1NMU A;  2GHA A;  1MG1 A;  3MST A;  4PCD A;  3TYH A;  5AE4 A;  2JJK A;  2PVU A;  1MM7 A;  1DTG A;  1OLC A;  2XXK A;  3SDF A;  1NV2 A;  1SW2 A;  3TEL A;  5LOM A;  4BDN A;  4WED A;  3K1M A;  3S9L C;  3EQ1 A;  1XS5 A;  4I3Y A;  4PF6 A;  1UIU A;  1Z7M E;  2QS3 A;  1SI0 A;  4GWY A;  1KWH A;  2B3F A;  4YB7 A;  1LFG A;  5KCJ A;  4LZ7 A;  2O69 A;  4GWW A;  4OET A;  5B7D A;  4NX1 A;  4MAG A;  2DWI A;  3IB0 A;  1BTJ A;  1RDZ A;  5EQ8 A;  3KEI A;  3Q29 A;  1Y9U A;  3FV1 A;  3O66 A;  3RTF B;  2XD2 A;  3MP8 A;  4NF8 A;  1D9Y A;  2W7Y A;  3QUJ A;  1US5 A;  4TQU Q;  4Z0I A;  1MDQ A;  4HE2 A;  1FPE A;  4WEP A;  2ZYO A;  3MUQ A; 
#chains in the Genus database with same CATH homology
 2XD3 A;  1J1N A;  2H25 A;  2XXW A;  3MAM A;  3S9N C;  4XTC Q;  3FXR A;  1AMF A;  1A8F A;  3C9H A;  3S9M C;  3N26 A;  1H76 A;  3EHT A;  3ZSF A;  4PP0 A;  2R6G E;  4JSD A;  4YZZ A;  1OQH A;  1P1Q A;  4FEB A;  4GVO A;  4R73 A;  3SER A;  1GTK A;  4DXB A;  2A5T A;  5CBR A;  2Y7W A;  4OMB A;  5A5X A;  1B3G A;  4R2F A;  1S50 A;  5FHN A;  2O6A A;  4R72 A;  3T9U A;  3TQL A;  1LBB A;  2P2A A;  3DM0 A;  3K4U A;  3R6U A;  5EHS A;  4ZED A;  3V5A A;  3PPR A;  5ITP A;  3MVX A;  2E1S A;  3SES A;  3T22 A;  2QMX A;  1B51 A;  1NNP A;  2ONR A;  2R71 A;  1H44 A;  3FV2 A;  4GXA A;  5AA1 A;  3RQT A;  4F3P A;  4HW8 A;  4KCD A;  4GRK A;  3PMW A;  3IOV A;  4OFJ A;  1JQF A;  4XIG Q;  4GIZ A;  1A55 A;  3IOU A;  3OSR A;  3HST A;  3HN0 A;  3OEN A;  1O7T A;  1GV8 A;  3H3G A;  2XXR A;  4U4X A;  2AL4 A;  1EH3 A;  1FQD A;  1YPN A;  3FVK A;  4U1O A;  3T9H B;  2YJP A;  3LSW A;  1XT8 A;  3E13 X;  4PET A;  1ZU0 A;  3RY3 A;  2RCB A;  2QJE A;  3K1N A;  1B9J A;  2DWH A;  2I3W A;  2XX9 A;  4KD5 A;  1B1H A;  4ESW A;  3B7D A;  1R9L A;  2V84 A;  1A54 A;  3MWB A;  1Y1Z A;  2OCU A;  2THI A;  1QUI A;  2F7B A;  3TQW A;  3FAS A;  4U1Z A;  2I48 A;  4FJP A;  4GL8 A;  3E3K A;  1Y4T A;  5L8D A;  4XKN A;  3KBR A;  4ZZA A;  3MVZ A;  4I9D A;  3CRB A;  4R6K A;  5I59 B;  3C33 A;  1AL3 A;  4QHQ A;  3N6T A;  2P0S A;  4H5F A;  1B5I A;  2RF1 A;  3FJM A;  5FHM A;  3JYR A;  3LC8 A;  4F1Y A;  1OQG A;  2HFB A;  5L9O A;  1B3L A;  2ZYM A;  3OO7 A;  3TTM A;  3U1O A;  4QSC A;  4C1T A;  4IO6 A;  1OVB A;  2PX1 A;  3EN3 A;  5BWJ A;  5DVJ A;  2RKM A;  1IXC A;  1A99 A;  1DPP A;  1XVY A;  2O51 A;  2GFE A;  3BFU A;  2D5W A;  4M4G A;  5H8S A;  3TCF A;  3L6G A;  4Z7E A;  3MVY A;  5KDT B;  5CMM A;  4RJZ A;  1ZTY A;  4LVQ A;  1FQA A;  1S9T A;  3H6U A;  1P1U A;  3TMG A;  3QK6 A;  3VVF A;  3TKD A;  1H3D A;  3UN6 A;  4AB5 A;  4N07 A;  5DVF A;  3IJO B;  1MQH A;  1MXZ A;  2F6P A;  3O6H A;  3U94 A;  3MVW A;  1BIY A;  1MY4 A;  1BLF A;  2CMO A;  2OWT A;  4IY6 A;  4KYE A;  5TP9 A;  2ZNS A;  2F97 A;  3MZB A;  4ELQ A;  4ELP A;  1LAH E;  3U72 A;  3TTR A;  1MRP A;  3SEW A;  4RA1 A;  1SW5 A;  1SDX A;  1B7Z A;  1MH3 A;  1UQW A;  2V25 A;  1Y20 A;  2DSF A;  3EF7 A;  3IR1 A;  3K6U A;  3E4R A;  4AQ4 A;  3ZS6 A;  4ELR A;  4EQ7 A;  2RIN A;  3EPE A;  1B2H A;  3QIM A;  4FED A;  2HAV A;  4U21 A;  4EQB A;  3CG3 A;  1UTH A;  3TAJ A;  1UTB A;  1JEU A;  2ANJ A;  4FE8 A;  2REG A;  4RY1 A;  4RPN A;  2DS9 A;  3IOR A;  4RXL A;  5AA2 D;  1JW1 A;  4GD5 A;  1LFH A;  2ABH A;  3PGF A;  1IXI A;  1NNT A;  1OIB A;  3A3C A;  3H06 B;  1LLS A;  2HXW A;  1FTM A;  2ZYN A;  4JWX A;  1ZJL A;  4KYS A;  1IUD A;  4OHN A;  4ZEI A;  1UIV A;  4DXU A;  1TT1 A;  2XX7 A;  5H8N B;  2Q88 A;  2H99 A;  4F1V A;  1SW4 A;  2V3T A;  3S9E A;  5L9M A;  1HSL A;  1RKM A;  3MQ9 A;  1POY 1;  1N76 A;  3TTK A;  2I4C A;  3FVO A;  3K6V A;  5CMK A;  4QF9 A;  5JTY B;  4LP2 B;  4G68 B;  4OFL A;  2OZZ A;  2HQ0 A;  4IGT A;  4IO7 A;  4OXV A;  5H8Q A;  1ZKB A;  4OEU A;  4FAJ A;  4P0G A;  2ZNT A;  4X1D A;  3LSX A;  4AB6 A;  3MPL A;  4U22 A;  4IO4 A;  5EHM A;  2DVC A;  2VGQ A;  1B4H A;  4KCC A;  4QFK A;  3SEV A;  3FXQ A;  1H45 A;  3CSB A;  4DIG A;  2D21 A;  1I6Q A;  1N04 A;  3K6X A;  3MUQ A;  4OEN A;  1QJM A;  4X9T A;  4H8I A;  1LAF E;  2G29 A;  4ZEF A;  1LB9 A;  3B6Q A;  2OK2 A;  3C36 A;  2X26 A;  3DLN A;  3KN7 A;  3DP8 A;  5JK4 A;  5HBC A;  1L5T A;  5DEX A;  1I69 A;  2AIX A;  4G68 C;  4QFP A;  1Y4C A;  3USD A;  4BDL A;  4LQ5 A;  4NMY A;  5H8Q B;  4F39 A;  1MQJ A;  4G68 A;  2IA4 A;  1LBC A;  3ZKL A;  3ODB A;  4RYA A;  2DWJ A;  5ISU A;  3JV9 A;  4OVJ A;  1PB9 A;  4GF8 A;  3H4Z A;  4FAT A;  1NNF A;  3LSL A;  4QFO A;  1NKX A;  1YCJ A;  4I1D A;  1D3K A;  4GFR A;  4F29 A;  4YB5 A;  1DPE A;  1XVX A;  1VFD A;  2YPN A;  4R6Y A;  4ZS9 A;  2ZMB A;  3G3I A;  4EF1 A;  1A8E A;  2DE2 A;  1ZMG A;  2QSX A;  4OES A;  3RN8 A;  3K1P A;  4YKJ A;  2QS1 A;  1HSE A;  1LAX A;  1PB7 A;  3EHU A;  1IIW A;  3GZG A;  1QKB A;  5TPA B;  3TDJ A;  2Q2A A;  4GL0 A;  3RPW A;  4OFO A;  3RGY A;  1FQF A;  1YTV A;  2DWA A;  4XKP A;  4H65 A;  3RNN A;  3Q28 A;  2QS4 A;  1POT A;  4H67 A;  3IJX B;  5ELV A;  3V8X B;  1SYH A;  2XX8 A;  5BUU A;  3TOD A;  4WKM A;  5TU0 A;  3THI A;  2HZL A;  5DYH A;  1JET A;  1FQE A;  4C0R A;  1QW0 A;  4P11 A;  2Z23 A;  1JNF A;  2PT1 A;  2REJ A;  2DXR A;  2VD3 A;  3G3F A;  4THI A;  3TTL A;  4ELO A;  2F35 A;  2KLF A;  1GGG A;  2F8D A;  3H6W A;  1PBP A;  4R2B A;  5H8H B;  4BLA A;  3CI8 A;  3OSQ A;  1RYO A;  2F7C A;  3LUY A;  3PD9 A;  3CG1 A;  3U92 A;  1BKA A;  4EXL A;  5ICT A;  3KSX A;  4BDQ A;  3D4G A;  2Z8F A;  3G3G A;  3O97 A;  4RPO A;  1M5B A;  1O63 A;  1WVJ A;  3LSF B;  5DEX B;  2V3U A;  1B32 A;  4KHZ E;  5I58 A;  2ONK E;  1B3F A;  4JWY A;  1D4N A;  4EQ9 A;  5I58 B;  3CFX A;  4H8J A;  4Q5T A;  1TFA A;  3EHS A;  1B46 A;  1P1W A;  1PEB A;  1IEJ A;  3IX1 A;  4DE8 A;  1XC1 A;  4JSO A;  4YMA A;  4Q8R A;  1US4 A;  1USY H;  3KZG A;  3G3K A;  3QYT A;  3KN8 A;  4XKQ A;  3UA8 A;  3GBA A;  5CBS A;  1N3X A;  3M3K A;  3TTN A;  1B1X A;  3OD7 A;  3MC2 A;  4G8N A;  3MBP A;  1PBQ A;  1MY3 A;  2F78 A;  3UK4 A;  1MY2 A;  5I56 A;  1B40 A;  1MXY A;  5I59 A;  3TEP A;  3PUV E;  1WOD A;  2QS2 A;  2QMW A;  5AA4 A;  1FTJ A;  2Y7K A;  4OWD A;  3A3U A;  2DE4 A;  5H8N A;  1ANF A;  5TPA A;  4H5G A;  3PUY E;  4EF2 A;  3TCH A;  5FHO A;  4OYV A;  2O1L A;  3PMX A;  4IO3 A;  3W15 C;  2RCA A;  3OOA A;  1JVX A;  3VXB A;  1AOV A;  5CC2 A;  3F11 A;  2Y7P A;  1LST A;  1MPD A;  1SBP A;  1MS7 A;  3CIJ A;  1JW4 A;  2Z8E A;  3FJG A;  3HCQ A;  4JXI A;  4N6P A;  1DMB A;  1DOT A;  3MZ9 A;  4M1V A;  1UTB B;  1B7U A;  3IB2 A;  3N6U A;  4DXC A;  3T93 B;  1URS A;  3H6T A;  4YU0 A;  1VR5 A;  3SEU A;  3PUX E;  3DEL B;  4HCY A;  4LZ8 A;  4FIM A;  4X1B A;  1Y3N A;  2LAO A;  5HM4 B;  5I56 B;  1SD3 A;  1LAG E;  4O3C A;  2XXQ A;  3PPP A;  5CI5 A;  1XHY A;  1ATG A;  2F6G A;  3OO9 A;  3DP6 A;  1FTL A;  2OJT A;  3DP4 A;  3R26 A;  4LQ2 A;  3SEY A;  3VVD A;  3PPO A;  4JWO A;  4U4S A;  4F19 A;  5A5X B;  2YLN A;  4DCY A;  3K00 A;  4O3A A;  3C31 A;  2HEU A;  4U23 A;  1OLA A;  4WEP A;  3U93 A;  4K3F A;  1NH8 A;  2FNC A;  1MXW A;  2UVG A;  1QUL A;  2DE3 A;  3K2D A;  3TCG A;  3KG2 A;  3C35 A;  1MPC A;  3IO6 A;  3M8U A;  4HTG A;  1MQI A;  3W9V A;  2B65 A;  2F5X A;  3N5L A;  2NXO A;  5I2K A;  1S7Y A;  3RT8 A;  1CE2 A;  3VVE A;  4QSE A;  1N7W A;  1SYI A;  3O9P A;  4NF5 B;  5H8H A;  3PV0 E;  3T96 B;  2DOJ A;  4O3B A;  1A7L A;  3W9W A;  2UYF A;  1URG A;  2I6E A;  3MJN A;  1FQB A;  1LCF A;  3OO8 A;  4NF8 B;  2NUV A;  3KOT A;  3CR9 A;  4OER A;  1MM6 A;  2Y7R A;  2X7Q A;  5M2V A;  3PD8 A;  3K01 A;  3KJ7 A;  4NF4 B;  1DTZ A;  1AIV A;  5I2N A;  4I8C A;  3LBS A;  4ISU A;  4YKI A;  5F1Q A;  1ZIU A;  1QVS A;  3B6T A;  2UVH A;  3KGC A;  3OEK A;  3Q25 A;  4LUB A;  5EYF A;  1EZP A;  1MXV A;  4RK2 A;  2HCA A;  1MXX A;  3OO6 A;  3IO4 A;  3HV1 A;  4E0X A;  4R74 A;  1B52 A;  2XXY A;  1M5C A;  3KFM A;  3KN3 A;  3LR1 A;  2ONS A;  2FA7 A;  2OLB A;  2X7P A;  2HZK A;  1F9B A;  4IO5 A;  1VSO A;  4F3B A;  5I2N B;  5I84 A;  4NF4 A;  3VV5 A;  4KI0 E;  1B05 A;  1MXU A;  4POX A;  1MQD A;  2O84 X;  2QRY A;  4ZEB A;  2F34 A;  3CVG A;  5H8F B;  3FVG A;  1GVC A;  4EUO A;  1MH4 A;  2Q8J A;  3QAX A;  3ECR A;  4EXK A;  2F7A A;  3MP6 A;  1TFD A;  4OQO A;  4GOT A;  1M5F A;  2DQV A;  1EU8 A;  1EZ9 A;  4QFL A;  3CFL A;  1B3H A;  4JDF A;  3ZKK A;  1MDP 1;  4FEC A;  1B3E A;  3Q26 A;  5FTH A;  2NWJ A;  1A40 A;  5HPQ A;  1MY1 A;  2XXT A;  3IAZ A;  4G2Z A;  2P1S A;  4H1X A;  3ONM A;  4KR5 A;  4QSD A;  5CMC A;  3O6G A;  3ILT B;  4QFN A;  1VFE A;  4PFT A;  2H98 A;  4NWC A;  1CB6 A;  1TWY A;  1VE4 A;  4P0I A;  3T9V A;  1B7H A;  2NVU B;  2PYY A;  1OMP A;  4LA9 A;  3ILU B;  3KSJ A;  1B0L A;  1GR2 A;  3FIR A;  5JTY A;  3H03 A;  3IL1 B;  3T66 A;  4YMB A;  2M8C A;  4KPT A;  5ICQ A;  4NED A;  4GWO A;  1PC3 A;  2Y84 A;  3OEM A;  2O7U A;  3IB1 A;  3WAF A;  3VXC A;  3OXN A;  2XXI A;  4IY5 A;  3UOR A;  2ALU A;  4IGR A;  3E9X A;  1TXF A;  3RLF E;  5KZT A;  3VLU A;  2GRV A;  4I62 A;  4ZE9 A;  1URD A;  2XXX A;  4LON B;  2ESN A;  3T9X B;  2VP1 A;  2Q2C A;  3S2V A;  1B0H A;  3QXM A;  1WDN A;  4KYD A;  4OEV A;  2BJJ X;  3RTW B;  1SI1 A;  2H9B A;  3IOW A;  3O6I A;  4NE4 A;  3O2A A;  3QSL A;  1O64 A;  1I6A A;  3A09 A;  3IOT A;  3TFL A;  2H5Y A;  3HHG A;  4KFQ A;  1R9Q A;  4MBP A;  1FTO A;  2R9J A;  4H0W A;  4F3S A;  1QUK A;  1UTH B;  2I0C A;  5J1D A;  4NF6 B;  3PMV A;  1P1N A;  3OEL A;  1ELJ A;  3PUW E;  2XXH A;  4MFI A;  5CRY A;  1T0K A;  3FVN A;  4E0W A;  2WKY A;  4GLI A;  3L6H A;  4RNS A;  3PPQ A;  2G93 A;  2VOZ A;  3G3J A;  5TP9 B;  3UGW A;  3G7W A;  4G8H A;  4IB2 A;  4IO2 A;  4OZ9 A;  4PE5 B;  3K6W A;  1P99 A;  4C1U A;  5L9S A;  2DYX A;  1N0T A;  1FW0 A;  1MPB A;  1SW1 A;  1YAE A;  2I49 A;  3FAT A;  3FZV A;  4MLV A;  1EZO A;  3CFZ A;  1P1O A;  3VDF A;  4F18 A;  1M5D A;  4ESX A;  4GXS B;  3U8Q A;  5JEI A;  5DVI A;  2D3I A;  4POW A;  1N3W A;  4ECF A;  4NF5 A;  2Q89 A;  1MQG A;  4UA8 A;  2DVZ A;  2ZXT A;  4BDO A;  4NWD A;  3O28 A;  1NFT A;  3VLW A;  3K0V A;  3PUZ E;  4UAC A;  3C32 A;  4H6D A;  1ZBM A;  2V3Q A;  3GXA A;  3VLV A;  4LZ5 A;  2DXY A;  2H4I A;  5CMB A;  3I5O A;  2O7I A;  2PBW A;  4DZ1 A;  2RC7 A;  1JW5 A;  4G8M A;  1QUJ A;  3N94 A;  4LAT A;  4G4P A;  3SET A;  4NF6 A;  3AXF A;  2HAU A;  3FUZ A;  3TZA A;  5FTI A;  5IKB A;  1Q35 A;  3M3L A;  3HHF A;  4GQO A;  3SEX A;  1B5H A;  1NNK A;  4ND9 A;  1BP5 A;  1B5J A;  2PT2 A;  2QL3 A;  2Z8D A;  1FQC A;  2B3B A;  2IEE A;  3C4M A;  4N13 A;  4RK9 A;  4DDD A;  4YAH X;  4DLD A;  1LB8 A;  2Q9T A;  3FJ7 A;  2QPQ A;  3UP9 A;  2GHB A;  3KOS A;  4R9F A;  2RC9 A;  4NTL A;  1JVY A;  3RT6 B;  1LFI A;  2I4B A;  3B6W A;  2E0S A;  1Y3P A;  5CM6 A;  1LGB C;  3FGS A;  5F7V A;  3R7X A;  5DTB A;  1II5 A;  3RUM A;  5I57 A;  2O68 A;  1IXH A;  4BDM A;  1SQY A;  3V89 B;  2A5T B;  4R75 A;  4MF3 A;  1R1N A;  1NMU A;  2GHA A;  1MG1 A;  2I58 A;  2PMS A;  2ZNU A;  4TLM B;  4XXU A;  1OVT A;  2I0B A;  3BKI B;  4L17 A;  3TYH A;  3KJT A;  4PFU A;  1IQ7 A;  1DSN A;  3M3F A;  5K2Y A;  4BDR A;  5AE4 A;  3MP1 A;  4ZDM A;  4ZEK A;  5K2X A;  5AA4 B;  2OWS A;  3C34 A;  5B70 A;  2AL5 A;  3I3V A;  1SVX B;  2PVU A;  1MM7 A;  1DTG A;  2XXV A;  3IK6 B;  4HS7 A;  5AA2 A;  3D4C A;  1Q1K A;  1AH5 A;  1OLC A;  2UXA A;  3SDF A;  1SW2 A;  4G77 A;  4WXJ A;  3TEL A;  1N84 A;  2DP8 A;  2O1M A;  1ZLQ A;  1FTK A;  1R6Z A;  2XHD A;  4KQP A;  5LOM A;  4BDN A;  4WED A;  3K1M A;  3S9L C;  3PPN A;  1Z7N E;  1PB8 A;  3EQ1 A;  1XS5 A;  4YB6 A;  2XXP A;  3TPA A;  1UIU A;  1Z7M E;  3FD3 A;  1LCT A;  3PU5 A;  4YKK A;  2QS3 A;  3SKP A;  4FOR A;  4ZEC A;  2XXU A;  4JB7 A;  4R9G A;  1SI0 A;  3G3H A;  1KWH A;  4ZE8 A;  4F2O A;  2B3F A;  3OMB A;  1IZ1 A;  4YB7 A;  5I57 B;  3HPI A;  3GLB A;  4ZZE A;  3O29 A;  3HO7 A;  2I3V A;  2UVJ A;  4X48 A;  3WAE A;  1LFG A;  5KCJ A;  1QKA A;  4JBZ A;  1I6B A;  1XOC A;  5DT6 A;  2UYE A;  2ZYK A;  2V93 A;  5H8F A;  3Q27 A;  2CZL A;  4LZ7 A;  1M5E A;  3I6V A;  3MPK A;  3V83 A;  2O69 A;  1USY E;  4EDP A;  3JZJ A;  1JEV A;  4OET A;  1RYX A;  2AYS A;  4MLQ A;  1Y3Q A;  4QRZ A;  4TLL B;  1IXG A;  4HCW A;  2GH9 A;  3FXU A;  4PFW A;  4F2Q A;  2Y7I A;  5AA3 A;  5B7D A;  4ONY A;  4OTE A;  2UVI A;  4U2R A;  4Q0C A;  4F22 A;  1H43 A;  4XKR A;  4PFY A;  2DWI A;  3IB0 A;  4YIC A;  1NL5 A;  3UIF A;  5IAI A;  1Y1M A;  2NOO A;  3H6V A;  1B58 A;  1B4Z A;  1BTJ A;  1PDA A;  3TUS A;  2VHA A;  1D9V A;  5KCJ B;  4PQJ A;  5ITO A;  3GBB A;  3KEI A;  3Q29 A;  4R6H A;  3BFT A;  1Y9U A;  3MW0 A;  1IIT A;  1N7X A;  2VD2 A;  3FV1 A;  3O66 A;  5KDT A;  1MY0 A;  3RTF B;  3VFJ A;  2XD2 A;  4YKP A;  4DCX A;  3CSG A;  1NH7 A;  1FCK A;  3MP8 A;  4F1U A;  4NF8 A;  4F3G A;  4Q30 B;  2F36 A;  1D9Y A;  2OBG A;  3MZ1 A;  3BBR A;  2W7Y A;  3S4U A;  3QUJ A;  1B6H A;  3K02 A;  3P7I A;  1US5 A;  3H7M A;  4TOZ A;  4MH5 A;  4TQU Q;  3VE1 B;  2FYI A;  3QUF A;  1MDQ A;  4Z0I A;  5AA2 B;  2A5S A;  1HSJ A;  2ZYO A;  2Z22 A;  4F31 B;  2RC8 A;  5I2K B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...