3VXCA

Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
398
structure length
398
Chain Sequence
TITAMVYGDDAVKVQDKAASRFNASAEAKKANAKVKMERIPASDYPAKLRTAMGSPNAPDIFFNWGGGSIKAYKEAGQLVDLTDVIKSDEVLSTGFLPSVVAAGSLDGHEYGIPMRGMQPVLLFYNKSVFAEHKLTPPTTWDQLLDNVAKLKKAGVTPFALGGVEIWPELMWLEYLVDRIGGPQVFDKIRNGDASGWGDPAVLKAAQTVKQLVDEGAFGKGFSSVSYNNGGAPALLAKGKAGMHLMGSWEYSTQLGKFPDFAKKDLGWCAFPSFEGGAGDIRNVVGNPCNYWSVNARTGNKDGAIAFLRDCASEAYTKDLIDNGDVPTTTIAENMLDSSPNPEFAKFQYQLVQKAPNFTLSWDQAVDPDWQQPMLTEINKLFVGKSSPEQFVSALKGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Xylooligosaccharide-Binding Protein from Streptomyces thermoviolaceus OPC-520: Dramatic Conformational Change with Ligand binding
rcsb
source organism Streptomyces thermoviolaceus
molecule tags Sugar binding protein
molecule keywords Putative sugar-binding lipoprotein
total genus 145
structure length 398
sequence length 398
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vxcA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3vxcA02
2O6AA 3IORA 4HCWA 3USDA 1FTLA 4RPOA 1A7LA 1Y1ZA 2DWAA 3K00A 4Z0IA 3VFJA 3SETA 4F19A 4DZ1A 3GLBA 2VGQA 1OVTA 1LBCA 2I4BA 2FYIA 1CB6A 1MQHA 4OETA 1GV8A 3H06B 5H8NB 2ZYNA 5KDTA 1EH3A 4FIMA 3I6VA 5JEIA 4NF4A 4KPTA 3SEYA 2AL5A 5DT6A 3ECRA 1I69A 1ZTYA 5ICTA 4KD5A 2XXPA 4R6KA 4DXCA 4ONYA 3G7WA 3Q25A 2IA4A 1O7TA 3U72A 4N07A 1FQEA 3FJ7A 3TCHA 3JYRA 2F7CA 3OENA 4LZ7A 3MVZA 2HZKA 3CFLA 1FQBA 1QKAA 4IGRA 1BIYA 1II5A 3CFXA 1BKAA 2V84A 1JW1A 2DE2A 1MH4A 1LLSA 4H5GA 4H8JA 1IZ1A 4I62A 3ODBA 4LA9A 2AL4A 4MLQA 1PB7A 4LQ2A 5A5XA 4THIA 1B3EA 3PMVA 4DIGA 3LBSA 2F36A 1JW4A 3RLFE 4FE8A 1P99A 2A5TA 3FVNA 3K1MA 3HO7A 3O6IA 4O3AA 4OESA 4F39A 1ZU0A 3S9EA 3FJGA 4NF5A 3VXBA 3UK4A 3CR9A 3KOTA 1UTHB 2O84X 2F34A 1L5TA 4R6YA 1TFDA 3LC8A 5H8QA 4Q8RA 3CG3A 2H5YA 2VHAA 1XC1A 3O28A 2W7YA 2ZXTA 3R26A 4N6PA 5I59A 5LOMA 1POTA 2VOZA 3OEMA 4FEBA 4G68C 4GXSB 2NVUB 3SEXA 3HPIA 2DOJA 3VVFA 4YB6A 3U1OA 3DP6A 3E13X 4EF1A 4KFQA 5K2XA 3RY3A 3SEVA 4POXA 1TFAA 3SESA 4BDLA 3T9VA 2DVZA 3IB1A 5ITPA 1B7UA 1DMBA 1LGBC 3G3GA 1MPCA 3SDFA 3MP6A 1A54A 3CSBA 2D3IA 3H6WA 4EXKA 1H45A 2O7UA 1OQHA 3G3KA 3O6HA 1IIWA 4YKJA 3THIA 4EQBA 4H1XA 2X7PA 1RYXA 1XVXA 4PE5B 3IJXB 4YKKA 3K02A 3W15C 1MXZA 4GL8A 4HCYA 4KR5A 3P7IA 4XKQA 4XKPA 5CMBA 5DVJA 4BDQA 3VV5A 1MQIA 4ZEIA 2O51A 1I6BA 2HXWA 5EYFA 1ZBMA 3U94A 4FATA 1B5JA 4F2QA 3EHSA 3CFZA 3IOWA 1GVCA 3Q28A 4BDRA 2RINA 1B5IA 4G2ZA 3MBPA 4ZE8A 3TEPA 1FTOA 1HSEA 1IEJA 1WVJA 2ZYKA 3IK6B 3LSFB 3O2AA 4GRKA 4OWDA 1B1HA 3HN0A 1T0KA 1MM6A 4PFYA 1MY1A 4G8HA 1NH8A 2Q89A 1NNPA 4BDOA 5FTHA 4U4XA 1FQAA 3MUQA 3IL1B 4IO7A 3OO9A 2H25A 4NF6A 4OMBA 4OQOA 5AA4B 3FATA 2PMSA 1MY2A 1OLAA 4RA1A 1M5CA 1MG1A 1IXGA 3EHUA 4I8CA 1LB9A 4F1UA 3HHGA 1IUDA 1B3HA 2QL3A 5I2KB 3T93B 1Y4TA 1LAFE 1JNFA 4C1TA 1B0LA 5ELVA 2GH9A 3E3KA 4JB7A 3TPAA 5I59B 3S9MC 2GHBA 2LAOA 1MPDA 1QUJA 3G3IA 4GQOA 4LUBA 1UIVA 2DYXA 4ZE9A 1B1XA 2BJJX 3PPNA 3PPPA 3M3LA 1IQ7A 4FJPA 4GFRA 4GOTA 2XX7A 4OEVA 5AA2A 1FQFA 1MH3A 1Q35A 4O3CA 2HFBA 4OERA 5CBSA 3ILUB 1ELJA 4KHZE 4KI0E 3SEUA 3U92A 3KJTA 3RGYA 3V89B 4X1BA 3RN8A 2Q2CA 4NWCA 3TTNA 4F3BA 4DDDA 4QFOA 4R72A 4E0WA 3C36A 2GRVA 3FV2A 1CE2A 2I4CA 4IO2A 4PETA 2XXVA 2THIA 1GGGA 5CMCA 4F18A 5B7DA 3FGSA 4YKIA 1B58A 3KFMA 3KSXA 4IGTA 3M8UA 3IO4A 2ZMBA 4WEPA 2P0SA 1OQGA 1PC3A 4C1UA 3D4GA 1LAGE 3T96B 3KGCA 3PPRA 1NNKA 4JWYA 5TU0A 5AA1A 3I3VA 3EN3A 1FQCA 3K1NA 1Y1MA 2QSXA 3OXNA 3MP8A 4KYEA 5HPQA 3A3CA 4RXLA 1A40A 3DP4A 3PU5A 2GFEA 3FVKA 3GXAA 1H43A 4U22A 4HW8A 3RNNA 1B3FA 1H44A 4IY5A 5H8FB 5CI5A 3K2DA 5IAIA 3H6UA 2OZZA 2Y7KA 1MS7A 4OVJA 1M5EA 3DP8A 2Z8FA 3JV9A 5F7VA 1N7WA 1OLCA 3BFTA 4KYSA 2RCAA 3QAXA 2DVCA 3O9PA 3TZAA 2ANJA 1N3WA 1IXCA 3K0VA 3TTKA 3B7DA 4G8NA 3G3FA 3CVGA 5I56B 2E1SA 5BUUA 2PT2A 5DTBA 2RC7A 3KN3A 3ILTB 3K6XA 4YU0A 2XX8A 1R6ZA 1LFHA 3VE1B 4KCDA 1OMPA 1O63A 2QMXA 2XXUA 4NMYA 3RPWA 1B6HA 4FORA 2WKYA 1FQDA 3DLNA 4U1OA 1XT8A 1UIUA 3IOVA 1B32A 2GHAA 3W9VA 4ESWA 1MXXA 2YLNA 4JWOA 5DEXA 3KSJA 3CSGA 1IXHA 1JETA 3KN8A 4GVOA 4YMBA 2Z8DA 5L9MA 4ELPA 1M5BA 4RY1A 3JZJA 3PMXA 2FNCA 4PQJA 3IJOB 3O97A 3T9UA 4H6DA 2O69A 2Y7PA 5AA4A 3VXCA 1UTBA 4GXAA 1LFIA 1MY3A 2UYFA 4JSOA 2ONSA 3VLVA 2XXYA 3HV1A 4ZEKA 4JSDA 1B51A 3TTRA 1I6QA 2HEUA 4OZ9A 4QF9A 3ZS6A 4BLAA 3TYHA 5BWJA 3OEKA 4GD5A 3IB2A 2FA7A 4OTEA 3UORA 2V3TA 2REJA 4JBZA 2I49A 4ESXA 5AA2D 1A8EA 2XXXA 1B9JA 1H3DA 1OVBA 1URSA 1AH5A 4R74A 3RTFB 3N5LA 5I57A 4Q5TA 2P1SA 2DP8A 4MLVA 4G77A 2UVJA 3BFUA 2A5SA 4KYDA 4OEUA 2D5WA 3I5OA 2QS2A 3QUJA 1A8FA 1YPNA 4LVQA 1LSTA 1SI0A 5H8SA 5H8FA 3KOSA 4DE8A 3O6GA 2ZNSA 1LCTA 4M4GA 5L9SA 3PV0E 5CRYA 3FZVA 3S4UA 3TAJA 5TP9B 1WDNA 4QFNA 2O7IA 4K3FA 3TCFA 4NWDA 4R9FA 4OENA 1ZMGA 3FVGA 4GLIA 4EQ7A 4OFOA 3LSLA 1D3KA 3S2VA 4OYVA 2OK2A 4R2BA 1I6AA 3E9XA 4RNSA 1R9LA 3IOUA 2PT1A 2I0CA 3PUYE 4HS7A 5CBRA 1YAEA 2I0BA 3PUXE 3KBRA 4F2OA 3MW0A 4LONB 1N7XA 5H8HB 1US5A 5KCJA 4BDMA 4DCXA 2XXWA 4RPNA 5M2VA 1JEVA 3R7XA 3VLUA 2V3UA 3FD3A 4HTGA 4Q0CA 4YB7A 4IO4A 1USYH 1MPBA 1GTKA 1VSOA 1QKBA 2QS3A 2IEEA 3HCQA 2PBWA 2QS4A 3MQ9A 3FV1A 1DTGA 3MZ1A 4G68B 4MH5A 5CMMA 3SEWA 3C31A 4F31B 1FTJA 4WXJA 2YPNA 4N13A 4NF6B 3G3JA 3K1PA 1SI1A 5TPAA 2CMOA 3CG1A 1BLFA 3Q27A 4XKRA 3VVEA 4NF8A 5B70A 1S9TA 1POY1 1D9VA 2REGA 2ZYOA 3WAEA 4MF3A 2HQ0A 3UA8A 4U4SA 3B6QA 4GL0A 1Q1KA 4ZDMA 1QJMA 3A09A 1MDP1 3C9HA 1JEUA 4XKNA 3K6VA 4O3BA 4MBPA 3IR1A 3UP9A 2V3QA 4EXLA 1EZPA 1ATGA 1R1NA 4ZS9A 3ZKLA 4F29A 3CI8A 3T66A 4P11A 2NUVA 2VD2A 3N94A 2NXOA 2P2AA 5CM6A 1MXYA 4AB6A 3MVXA 2I3WA 4GF8A 4UACA 1TXFA 4Q30B 4WKMA 2G29A 1A99A 5FHMA 1M5FA 1P1NA 2OJTA 2H99A 4FECA 3PMWA 4R9GA 1EU8A 1MY0A 1NMUA 3TODA 1USYE 2UXAA 5I58A 3T22A 5KDTB 4JDFA 3TFLA 1LAXA 1MXWA 3H6VA 4QHQA 4QSDA 5KCJB 3TUSA 5JK4A 4FAJA 1LB8A 2QJEA 2XD2A 2XX9A 3OSRA 4DXUA 1SDXA 1QUIA 2UYEA 4X48A 2B3FA 4H8IA 2NWJA 1VFDA 3K6UA 3UIFA 4DXBA 3M3KA 5AA2B 3B6TA 4U23A 1MQJA 4E0XA 1XVYA 4POWA 3MVYA 1JVXA 2AIXA 2OBGA 4QFPA 3V83A 2H4IA 3QK6A 2ZYMA 3RQTA 3RT8A 3Q26A 1MQGA 1ANFA 2F78A 1SVXB 4EDPA 3CIJA 4QSEA 5I2KA 3H6TA 2UVGA 4P0GA 5TPAB 5CC2A 2F6GA 1DTZA 4NF8B 3BKIB 3C33A 4U1ZA 4XIGQ 4YZZA 1M5DA 2DWJA 2RKMA 1NH7A 2ONRA 1N84A 1H76A 2Q88A 1JW5A 2OWSA 1PEBA 1B40A 5DVFA 4L17A 5F1QA 3TTLA 1DSNA 2X26A 4OXVA 1LAHE 1VE4A 2HCAA 4EQ9A 5ISUA 1P1UA 1URDA 4ELOA 3PPQA 1S50A 3KN7A 1MM7A 1PBQA 1YTVA 4NEDA 3TKDA 2DWHA 1FW0A 1B52A 3QIMA 3IAZA 3TCGA 4ELQA 1NL5A 3C34A 3AXFA 1URGA 4R2FA 4IY6A 4OHNA 4PFUA 4Z7EA 1NFTA 2B65A 3IOTA 2DE3A 2Y7IA 3S9NC 3TMGA 3GBAA 3RTWB 4ZEBA 3GBBA 1B3LA 5DEXB 2QPQA 4LQ5A 1N0TA 1OIBA 2F35A 5I2NB 1ZIUA 3RT6B 4H65A 1QW0A 4R75A 4RJZA 3MAMA 3SERA 4X1DA 1IITA 2R71A 4M1VA 2Y84A 5JTYA 3LSXA 3MVWA 3OOAA 3T9HB 3VVDA 5I56A 1GR2A 4F3SA 3Q29A 1FTKA 4R73A 1LBBA 3GZGA 4QFKA 5DVIA 3V5AA 5EHMA 2ZNUA 4YB5A 5CMKA 1PB9A 2UVIA 3G3HA 3IO6A 4GIZA 3MPLA 3QUFA 4ZEDA 1AIVA 3MPKA 3DELB 2OWTA 2X7QA 1XS5A 1RKMA 2AYSA 3IB0A 4MFIA 4LZ8A 4UA8A 1QUKA 3OSQA 2OLBA 3OO8A 4TLMB 5ITOA 1Y3PA 1ZKBA 3N26A 3TQWA 1BP5A 4RYAA 4R6HA 4F3GA 1IXIA 4ZEFA 2Q8JA 1N04A 4IO3A 2ESNA 1RYOA 1PB8A 2H98A 5AA3A 3OELA 3C4MA 1MQDA 2D21A 2O1LA 5FHNA 3FIRA 2A5TB 1D9YA 1P1WA 2F8DA 2YJPA 3H03A 1MRPA 1UTBB 3O66A 3TTMA 2V93A 4XXUA 3OO6A 1B7HA 4G8MA 4GWOA 1KWHA 5AE4A 1NNFA 2O68A 4QRZA 1Y20A 2RC9A 4PFWA 3PGFA 1F9BA 1VFEA 4PFTA 1HSJA 1SQYA 1TWYA 3C35A 2F7AA 2KLFA 2Z22A 3VLWA 2VP1A 4NTLA 3O29A 1A55A 2O1MA 4ZZEA 1B46A 3EHTA 1WODA 1ZLQA 2CZLA 4YAHX 1US4A 5K2YA 4ISUA 3BBRA 1HSLA 1MXVA 1YCJA 3FUZA 3N6UA 3FXQA 3PUVE 3U93A 4ZECA 5J1DA 3L6HA 1Z7ME 4TOZA 5I84A 2I58A 2ALUA 3KG2A 2Q2AA 4X9TA 3D4CA 3UN6A 1AL3A 5HM4B 3CRBA 2XXQA 2NOOA 3N6TA 4XTCQ 1J1NA 3U8QA 3MZ9A 2RCBA 4OFJA 4F1YA 3IX1A 2HAUA 4IO6A 2G93A 4WEDA 5TP9A 3MC2A 2DWIA 2OCUA 3EF7A 3RUMA 1SW5A 2HAVA 2RC8A 5L8DA 1P1QA 1SYHA 3MZBA 4G4PA 2QS1A 4ZZAA 4NE4A 4EUOA 2RF1A 3LR1A 1FCKA 1EZ9A 1XOCA 3FXRA 4U2RA 2VD3A 1SW2A 3KJ7A 1SW1A 1LCFA 1DOTA 1XHYA 2DXRA 4TLLB 2I3VA 2XXTA 3ZKKA 2DS9A 1MDQA 3MP1A 3ONMA 4RK9A 3TELA 5L9OA 4RK2A 1FTMA 2F5XA 5EHSA 4ELRA 1P1OA 3HSTA 1UQWA 2E0SA 5IKBA 4OFLA 1Y9UA 1MXUA 4G68A 4NF4B 2HZLA 3KZGA 1Z7NE 3F11A 2PYYA 4BDNA 4ND9A 1B4HA 1SW4A 4KCCA 1Y4CA 4IO5A 1B0HA 3QXMA 3OD7A 2DE4A 3A3UA 3PUWE 4JXIA 1Y3NA 3B6WA 4IB2A 4QSCA 3SKPA 3TQLA 3PUZE 2PX1A 3PPOA 1TT1A 3H7MA 1B05A 5JTYB 4H0WA 1N76A 2Z23A 5HBCA 4LZ5A 1VR5A 3C32A 2F6PA 1JVYA 3W9WA 5H8QB 4FEDA 2B3BA 2DXYA 3H4ZA 1NKXA 2Y7RA 3FASA 4YICA 2DQVA 5H8HA 4F22A 1QULA 4P0IA 5I2NA 1R9QA 2XD3A 1S7YA 4EF2A 2F7BA 4YKPA 2XXIA 1SD3A 1MY4A 2Z8EA 3L6GA 3FJMA 3KEIA 4LP2B 3ZSFA 3K01A 1B3GA 4YMAA 1EZOA 5FHOA 1ZJLA 2F97A 2XHDA 3H3GA 4H67A 3EPEA 3FVOA 3LUYA 4DLDA 2M8CA 3DM0A 3HHFA 5A5XB 2QMWA 5ICQA 4F1VA 2ONKE 5DYHA 3T9XB 5KZTA 3FXUA 3S9LC 3EQ1A 4H5FA 1QVSA 4U21A 1O64A 4DCYA 3WAFA 2QRYA 3UGWA 3OO7A 1BTJA 2Q9TA 2I6EA 3K4UA 1B5HA 3M3FA 3QYTA 1D4NA 3PD9A 4I1DA 3V8XB 5H8NA 3OMBA 1SBPA 5I58B 1UTHA 1NNTA 2H9BA 3VDFA 4NF5B 5I57B 2UVHA 2XXRA 1B2HA 4PP0A 2PVUA 1N3XA 4QFLA 1DPPA 2ZNTA 1LFGA 4JWXA 4C0RA 1PDAA 1SYIA 4ECFA 2XXHA 4KQPA 2V25A 3MWBA 4TQUQ 1PBPA 3TDJA 2R9JA 2Y7WA 3R6UA 3K6WA 2DSFA 2I48A 1B4ZA 3QSLA 1JQFA 4LATA 2ABHA 4AB5A 3MJNA 2R6GE 1AMFA 4I9DA 1Y3QA 1B7ZA 3LSWA 3PD8A 5FTIA 3E4RA 4AQ4A 4F3PA 1AOVA 1DPEA
chains in the Genus database with same CATH superfamily
3USDA 1A7LA 1Y1ZA 3K00A 4Z0IA 3GLBA 2VGQA 5H8NB 4GWUA 4PTKA 1EH3A 5JEIA 4O94A 4KD5A 4DXCA 2IA4A 3TCHA 3FJ7A 3JYRA 2F7CA 4X04A 2HZKA 3CFLA 2V84A 1MH4A 1LLSA 4GX6A 1PB7A 4DIGA 3A29A 3LBSA 5IZ3B 2A5TA 5J16A 3FJGA 4NF5A 2F34A 3R26A 2VHAA 5LOMA 3O28A 2W7YA 2ZXTA 4G68C 2NVUB 4NX1A 4KFQA 4PAKA 5K2XA 3SESA 4BDLA 3IB1A 1DMBA 1LGBC 3G3GA 1MPCA 3SDFA 2D3IA 3O6HA 3QMFA 4YKJA 4H1XA 2X7PA 4O7IA 4PE5B 4YKKA 1MXZA 4HCYA 4KR5A 1FRPA 1MQIA 1LBVA 4ZEIA 5EYFA 1B5JA 1GVCA 4G2ZA 4ZE8A 1IEJA 1WVJA 1RDZA 3HN0A 4PFYA 1MY1A 4GWZA 1RDYA 2Q89A 4IO7A 4OMBA 2H25A 5IZ1A 4N17A 1MG1A 2DDKA 1YXIA 2QL3A 5I2KB 3T93B 5IZ3A 1JNFA 3FBPA 4MIJA 2LAOA 1QUJA 3PPNA 4OEVA 4GOTA 2FHYA 1FQFA 4XF5A 4O3CA 4NWCA 4F3BA 1NV4A 2GRVA 3FV2A 4PETA 5CMCA 2QVUA 5B7DA 1DCUA 4IGTA 3M8UA 2ZMBA 3D4GA 5TU0A 5AA1A 1DK4A 3K1NA 2QSXA 5LDZA 1A40A 3DP4A 3FVKA 4HW8A 1B3FA 4IY5A 4JVCA 2Y7KA 2DVCA 2ANJA 3G3FA 2E1SA 4PFRA 2RC7A 3ILTB 3V83A 4NQ8A 2PFZA 1XT8A 1UIUA 3IOVA 1B32A 1MXXA 3CSGA 4QBAA 4ELPA 2XWKA 3JZJA 3O97A 5AA4A 1UTBA 1LFIA 1MY3A 2UYFA 5BWJA 4OZ9A 1FSAA 3TYHA 3OEKA 4GD5A 3IB2A 5EQAA 3LUZA 1D9QA 2REJA 4ESXA 1A8EA 1H3DA 2GQ1A 3RTFB 3N5LA 1IMAA 1A8FA 4LVQA 1SI0A 3O6GA 1LCTA 3PV0E 4NN3A 4K3FA 4NWDA 1QGXA 1D3KA 3LSLA 4MNIA 3IOUA 5CBRA 1YAEA 5H8HB 4MX6A 4DCXA 3VLUA 3FD3A 4HTGA 4Q0CA 1USYH 2R8TA 2WBDA 3V5AA 1QKBA 1FTJA 3G3JA 1SI1A 5TPAA 4NF8A 3WAEA 3UA8A 4ZDMA 2Q74A 1MDP1 3C9HA 4EXLA 2V3QA 1R1NA 4ZS9A 3T66A 4P11A 1FBFA 3N94A 5CM6A 1MXYA 2HPGA 2I3WA 1TXFA 4WKMA 5EQ8A 5FHMA 1M5FA 1P1NA 1NMUA 1USYE 3T22A 3TFLA 3H6VA 5KCJB 2QJEA 2UYEA 2B3FA 2NWJA 3UIFA 1VFDA 2KR0A 4E0XA 2OBGA 4QFPA 4I3EA 3Q26A 3CIJA 4QSEA 5I2KA 5CC2A 1DTZA 4NF8B 4XIGQ 2RKMA 4FAJA 2ONRA 1N84A 5F1QA 3TDJA 1JW5A 2FVZA 1FBCA 2X26A 4EQ9A 5ISUA 4ELOA 3KN7A 1PBQA 2DWHA 1B52A 4ELQA 3IAZA 4R2FA 3E79A 1NFTA 3IOTA 1N0TA 1Q9DA 3KC0A 4R75A 4RJZA 3SERA 4O7MA 4X1DA 1IITA 4GWXA 1KZ8A 3T9HB 1YZ0A 2UVIA 4GIZA 3MPLA 3MPKA 3DELB 2AYSA 4LZ8A 5ITOA 3SZPA 3N26A 4F3GA 1IXIA 2ESNA 3OELA 3C4MA 2A5TB 1UTBB 1KWHA 2O68A 4QRZA 1VFEA 2F7AA 3VLWA 3O29A 2CZLA 1HSLA 1NV1A 3FUZA 4ZECA 5J1DA 2Q2AA 3UN6A 3D4CA 1AL3A 4XTCQ 1J1NA 2ZZWA 2RCBA 4OFJA 3IX1A 5TP9A 1FJ9A 2DWIA 2OCUA 3MC2A 1P1QA 4ZZAA 2QS1A 2QVRA 4EUOA 3S2VA 1EZ9A 3FXRA 1SW2A 3KJ7A 4TLLB 3ZKKA 1XHYA 2DS9A 3MP1A 3ONMA 5L9OA 1NV5A 1UQWA 1Y9UA 3F11A 4OVSA 4ND9A 1SW4A 4IO5A 1B0HA 2PCRA 2DE4A 3PUWE 2PX1A 3H7MA 1B05A 4N6KA 3BIHA 4H0WA 1IMEA 1VR5A 5H8QB 2B3BA 2DXYA 3H4ZA 4YMAA 2Y7RA 3FASA 4N91A 4F22A 1S7YA 4P1EA 1SD3A 3L6GA 3FJMA 3RPLA 4LP2B 2Y5LA 3LUYA 4NG7A 3T0JA 3EQ1A 4DCYA 1BTJA 2Q9TA 3QYTA 1B5HA 1SBPA 5I57B 4PP0A 2PVUA 4GX4A 2R9JA 4P3LA 2V4CA 1AMFA 4N6DA 4F3PA 2FIXA 3IORA 2DWAA 3SETA 4F19A 1LBCA 1NV3A 2I4BA 2FYIA 1CB6A 1MQHA 5KDTA 2ZYNA 4FIMA 2FBPA 2AL5A 3KC1A 5ICTA 2XXPA 4ONYA 3Q25A 4N07A 2VPOA 4LZ7A 1G0HA 3T9UA 3W15C 1BIYA 4NF4A 3CFXA 4JVIA 2AL4A 4LQ2A 5A5XA 3PMVA 2WYKA 1JW4A 4FE8A 3FVNA 3K1MA 3S9EA 1ZU0A 5I57A 3VXBA 3LC8A 5I59A 1XC1A 2VOZA 4GXSB 5I5PA 3RY3A 4POXA 1FBEA 3MP6A 3CSBA 4EXKA 1H45A 2XWVA 3G3KA 1RDXA 1RYXA 1XVXA 3IJXB 5CMBA 2CZIA 3P7IA 3U94A 2HXRA 1EYJA 1B1HA 4BDOA 3IL1B 4P56A 4OQOA 1OLAA 1M5CA 1IXGA 4PBQA 1B0LA 5ELVA 5ET8A 2GH9A 5I3SA 4I3YA 2GHBA 1UIVA 1B1XA 4GFRA 3PPPA 2XX7A 4MAGA 5CBSA 1ELJA 4KI0E 3SEUA 3V89B 3RGYA 3HFUA 4E0WA 3C36A 1KA0A 1CE2A 2P3NA 4IO2A 2THIA 4YKIA 3IO4A 4WEPA 2P0SA 1YYZA 3T96B 3KGCA 4AS5A 1NNKA 3I3VA 3EN3A 3OXNA 5HPQA 4RXLA 4DI4B 1H43A 5IAIA 5CI5A 3K2DA 4O8MA 2OZZA 1M5EA 5F7VA 3BFTA 1OLCA 2RCAA 3O9PA 3TZAA 1IXCA 3K0VA 3B7DA 5I56B 1LFHA 4YU0A 1O63A 1B6HA 2WKYA 4H45A 4KXPA 4JWOA 5DEXA 1BK4A 3KBZA 1M5BA 2O69A 3VXCA 4GXAA 3VLVA 2XXYA 3HV1A 3PTYA 3TTRA 2HEUA 3ZS6A 4QF9A 5F24A 2FA7A 4JBZA 4MNCA 1OVBA 4MLVA 4G77A 2UVJA 3BFUA 2A5SA 4KYDA 4OEUA 1AWBA 3I5OA 5H8SA 3U65A 3IFAA 5CRYA 1FPJA 1IMCA 3TAJA 4QFNA 2O7IA 5I2NA 1FPBA 1KA1A 4OYVA 4R2BA 2PT1A 2I0CA 3KBRA 3MW0A 5KCJA 2XXWA 4GX3A 1JEVA 4YB7A 1FPEA 3HCQA 4MH5A 3SEWA 4F31B 4WXJA 3CG1A 1BLFA 3Q27A 4XKRA 3VVEA 1POY1 2HQ0A 3B8BA 1QJMA 1JEUA 4XKNA 4O3BA 4MBPA 3IR1A 3UP9A 4F29A 2NUVA 2XXKA 4XFEA 4Q30B 1A99A 2H99A 3PMWA 5EQ7A 1EU8A 3TODA 5ET6A 1MXWA 2XD2A 1SDXA 4X48A 2VT5A 3K6UA 5AA2B 3B6TA 1XVYA 3RYDA 2H4IA 3QK6A 3RQTA 3RT8A 1MQGA 3H6TA 4P0GA 2CEXA 1NH7A 5DVFA 1PEBA 4L17A 3TTLA 1VE4A 1P1UA 1URDA 1S50A 1MM7A 3QIMA 2XWIA 1NL5A 3AXFA 2PFYA 3RTWB 1NV2A 2BJIA 2F35A 1ZIUA 3RT6B 4H65A 1FBPA 3LSXA 1GR2A 4F3SA 3Q29A 4R73A 5DVIA 1NV0A 5EHMA 4YB5A 5EYHA 3G3HA 4ZEDA 3QUFA 5EYGA 1RKMA 2OLBA 1Y3PA 1ZKBA 4RYAA 4R6HA 1N04A 1RYOA 5AA3A 5FHNA 1MQDA 2D21A 2O1LA 4OVRA 3OO6A 1Y20A 1F9BA 4PGPA 1TWYA 2Z22A 2VP1A 4QXDA 1WODA 4N81A 5K2YA 1NV7A 4ISUA 1Z7ME 4TOZA 4X9TA 1FBHA 3N6TA 3U8QA 4WEDA 2HAUA 3EF7A 1SW5A 5L8DA 4G4PA 5IZZA 4NE4A 1XOCA 3MYUA 3TELA 4OVTA 5EHSA 3ROJA 1P1OA 2MKZA 2E0SA 1MXUA 4NF4B 2HZLA 3KZGA 1FJ6A 4BDNA 1B4HA 1EYKA 3TQLA 3B6WA 4IB2A 4QSCA 4PAFA 5HBCA 4NAPA 2VPNA 3W9WA 1NKXA 4P0IA 2XD3A 4EF2A 4YKPA 5FHOA 1ZJLA 4H67A 2XHDA 5A5XB 2QMWA 2ONKE 5DYHA 3T9XB 4U21A 1O64A 5T3JA 2QRYA 3OO7A 4XEQA 3PD9A 5I58B 3VDFA 4NF5B 2XXRA 4LN5A 1B2HA 2V25A 2DSFA 3QSLA 2ABHA 4AB5A 3MJNA 2R6GE 5FTIA 1B7ZA 3LSWA 3PD8A 4AQ4A 4MHFA 4N15A 4PDHA 5I7IA 1DPEA 2O6AA 1FTLA 4RPOA 3VFJA 1OVTA 3FXBA 1GV8A 3I6VA 4KPTA 3SEYA 5DT6A 3G7WA 3U72A 3OENA 3MVZA 4OWDA 1FQBA 1QKAA 4IGRA 1BKAA 1JW1A 4LA9A 1IZ1A 3ODBA 4MLQA 1LBWA 2F36A 1P99A 4F39A 3O6IA 1L5TA 4R6YA 5H8QA 4Q8RA 4N6PA 1VDWA 1POTA 4FEBA 3SEXA 3HPIA 3VVFA 4YB6A 3DP6A 3E13X 4EF1A 4HE1A 3SEVA 5ESYA 1TFAA 3T9VA 2DVZA 5ITPA 1A54A 3H6WA 1OQHA 3THIA 3K02A 4BDQA 4XKPA 3VV5A 2O51A 4FATA 3EHSA 3CFZA 3IOWA 4GWYA 3Q28A 2RINA 1B5IA 3MBPA 4N8YA 1FTOA 1MM6A 4U4XA 2ZZXA 4NF6A 2PMSA 4RA1A 3EHUA 1LB9A 5FBPA 1IUDA 1B3HA 1Y4TA 1LAFE 4GBWA 3E3KA 4JB7A 5I59B 4ZE9A 4LUBA 3S9LC 2BJJX 3M3LA 4FJPA 1IMBA 1MH3A 2HFBA 3ILUB 4X8RA 4KHZE 3KJTA 4MCOA 4PGNA 3RN8A 4QFOA 4R72A 4F18A 1GGGA 3FGSA 3KFMA 3KSXA 4C1UA 1OQGA 1LAGE 3PPRA 1FQCA 1Y1MA 4KYEA 2WEFA 3BIGA 3RNNA 1H44A 1K9ZA 3DP8A 2Z8FA 3JV9A 1N7WA 4KYSA 4GWWA 1N3WA 3TTKA 3CVGA 2PT2A 5DTBA 3KN3A 4DI3D 1R6ZA 4KCDA 1OMPA 2QMXA 1NI9A 4NMYA 4FORA 1FQDA 3DLNA 3W9VA 2YLNA 3KSJA 1IXHA 1JETA 4YMBA 3PMXA 2FNCA 3IJOB 4JSOA 4ZEKA 1B51A 4BLAA 5AA2D 1B9JA 4MEVA 1URSA 4Q5TA 2P1SA 2DP8A 2B4LA 2D5WA 3QUJA 3ISPA 1LSTA 4DE8A 3S4UA 3FZVA 3TCFA 4R9FA 1DBZA 4RNSA 1R9LA 4HS7A 2I0BA 4IR8A 4LONB 1N7XA 4BDMA 2FIEA 5M2VA 3R7XA 1MPBA 1VSOA 3MQ9A 3UORA 2IEEA 3MZ1A 3FV1A 1DTGA 5CMMA 5ET5A 2YPNA 4N13A 3K1PA 2CMOA 1S9TA 4U4SA 4GL0A 1Q1KA 3A09A 1EZPA 1ATGA 3ZKLA 2WBBA 3CI8A 2NXOA 4AB6A 3MVXA 4GF8A 4UACA 4HE0A 4R9GA 1MY0A 4PFBA 5I58A 2UXAA 5KDTB 2B4MA 2ZZVA 1LB8A 3OSRA 4DXUA 1QUIA 5A5LA 4H8IA 4DXBA 3M3KA 2AIXA 4NHBA 4HE2A 1SVXB 2UVGA 3BKIB 4YZZA 2JJKA 1M5DA 2V3TA 2DWJA 1H76A 2Q88A 2OWSA 1B40A 3PPQA 3TCGA 4IY6A 4PFUA 4Z7EA 2DE3A 2Y7IA 4NGUA 3TMGA 3S9NC 4ZEBA 2QPQA 4LQ5A 1OIBA 1XI6A 1QW0A 1NV6A 3MAMA 2KQZA 2R71A 5JTYA 3MVWA 2CZHA 3OOAA 3VVDA 1FTKA 4QFKA 2ZNUA 5CMKA 1PB9A 3IO6A 1AIVA 2OWTA 2P3VA 2X7QA 3IB0A 4UA8A 4TLMB 1IMFA 3TQWA 1BP5A 4AS4A 2Q8JA 4IO3A 2H98A 1P1WA 2F8DA 2YJPA 3H03A 3TTMA 1MRPA 3B50A 2V93A 4XXUA 4GWOA 1NNFA 2RC9A 4PFWA 4PAIA 4PFTA 1HSJA 3C35A 2KLFA 1JP4A 4NTLA 1A55A 1B46A 3EHTA 1ZLQA 4YAHX 1US4A 1MXVA 3PUVE 3FXQA 3L6HA 2I58A 2ALUA 3KG2A 1NUYA 3CRBA 4F1YA 5AA4B 5I2NB 3RUMA 2G93A 3MZBA 1FBDA 4XKQA 4U2RA 3LR1A 1FCKA 1LEVA 5H8HA 1SW1A 1LCFA 1DOTA 2I3VA 4PBHA 2F5XA 4ELRA 5IKBA 4OFLA 4G68A 2PYYA 4KCCA 1Y4CA 3QXMA 2XA5A 3PUZE 1TT1A 3E78A 1N76A 4LZ5A 3C32A 1JVYA 4FEDA 4YICA 2DQVA 1R9QA 1LBXA 2XXIA 2Z8EA 4PCDA 4DLDA 3EPEA 3DM0A 5ICQA 5KZTA 4H5FA 4JVDA 1LBZA 3K4UA 4I1DA 3V8XB 4MJOA 5H8NA 3OMBA 1UTHA 1NNTA 2UVHA 1N3XA 1DPPA 1NUXA 4C0RA 1PDAA 1SYIA 4KQPA 1PBPA 3K6WA 1B4ZA 4LATA 3IFCA 4I9DA 3E4RA 4HXVA 4HCWA 4DZ1A 4NF0A 4OETA 3H06B 3ECRA 1I69A 1ZTYA 4MNPA 4R6KA 1LBYA 1O7TA 1FQEA 1II5A 4I62A 2DE2A 4H5GA 4H8JA 4TQUQ 4THIA 1B3EA 3RLFE 3HO7A 4O3AA 4OESA 4OVPA 3UK4A 3CR9A 3KOTA 1UTHB 2O84X 4PF8A 1TFDA 3CG3A 2H5YA 2Y5KA 3OEMA 2DOJA 3U1OA 1FPGA 1B7UA 2O7UA 1IIWA 4EQBA 1K9YA 4GL8A 5DVJA 1I6BA 1CNQA 2HXWA 1ZBMA 4F2QA 3MSTA 4BDRA 3TEPA 1HSEA 3IK6B 3LSFB 2ZYKA 3O2AA 4GRKA 1T0KA 3GYYA 4G8HA 1NH8A 1NNPA 5FTHA 1FQAA 3MUQA 3OO9A 3FATA 1MY2A 1FPIA 4I8CA 4F1UA 3HHGA 2QVVA 4C1TA 4UABA 3TPAA 1MPDA 3G3IA 4GQOA 2DYXA 1IQ7A 5AA2A 1Q35A 4OERA 3U92A 4X1BA 2Q2CA 3TTNA 3NOHA 4DDDA 2WX9A 2I4CA 2XXVA 1B58A 3T1BA 1PC3A 4JWYA 3MP8A 3A3CA 3PU5A 2GFEA 3GXAA 4U22A 5H8FB 3H6UA 1MS7A 4OVJA 4PDDA 1FBGA 3QAXA 1G0IA 4G8NA 5BUUA 3K6XA 2XX8A 3VE1B 3RPWA 3RPLB 2XXUA 4U1OA 2GHAA 4ESWA 4GVOA 3KN8A 2Z8DA 5L9MA 4RY1A 1INPA 4PQJA 4H6DA 2Y7PA 2ONSA 4JSDA 1I6QA 4OTEA 2I49A 2XXXA 5IM2A 1AH5A 4R74A 3D1RA 1FPFA 2QS2A 1YPNA 5H8FA 4P8BA 3KOSA 2OWZA 2ZNSA 4M4GA 5TP9B 1WDNA 4OENA 1ZMGA 3FVGA 4GLIA 4EQ7A 4OFOA 2OK2A 1I6AA 3E9XA 3PUYE 4F2OA 3PUXE 1US5A 5ET7A 4RPNA 2V3UA 2QFLA 4IO4A 1GTKA 2QS3A 4N4UA 4G68B 5L9SA 2PBWA 2QS4A 3C31A 4NF6B 4G61A 4PC9A 5B70A 1D9VA 2REGA 2ZYOA 2F3DA 4MF3A 3B6QA 4OVQA 5IGAA 5DW8A 3K6VA 2OX3A 2F3BA 2VD2A 2P2AA 4FBPA 2G29A 2OJTA 4FECA 4JDFA 1LAXA 1IMDA 4QHQA 4QSDA 3TUSA 5JK4A 2XX9A 2Q8MA 4U23A 1MQJA 4POWA 3MVYA 1JVXA 2L5VA 2ZYMA 1ANFA 2F78A 4N8GA 4EDPA 5TPAB 2F6GA 3C33A 4U1ZA 4PF6A 1DSNA 4OXVA 1LAHE 2HCAA 1YTVA 4NEDA 3TKDA 1FW0A 3C34A 1URGA 1FPKA 3CHGA 4OHNA 2B65A 3GBAA 3GBBA 1B3LA 5DEXB 2CZKA 4M1VA 2Y84A 5I56A 4PE3A 1LBBA 3GZGA 4P47A 4PFIA 2CEYA 1XS5A 4MFIA 1QUKA 3OSQA 3OO8A 1FTAA 3LV0A 5LTCA 4ZEFA 1EYIA 1PB8A 3FIRA 1D9YA 3O66A 1B7HA 4G8MA 2WYPA 5AE4A 1NUWA 1FPDA 3PGFA 1SQYA 2O1MA 1SPIA 4ZZEA 3BBRA 1YCJA 3N6UA 3U93A 4I40A 4OANA 5I84A 5HM4B 2XXQA 2NOOA 3MZ9A 3S9MC 4IO6A 1NUZA 2HAVA 2RC8A 1SYHA 5EQ9A 2RF1A 1FPLA 2VD3A 2DXRA 4GBVA 4H46A 2XXTA 3EKIA 4GWSA 4OA4A 1MDQA 4RK9A 4RK2A 1FTMA 3HSTA 2HHMA 1Z7NE 2XWOA 3OD7A 3A3UA 4JXIA 3SKPA 1Y3NA 3PPOA 5JTYB 2Z23A 2F6PA 4MMPA 1QULA 4P1LA 2F7BA 1MY4A 3KEIA 3ZSFA 3K01A 1B3GA 1EZOA 2F97A 3H3GA 3FVOA 2M8CA 3HHFA 4F1VA 3FXUA 1QVSA 3WAFA 3UGWA 2I6EA 3M3FA 1D4NA 4P9KA 2H9BA 4QFLA 4JWXA 2ZNTA 1LFGA 4ECFA 2XXHA 3MWBA 2Y7WA 3R6UA 2I48A 1JQFA 1Y3QA 1AOVA
chains in the Genus database with same CATH topology
2O6AA 3IORA 4HCWA 3USDA 1FTLA 4RPOA 1A7LA 1Y1ZA 2DWAA 3K00A 4Z0IA 3VFJA 3SETA 4F19A 4DZ1A 3GLBA 2VGQA 1OVTA 1LBCA 2I4BA 2FYIA 1CB6A 1MQHA 4OETA 1GV8A 3H06B 5H8NB 2ZYNA 5KDTA 1EH3A 4FIMA 3I6VA 5JEIA 4NF4A 4KPTA 3SEYA 2AL5A 5DT6A 3ECRA 1I69A 1ZTYA 5ICTA 4KD5A 2XXPA 4R6KA 4DXCA 4ONYA 3G7WA 3Q25A 2IA4A 1O7TA 3U72A 4N07A 1FQEA 3FJ7A 3TCHA 3JYRA 2F7CA 3OENA 4LZ7A 3MVZA 2HZKA 3CFLA 1FQBA 1QKAA 4IGRA 1BIYA 1II5A 3CFXA 1BKAA 2V84A 1JW1A 2DE2A 1MH4A 1LLSA 4H5GA 4H8JA 1IZ1A 4I62A 3ODBA 4LA9A 2AL4A 4MLQA 1PB7A 4LQ2A 5A5XA 4THIA 1B3EA 3PMVA 4DIGA 3LBSA 2F36A 1JW4A 3RLFE 4FE8A 1P99A 2A5TA 3FVNA 3K1MA 3HO7A 3O6IA 4O3AA 4OESA 4F39A 1ZU0A 3S9EA 3FJGA 4NF5A 3VXBA 3UK4A 3CR9A 3KOTA 1UTHB 2O84X 2F34A 1L5TA 4R6YA 1TFDA 3LC8A 5H8QA 4Q8RA 3CG3A 2H5YA 2VHAA 1XC1A 3O28A 2W7YA 2ZXTA 3R26A 4N6PA 5I59A 5LOMA 1POTA 2VOZA 3OEMA 4FEBA 4G68C 4GXSB 2NVUB 3SEXA 3HPIA 2DOJA 3VVFA 4YB6A 3U1OA 3DP6A 3E13X 4EF1A 4KFQA 5K2XA 3RY3A 3SEVA 4POXA 1TFAA 3SESA 4BDLA 3T9VA 2DVZA 3IB1A 5ITPA 1B7UA 1DMBA 1LGBC 3G3GA 1MPCA 3SDFA 3MP6A 1A54A 3CSBA 2D3IA 3H6WA 4EXKA 1H45A 2O7UA 1OQHA 3G3KA 3O6HA 1IIWA 4YKJA 3THIA 4EQBA 4H1XA 2X7PA 1RYXA 1XVXA 4PE5B 3IJXB 4YKKA 3K02A 3W15C 1MXZA 4GL8A 4HCYA 4KR5A 3P7IA 4XKQA 4XKPA 5CMBA 5DVJA 4BDQA 3VV5A 1MQIA 4ZEIA 2O51A 1I6BA 2HXWA 5EYFA 1ZBMA 3U94A 4FATA 1B5JA 4F2QA 3EHSA 3CFZA 3IOWA 1GVCA 3Q28A 4BDRA 2RINA 1B5IA 4G2ZA 3MBPA 4ZE8A 3TEPA 1FTOA 1HSEA 1IEJA 1WVJA 2ZYKA 3IK6B 3LSFB 3O2AA 4GRKA 4OWDA 1B1HA 3HN0A 1T0KA 1MM6A 4PFYA 1MY1A 4G8HA 1NH8A 2Q89A 1NNPA 4BDOA 5FTHA 4U4XA 1FQAA 3MUQA 3IL1B 4IO7A 3OO9A 2H25A 4NF6A 4OMBA 4OQOA 5AA4B 3FATA 2PMSA 1MY2A 1OLAA 4RA1A 1M5CA 1MG1A 1IXGA 3EHUA 4I8CA 1LB9A 4F1UA 3HHGA 1IUDA 1B3HA 2QL3A 5I2KB 3T93B 1Y4TA 1LAFE 1JNFA 4C1TA 1B0LA 5ELVA 2GH9A 3E3KA 4JB7A 3TPAA 5I59B 3S9MC 2GHBA 2LAOA 1MPDA 1QUJA 3G3IA 4GQOA 4LUBA 1UIVA 2DYXA 4ZE9A 1B1XA 2BJJX 3PPNA 3PPPA 3M3LA 1IQ7A 4FJPA 4GFRA 4GOTA 2XX7A 4OEVA 5AA2A 1FQFA 1MH3A 1Q35A 4O3CA 2HFBA 4OERA 5CBSA 3ILUB 1ELJA 4KHZE 4KI0E 3SEUA 3U92A 3KJTA 3RGYA 3V89B 4X1BA 3RN8A 2Q2CA 4NWCA 3TTNA 4F3BA 4DDDA 4QFOA 4R72A 4E0WA 3C36A 2GRVA 3FV2A 1CE2A 2I4CA 4IO2A 4PETA 2XXVA 2THIA 1GGGA 5CMCA 4F18A 5B7DA 3FGSA 4YKIA 1B58A 3KFMA 3KSXA 4IGTA 3M8UA 3IO4A 2ZMBA 4WEPA 2P0SA 1OQGA 1PC3A 4C1UA 3D4GA 1LAGE 3T96B 3KGCA 3PPRA 1NNKA 4JWYA 5TU0A 5AA1A 3I3VA 3EN3A 1FQCA 3K1NA 1Y1MA 2QSXA 3OXNA 3MP8A 4KYEA 5HPQA 3A3CA 4RXLA 1A40A 3DP4A 3PU5A 2GFEA 3FVKA 3GXAA 1H43A 4U22A 4HW8A 3RNNA 1B3FA 1H44A 4IY5A 5H8FB 5CI5A 3K2DA 5IAIA 3H6UA 2OZZA 2Y7KA 1MS7A 4OVJA 1M5EA 3DP8A 2Z8FA 3JV9A 5F7VA 1N7WA 1OLCA 3BFTA 4KYSA 2RCAA 3QAXA 2DVCA 3O9PA 3TZAA 2ANJA 1N3WA 1IXCA 3K0VA 3TTKA 3B7DA 4G8NA 3G3FA 3CVGA 5I56B 2E1SA 5BUUA 2PT2A 5DTBA 2RC7A 3KN3A 3ILTB 3K6XA 4YU0A 2XX8A 1R6ZA 1LFHA 3VE1B 4KCDA 1OMPA 1O63A 2QMXA 2XXUA 4NMYA 3RPWA 1B6HA 4FORA 2WKYA 1FQDA 3DLNA 4U1OA 1XT8A 1UIUA 3IOVA 1B32A 2GHAA 3W9VA 4ESWA 1MXXA 2YLNA 4JWOA 5DEXA 3KSJA 3CSGA 1IXHA 1JETA 3KN8A 4GVOA 4YMBA 2Z8DA 5L9MA 4ELPA 1M5BA 4RY1A 3JZJA 3PMXA 2FNCA 4PQJA 3IJOB 3O97A 3T9UA 4H6DA 2O69A 2Y7PA 5AA4A 3VXCA 1UTBA 4GXAA 1LFIA 1MY3A 2UYFA 4JSOA 2ONSA 3VLVA 2XXYA 3HV1A 4ZEKA 4JSDA 1B51A 3TTRA 1I6QA 2HEUA 4OZ9A 4QF9A 3ZS6A 4BLAA 3TYHA 5BWJA 3OEKA 4GD5A 3IB2A 2FA7A 4OTEA 3UORA 2V3TA 2REJA 4JBZA 2I49A 4ESXA 5AA2D 1A8EA 2XXXA 1B9JA 1H3DA 1OVBA 1URSA 1AH5A 4R74A 3RTFB 3N5LA 5I57A 4Q5TA 2P1SA 2DP8A 4MLVA 4G77A 2UVJA 3BFUA 2A5SA 4KYDA 4OEUA 2D5WA 3I5OA 2QS2A 3QUJA 1A8FA 1YPNA 4LVQA 1LSTA 1SI0A 5H8SA 5H8FA 3KOSA 4DE8A 3O6GA 2ZNSA 1LCTA 4M4GA 5L9SA 3PV0E 5CRYA 3FZVA 3S4UA 3TAJA 5TP9B 1WDNA 4QFNA 2O7IA 4K3FA 3TCFA 4NWDA 4R9FA 4OENA 1ZMGA 3FVGA 4GLIA 4EQ7A 4OFOA 3LSLA 1D3KA 3S2VA 4OYVA 2OK2A 4R2BA 1I6AA 3E9XA 4RNSA 1R9LA 3IOUA 2PT1A 2I0CA 3PUYE 4HS7A 5CBRA 1YAEA 2I0BA 3PUXE 3KBRA 4F2OA 3MW0A 4LONB 1N7XA 5H8HB 1US5A 5KCJA 4BDMA 4DCXA 2XXWA 4RPNA 5M2VA 1JEVA 3R7XA 3VLUA 2V3UA 3FD3A 4HTGA 4Q0CA 4YB7A 4IO4A 1USYH 1MPBA 1GTKA 1VSOA 1QKBA 2QS3A 2IEEA 3HCQA 2PBWA 2QS4A 3MQ9A 3FV1A 1DTGA 3MZ1A 4G68B 4MH5A 5CMMA 3SEWA 3C31A 4F31B 1FTJA 4WXJA 2YPNA 4N13A 4NF6B 3G3JA 3K1PA 1SI1A 5TPAA 2CMOA 3CG1A 1BLFA 3Q27A 4XKRA 3VVEA 4NF8A 5B70A 1S9TA 1POY1 1D9VA 2REGA 2ZYOA 3WAEA 4MF3A 2HQ0A 3UA8A 4U4SA 3B6QA 4GL0A 1Q1KA 4ZDMA 1QJMA 3A09A 1MDP1 3C9HA 1JEUA 4XKNA 3K6VA 4O3BA 4MBPA 3IR1A 3UP9A 2V3QA 4EXLA 1EZPA 1ATGA 1R1NA 4ZS9A 3ZKLA 4F29A 3CI8A 3T66A 4P11A 2NUVA 2VD2A 3N94A 2NXOA 2P2AA 5CM6A 1MXYA 4AB6A 3MVXA 2I3WA 4GF8A 4UACA 1TXFA 4Q30B 4WKMA 2G29A 1A99A 5FHMA 1M5FA 1P1NA 2OJTA 2H99A 4FECA 3PMWA 4R9GA 1EU8A 1MY0A 1NMUA 3TODA 1USYE 2UXAA 5I58A 3T22A 5KDTB 4JDFA 3TFLA 1LAXA 1MXWA 3H6VA 4QHQA 4QSDA 5KCJB 3TUSA 5JK4A 4FAJA 1LB8A 2QJEA 2XD2A 2XX9A 3OSRA 4DXUA 1SDXA 1QUIA 2UYEA 4X48A 2B3FA 4H8IA 2NWJA 1VFDA 3K6UA 3UIFA 4DXBA 3M3KA 5AA2B 3B6TA 4U23A 1MQJA 4E0XA 1XVYA 4POWA 3MVYA 1JVXA 2AIXA 2OBGA 4QFPA 3V83A 2H4IA 3QK6A 2ZYMA 3RQTA 3RT8A 3Q26A 1MQGA 1ANFA 2F78A 1SVXB 4EDPA 3CIJA 4QSEA 5I2KA 3H6TA 2UVGA 4P0GA 5TPAB 5CC2A 2F6GA 1DTZA 4NF8B 3BKIB 3C33A 4U1ZA 4XIGQ 4YZZA 1M5DA 2DWJA 2RKMA 1NH7A 2ONRA 1N84A 1H76A 2Q88A 1JW5A 2OWSA 1PEBA 1B40A 5DVFA 4L17A 5F1QA 3TTLA 1DSNA 2X26A 4OXVA 1LAHE 1VE4A 2HCAA 4EQ9A 5ISUA 1P1UA 1URDA 4ELOA 3PPQA 1S50A 3KN7A 1MM7A 1PBQA 1YTVA 4NEDA 3TKDA 2DWHA 1FW0A 1B52A 3QIMA 3IAZA 3TCGA 4ELQA 1NL5A 3C34A 3AXFA 1URGA 4R2FA 4IY6A 4OHNA 4PFUA 4Z7EA 1NFTA 2B65A 3IOTA 2DE3A 2Y7IA 3S9NC 3TMGA 3GBAA 3RTWB 4ZEBA 3GBBA 1B3LA 5DEXB 2QPQA 4LQ5A 1N0TA 1OIBA 2F35A 5I2NB 1ZIUA 3RT6B 4H65A 1QW0A 4R75A 4RJZA 3MAMA 3SERA 4X1DA 1IITA 2R71A 4M1VA 2Y84A 5JTYA 3LSXA 3MVWA 3OOAA 3T9HB 3VVDA 5I56A 1GR2A 4F3SA 3Q29A 1FTKA 4R73A 1LBBA 3GZGA 4QFKA 5DVIA 3V5AA 5EHMA 2ZNUA 4YB5A 5CMKA 1PB9A 2UVIA 3G3HA 3IO6A 4GIZA 3MPLA 3QUFA 4ZEDA 1AIVA 3MPKA 3DELB 2OWTA 2X7QA 1XS5A 1RKMA 2AYSA 3IB0A 4MFIA 4LZ8A 4UA8A 1QUKA 3OSQA 2OLBA 3OO8A 4TLMB 5ITOA 1Y3PA 1ZKBA 3N26A 3TQWA 1BP5A 4RYAA 4R6HA 4F3GA 1IXIA 4ZEFA 2Q8JA 1N04A 4IO3A 2ESNA 1RYOA 1PB8A 2H98A 5AA3A 3OELA 3C4MA 1MQDA 2D21A 2O1LA 5FHNA 3FIRA 2A5TB 1D9YA 1P1WA 2F8DA 2YJPA 3H03A 1MRPA 1UTBB 3O66A 3TTMA 2V93A 4XXUA 3OO6A 1B7HA 4G8MA 4GWOA 1KWHA 5AE4A 1NNFA 2O68A 4QRZA 1Y20A 2RC9A 4PFWA 3PGFA 1F9BA 1VFEA 4PFTA 1HSJA 1SQYA 1TWYA 3C35A 2F7AA 2KLFA 2Z22A 3VLWA 2VP1A 4NTLA 3O29A 1A55A 2O1MA 4ZZEA 1B46A 3EHTA 1WODA 1ZLQA 2CZLA 4YAHX 1US4A 5K2YA 4ISUA 3BBRA 1HSLA 1MXVA 1YCJA 3FUZA 3N6UA 3FXQA 3PUVE 3U93A 4ZECA 5J1DA 3L6HA 1Z7ME 4TOZA 5I84A 2I58A 2ALUA 3KG2A 2Q2AA 4X9TA 3D4CA 3UN6A 1AL3A 5HM4B 3CRBA 2XXQA 2NOOA 3N6TA 4XTCQ 1J1NA 3U8QA 3MZ9A 2RCBA 4OFJA 4F1YA 3IX1A 2HAUA 4IO6A 2G93A 4WEDA 5TP9A 3MC2A 2DWIA 2OCUA 3EF7A 3RUMA 1SW5A 2HAVA 2RC8A 5L8DA 1P1QA 1SYHA 3MZBA 4G4PA 2QS1A 4ZZAA 4NE4A 4EUOA 2RF1A 3LR1A 1FCKA 1EZ9A 1XOCA 3FXRA 4U2RA 2VD3A 1SW2A 3KJ7A 1SW1A 1LCFA 1DOTA 1XHYA 2DXRA 4TLLB 2I3VA 2XXTA 3ZKKA 2DS9A 1MDQA 3MP1A 3ONMA 4RK9A 3TELA 5L9OA 4RK2A 1FTMA 2F5XA 5EHSA 4ELRA 1P1OA 3HSTA 1UQWA 2E0SA 5IKBA 4OFLA 1Y9UA 1MXUA 4G68A 4NF4B 2HZLA 3KZGA 1Z7NE 3F11A 2PYYA 4BDNA 4ND9A 1B4HA 1SW4A 4KCCA 1Y4CA 4IO5A 1B0HA 3QXMA 3OD7A 2DE4A 3A3UA 3PUWE 4JXIA 1Y3NA 3B6WA 4IB2A 4QSCA 3SKPA 3TQLA 3PUZE 2PX1A 3PPOA 1TT1A 3H7MA 1B05A 5JTYB 4H0WA 1N76A 2Z23A 5HBCA 4LZ5A 1VR5A 3C32A 2F6PA 1JVYA 3W9WA 5H8QB 4FEDA 2B3BA 2DXYA 3H4ZA 1NKXA 2Y7RA 3FASA 4YICA 2DQVA 5H8HA 4F22A 1QULA 4P0IA 5I2NA 1R9QA 2XD3A 1S7YA 4EF2A 2F7BA 4YKPA 2XXIA 1SD3A 1MY4A 2Z8EA 3L6GA 3FJMA 3KEIA 4LP2B 3ZSFA 3K01A 1B3GA 4YMAA 1EZOA 5FHOA 1ZJLA 2F97A 2XHDA 3H3GA 4H67A 3EPEA 3FVOA 3LUYA 4DLDA 2M8CA 3DM0A 3HHFA 5A5XB 2QMWA 5ICQA 4F1VA 2ONKE 5DYHA 3T9XB 5KZTA 3FXUA 3S9LC 3EQ1A 4H5FA 1QVSA 4U21A 1O64A 4DCYA 3WAFA 2QRYA 3UGWA 3OO7A 1BTJA 2Q9TA 2I6EA 3K4UA 1B5HA 3M3FA 3QYTA 1D4NA 3PD9A 4I1DA 3V8XB 5H8NA 3OMBA 1SBPA 5I58B 1UTHA 1NNTA 2H9BA 3VDFA 4NF5B 5I57B 2UVHA 2XXRA 1B2HA 4PP0A 2PVUA 1N3XA 4QFLA 1DPPA 2ZNTA 1LFGA 4JWXA 4C0RA 1PDAA 1SYIA 4ECFA 2XXHA 4KQPA 2V25A 3MWBA 4TQUQ 1PBPA 3TDJA 2R9JA 2Y7WA 3R6UA 3K6WA 2DSFA 2I48A 1B4ZA 3QSLA 1JQFA 4LATA 2ABHA 4AB5A 3MJNA 2R6GE 1AMFA 4I9DA 1Y3QA 1B7ZA 3LSWA 3PD8A 5FTIA 3E4RA 4AQ4A 4F3PA 1AOVA 1DPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6A A;  3IOR A;  4HCW A;  3USD A;  1FTL A;  4RPO A;  1A7L A;  1Y1Z A;  2DWA A;  3K00 A;  4Z0I A;  3VFJ A;  3SET A;  4F19 A;  4DZ1 A;  3GLB A;  2VGQ A;  1OVT A;  1LBC A;  2I4B A;  2FYI A;  1CB6 A;  1MQH A;  4OET A;  1GV8 A;  3H06 B;  5H8N B;  2ZYN A;  5KDT A;  1EH3 A;  4FIM A;  3I6V A;  5JEI A;  4NF4 A;  4KPT A;  3SEY A;  2AL5 A;  5DT6 A;  3ECR A;  1I69 A;  1ZTY A;  5ICT A;  4KD5 A;  2XXP A;  4R6K A;  4DXC A;  4ONY A;  3G7W A;  3Q25 A;  2IA4 A;  1O7T A;  3U72 A;  4N07 A;  1FQE A;  3FJ7 A;  3TCH A;  3JYR A;  2F7C A;  3OEN A;  4LZ7 A;  3MVZ A;  2HZK A;  3CFL A;  1FQB A;  1QKA A;  4IGR A;  1BIY A;  1II5 A;  3CFX A;  1BKA A;  2V84 A;  1JW1 A;  2DE2 A;  1MH4 A;  1LLS A;  4H5G A;  4H8J A;  1IZ1 A;  4I62 A;  3ODB A;  4LA9 A;  2AL4 A;  4MLQ A;  1PB7 A;  4LQ2 A;  5A5X A;  4THI A;  1B3E A;  3PMV A;  4DIG A;  3LBS A;  2F36 A;  1JW4 A;  3RLF E;  4FE8 A;  1P99 A;  2A5T A;  3FVN A;  3K1M A;  3HO7 A;  3O6I A;  4O3A A;  4OES A;  4F39 A;  1ZU0 A;  3S9E A;  3FJG A;  4NF5 A;  3VXB A;  3UK4 A;  3CR9 A;  3KOT A;  1UTH B;  2O84 X;  2F34 A;  1L5T A;  4R6Y A;  1TFD A;  3LC8 A;  5H8Q A;  4Q8R A;  3CG3 A;  2H5Y A;  2VHA A;  1XC1 A;  3O28 A;  2W7Y A;  2ZXT A;  3R26 A;  4N6P A;  5I59 A;  5LOM A;  1POT A;  2VOZ A;  3OEM A;  4FEB A;  4G68 C;  4GXS B;  2NVU B;  3SEX A;  3HPI A;  2DOJ A;  3VVF A;  4YB6 A;  3U1O A;  3DP6 A;  3E13 X;  4EF1 A;  4KFQ A;  5K2X A;  3RY3 A;  3SEV A;  4POX A;  1TFA A;  3SES A;  4BDL A;  3T9V A;  2DVZ A;  3IB1 A;  5ITP A;  1B7U A;  1DMB A;  1LGB C;  3G3G A;  1MPC A;  3SDF A;  3MP6 A;  1A54 A;  3CSB A;  2D3I A;  3H6W A;  4EXK A;  1H45 A;  2O7U A;  1OQH A;  3G3K A;  3O6H A;  1IIW A;  4YKJ A;  3THI A;  4EQB A;  4H1X A;  2X7P A;  1RYX A;  1XVX A;  4PE5 B;  3IJX B;  4YKK A;  3K02 A;  3W15 C;  1MXZ A;  4GL8 A;  4HCY A;  4KR5 A;  3P7I A;  4XKQ A;  4XKP A;  5CMB A;  5DVJ A;  4BDQ A;  3VV5 A;  1MQI A;  4ZEI A;  2O51 A;  1I6B A;  2HXW A;  5EYF A;  1ZBM A;  3U94 A;  4FAT A;  1B5J A;  4F2Q A;  3EHS A;  3CFZ A;  3IOW A;  1GVC A;  3Q28 A;  4BDR A;  2RIN A;  1B5I A;  4G2Z A;  3MBP A;  4ZE8 A;  3TEP A;  1FTO A;  1HSE A;  1IEJ A;  1WVJ A;  2ZYK A;  3IK6 B;  3LSF B;  3O2A A;  4GRK A;  4OWD A;  1B1H A;  3HN0 A;  1T0K A;  1MM6 A;  4PFY A;  1MY1 A;  4G8H A;  1NH8 A;  2Q89 A;  1NNP A;  4BDO A;  5FTH A;  4U4X A;  1FQA A;  3MUQ A;  3IL1 B;  4IO7 A;  3OO9 A;  2H25 A;  4NF6 A;  4OMB A;  4OQO A;  5AA4 B;  3FAT A;  2PMS A;  1MY2 A;  1OLA A;  4RA1 A;  1M5C A;  1MG1 A;  1IXG A;  3EHU A;  4I8C A;  1LB9 A;  4F1U A;  3HHG A;  1IUD A;  1B3H A;  2QL3 A;  5I2K B;  3T93 B;  1Y4T A;  1LAF E;  1JNF A;  4C1T A;  1B0L A;  5ELV A;  2GH9 A;  3E3K A;  4JB7 A;  3TPA A;  5I59 B;  3S9M C;  2GHB A;  2LAO A;  1MPD A;  1QUJ A;  3G3I A;  4GQO A;  4LUB A;  1UIV A;  2DYX A;  4ZE9 A;  1B1X A;  2BJJ X;  3PPN A;  3PPP A;  3M3L A;  1IQ7 A;  4FJP A;  4GFR A;  4GOT A;  2XX7 A;  4OEV A;  5AA2 A;  1FQF A;  1MH3 A;  1Q35 A;  4O3C A;  2HFB A;  4OER A;  5CBS A;  3ILU B;  1ELJ A;  4KHZ E;  4KI0 E;  3SEU A;  3U92 A;  3KJT A;  3RGY A;  3V89 B;  4X1B A;  3RN8 A;  2Q2C A;  4NWC A;  3TTN A;  4F3B A;  4DDD A;  4QFO A;  4R72 A;  4E0W A;  3C36 A;  2GRV A;  3FV2 A;  1CE2 A;  2I4C A;  4IO2 A;  4PET A;  2XXV A;  2THI A;  1GGG A;  5CMC A;  4F18 A;  5B7D A;  3FGS A;  4YKI A;  1B58 A;  3KFM A;  3KSX A;  4IGT A;  3M8U A;  3IO4 A;  2ZMB A;  4WEP A;  2P0S A;  1OQG A;  1PC3 A;  4C1U A;  3D4G A;  1LAG E;  3T96 B;  3KGC A;  3PPR A;  1NNK A;  4JWY A;  5TU0 A;  5AA1 A;  3I3V A;  3EN3 A;  1FQC A;  3K1N A;  1Y1M A;  2QSX A;  3OXN A;  3MP8 A;  4KYE A;  5HPQ A;  3A3C A;  4RXL A;  1A40 A;  3DP4 A;  3PU5 A;  2GFE A;  3FVK A;  3GXA A;  1H43 A;  4U22 A;  4HW8 A;  3RNN A;  1B3F A;  1H44 A;  4IY5 A;  5H8F B;  5CI5 A;  3K2D A;  5IAI A;  3H6U A;  2OZZ A;  2Y7K A;  1MS7 A;  4OVJ A;  1M5E A;  3DP8 A;  2Z8F A;  3JV9 A;  5F7V A;  1N7W A;  1OLC A;  3BFT A;  4KYS A;  2RCA A;  3QAX A;  2DVC A;  3O9P A;  3TZA A;  2ANJ A;  1N3W A;  1IXC A;  3K0V A;  3TTK A;  3B7D A;  4G8N A;  3G3F A;  3CVG A;  5I56 B;  2E1S A;  5BUU A;  2PT2 A;  5DTB A;  2RC7 A;  3KN3 A;  3ILT B;  3K6X A;  4YU0 A;  2XX8 A;  1R6Z A;  1LFH A;  3VE1 B;  4KCD A;  1OMP A;  1O63 A;  2QMX A;  2XXU A;  4NMY A;  3RPW A;  1B6H A;  4FOR A;  2WKY A;  1FQD A;  3DLN A;  4U1O A;  1XT8 A;  1UIU A;  3IOV A;  1B32 A;  2GHA A;  3W9V A;  4ESW A;  1MXX A;  2YLN A;  4JWO A;  5DEX A;  3KSJ A;  3CSG A;  1IXH A;  1JET A;  3KN8 A;  4GVO A;  4YMB A;  2Z8D A;  5L9M A;  4ELP A;  1M5B A;  4RY1 A;  3JZJ A;  3PMX A;  2FNC A;  4PQJ A;  3IJO B;  3O97 A;  3T9U A;  4H6D A;  2O69 A;  2Y7P A;  5AA4 A;  3VXC A;  1UTB A;  4GXA A;  1LFI A;  1MY3 A;  2UYF A;  4JSO A;  2ONS A;  3VLV A;  2XXY A;  3HV1 A;  4ZEK A;  4JSD A;  1B51 A;  3TTR A;  1I6Q A;  2HEU A;  4OZ9 A;  4QF9 A;  3ZS6 A;  4BLA A;  3TYH A;  5BWJ A;  3OEK A;  4GD5 A;  3IB2 A;  2FA7 A;  4OTE A;  3UOR A;  2V3T A;  2REJ A;  4JBZ A;  2I49 A;  4ESX A;  5AA2 D;  1A8E A;  2XXX A;  1B9J A;  1H3D A;  1OVB A;  1URS A;  1AH5 A;  4R74 A;  3RTF B;  3N5L A;  5I57 A;  4Q5T A;  2P1S A;  2DP8 A;  4MLV A;  4G77 A;  2UVJ A;  3BFU A;  2A5S A;  4KYD A;  4OEU A;  2D5W A;  3I5O A;  2QS2 A;  3QUJ A;  1A8F A;  1YPN A;  4LVQ A;  1LST A;  1SI0 A;  5H8S A;  5H8F A;  3KOS A;  4DE8 A;  3O6G A;  2ZNS A;  1LCT A;  4M4G A;  5L9S A;  3PV0 E;  5CRY A;  3FZV A;  3S4U A;  3TAJ A;  5TP9 B;  1WDN A;  4QFN A;  2O7I A;  4K3F A;  3TCF A;  4NWD A;  4R9F A;  4OEN A;  1ZMG A;  3FVG A;  4GLI A;  4EQ7 A;  4OFO A;  3LSL A;  1D3K A;  3S2V A;  4OYV A;  2OK2 A;  4R2B A;  1I6A A;  3E9X A;  4RNS A;  1R9L A;  3IOU A;  2PT1 A;  2I0C A;  3PUY E;  4HS7 A;  5CBR A;  1YAE A;  2I0B A;  3PUX E;  3KBR A;  4F2O A;  3MW0 A;  4LON B;  1N7X A;  5H8H B;  1US5 A;  5KCJ A;  4BDM A;  4DCX A;  2XXW A;  4RPN A;  5M2V A;  1JEV A;  3R7X A;  3VLU A;  2V3U A;  3FD3 A;  4HTG A;  4Q0C A;  4YB7 A;  4IO4 A;  1USY H;  1MPB A;  1GTK A;  1VSO A;  1QKB A;  2QS3 A;  2IEE A;  3HCQ A;  2PBW A;  2QS4 A;  3MQ9 A;  3FV1 A;  1DTG A;  3MZ1 A;  4G68 B;  4MH5 A;  5CMM A;  3SEW A;  3C31 A;  4F31 B;  1FTJ A;  4WXJ A;  2YPN A;  4N13 A;  4NF6 B;  3G3J A;  3K1P A;  1SI1 A;  5TPA A;  2CMO A;  3CG1 A;  1BLF A;  3Q27 A;  4XKR A;  3VVE A;  4NF8 A;  5B70 A;  1S9T A;  1POY 1;  1D9V A;  2REG A;  2ZYO A;  3WAE A;  4MF3 A;  2HQ0 A;  3UA8 A;  4U4S A;  3B6Q A;  4GL0 A;  1Q1K A;  4ZDM A;  1QJM A;  3A09 A;  1MDP 1;  3C9H A;  1JEU A;  4XKN A;  3K6V A;  4O3B A;  4MBP A;  3IR1 A;  3UP9 A;  2V3Q A;  4EXL A;  1EZP A;  1ATG A;  1R1N A;  4ZS9 A;  3ZKL A;  4F29 A;  3CI8 A;  3T66 A;  4P11 A;  2NUV A;  2VD2 A;  3N94 A;  2NXO A;  2P2A A;  5CM6 A;  1MXY A;  4AB6 A;  3MVX A;  2I3W A;  4GF8 A;  4UAC A;  1TXF A;  4Q30 B;  4WKM A;  2G29 A;  1A99 A;  5FHM A;  1M5F A;  1P1N A;  2OJT A;  2H99 A;  4FEC A;  3PMW A;  4R9G A;  1EU8 A;  1MY0 A;  1NMU A;  3TOD A;  1USY E;  2UXA A;  5I58 A;  3T22 A;  5KDT B;  4JDF A;  3TFL A;  1LAX A;  1MXW A;  3H6V A;  4QHQ A;  4QSD A;  5KCJ B;  3TUS A;  5JK4 A;  4FAJ A;  1LB8 A;  2QJE A;  2XD2 A;  2XX9 A;  3OSR A;  4DXU A;  1SDX A;  1QUI A;  2UYE A;  4X48 A;  2B3F A;  4H8I A;  2NWJ A;  1VFD A;  3K6U A;  3UIF A;  4DXB A;  3M3K A;  5AA2 B;  3B6T A;  4U23 A;  1MQJ A;  4E0X A;  1XVY A;  4POW A;  3MVY A;  1JVX A;  2AIX A;  2OBG A;  4QFP A;  3V83 A;  2H4I A;  3QK6 A;  2ZYM A;  3RQT A;  3RT8 A;  3Q26 A;  1MQG A;  1ANF A;  2F78 A;  1SVX B;  4EDP A;  3CIJ A;  4QSE A;  5I2K A;  3H6T A;  2UVG A;  4P0G A;  5TPA B;  5CC2 A;  2F6G A;  1DTZ A;  4NF8 B;  3BKI B;  3C33 A;  4U1Z A;  4XIG Q;  4YZZ A;  1M5D A;  2DWJ A;  2RKM A;  1NH7 A;  2ONR A;  1N84 A;  1H76 A;  2Q88 A;  1JW5 A;  2OWS A;  1PEB A;  1B40 A;  5DVF A;  4L17 A;  5F1Q A;  3TTL A;  1DSN A;  2X26 A;  4OXV A;  1LAH E;  1VE4 A;  2HCA A;  4EQ9 A;  5ISU A;  1P1U A;  1URD A;  4ELO A;  3PPQ A;  1S50 A;  3KN7 A;  1MM7 A;  1PBQ A;  1YTV A;  4NED A;  3TKD A;  2DWH A;  1FW0 A;  1B52 A;  3QIM A;  3IAZ A;  3TCG A;  4ELQ A;  1NL5 A;  3C34 A;  3AXF A;  1URG A;  4R2F A;  4IY6 A;  4OHN A;  4PFU A;  4Z7E A;  1NFT A;  2B65 A;  3IOT A;  2DE3 A;  2Y7I A;  3S9N C;  3TMG A;  3GBA A;  3RTW B;  4ZEB A;  3GBB A;  1B3L A;  5DEX B;  2QPQ A;  4LQ5 A;  1N0T A;  1OIB A;  2F35 A;  5I2N B;  1ZIU A;  3RT6 B;  4H65 A;  1QW0 A;  4R75 A;  4RJZ A;  3MAM A;  3SER A;  4X1D A;  1IIT A;  2R71 A;  4M1V A;  2Y84 A;  5JTY A;  3LSX A;  3MVW A;  3OOA A;  3T9H B;  3VVD A;  5I56 A;  1GR2 A;  4F3S A;  3Q29 A;  1FTK A;  4R73 A;  1LBB A;  3GZG A;  4QFK A;  5DVI A;  3V5A A;  5EHM A;  2ZNU A;  4YB5 A;  5CMK A;  1PB9 A;  2UVI A;  3G3H A;  3IO6 A;  4GIZ A;  3MPL A;  3QUF A;  4ZED A;  1AIV A;  3MPK A;  3DEL B;  2OWT A;  2X7Q A;  1XS5 A;  1RKM A;  2AYS A;  3IB0 A;  4MFI A;  4LZ8 A;  4UA8 A;  1QUK A;  3OSQ A;  2OLB A;  3OO8 A;  4TLM B;  5ITO A;  1Y3P A;  1ZKB A;  3N26 A;  3TQW A;  1BP5 A;  4RYA A;  4R6H A;  4F3G A;  1IXI A;  4ZEF A;  2Q8J A;  1N04 A;  4IO3 A;  2ESN A;  1RYO A;  1PB8 A;  2H98 A;  5AA3 A;  3OEL A;  3C4M A;  1MQD A;  2D21 A;  2O1L A;  5FHN A;  3FIR A;  2A5T B;  1D9Y A;  1P1W A;  2F8D A;  2YJP A;  3H03 A;  1MRP A;  1UTB B;  3O66 A;  3TTM A;  2V93 A;  4XXU A;  3OO6 A;  1B7H A;  4G8M A;  4GWO A;  1KWH A;  5AE4 A;  1NNF A;  2O68 A;  4QRZ A;  1Y20 A;  2RC9 A;  4PFW A;  3PGF A;  1F9B A;  1VFE A;  4PFT A;  1HSJ A;  1SQY A;  1TWY A;  3C35 A;  2F7A A;  2KLF A;  2Z22 A;  3VLW A;  2VP1 A;  4NTL A;  3O29 A;  1A55 A;  2O1M A;  4ZZE A;  1B46 A;  3EHT A;  1WOD A;  1ZLQ A;  2CZL A;  4YAH X;  1US4 A;  5K2Y A;  4ISU A;  3BBR A;  1HSL A;  1MXV A;  1YCJ A;  3FUZ A;  3N6U A;  3FXQ A;  3PUV E;  3U93 A;  4ZEC A;  5J1D A;  3L6H A;  1Z7M E;  4TOZ A;  5I84 A;  2I58 A;  2ALU A;  3KG2 A;  2Q2A A;  4X9T A;  3D4C A;  3UN6 A;  1AL3 A;  5HM4 B;  3CRB A;  2XXQ A;  2NOO A;  3N6T A;  4XTC Q;  1J1N A;  3U8Q A;  3MZ9 A;  2RCB A;  4OFJ A;  4F1Y A;  3IX1 A;  2HAU A;  4IO6 A;  2G93 A;  4WED A;  5TP9 A;  3MC2 A;  2DWI A;  2OCU A;  3EF7 A;  3RUM A;  1SW5 A;  2HAV A;  2RC8 A;  5L8D A;  1P1Q A;  1SYH A;  3MZB A;  4G4P A;  2QS1 A;  4ZZA A;  4NE4 A;  4EUO A;  2RF1 A;  3LR1 A;  1FCK A;  1EZ9 A;  1XOC A;  3FXR A;  4U2R A;  2VD3 A;  1SW2 A;  3KJ7 A;  1SW1 A;  1LCF A;  1DOT A;  1XHY A;  2DXR A;  4TLL B;  2I3V A;  2XXT A;  3ZKK A;  2DS9 A;  1MDQ A;  3MP1 A;  3ONM A;  4RK9 A;  3TEL A;  5L9O A;  4RK2 A;  1FTM A;  2F5X A;  5EHS A;  4ELR A;  1P1O A;  3HST A;  1UQW A;  2E0S A;  5IKB A;  4OFL A;  1Y9U A;  1MXU A;  4G68 A;  4NF4 B;  2HZL A;  3KZG A;  1Z7N E;  3F11 A;  2PYY A;  4BDN A;  4ND9 A;  1B4H A;  1SW4 A;  4KCC A;  1Y4C A;  4IO5 A;  1B0H A;  3QXM A;  3OD7 A;  2DE4 A;  3A3U A;  3PUW E;  4JXI A;  1Y3N A;  3B6W A;  4IB2 A;  4QSC A;  3SKP A;  3TQL A;  3PUZ E;  2PX1 A;  3PPO A;  1TT1 A;  3H7M A;  1B05 A;  5JTY B;  4H0W A;  1N76 A;  2Z23 A;  5HBC A;  4LZ5 A;  1VR5 A;  3C32 A;  2F6P A;  1JVY A;  3W9W A;  5H8Q B;  4FED A;  2B3B A;  2DXY A;  3H4Z A;  1NKX A;  2Y7R A;  3FAS A;  4YIC A;  2DQV A;  5H8H A;  4F22 A;  1QUL A;  4P0I A;  5I2N A;  1R9Q A;  2XD3 A;  1S7Y A;  4EF2 A;  2F7B A;  4YKP A;  2XXI A;  1SD3 A;  1MY4 A;  2Z8E A;  3L6G A;  3FJM A;  3KEI A;  4LP2 B;  3ZSF A;  3K01 A;  1B3G A;  4YMA A;  1EZO A;  5FHO A;  1ZJL A;  2F97 A;  2XHD A;  3H3G A;  4H67 A;  3EPE A;  3FVO A;  3LUY A;  4DLD A;  2M8C A;  3DM0 A;  3HHF A;  5A5X B;  2QMW A;  5ICQ A;  4F1V A;  2ONK E;  5DYH A;  3T9X B;  5KZT A;  3FXU A;  3S9L C;  3EQ1 A;  4H5F A;  1QVS A;  4U21 A;  1O64 A;  4DCY A;  3WAF A;  2QRY A;  3UGW A;  3OO7 A;  1BTJ A;  2Q9T A;  2I6E A;  3K4U A;  1B5H A;  3M3F A;  3QYT A;  1D4N A;  3PD9 A;  4I1D A;  3V8X B;  5H8N A;  3OMB A;  1SBP A;  5I58 B;  1UTH A;  1NNT A;  2H9B A;  3VDF A;  4NF5 B;  5I57 B;  2UVH A;  2XXR A;  1B2H A;  4PP0 A;  2PVU A;  1N3X A;  4QFL A;  1DPP A;  2ZNT A;  1LFG A;  4JWX A;  4C0R A;  1PDA A;  1SYI A;  4ECF A;  2XXH A;  4KQP A;  2V25 A;  3MWB A;  4TQU Q;  1PBP A;  3TDJ A;  2R9J A;  2Y7W A;  3R6U A;  3K6W A;  2DSF A;  2I48 A;  1B4Z A;  3QSL A;  1JQF A;  4LAT A;  2ABH A;  4AB5 A;  3MJN A;  2R6G E;  1AMF A;  4I9D A;  1Y3Q A;  1B7Z A;  3LSW A;  3PD8 A;  5FTI A;  3E4R A;  4AQ4 A;  4F3P A;  1AOV A;  1DPE A; 
#chains in the Genus database with same CATH topology
 3USD A;  1A7L A;  1Y1Z A;  3K00 A;  4Z0I A;  3GLB A;  2VGQ A;  5H8N B;  4GWU A;  4PTK A;  1EH3 A;  5JEI A;  4O94 A;  4KD5 A;  4DXC A;  2IA4 A;  3TCH A;  3FJ7 A;  3JYR A;  2F7C A;  4X04 A;  2HZK A;  3CFL A;  2V84 A;  1MH4 A;  1LLS A;  4GX6 A;  1PB7 A;  4DIG A;  3A29 A;  3LBS A;  5IZ3 B;  2A5T A;  5J16 A;  3FJG A;  4NF5 A;  2F34 A;  3R26 A;  2VHA A;  5LOM A;  3O28 A;  2W7Y A;  2ZXT A;  4G68 C;  2NVU B;  4NX1 A;  4KFQ A;  4PAK A;  5K2X A;  3SES A;  4BDL A;  3IB1 A;  1DMB A;  1LGB C;  3G3G A;  1MPC A;  3SDF A;  2D3I A;  3O6H A;  3QMF A;  4YKJ A;  4H1X A;  2X7P A;  4O7I A;  4PE5 B;  4YKK A;  1MXZ A;  4HCY A;  4KR5 A;  1FRP A;  1MQI A;  1LBV A;  4ZEI A;  5EYF A;  1B5J A;  1GVC A;  4G2Z A;  4ZE8 A;  1IEJ A;  1WVJ A;  1RDZ A;  3HN0 A;  4PFY A;  1MY1 A;  4GWZ A;  1RDY A;  2Q89 A;  4IO7 A;  4OMB A;  2H25 A;  5IZ1 A;  4N17 A;  1MG1 A;  2DDK A;  1YXI A;  2QL3 A;  5I2K B;  3T93 B;  5IZ3 A;  1JNF A;  3FBP A;  4MIJ A;  2LAO A;  1QUJ A;  3PPN A;  4OEV A;  4GOT A;  2FHY A;  1FQF A;  4XF5 A;  4O3C A;  4NWC A;  4F3B A;  1NV4 A;  2GRV A;  3FV2 A;  4PET A;  5CMC A;  2QVU A;  5B7D A;  1DCU A;  4IGT A;  3M8U A;  2ZMB A;  3D4G A;  5TU0 A;  5AA1 A;  1DK4 A;  3K1N A;  2QSX A;  5LDZ A;  1A40 A;  3DP4 A;  3FVK A;  4HW8 A;  1B3F A;  4IY5 A;  4JVC A;  2Y7K A;  2DVC A;  2ANJ A;  3G3F A;  2E1S A;  4PFR A;  2RC7 A;  3ILT B;  3V83 A;  4NQ8 A;  2PFZ A;  1XT8 A;  1UIU A;  3IOV A;  1B32 A;  1MXX A;  3CSG A;  4QBA A;  4ELP A;  2XWK A;  3JZJ A;  3O97 A;  5AA4 A;  1UTB A;  1LFI A;  1MY3 A;  2UYF A;  5BWJ A;  4OZ9 A;  1FSA A;  3TYH A;  3OEK A;  4GD5 A;  3IB2 A;  5EQA A;  3LUZ A;  1D9Q A;  2REJ A;  4ESX A;  1A8E A;  1H3D A;  2GQ1 A;  3RTF B;  3N5L A;  1IMA A;  1A8F A;  4LVQ A;  1SI0 A;  3O6G A;  1LCT A;  3PV0 E;  4NN3 A;  4K3F A;  4NWD A;  1QGX A;  1D3K A;  3LSL A;  4MNI A;  3IOU A;  5CBR A;  1YAE A;  5H8H B;  4MX6 A;  4DCX A;  3VLU A;  3FD3 A;  4HTG A;  4Q0C A;  1USY H;  2R8T A;  2WBD A;  3V5A A;  1QKB A;  1FTJ A;  3G3J A;  1SI1 A;  5TPA A;  4NF8 A;  3WAE A;  3UA8 A;  4ZDM A;  2Q74 A;  1MDP 1;  3C9H A;  4EXL A;  2V3Q A;  1R1N A;  4ZS9 A;  3T66 A;  4P11 A;  1FBF A;  3N94 A;  5CM6 A;  1MXY A;  2HPG A;  2I3W A;  1TXF A;  4WKM A;  5EQ8 A;  5FHM A;  1M5F A;  1P1N A;  1NMU A;  1USY E;  3T22 A;  3TFL A;  3H6V A;  5KCJ B;  2QJE A;  2UYE A;  2B3F A;  2NWJ A;  3UIF A;  1VFD A;  2KR0 A;  4E0X A;  2OBG A;  4QFP A;  4I3E A;  3Q26 A;  3CIJ A;  4QSE A;  5I2K A;  5CC2 A;  1DTZ A;  4NF8 B;  4XIG Q;  2RKM A;  4FAJ A;  2ONR A;  1N84 A;  5F1Q A;  3TDJ A;  1JW5 A;  2FVZ A;  1FBC A;  2X26 A;  4EQ9 A;  5ISU A;  4ELO A;  3KN7 A;  1PBQ A;  2DWH A;  1B52 A;  4ELQ A;  3IAZ A;  4R2F A;  3E79 A;  1NFT A;  3IOT A;  1N0T A;  1Q9D A;  3KC0 A;  4R75 A;  4RJZ A;  3SER A;  4O7M A;  4X1D A;  1IIT A;  4GWX A;  1KZ8 A;  3T9H B;  1YZ0 A;  2UVI A;  4GIZ A;  3MPL A;  3MPK A;  3DEL B;  2AYS A;  4LZ8 A;  5ITO A;  3SZP A;  3N26 A;  4F3G A;  1IXI A;  2ESN A;  3OEL A;  3C4M A;  2A5T B;  1UTB B;  1KWH A;  2O68 A;  4QRZ A;  1VFE A;  2F7A A;  3VLW A;  3O29 A;  2CZL A;  1HSL A;  1NV1 A;  3FUZ A;  4ZEC A;  5J1D A;  2Q2A A;  3UN6 A;  3D4C A;  1AL3 A;  4XTC Q;  1J1N A;  2ZZW A;  2RCB A;  4OFJ A;  3IX1 A;  5TP9 A;  1FJ9 A;  2DWI A;  2OCU A;  3MC2 A;  1P1Q A;  4ZZA A;  2QS1 A;  2QVR A;  4EUO A;  3S2V A;  1EZ9 A;  3FXR A;  1SW2 A;  3KJ7 A;  4TLL B;  3ZKK A;  1XHY A;  2DS9 A;  3MP1 A;  3ONM A;  5L9O A;  1NV5 A;  1UQW A;  1Y9U A;  3F11 A;  4OVS A;  4ND9 A;  1SW4 A;  4IO5 A;  1B0H A;  2PCR A;  2DE4 A;  3PUW E;  2PX1 A;  3H7M A;  1B05 A;  4N6K A;  3BIH A;  4H0W A;  1IME A;  1VR5 A;  5H8Q B;  2B3B A;  2DXY A;  3H4Z A;  4YMA A;  2Y7R A;  3FAS A;  4N91 A;  4F22 A;  1S7Y A;  4P1E A;  1SD3 A;  3L6G A;  3FJM A;  3RPL A;  4LP2 B;  2Y5L A;  3LUY A;  4NG7 A;  3T0J A;  3EQ1 A;  4DCY A;  1BTJ A;  2Q9T A;  3QYT A;  1B5H A;  1SBP A;  5I57 B;  4PP0 A;  2PVU A;  4GX4 A;  2R9J A;  4P3L A;  2V4C A;  1AMF A;  4N6D A;  4F3P A;  2FIX A;  3IOR A;  2DWA A;  3SET A;  4F19 A;  1LBC A;  1NV3 A;  2I4B A;  2FYI A;  1CB6 A;  1MQH A;  5KDT A;  2ZYN A;  4FIM A;  2FBP A;  2AL5 A;  3KC1 A;  5ICT A;  2XXP A;  4ONY A;  3Q25 A;  4N07 A;  2VPO A;  4LZ7 A;  1G0H A;  3T9U A;  3W15 C;  1BIY A;  4NF4 A;  3CFX A;  4JVI A;  2AL4 A;  4LQ2 A;  5A5X A;  3PMV A;  2WYK A;  1JW4 A;  4FE8 A;  3FVN A;  3K1M A;  3S9E A;  1ZU0 A;  5I57 A;  3VXB A;  3LC8 A;  5I59 A;  1XC1 A;  2VOZ A;  4GXS B;  5I5P A;  3RY3 A;  4POX A;  1FBE A;  3MP6 A;  3CSB A;  4EXK A;  1H45 A;  2XWV A;  3G3K A;  1RDX A;  1RYX A;  1XVX A;  3IJX B;  5CMB A;  2CZI A;  3P7I A;  3U94 A;  2HXR A;  1EYJ A;  1B1H A;  4BDO A;  3IL1 B;  4P56 A;  4OQO A;  1OLA A;  1M5C A;  1IXG A;  4PBQ A;  1B0L A;  5ELV A;  5ET8 A;  2GH9 A;  5I3S A;  4I3Y A;  2GHB A;  1UIV A;  1B1X A;  4GFR A;  3PPP A;  2XX7 A;  4MAG A;  5CBS A;  1ELJ A;  4KI0 E;  3SEU A;  3V89 B;  3RGY A;  3HFU A;  4E0W A;  3C36 A;  1KA0 A;  1CE2 A;  2P3N A;  4IO2 A;  2THI A;  4YKI A;  3IO4 A;  4WEP A;  2P0S A;  1YYZ A;  3T96 B;  3KGC A;  4AS5 A;  1NNK A;  3I3V A;  3EN3 A;  3OXN A;  5HPQ A;  4RXL A;  4DI4 B;  1H43 A;  5IAI A;  5CI5 A;  3K2D A;  4O8M A;  2OZZ A;  1M5E A;  5F7V A;  3BFT A;  1OLC A;  2RCA A;  3O9P A;  3TZA A;  1IXC A;  3K0V A;  3B7D A;  5I56 B;  1LFH A;  4YU0 A;  1O63 A;  1B6H A;  2WKY A;  4H45 A;  4KXP A;  4JWO A;  5DEX A;  1BK4 A;  3KBZ A;  1M5B A;  2O69 A;  3VXC A;  4GXA A;  3VLV A;  2XXY A;  3HV1 A;  3PTY A;  3TTR A;  2HEU A;  3ZS6 A;  4QF9 A;  5F24 A;  2FA7 A;  4JBZ A;  4MNC A;  1OVB A;  4MLV A;  4G77 A;  2UVJ A;  3BFU A;  2A5S A;  4KYD A;  4OEU A;  1AWB A;  3I5O A;  5H8S A;  3U65 A;  3IFA A;  5CRY A;  1FPJ A;  1IMC A;  3TAJ A;  4QFN A;  2O7I A;  5I2N A;  1FPB A;  1KA1 A;  4OYV A;  4R2B A;  2PT1 A;  2I0C A;  3KBR A;  3MW0 A;  5KCJ A;  2XXW A;  4GX3 A;  1JEV A;  4YB7 A;  1FPE A;  3HCQ A;  4MH5 A;  3SEW A;  4F31 B;  4WXJ A;  3CG1 A;  1BLF A;  3Q27 A;  4XKR A;  3VVE A;  1POY 1;  2HQ0 A;  3B8B A;  1QJM A;  1JEU A;  4XKN A;  4O3B A;  4MBP A;  3IR1 A;  3UP9 A;  4F29 A;  2NUV A;  2XXK A;  4XFE A;  4Q30 B;  1A99 A;  2H99 A;  3PMW A;  5EQ7 A;  1EU8 A;  3TOD A;  5ET6 A;  1MXW A;  2XD2 A;  1SDX A;  4X48 A;  2VT5 A;  3K6U A;  5AA2 B;  3B6T A;  1XVY A;  3RYD A;  2H4I A;  3QK6 A;  3RQT A;  3RT8 A;  1MQG A;  3H6T A;  4P0G A;  2CEX A;  1NH7 A;  5DVF A;  1PEB A;  4L17 A;  3TTL A;  1VE4 A;  1P1U A;  1URD A;  1S50 A;  1MM7 A;  3QIM A;  2XWI A;  1NL5 A;  3AXF A;  2PFY A;  3RTW B;  1NV2 A;  2BJI A;  2F35 A;  1ZIU A;  3RT6 B;  4H65 A;  1FBP A;  3LSX A;  1GR2 A;  4F3S A;  3Q29 A;  4R73 A;  5DVI A;  1NV0 A;  5EHM A;  4YB5 A;  5EYH A;  3G3H A;  4ZED A;  3QUF A;  5EYG A;  1RKM A;  2OLB A;  1Y3P A;  1ZKB A;  4RYA A;  4R6H A;  1N04 A;  1RYO A;  5AA3 A;  5FHN A;  1MQD A;  2D21 A;  2O1L A;  4OVR A;  3OO6 A;  1Y20 A;  1F9B A;  4PGP A;  1TWY A;  2Z22 A;  2VP1 A;  4QXD A;  1WOD A;  4N81 A;  5K2Y A;  1NV7 A;  4ISU A;  1Z7M E;  4TOZ A;  4X9T A;  1FBH A;  3N6T A;  3U8Q A;  4WED A;  2HAU A;  3EF7 A;  1SW5 A;  5L8D A;  4G4P A;  5IZZ A;  4NE4 A;  1XOC A;  3MYU A;  3TEL A;  4OVT A;  5EHS A;  3ROJ A;  1P1O A;  2MKZ A;  2E0S A;  1MXU A;  4NF4 B;  2HZL A;  3KZG A;  1FJ6 A;  4BDN A;  1B4H A;  1EYK A;  3TQL A;  3B6W A;  4IB2 A;  4QSC A;  4PAF A;  5HBC A;  4NAP A;  2VPN A;  3W9W A;  1NKX A;  4P0I A;  2XD3 A;  4EF2 A;  4YKP A;  5FHO A;  1ZJL A;  4H67 A;  2XHD A;  5A5X B;  2QMW A;  2ONK E;  5DYH A;  3T9X B;  4U21 A;  1O64 A;  5T3J A;  2QRY A;  3OO7 A;  4XEQ A;  3PD9 A;  5I58 B;  3VDF A;  4NF5 B;  2XXR A;  4LN5 A;  1B2H A;  2V25 A;  2DSF A;  3QSL A;  2ABH A;  4AB5 A;  3MJN A;  2R6G E;  5FTI A;  1B7Z A;  3LSW A;  3PD8 A;  4AQ4 A;  4MHF A;  4N15 A;  4PDH A;  5I7I A;  1DPE A;  2O6A A;  1FTL A;  4RPO A;  3VFJ A;  1OVT A;  3FXB A;  1GV8 A;  3I6V A;  4KPT A;  3SEY A;  5DT6 A;  3G7W A;  3U72 A;  3OEN A;  3MVZ A;  4OWD A;  1FQB A;  1QKA A;  4IGR A;  1BKA A;  1JW1 A;  4LA9 A;  1IZ1 A;  3ODB A;  4MLQ A;  1LBW A;  2F36 A;  1P99 A;  4F39 A;  3O6I A;  1L5T A;  4R6Y A;  5H8Q A;  4Q8R A;  4N6P A;  1VDW A;  1POT A;  4FEB A;  3SEX A;  3HPI A;  3VVF A;  4YB6 A;  3DP6 A;  3E13 X;  4EF1 A;  4HE1 A;  3SEV A;  5ESY A;  1TFA A;  3T9V A;  2DVZ A;  5ITP A;  1A54 A;  3H6W A;  1OQH A;  3THI A;  3K02 A;  4BDQ A;  4XKP A;  3VV5 A;  2O51 A;  4FAT A;  3EHS A;  3CFZ A;  3IOW A;  4GWY A;  3Q28 A;  2RIN A;  1B5I A;  3MBP A;  4N8Y A;  1FTO A;  1MM6 A;  4U4X A;  2ZZX A;  4NF6 A;  2PMS A;  4RA1 A;  3EHU A;  1LB9 A;  5FBP A;  1IUD A;  1B3H A;  1Y4T A;  1LAF E;  4GBW A;  3E3K A;  4JB7 A;  5I59 B;  4ZE9 A;  4LUB A;  3S9L C;  2BJJ X;  3M3L A;  4FJP A;  1IMB A;  1MH3 A;  2HFB A;  3ILU B;  4X8R A;  4KHZ E;  3KJT A;  4MCO A;  4PGN A;  3RN8 A;  4QFO A;  4R72 A;  4F18 A;  1GGG A;  3FGS A;  3KFM A;  3KSX A;  4C1U A;  1OQG A;  1LAG E;  3PPR A;  1FQC A;  1Y1M A;  4KYE A;  2WEF A;  3BIG A;  3RNN A;  1H44 A;  1K9Z A;  3DP8 A;  2Z8F A;  3JV9 A;  1N7W A;  4KYS A;  4GWW A;  1N3W A;  3TTK A;  3CVG A;  2PT2 A;  5DTB A;  3KN3 A;  4DI3 D;  1R6Z A;  4KCD A;  1OMP A;  2QMX A;  1NI9 A;  4NMY A;  4FOR A;  1FQD A;  3DLN A;  3W9V A;  2YLN A;  3KSJ A;  1IXH A;  1JET A;  4YMB A;  3PMX A;  2FNC A;  3IJO B;  4JSO A;  4ZEK A;  1B51 A;  4BLA A;  5AA2 D;  1B9J A;  4MEV A;  1URS A;  4Q5T A;  2P1S A;  2DP8 A;  2B4L A;  2D5W A;  3QUJ A;  3ISP A;  1LST A;  4DE8 A;  3S4U A;  3FZV A;  3TCF A;  4R9F A;  1DBZ A;  4RNS A;  1R9L A;  4HS7 A;  2I0B A;  4IR8 A;  4LON B;  1N7X A;  4BDM A;  2FIE A;  5M2V A;  3R7X A;  1MPB A;  1VSO A;  3MQ9 A;  3UOR A;  2IEE A;  3MZ1 A;  3FV1 A;  1DTG A;  5CMM A;  5ET5 A;  2YPN A;  4N13 A;  3K1P A;  2CMO A;  1S9T A;  4U4S A;  4GL0 A;  1Q1K A;  3A09 A;  1EZP A;  1ATG A;  3ZKL A;  2WBB A;  3CI8 A;  2NXO A;  4AB6 A;  3MVX A;  4GF8 A;  4UAC A;  4HE0 A;  4R9G A;  1MY0 A;  4PFB A;  5I58 A;  2UXA A;  5KDT B;  2B4M A;  2ZZV A;  1LB8 A;  3OSR A;  4DXU A;  1QUI A;  5A5L A;  4H8I A;  4DXB A;  3M3K A;  2AIX A;  4NHB A;  4HE2 A;  1SVX B;  2UVG A;  3BKI B;  4YZZ A;  2JJK A;  1M5D A;  2V3T A;  2DWJ A;  1H76 A;  2Q88 A;  2OWS A;  1B40 A;  3PPQ A;  3TCG A;  4IY6 A;  4PFU A;  4Z7E A;  2DE3 A;  2Y7I A;  4NGU A;  3TMG A;  3S9N C;  4ZEB A;  2QPQ A;  4LQ5 A;  1OIB A;  1XI6 A;  1QW0 A;  1NV6 A;  3MAM A;  2KQZ A;  2R71 A;  5JTY A;  3MVW A;  2CZH A;  3OOA A;  3VVD A;  1FTK A;  4QFK A;  2ZNU A;  5CMK A;  1PB9 A;  3IO6 A;  1AIV A;  2OWT A;  2P3V A;  2X7Q A;  3IB0 A;  4UA8 A;  4TLM B;  1IMF A;  3TQW A;  1BP5 A;  4AS4 A;  2Q8J A;  4IO3 A;  2H98 A;  1P1W A;  2F8D A;  2YJP A;  3H03 A;  3TTM A;  1MRP A;  3B50 A;  2V93 A;  4XXU A;  4GWO A;  1NNF A;  2RC9 A;  4PFW A;  4PAI A;  4PFT A;  1HSJ A;  3C35 A;  2KLF A;  1JP4 A;  4NTL A;  1A55 A;  1B46 A;  3EHT A;  1ZLQ A;  4YAH X;  1US4 A;  1MXV A;  3PUV E;  3FXQ A;  3L6H A;  2I58 A;  2ALU A;  3KG2 A;  1NUY A;  3CRB A;  4F1Y A;  5AA4 B;  5I2N B;  3RUM A;  2G93 A;  3MZB A;  1FBD A;  4XKQ A;  4U2R A;  3LR1 A;  1FCK A;  1LEV A;  5H8H A;  1SW1 A;  1LCF A;  1DOT A;  2I3V A;  4PBH A;  2F5X A;  4ELR A;  5IKB A;  4OFL A;  4G68 A;  2PYY A;  4KCC A;  1Y4C A;  3QXM A;  2XA5 A;  3PUZ E;  1TT1 A;  3E78 A;  1N76 A;  4LZ5 A;  3C32 A;  1JVY A;  4FED A;  4YIC A;  2DQV A;  1R9Q A;  1LBX A;  2XXI A;  2Z8E A;  4PCD A;  4DLD A;  3EPE A;  3DM0 A;  5ICQ A;  5KZT A;  4H5F A;  4JVD A;  1LBZ A;  3K4U A;  4I1D A;  3V8X B;  4MJO A;  5H8N A;  3OMB A;  1UTH A;  1NNT A;  2UVH A;  1N3X A;  1DPP A;  1NUX A;  4C0R A;  1PDA A;  1SYI A;  4KQP A;  1PBP A;  3K6W A;  1B4Z A;  4LAT A;  3IFC A;  4I9D A;  3E4R A;  4HXV A;  4HCW A;  4DZ1 A;  4NF0 A;  4OET A;  3H06 B;  3ECR A;  1I69 A;  1ZTY A;  4MNP A;  4R6K A;  1LBY A;  1O7T A;  1FQE A;  1II5 A;  4I62 A;  2DE2 A;  4H5G A;  4H8J A;  4TQU Q;  4THI A;  1B3E A;  3RLF E;  3HO7 A;  4O3A A;  4OES A;  4OVP A;  3UK4 A;  3CR9 A;  3KOT A;  1UTH B;  2O84 X;  4PF8 A;  1TFD A;  3CG3 A;  2H5Y A;  2Y5K A;  3OEM A;  2DOJ A;  3U1O A;  1FPG A;  1B7U A;  2O7U A;  1IIW A;  4EQB A;  1K9Y A;  4GL8 A;  5DVJ A;  1I6B A;  1CNQ A;  2HXW A;  1ZBM A;  4F2Q A;  3MST A;  4BDR A;  3TEP A;  1HSE A;  3IK6 B;  3LSF B;  2ZYK A;  3O2A A;  4GRK A;  1T0K A;  3GYY A;  4G8H A;  1NH8 A;  1NNP A;  5FTH A;  1FQA A;  3MUQ A;  3OO9 A;  3FAT A;  1MY2 A;  1FPI A;  4I8C A;  4F1U A;  3HHG A;  2QVV A;  4C1T A;  4UAB A;  3TPA A;  1MPD A;  3G3I A;  4GQO A;  2DYX A;  1IQ7 A;  5AA2 A;  1Q35 A;  4OER A;  3U92 A;  4X1B A;  2Q2C A;  3TTN A;  3NOH A;  4DDD A;  2WX9 A;  2I4C A;  2XXV A;  1B58 A;  3T1B A;  1PC3 A;  4JWY A;  3MP8 A;  3A3C A;  3PU5 A;  2GFE A;  3GXA A;  4U22 A;  5H8F B;  3H6U A;  1MS7 A;  4OVJ A;  4PDD A;  1FBG A;  3QAX A;  1G0I A;  4G8N A;  5BUU A;  3K6X A;  2XX8 A;  3VE1 B;  3RPW A;  3RPL B;  2XXU A;  4U1O A;  2GHA A;  4ESW A;  4GVO A;  3KN8 A;  2Z8D A;  5L9M A;  4RY1 A;  1INP A;  4PQJ A;  4H6D A;  2Y7P A;  2ONS A;  4JSD A;  1I6Q A;  4OTE A;  2I49 A;  2XXX A;  5IM2 A;  1AH5 A;  4R74 A;  3D1R A;  1FPF A;  2QS2 A;  1YPN A;  5H8F A;  4P8B A;  3KOS A;  2OWZ A;  2ZNS A;  4M4G A;  5TP9 B;  1WDN A;  4OEN A;  1ZMG A;  3FVG A;  4GLI A;  4EQ7 A;  4OFO A;  2OK2 A;  1I6A A;  3E9X A;  3PUY E;  4F2O A;  3PUX E;  1US5 A;  5ET7 A;  4RPN A;  2V3U A;  2QFL A;  4IO4 A;  1GTK A;  2QS3 A;  4N4U A;  4G68 B;  5L9S A;  2PBW A;  2QS4 A;  3C31 A;  4NF6 B;  4G61 A;  4PC9 A;  5B70 A;  1D9V A;  2REG A;  2ZYO A;  2F3D A;  4MF3 A;  3B6Q A;  4OVQ A;  5IGA A;  5DW8 A;  3K6V A;  2OX3 A;  2F3B A;  2VD2 A;  2P2A A;  4FBP A;  2G29 A;  2OJT A;  4FEC A;  4JDF A;  1LAX A;  1IMD A;  4QHQ A;  4QSD A;  3TUS A;  5JK4 A;  2XX9 A;  2Q8M A;  4U23 A;  1MQJ A;  4POW A;  3MVY A;  1JVX A;  2L5V A;  2ZYM A;  1ANF A;  2F78 A;  4N8G A;  4EDP A;  5TPA B;  2F6G A;  3C33 A;  4U1Z A;  4PF6 A;  1DSN A;  4OXV A;  1LAH E;  2HCA A;  1YTV A;  4NED A;  3TKD A;  1FW0 A;  3C34 A;  1URG A;  1FPK A;  3CHG A;  4OHN A;  2B65 A;  3GBA A;  3GBB A;  1B3L A;  5DEX B;  2CZK A;  4M1V A;  2Y84 A;  5I56 A;  4PE3 A;  1LBB A;  3GZG A;  4P47 A;  4PFI A;  2CEY A;  1XS5 A;  4MFI A;  1QUK A;  3OSQ A;  3OO8 A;  1FTA A;  3LV0 A;  5LTC A;  4ZEF A;  1EYI A;  1PB8 A;  3FIR A;  1D9Y A;  3O66 A;  1B7H A;  4G8M A;  2WYP A;  5AE4 A;  1NUW A;  1FPD A;  3PGF A;  1SQY A;  2O1M A;  1SPI A;  4ZZE A;  3BBR A;  1YCJ A;  3N6U A;  3U93 A;  4I40 A;  4OAN A;  5I84 A;  5HM4 B;  2XXQ A;  2NOO A;  3MZ9 A;  3S9M C;  4IO6 A;  1NUZ A;  2HAV A;  2RC8 A;  1SYH A;  5EQ9 A;  2RF1 A;  1FPL A;  2VD3 A;  2DXR A;  4GBV A;  4H46 A;  2XXT A;  3EKI A;  4GWS A;  4OA4 A;  1MDQ A;  4RK9 A;  4RK2 A;  1FTM A;  3HST A;  2HHM A;  1Z7N E;  2XWO A;  3OD7 A;  3A3U A;  4JXI A;  3SKP A;  1Y3N A;  3PPO A;  5JTY B;  2Z23 A;  2F6P A;  4MMP A;  1QUL A;  4P1L A;  2F7B A;  1MY4 A;  3KEI A;  3ZSF A;  3K01 A;  1B3G A;  1EZO A;  2F97 A;  3H3G A;  3FVO A;  2M8C A;  3HHF A;  4F1V A;  3FXU A;  1QVS A;  3WAF A;  3UGW A;  2I6E A;  3M3F A;  1D4N A;  4P9K A;  2H9B A;  4QFL A;  4JWX A;  2ZNT A;  1LFG A;  4ECF A;  2XXH A;  3MWB A;  2Y7W A;  3R6U A;  2I48 A;  1JQF A;  1Y3Q A;  1AOV A; 
#chains in the Genus database with same CATH homology
 2O6A A;  3IOR A;  4HCW A;  3USD A;  1FTL A;  4RPO A;  1A7L A;  1Y1Z A;  2DWA A;  3K00 A;  4Z0I A;  3VFJ A;  3SET A;  4F19 A;  4DZ1 A;  3GLB A;  2VGQ A;  1OVT A;  1LBC A;  2I4B A;  2FYI A;  1CB6 A;  1MQH A;  4OET A;  1GV8 A;  3H06 B;  5H8N B;  2ZYN A;  5KDT A;  1EH3 A;  4FIM A;  3I6V A;  5JEI A;  4NF4 A;  4KPT A;  3SEY A;  2AL5 A;  5DT6 A;  3ECR A;  1I69 A;  1ZTY A;  5ICT A;  4KD5 A;  2XXP A;  4R6K A;  4DXC A;  4ONY A;  3G7W A;  3Q25 A;  2IA4 A;  1O7T A;  3U72 A;  4N07 A;  1FQE A;  3FJ7 A;  3TCH A;  3JYR A;  2F7C A;  3OEN A;  4LZ7 A;  3MVZ A;  2HZK A;  3CFL A;  1FQB A;  1QKA A;  4IGR A;  1BIY A;  1II5 A;  3CFX A;  1BKA A;  2V84 A;  1JW1 A;  2DE2 A;  1MH4 A;  1LLS A;  4H5G A;  4H8J A;  1IZ1 A;  4I62 A;  3ODB A;  4LA9 A;  2AL4 A;  4MLQ A;  1PB7 A;  4LQ2 A;  5A5X A;  4THI A;  1B3E A;  3PMV A;  4DIG A;  3LBS A;  2F36 A;  1JW4 A;  3RLF E;  4FE8 A;  1P99 A;  2A5T A;  3FVN A;  3K1M A;  3HO7 A;  3O6I A;  4O3A A;  4OES A;  4F39 A;  1ZU0 A;  3S9E A;  3FJG A;  4NF5 A;  3VXB A;  3UK4 A;  3CR9 A;  3KOT A;  1UTH B;  2O84 X;  2F34 A;  1L5T A;  4R6Y A;  1TFD A;  3LC8 A;  5H8Q A;  4Q8R A;  3CG3 A;  2H5Y A;  2VHA A;  1XC1 A;  3O28 A;  2W7Y A;  2ZXT A;  3R26 A;  4N6P A;  5I59 A;  5LOM A;  1POT A;  2VOZ A;  3OEM A;  4FEB A;  4G68 C;  4GXS B;  2NVU B;  3SEX A;  3HPI A;  2DOJ A;  3VVF A;  4YB6 A;  3U1O A;  3DP6 A;  3E13 X;  4EF1 A;  4KFQ A;  5K2X A;  3RY3 A;  3SEV A;  4POX A;  1TFA A;  3SES A;  4BDL A;  3T9V A;  2DVZ A;  3IB1 A;  5ITP A;  1B7U A;  1DMB A;  1LGB C;  3G3G A;  1MPC A;  3SDF A;  3MP6 A;  1A54 A;  3CSB A;  2D3I A;  3H6W A;  4EXK A;  1H45 A;  2O7U A;  1OQH A;  3G3K A;  3O6H A;  1IIW A;  4YKJ A;  3THI A;  4EQB A;  4H1X A;  2X7P A;  1RYX A;  1XVX A;  4PE5 B;  3IJX B;  4YKK A;  3K02 A;  3W15 C;  1MXZ A;  4GL8 A;  4HCY A;  4KR5 A;  3P7I A;  4XKQ A;  4XKP A;  5CMB A;  5DVJ A;  4BDQ A;  3VV5 A;  1MQI A;  4ZEI A;  2O51 A;  1I6B A;  2HXW A;  5EYF A;  1ZBM A;  3U94 A;  4FAT A;  1B5J A;  4F2Q A;  3EHS A;  3CFZ A;  3IOW A;  1GVC A;  3Q28 A;  4BDR A;  2RIN A;  1B5I A;  4G2Z A;  3MBP A;  4ZE8 A;  3TEP A;  1FTO A;  1HSE A;  1IEJ A;  1WVJ A;  2ZYK A;  3IK6 B;  3LSF B;  3O2A A;  4GRK A;  4OWD A;  1B1H A;  3HN0 A;  1T0K A;  1MM6 A;  4PFY A;  1MY1 A;  4G8H A;  1NH8 A;  2Q89 A;  1NNP A;  4BDO A;  5FTH A;  4U4X A;  1FQA A;  3MUQ A;  3IL1 B;  4IO7 A;  3OO9 A;  2H25 A;  4NF6 A;  4OMB A;  4OQO A;  5AA4 B;  3FAT A;  2PMS A;  1MY2 A;  1OLA A;  4RA1 A;  1M5C A;  1MG1 A;  1IXG A;  3EHU A;  4I8C A;  1LB9 A;  4F1U A;  3HHG A;  1IUD A;  1B3H A;  2QL3 A;  5I2K B;  3T93 B;  1Y4T A;  1LAF E;  1JNF A;  4C1T A;  1B0L A;  5ELV A;  2GH9 A;  3E3K A;  4JB7 A;  3TPA A;  5I59 B;  3S9M C;  2GHB A;  2LAO A;  1MPD A;  1QUJ A;  3G3I A;  4GQO A;  4LUB A;  1UIV A;  2DYX A;  4ZE9 A;  1B1X A;  2BJJ X;  3PPN A;  3PPP A;  3M3L A;  1IQ7 A;  4FJP A;  4GFR A;  4GOT A;  2XX7 A;  4OEV A;  5AA2 A;  1FQF A;  1MH3 A;  1Q35 A;  4O3C A;  2HFB A;  4OER A;  5CBS A;  3ILU B;  1ELJ A;  4KHZ E;  4KI0 E;  3SEU A;  3U92 A;  3KJT A;  3RGY A;  3V89 B;  4X1B A;  3RN8 A;  2Q2C A;  4NWC A;  3TTN A;  4F3B A;  4DDD A;  4QFO A;  4R72 A;  4E0W A;  3C36 A;  2GRV A;  3FV2 A;  1CE2 A;  2I4C A;  4IO2 A;  4PET A;  2XXV A;  2THI A;  1GGG A;  5CMC A;  4F18 A;  5B7D A;  3FGS A;  4YKI A;  1B58 A;  3KFM A;  3KSX A;  4IGT A;  3M8U A;  3IO4 A;  2ZMB A;  4WEP A;  2P0S A;  1OQG A;  1PC3 A;  4C1U A;  3D4G A;  1LAG E;  3T96 B;  3KGC A;  3PPR A;  1NNK A;  4JWY A;  5TU0 A;  5AA1 A;  3I3V A;  3EN3 A;  1FQC A;  3K1N A;  1Y1M A;  2QSX A;  3OXN A;  3MP8 A;  4KYE A;  5HPQ A;  3A3C A;  4RXL A;  1A40 A;  3DP4 A;  3PU5 A;  2GFE A;  3FVK A;  3GXA A;  1H43 A;  4U22 A;  4HW8 A;  3RNN A;  1B3F A;  1H44 A;  4IY5 A;  5H8F B;  5CI5 A;  3K2D A;  5IAI A;  3H6U A;  2OZZ A;  2Y7K A;  1MS7 A;  4OVJ A;  1M5E A;  3DP8 A;  2Z8F A;  3JV9 A;  5F7V A;  1N7W A;  1OLC A;  3BFT A;  4KYS A;  2RCA A;  3QAX A;  2DVC A;  3O9P A;  3TZA A;  2ANJ A;  1N3W A;  1IXC A;  3K0V A;  3TTK A;  3B7D A;  4G8N A;  3G3F A;  3CVG A;  5I56 B;  2E1S A;  5BUU A;  2PT2 A;  5DTB A;  2RC7 A;  3KN3 A;  3ILT B;  3K6X A;  4YU0 A;  2XX8 A;  1R6Z A;  1LFH A;  3VE1 B;  4KCD A;  1OMP A;  1O63 A;  2QMX A;  2XXU A;  4NMY A;  3RPW A;  1B6H A;  4FOR A;  2WKY A;  1FQD A;  3DLN A;  4U1O A;  1XT8 A;  1UIU A;  3IOV A;  1B32 A;  2GHA A;  3W9V A;  4ESW A;  1MXX A;  2YLN A;  4JWO A;  5DEX A;  3KSJ A;  3CSG A;  1IXH A;  1JET A;  3KN8 A;  4GVO A;  4YMB A;  2Z8D A;  5L9M A;  4ELP A;  1M5B A;  4RY1 A;  3JZJ A;  3PMX A;  2FNC A;  4PQJ A;  3IJO B;  3O97 A;  3T9U A;  4H6D A;  2O69 A;  2Y7P A;  5AA4 A;  3VXC A;  1UTB A;  4GXA A;  1LFI A;  1MY3 A;  2UYF A;  4JSO A;  2ONS A;  3VLV A;  2XXY A;  3HV1 A;  4ZEK A;  4JSD A;  1B51 A;  3TTR A;  1I6Q A;  2HEU A;  4OZ9 A;  4QF9 A;  3ZS6 A;  4BLA A;  3TYH A;  5BWJ A;  3OEK A;  4GD5 A;  3IB2 A;  2FA7 A;  4OTE A;  3UOR A;  2V3T A;  2REJ A;  4JBZ A;  2I49 A;  4ESX A;  5AA2 D;  1A8E A;  2XXX A;  1B9J A;  1H3D A;  1OVB A;  1URS A;  1AH5 A;  4R74 A;  3RTF B;  3N5L A;  5I57 A;  4Q5T A;  2P1S A;  2DP8 A;  4MLV A;  4G77 A;  2UVJ A;  3BFU A;  2A5S A;  4KYD A;  4OEU A;  2D5W A;  3I5O A;  2QS2 A;  3QUJ A;  1A8F A;  1YPN A;  4LVQ A;  1LST A;  1SI0 A;  5H8S A;  5H8F A;  3KOS A;  4DE8 A;  3O6G A;  2ZNS A;  1LCT A;  4M4G A;  5L9S A;  3PV0 E;  5CRY A;  3FZV A;  3S4U A;  3TAJ A;  5TP9 B;  1WDN A;  4QFN A;  2O7I A;  4K3F A;  3TCF A;  4NWD A;  4R9F A;  4OEN A;  1ZMG A;  3FVG A;  4GLI A;  4EQ7 A;  4OFO A;  3LSL A;  1D3K A;  3S2V A;  4OYV A;  2OK2 A;  4R2B A;  1I6A A;  3E9X A;  4RNS A;  1R9L A;  3IOU A;  2PT1 A;  2I0C A;  3PUY E;  4HS7 A;  5CBR A;  1YAE A;  2I0B A;  3PUX E;  3KBR A;  4F2O A;  3MW0 A;  4LON B;  1N7X A;  5H8H B;  1US5 A;  5KCJ A;  4BDM A;  4DCX A;  2XXW A;  4RPN A;  5M2V A;  1JEV A;  3R7X A;  3VLU A;  2V3U A;  3FD3 A;  4HTG A;  4Q0C A;  4YB7 A;  4IO4 A;  1USY H;  1MPB A;  1GTK A;  1VSO A;  1QKB A;  2QS3 A;  2IEE A;  3HCQ A;  2PBW A;  2QS4 A;  3MQ9 A;  3FV1 A;  1DTG A;  3MZ1 A;  4G68 B;  4MH5 A;  5CMM A;  3SEW A;  3C31 A;  4F31 B;  1FTJ A;  4WXJ A;  2YPN A;  4N13 A;  4NF6 B;  3G3J A;  3K1P A;  1SI1 A;  5TPA A;  2CMO A;  3CG1 A;  1BLF A;  3Q27 A;  4XKR A;  3VVE A;  4NF8 A;  5B70 A;  1S9T A;  1POY 1;  1D9V A;  2REG A;  2ZYO A;  3WAE A;  4MF3 A;  2HQ0 A;  3UA8 A;  4U4S A;  3B6Q A;  4GL0 A;  1Q1K A;  4ZDM A;  1QJM A;  3A09 A;  1MDP 1;  3C9H A;  1JEU A;  4XKN A;  3K6V A;  4O3B A;  4MBP A;  3IR1 A;  3UP9 A;  2V3Q A;  4EXL A;  1EZP A;  1ATG A;  1R1N A;  4ZS9 A;  3ZKL A;  4F29 A;  3CI8 A;  3T66 A;  4P11 A;  2NUV A;  2VD2 A;  3N94 A;  2NXO A;  2P2A A;  5CM6 A;  1MXY A;  4AB6 A;  3MVX A;  2I3W A;  4GF8 A;  4UAC A;  1TXF A;  4Q30 B;  4WKM A;  2G29 A;  1A99 A;  5FHM A;  1M5F A;  1P1N A;  2OJT A;  2H99 A;  4FEC A;  3PMW A;  4R9G A;  1EU8 A;  1MY0 A;  1NMU A;  3TOD A;  1USY E;  2UXA A;  5I58 A;  3T22 A;  5KDT B;  4JDF A;  3TFL A;  1LAX A;  1MXW A;  3H6V A;  4QHQ A;  4QSD A;  5KCJ B;  3TUS A;  5JK4 A;  4FAJ A;  1LB8 A;  2QJE A;  2XD2 A;  2XX9 A;  3OSR A;  4DXU A;  1SDX A;  1QUI A;  2UYE A;  4X48 A;  2B3F A;  4H8I A;  2NWJ A;  1VFD A;  3K6U A;  3UIF A;  4DXB A;  3M3K A;  5AA2 B;  3B6T A;  4U23 A;  1MQJ A;  4E0X A;  1XVY A;  4POW A;  3MVY A;  1JVX A;  2AIX A;  2OBG A;  4QFP A;  3V83 A;  2H4I A;  3QK6 A;  2ZYM A;  3RQT A;  3RT8 A;  3Q26 A;  1MQG A;  1ANF A;  2F78 A;  1SVX B;  4EDP A;  3CIJ A;  4QSE A;  5I2K A;  3H6T A;  2UVG A;  4P0G A;  5TPA B;  5CC2 A;  2F6G A;  1DTZ A;  4NF8 B;  3BKI B;  3C33 A;  4U1Z A;  4XIG Q;  4YZZ A;  1M5D A;  2DWJ A;  2RKM A;  1NH7 A;  2ONR A;  1N84 A;  1H76 A;  2Q88 A;  1JW5 A;  2OWS A;  1PEB A;  1B40 A;  5DVF A;  4L17 A;  5F1Q A;  3TTL A;  1DSN A;  2X26 A;  4OXV A;  1LAH E;  1VE4 A;  2HCA A;  4EQ9 A;  5ISU A;  1P1U A;  1URD A;  4ELO A;  3PPQ A;  1S50 A;  3KN7 A;  1MM7 A;  1PBQ A;  1YTV A;  4NED A;  3TKD A;  2DWH A;  1FW0 A;  1B52 A;  3QIM A;  3IAZ A;  3TCG A;  4ELQ A;  1NL5 A;  3C34 A;  3AXF A;  1URG A;  4R2F A;  4IY6 A;  4OHN A;  4PFU A;  4Z7E A;  1NFT A;  2B65 A;  3IOT A;  2DE3 A;  2Y7I A;  3S9N C;  3TMG A;  3GBA A;  3RTW B;  4ZEB A;  3GBB A;  1B3L A;  5DEX B;  2QPQ A;  4LQ5 A;  1N0T A;  1OIB A;  2F35 A;  5I2N B;  1ZIU A;  3RT6 B;  4H65 A;  1QW0 A;  4R75 A;  4RJZ A;  3MAM A;  3SER A;  4X1D A;  1IIT A;  2R71 A;  4M1V A;  2Y84 A;  5JTY A;  3LSX A;  3MVW A;  3OOA A;  3T9H B;  3VVD A;  5I56 A;  1GR2 A;  4F3S A;  3Q29 A;  1FTK A;  4R73 A;  1LBB A;  3GZG A;  4QFK A;  5DVI A;  3V5A A;  5EHM A;  2ZNU A;  4YB5 A;  5CMK A;  1PB9 A;  2UVI A;  3G3H A;  3IO6 A;  4GIZ A;  3MPL A;  3QUF A;  4ZED A;  1AIV A;  3MPK A;  3DEL B;  2OWT A;  2X7Q A;  1XS5 A;  1RKM A;  2AYS A;  3IB0 A;  4MFI A;  4LZ8 A;  4UA8 A;  1QUK A;  3OSQ A;  2OLB A;  3OO8 A;  4TLM B;  5ITO A;  1Y3P A;  1ZKB A;  3N26 A;  3TQW A;  1BP5 A;  4RYA A;  4R6H A;  4F3G A;  1IXI A;  4ZEF A;  2Q8J A;  1N04 A;  4IO3 A;  2ESN A;  1RYO A;  1PB8 A;  2H98 A;  5AA3 A;  3OEL A;  3C4M A;  1MQD A;  2D21 A;  2O1L A;  5FHN A;  3FIR A;  2A5T B;  1D9Y A;  1P1W A;  2F8D A;  2YJP A;  3H03 A;  1MRP A;  1UTB B;  3O66 A;  3TTM A;  2V93 A;  4XXU A;  3OO6 A;  1B7H A;  4G8M A;  4GWO A;  1KWH A;  5AE4 A;  1NNF A;  2O68 A;  4QRZ A;  1Y20 A;  2RC9 A;  4PFW A;  3PGF A;  1F9B A;  1VFE A;  4PFT A;  1HSJ A;  1SQY A;  1TWY A;  3C35 A;  2F7A A;  2KLF A;  2Z22 A;  3VLW A;  2VP1 A;  4NTL A;  3O29 A;  1A55 A;  2O1M A;  4ZZE A;  1B46 A;  3EHT A;  1WOD A;  1ZLQ A;  2CZL A;  4YAH X;  1US4 A;  5K2Y A;  4ISU A;  3BBR A;  1HSL A;  1MXV A;  1YCJ A;  3FUZ A;  3N6U A;  3FXQ A;  3PUV E;  3U93 A;  4ZEC A;  5J1D A;  3L6H A;  1Z7M E;  4TOZ A;  5I84 A;  2I58 A;  2ALU A;  3KG2 A;  2Q2A A;  4X9T A;  3D4C A;  3UN6 A;  1AL3 A;  5HM4 B;  3CRB A;  2XXQ A;  2NOO A;  3N6T A;  4XTC Q;  1J1N A;  3U8Q A;  3MZ9 A;  2RCB A;  4OFJ A;  4F1Y A;  3IX1 A;  2HAU A;  4IO6 A;  2G93 A;  4WED A;  5TP9 A;  3MC2 A;  2DWI A;  2OCU A;  3EF7 A;  3RUM A;  1SW5 A;  2HAV A;  2RC8 A;  5L8D A;  1P1Q A;  1SYH A;  3MZB A;  4G4P A;  2QS1 A;  4ZZA A;  4NE4 A;  4EUO A;  2RF1 A;  3LR1 A;  1FCK A;  1EZ9 A;  1XOC A;  3FXR A;  4U2R A;  2VD3 A;  1SW2 A;  3KJ7 A;  1SW1 A;  1LCF A;  1DOT A;  1XHY A;  2DXR A;  4TLL B;  2I3V A;  2XXT A;  3ZKK A;  2DS9 A;  1MDQ A;  3MP1 A;  3ONM A;  4RK9 A;  3TEL A;  5L9O A;  4RK2 A;  1FTM A;  2F5X A;  5EHS A;  4ELR A;  1P1O A;  3HST A;  1UQW A;  2E0S A;  5IKB A;  4OFL A;  1Y9U A;  1MXU A;  4G68 A;  4NF4 B;  2HZL A;  3KZG A;  1Z7N E;  3F11 A;  2PYY A;  4BDN A;  4ND9 A;  1B4H A;  1SW4 A;  4KCC A;  1Y4C A;  4IO5 A;  1B0H A;  3QXM A;  3OD7 A;  2DE4 A;  3A3U A;  3PUW E;  4JXI A;  1Y3N A;  3B6W A;  4IB2 A;  4QSC A;  3SKP A;  3TQL A;  3PUZ E;  2PX1 A;  3PPO A;  1TT1 A;  3H7M A;  1B05 A;  5JTY B;  4H0W A;  1N76 A;  2Z23 A;  5HBC A;  4LZ5 A;  1VR5 A;  3C32 A;  2F6P A;  1JVY A;  3W9W A;  5H8Q B;  4FED A;  2B3B A;  2DXY A;  3H4Z A;  1NKX A;  2Y7R A;  3FAS A;  4YIC A;  2DQV A;  5H8H A;  4F22 A;  1QUL A;  4P0I A;  5I2N A;  1R9Q A;  2XD3 A;  1S7Y A;  4EF2 A;  2F7B A;  4YKP A;  2XXI A;  1SD3 A;  1MY4 A;  2Z8E A;  3L6G A;  3FJM A;  3KEI A;  4LP2 B;  3ZSF A;  3K01 A;  1B3G A;  4YMA A;  1EZO A;  5FHO A;  1ZJL A;  2F97 A;  2XHD A;  3H3G A;  4H67 A;  3EPE A;  3FVO A;  3LUY A;  4DLD A;  2M8C A;  3DM0 A;  3HHF A;  5A5X B;  2QMW A;  5ICQ A;  4F1V A;  2ONK E;  5DYH A;  3T9X B;  5KZT A;  3FXU A;  3S9L C;  3EQ1 A;  4H5F A;  1QVS A;  4U21 A;  1O64 A;  4DCY A;  3WAF A;  2QRY A;  3UGW A;  3OO7 A;  1BTJ A;  2Q9T A;  2I6E A;  3K4U A;  1B5H A;  3M3F A;  3QYT A;  1D4N A;  3PD9 A;  4I1D A;  3V8X B;  5H8N A;  3OMB A;  1SBP A;  5I58 B;  1UTH A;  1NNT A;  2H9B A;  3VDF A;  4NF5 B;  5I57 B;  2UVH A;  2XXR A;  1B2H A;  4PP0 A;  2PVU A;  1N3X A;  4QFL A;  1DPP A;  2ZNT A;  1LFG A;  4JWX A;  4C0R A;  1PDA A;  1SYI A;  4ECF A;  2XXH A;  4KQP A;  2V25 A;  3MWB A;  4TQU Q;  1PBP A;  3TDJ A;  2R9J A;  2Y7W A;  3R6U A;  3K6W A;  2DSF A;  2I48 A;  1B4Z A;  3QSL A;  1JQF A;  4LAT A;  2ABH A;  4AB5 A;  3MJN A;  2R6G E;  1AMF A;  4I9D A;  1Y3Q A;  1B7Z A;  3LSW A;  3PD8 A;  5FTI A;  3E4R A;  4AQ4 A;  4F3P A;  1AOV A;  1DPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...