3VXKA

Crystal structure of osd14
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
263
structure length
263
Chain Sequence
LLQILNVRVVGSGERVVVLSHGFGTDQSAWSRVLPYLTRDHRVVLYDLVCAGSVNPDHFDFRRYDNLDAYVDDLLAILDALRIPRCAFVGHSVSAMIGILASIRRPDLFAKLVLIGASPRFLNDSDYHGGFELEEIQQVFDAMGANYSAWATGYAPLAVGADVPAAVQEFSRTLFNMRPDISLHVCQTVFKTDLRGVLGMVRAPCVVVQTTRDVSVPASVAAYLKAHLGGRTTVEFLQTEGHLPHLSAPSLLAQVLRRALARY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular mechanism of strigolactone perception by DWARF14
pubmed doi rcsb
source organism Oryza sativa japonica group
molecule tags Hydrolase
molecule keywords Dwarf 88 esterase
total genus 87
structure length 263
sequence length 263
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3vxkA00
1R50A 3KSRA 3PE6A 3ESCA 5D6OA 3WWOA 5JIBA 1JMYA 4QWMA 2BJHA 4QDXA 2WG2A 1F6WA 5AICA 4MQLA 2XQIA 3DYIA 1TAHA 1MX1A 1PV1A 2ORYA 4ARAA 4UBLA 5LZ7A 5JAUA 3FSGD 1A7UA 3D4LA 5ALHA 3KWJA 3HLKA 1F0PA 5AKXA 4A23A 5FRDA 4HS9A 2PUHA 1XZEA 4Y2XA 1SFRA 4P9NA 2Y2VA 4ZRDA 4H7IA 3H1AA 3H2JA 1X70A 4LYEA 3C87A 3U1TA 1K6EA 3VVLA 3HABA 4QLAA 2X8BA 2HA7A 4BZZA 5EIEA 5AH0A 2H7XA 3KXPA 5HCUA 4N5HX 1U65A 2XB6A 4FLFA 3UUFA 5HKAA 2HA2A 2PL5A 2CEKA 5DWDA 3O4HA 3V1KA 4DLNA 1QFSA 5DNWA 2JGLA 2WHQA 2BFNA 1GQRA 2OXEA 1YR2A 3OG9A 1CUIA 3QZUA 1AQLA 2WFLA 1H23A 2G4LA 5A6VA 5JANA 5J3JA 1A8UA 4UHFA 4XX1A 3FLEA 2XMCA 4DNOA 5A7FA 2WM2A 4ZV7A 5ALNA 1JJBA 3RM3A 1X2BA 3G8YA 5C81A 4CCWA 2PSHA 5DLPA 2R11A 4G5XA 4X7BA 1UOQA 3MUNA 3W9BA 5E4TA 5AI4A 4L3WA 1LPAB 3WWCA 3WK7A 5CURA 1KU0A 4CIAA 3ICWA 1EINA 4RE6A 1CUFA 5CBKA 5EHZA 5KWIA 1CVLA 3G9TA 4OCZA 5CT5A 1VXRA 4L9AA 4B0OA 3I6MA 4S0XA 1QIDA 2IX9A 1A8SA 5T4EA 2WTNA 1XZBA 5KBYA 4CG1A 5AKJA 1UK8A 1AUOA 4UHCA 5HFNA 2FUKA 5ALDA 5HFAA 1R9MA 1CUVA 3D2CA 4EZIA 5ALSA 3O95A 2BGRA 1U8EA 4X6UA 3N0TA 2XMBA 3V1MA 5D3ZA 5AM1A 4BRZA 4UBIA 1DWQA 3FBWA 2WFZA 5AI9A 4BATA 5AKKA 2J4FA 3DCNA 3OC0A 3BJMA 4INZA 5T4BA 1BEZA 2YH2A 2JGIA 3VVMA 4DSZA 4Q3KA 4PF1A 4ZI5A 1B6GA 5KREA 3C43A 2H1IA 3IUNA 3JW8A 3FLBA 2QKYA 4J0IA 3WIBA 3SWWA 4GEGA 3W04A 4GLBA 2FJ0A 2VJBA 3D2AA 3STUA 1QO9A 2WIKA 2AJBA 3H2IA 4LXGA 1FFAA 2I3ZA 5JAHA 1EXWA 5LKAA 4YASA 1E5TA 3MVEA 3D59A 3WLAA 1WB5A 3C6YA 4BVJA 5LP1A 3CXUA 3A2NA 3I1YA 1BCSA 3WQHA 4AO8A 3BE8A 1AMNA 1W4LA 2C0QA 2GZRA 3DYVA 4MEBA 3OURA 2ONCA 1ZI9A 4LHEA 1WHTA 3R3YA 5CMLA 5ALOA 2XMSA 1XRQA 1EK2A 1BS9A 1SCQA 4Q3LA 2CBGA 4X71A 5BOVA 5AP9A 5FOQA 2OGSA 5DTJA 5LIPA 1DQYA 4K5QA 4HTAA 3H2GA 1DINA 5DYYA 1ZD3A 5DTIA 1BRTA 4P92A 4G8BA 1H2XA 4Q82A 1MAHA 3ZLTA 1VJ5A 4Y2VA 3H0CA 5IVKA 1R1DA 1SCIA 5AKHA 5JD4A 4P93A 2ES4A 3IUMA 1CUAA 5LZ4A 1VA4A 3PFBA 1AURA 2K2QB 4HRYA 2OG1A 2FX5A 3HZOA 4BCBA 3QBJA 2WUDA 4E46A 4AXBA 1L7AA 5AOAA 3NGMA 2CZQA 3FYUA 5K3AA 1XQYA 2XUFA 4BE9A 1P0PA 1ZI8A 3ANTA 3SK0A 1HL7A 3V1LA 3TRDA 2XUPA 1QFMA 3GFFA 4HAIA 2BGNA 3I2FA 3T4UA 2XLBA 3WL7A 1LBSA 1IZ7A 2WHPB 3DEAA 5KWJA 4N8DA 1YAHA 4WJLA 2WSLA 4WCVA 2XMRA 3DJYA 4IHAA 3M81A 3IVMA 3IA2A 2PM8A 1VLQA 4XJVA 4Y2PA 4BAGA 3H2HA 4G8CA 4KAAA 1DT5A 1L7RA 4EUSA 1XLWA 2JIDA 4O08A 2UZ0A 3HC7A 1MO2A 2HL6A 4J0GA 1THTA 1CUYA 1VZ2A 5F4ZA 1MTZA 2VAVA 4EBBA 2WJ4A 4HXGA 4YK7A 1NU6A 2XUQA 2Z8XA 1E66A 1X2EA 1ACJA 4UUQA 1MNAA 5AKZA 2DHEA 2Y1KA 1E8DA 2HA3A 5IH7A 3I2KA 3M83A 1UZAA 2VJDA 2YASA 5C8ZA 3C5VA 4AB1A 3E1GA 1EA5A 2G63A 2BCEA 5JATA 1RWQA 4JH0A 1CUJA 4AO6A 3ZV7A 4DMHA 4JYPA 5T4HA 4J0KA 1CQWA 1C7JA 1YS1X 2J3DA 2EEPA 3FCYA 3AIOA 3WL6A 2PSDA 3G7NA 2C58A 4FMPA 5ALYA 4MQMA 3WKDA 4FOLA 4FBLA 3RLIA 4Y9SA 3CN9A 3VISA 1CRLA 5LLSA 4BRSA 4Q3OA 1CUWA 3D0KA 4AZ0A 2WU4A 1H2YA 1PJAA 3C6XA 1BN6A 3STVA 3NOXA 4RGYA 5AOBA 1WB4A 4OYLA 1IMJA 4H77A 1VE7A 4H7HA 1FFBA 3C6ZA 4E14A 1UXOA 2GYVA 3A2MA 1LGYA 2C7BA 3O4JA 2GZSA 5HF5A 5FUMA 1IUOA 1XZJA 2RI6A 4LXHA 4OUKX 3F97A 4BP8A 4FNGA 3T52A 1BN7A 2ZVDA 2ZYSA 1GQSA 3P2MA 1AKNA 4WDRA 4OYYA 1JKMA 1K5PA 2XUDA 1MNQA 1IUNA 4E11A 3EQ8A 3EIOA 3R3VA 3NWOA 4ZWNA 3KOOA 4Q1VA 2OQIA 1XFDA 1MT3A 2WG1A 5HF9A 5A62A 1YSCA 2JEZA 3BL8A 4U2FA 2W6CX 2V9ZA 3M82A 5JAPA 5AK3A 1K63A 5JADA 3QPCA 5AM3A 1ZI6A 3E4DA 4B83A 1IVYA 2RHWA 1SC9A 2H7CA 4WFKA 4X97A 4LYDA 3I1IA 4BCCA 2FJPA 3EQ7A 1QJ4A 5K3EA 3RARA 3O4IA 3VKFA 2D5LA 4A16A 3FSGA 3QPAA 5BWCA 1Y37A 1VZ3A 1WB6A 3JYHA 2WFMA 1MN6A 2W22A 1JJFA 4BYMA 1H2ZA 2WUGA 1ODTC 1CIJA 5EHNA 4BDSA 7YASA 4FLMA 4AN0A 3SX4A 4PNZA 1LPBB 4ZV9A 2QMQA 3PFCA 4FFVA 2J3QA 4G4IA 4H7FA 4C88A 1TKRA 3HJUA 5HF8A 1EB9A 4ZGBA 4GXNA 1QIFA 5CH5A 1XZKA 5FP0A 1XZCA 5I7UA 4OU4A 4KYVA 5AO9A 1QIMA 1UK7A 5ALZA 2WHPA 3GELA 4G1FA 3W06A 4CIBA 3QVMA 2EDAA 4ZXFA 4M0EA 2RGUA 3A2LA 4PSUA 5YASA 5HKBA 4I19A 3QMMA 4UBMA 3U0VA 4FBMA 4FDMA 3DLTA 1XZLA 4KR0A 2PUJA 1QO7A 1QIKA 2CJPA 1H22A 2CMFA 2IIVA 5EHQA 3H04A 4QDUA 2WTMA 4QE3A 3YASA 4GHWA 1W76A 1ORVA 3PUIA 4HRXA 2OAEA 1HQDA 2CUTA 1EDBA 4JNCA 1TQHA 1M33A 4G4JA 4BE4A 4ARBA 5LYYA 3R41A 1QONA 3AFIA 1I6WA 4DMFA 2O7RA 2ECFA 1GT6A 3I2JA 4HXEB 4WY5A 4UPDA 4MXDA 3GROA 4CCYA 3O4GA 2VA9A 3I2GA 4DGQA 4X95A 3WK9A 2H7YA 2D0DA 3WWDA 3IULA 4PSDA 4B84A 2DCMA 2WIFA 3AZPA 1QOZA 5AKYA 5C8VA 1QIGA 1YCDA 4IH4A 4W1RA 5CT9A 3WIOA 2OQVA 3F9CA 3HACA 1WM1A 4LIPD 4ETWA 1L7QA 3EF3A 1TCAA 4QA9A 3AJAA 4H35A 2XQKA 2ZYIA 3BJRA 3WZMA 1XQXA 4OB8A 1LPOA 1GPNA 3DKKA 3A70A 1ZD5A 3SC2A 2HU5A 3DOIA 2QJWA 3WMRA 5K3DA 4PW0A 3PF9A 4B9EA 3LIIA 3WK6A 4K6KA 1CEXA 1F8UA 2HFKA 3E3AA 4NVRA 1GKKA 3CCBA 1MU0A 5AHXA 4PSCA 3ZPXA 1MX5A 4X85A 1WPRA 4K2AA 4ROTA 1UKAA 3BDIA 4I4CA 4AX4A 4N5IX 2HADA 2JEYA 4TVKA 3BXPA 4N8SA 4U2CA 4J0JA 5ISMA 4C4YA 2BKLA 1LPPA 1BE0A 5AI6A 2CB9A 1CUUA 4YX9A 3WL5A 1NX9A 3R40A 4EY7A 5HK9A 1CUEA 5C7YA 2XI4A 1YA4A 4X00A 4Y2RA 5ALIA 1CUDA 4Y7DA 1ZD4A 4EA6A 2QJRA 1UFOA 4GW3A 5FPPA 1VKHA 2DR0A 2XMZA 1DQZA 2V97A 4UFNA 3WKEA 5I8PA 3STXA 2QM0A 1NU8A 3DQZA 4IO0A 2BAGA 3C5WP 5ALWA 3QITA 1J2EA 1YAJA 2AXEA 3V9AA 5CXUA 2X76A 5ALTA 4UBOA 2DHCA 4MWTA 2HDWA 1IUPA 5DYTA 2C5GA 4B80A 1A88A 1W6RA 2V98A 4X91A 3ANSA 3I6YA 2B20A 1U4NA 3WK4A 1K4YA 2DQZA 1QLWA 3DOHA 1PFQA 4MEAA 4JEIA 4J0HA 3C8HA 2WKWA 1CQZA 4X90A 3VDXA 3HSSA 4UHBA 1J06A 3OOSA 4DNQA 4DSAA 3LS2A 3IUJA 2HA5A 1ZOIA 1R3DA 5HQ3A 3OTQA 4BDTA 3QH4A 3STWA 3TEJA 1KU6A 3RK4A 4QZVA 3G0BA 1TCBA 4FKBA 3MUOA 3F8SA 4QDZA 3R3ZA 5K3FA 1QZ3A 2WIDA 5FXMA 3WA7A 5FV4A 1DT3A 4BC0A 1XZIA 1TK3A 5CH8A 3H19A 3ZI7A 4CG3A 2WLSA 4W9RA 1W1IA 4AO7A 2QR5A 1C7IA 5CW2A 1AGYA 2BUCA 1XQVA 3L1JA 4K6HA 5FKJA 4QEKA 1XZFA 3L1HA 5ALGA 4GDMA 2GYWA 1LPMA 1HKHA 3C70A 2HRQA 5EIAA 1LBTA 4RE5A 4OSEA 2OLEA 1OCEA 1XLUA 4KAFA 2AJDA 2ZSHA 4TPKA 4UFOA 3LLCA 1CPYA 4XVCA 1YB7A 3FYUB 2JF0A 2HHAA 2PX6A 3HXKA 2ROQA 4L0CA 3WI7A 5FLKA 5CH3A 1P0QA 5D7BA 5A7HA 4FNMA 1CUXA 1LZLA 3WJ1A 5DYWA 4N8EA 3H17A 3ZWQA 3I2HA 4C4ZA 3AIKA 2ACEA 1E3QA 3UMJA 1VXOA 3GUUA 2OCKA 1CUSA 5ALXA 1GXSA 2QXTA 1MJ5A 1CUZA 2OCIA 4LXIA 4RNCA 3MGAA 3Q8WA 1QIHA 1THGA 3DNMA 3ESBA 4ZREA 4GI1A 4KRXA 2XUGA 4Q34A 4WDQA 4DMCA 1W52X 4B0PA 4Y2SA 3DL4A 1T4MA 4L72A 1YASA 2XE4A 1E8MA 3PF8A 1CUHA 3TGLA 2VF2A 2DSNA 1E8NA 5AKLA 2NW6A 3W2TA 1HBJA 3G0CA 3HI4A 3O9MA 5FDFA 1GPLA 1SCKA 2XQFA 3FVTA 2OCGA 5C8XA 4DIUA 2HU8A 3QPDA 1G5FA 4BVLA 3FCXA 1UKCA 3WK5A 3L1IA 5JD5A 4G4GA 1BCRA 3D2BA 3GZJA 5T4FA 4OU5A 3IUQA 5CTAA 4AZ3A 3QMVA 4FTWA 3K6KA 4H7DA 5E4JA 4P08A 2HA4A 2WU3A 1ETHA 2AJ8A 4KEAA 3D5EA 1AX9A 3G0DA 2OGZA 2C5FA 4LKOA 3UUEA 3G0GA 5AKGA 5JAOA 3EBLA 1GPKA 1JU4A 3C45A 5ALQA 4HXFB 4J03A 3WYNA 1HLGA 4B85A 3G9ZA 4X93A 6YASA 3DKRA 1EX9A 5DNUA 4U2EA 3I2IA 1CUBA 1D07A 1DTEA 1P0MA 4D9JA 3ICVA 3AILA 1AC5A 2HIHA 1G42A 4KACA 3IDAA 5AKEA 3R0VA 1QIIA 1HPLA 5ALUA 2PKYX 5AK6A 4PV7A 2WQZA 3C8DA 2QRUA 1ZD2P 3FYTA 4IH1A 1WOMA 2G5PA 3IURA 3X3HA 4OPMA 2HA0A 3VJKA 4BP9A 4F60A 4A5SA 3M3DA 4B7ZA 2QOEA 2JGMA 3STYA 1MAAA 1GZ7A 1B41A 1CLEA 3WKCA 5K3FB 2GBCA 1BU8A 2J4CA 5JZBA 3I6ZA 3LIPA 1ORWA 2XT0A 4KE9A 1BEEA 5HF6A 1TIBA 2PSJA 3H1BA 3KDAA 4NMWA 2WJ3A 5ALEA 3OPMA 4FHZA 1USWA 2G5TA 5EHXA 3IIIA 1DWOA 1S8OA 4Y2YA 2PU5A 2JGKA 4BBZA 1KEZA 4QDTA 2P8SA 2AJLI 1GGVA 4Y2JA 1N1MA 4XIIA 1ODSA 1UT6A 5FPQA 3HEAA 4H0CA 3STTA 4BB0A 1Y7HA 2VEOA 3LCRA 5LZ8A 4UBNA 3QMWA 1R9NA 3K2IA 1FFDA 2V96A 2O2GA 5LZ5A 2HFJA 4UHEA 1OXMA 1Y7IA 1JU3A 2WFLB 4WFIA 2XUKA 1DX4A 4BAZA 4Q05A 1LPNA 4AQDA 3N2ZB 4F0JA 1E89A 4BCDA 3GBSA 1O6FA 5HZGA 4QWWA 1SOMA 4JYMA 4AMYA 1AZWA 4B6GA 4XWGA 3EQ9A 4GECA 2QXUA 2R8BA 1U2EA 2I3DA 4J3JA 2QUAA 1LZKA 3V1NA 1G66A 1RYYA 2XMGA 2VT6A 2WIGA 3WJ2A 1Z68A 5JD6A 4Y2UA 3BF8A 4X6YA 4B82A 4C4XA 3R3XA 4BVKA 4G8DA 3JWEA 3S2ZA 2LIPA 4H7JA 1ZJ4A 1R88A 3D3NA 3I28A 3FNBA 2JGFA 3G02A 5ALVA 2EDCA 1XZHA 1QIJA 1G4HA 1J07A 2AJCA 3VJMA 3CCCA 4QDOA 4W1PA 1EDDA 2I78A 2XUHA 1MPXA 4X92A 5AI5A 5IKXA 4UBJA 1EI9A 3BDVA 4BAUA 4NS4A 4CFSA 5IVDA 1CFJA 4UBKA 1XZDA 4HVTA 3QYJA 1JT2A 2PPLA 2XUAA 1UOPA 1ACLA 1LPSA 5EGNA 4HZGA 1WPXA 2B4KA 5K3CA 5A2GA 2YYSA 4WY8A 3WKAA 2WG0A 1Q83A 2PSFA 2OPHA 3PDCA 2QS9A 2Y6VA 1ZGBA 4M0MA 2PBLA 4KJXA 2HA6A 5AOCA 1JFRA 2BUBA 4U2BA 4EY6A 4DMKA 1FFCA 4OD0A 2BUAA 4UHDA 4BZWA 4J7AA 2ZJFA 1ZICA 1W75A 4OB7A 4I3FA 1XZAA 2Z8ZA 1TCCA 1EDEA 3B12A 3FLAA 4CCYB 2Q0XA 2Z3WA 1IZ8A 3WA6A 4H7KA 4NZZA 2CKMA 2RONA 5JALA 2VATA 5AI8A 5E4YA 3VJLA 2ACKA 3KD2A 3H2KA 2JGEA 2GYUA 4F5ZA 4G9GA 3IBTA 3DL7A 5AM5A 1YB6A 4JUIA 5LKRA 5DJ5A 5ALMA 4OB6A 3F96A 3FOBA 4GWLA 5I9IA 1ZIXA 3CN7A 4C01A 1QIEA 1Q0ZA 1QTRA 4BTVA 4M0FA 5BV7A 4U2DA 5ALFA 5ALRA 2QZPA 2XUIA 1YS2X 3R3UA 1FFEA 3AUKA 2O2HA 1TRHA 1CR6A 2ZYHA 4EY4A 2QTBA 1UWCA 5D3KA 3TJMA 1EB8A 1UOOA 4IQ4A 2QUBA 1XZGA 1JI3A 3ZLUA 5AM2A 4FWBA 2XQJA 1WCYA 5LZ9A 4E15A 3AINA 1FSSA 3ESAA 3F67A 2GBFA 5AIAA 3WZLA 1J1IA 1UK6A 2C4HA 2DFPA 4DTCA 1LNSA 1ZJ5A 3B3QA 1Q84A 1CUCA 2C0PA 1XRRA 3FAKA 4MWSA 1QGED 2VAXA 4TGLA 3WKBA 4AMZA 2HM7A 2XMQA 5SYMA 2QVBA 1EHYA 4EY8A 4V2IA 4FFWA 5HQ3B 5LZ2A 3ZLVA 1WHSA 1C4XA 1R4ZA 2WIJA 5AI0A 1DWPA 2JBWA 2RAUA 3ESDA 1T2NA 3AIMA 1QE3A 2VSQA 1ZIYA 5K5EA 3O9VA 4G9EA 1VE6A 3PI6A 1O6GA 2RIPA 2XUJA 3BIXA 4K6GA 2VJAA 1XQWA 2GBGA 2PVSA 5ALLA 5ALJA 4RPCA 4BC1A 2VTVA 1UK9A 4PQEA 2YXPX 3A6ZA 3HRHA 2OCLA 3WWEA 3FVRA 3HYSA 3B5EA 4KRYA 4MJ3A 4CG2A 5AM0A 4X6XA 1ODCA 1OILA 3GA7A 1EVQA 3G0IA 3LP5A 2ZSIA 3DS8A 1BROA 2ZJ7A 5SYNA 3E0XA 2OAGA 5CT8A 5IVHA 4EB0A 4DM7A 2DHDA 3ILSA 3RKSA 3R3WA 4J0CA 2ZJ6A 3W9UA 1A8QA 2O7VA 1FJ2A 1XRLA 2XDWA 1GKLA 3AZOA 4X94A 1F0NA 4X3CA 3C6BA 2GBIA 4UFPA 4W63A 5JARA 4KE6A 1CV2A 4KE8A 3W05A 4Y2QA 1DU4A 2VT7A 1H2WA 5E2IA 4KAJA 1MX9A 2H9YA 2VQ6A 2DQYA 4PO3X 5A71A 5ALKA 5JYCA 1XKTA 2RHTA 3O0DA 3ED1A 4BTLA 2XQGA 5AKIA 1N5RA 2I03A 2QT9A 5EI5A 2Y6UA 1K8QA 4YPVA 5AM4A 2XLCA 3G9XA 5EIHA 4DNPA 5AK4A 2ZYRA 4DYHA 1EH5A 4B9AA 1VA5A 3F98A 3S8YA 4KE7A 3BF7A 3KWFA 3PUHA 2HU7A 2Y2UA 3NUZA 5AJHA 2WUEA 2B9VA 4C89A 1JJIA 4CI9A 4Z49A 2WILA 1P0IA 3FWHA 4H7EA 3PICA 4EY5A 3WK8A 4F21A 4C87A 1EK1A 4MYSA 4B81A 4QLOA 2PSEA 3IB3A 3AZQA 4AN1A 2B61A 3D7RA 4Y2TA 1JMKC 4UHHA 4U2GA 1EVEA 4J0DA 3BWXA 3WL8A 5BWBA 3WWPA 1Q0RA 2Z5GA 3WYDA 4C6HA 2X5XA 3OM8A 5JZSA 2Z3ZA 2WUFA 1HDEA 1RP1A 1N5MA 5AIBA 3H18A 4WFJA 1ZGCA 1YA8A 4GBGA 1QTIA 5CRIA 3FYUC 5AK5A 4W1QA 2O2IA 3DDUA 5CT4A 2WHRA 2XUOA 1DX6A 5DNVA 2E3JA 4EHBA 3DD5A 5CXXA 4W1SA 2WJ6A 5EFZA 2OGTA 1VOTA 3V48A 1N8SA 2PU7A 5IVIA 1XROA 5JZ9A 1ISPA 4IH9A 3VXKA 5ALPA 1XRMA 4ITVA 3Q0TA 5JASA 2IITA 4MYDA 3G9UA 4H18A 1XRNA 1XKLA 1LLFA 2VJCA 3BIWA 5ESRA 2JGJA 2XMDA 4QNNA 1XLVA 3K9BA 5H3HA 1XRPA 1UKBA 5K3BA 5A7GA 4FLEA 2HRRA 3QM1A 5CT6A 4DNFA 1XZMA 1CUGA 5HK8A
chains in the Genus database with same CATH superfamily
3WR5A 4KU4A 3KSRA 3RT1A 1TIKA 3QE4A 4HMOA 1DFIA 2FWBA 4G25A 4BKRA 1K3FA 4OMFG 1G18A 1LLDA 4GBED 1JLKA 1JMYA 4HJXA 4QWMA 1USKA 4D26A 1K92A 4KDFA 2IYWA 2HDHA 2B7BA 4P5DA 4JQOA 2ZSUA 4HGQA 1RI3A 2CCJA 2N75A 2YN0A 5A4DA 4ZHQF 1NM5C 3OFKA 1VMKA 5TQ2B 1I7LA 4BPRA 1T5OA 2H2DA 4BHTA 4MLZA 5C18A 2Q5CA 2QVYX 3EZ6A 2DBQA 4YCDA 5LDHA 2EFYA 5LQAA 1PV1A 1UF9A 1GWNA 3NKLA 4AG6A 1Z4LA 2ORYA 2CWWA 3LDFA 4FSHA 3O5AA 3VOSA 4WPGA 2KQUA 3CWZA 2XDAA 2YZ2A 3HUDA 3R9KA 2PTGA 2RH5A 3AP2A 3LXUX 1EUDB 5BYKA 2KBEA 3FGZA 3PGLA 4GRDA 3A6GA 4RW0A 4AJ1A 4LN1A 3U40A 4CM1A 4URXR 1NVTA 1PE0A 4BP1A 1XDBA 3FW1A 1E3DA 3EE6A 1PWEA 4DABA 3QELA 5ALHA 3KWJA 1GDDA 1W35A 3KDSE 3BILA 5MN5A 2H5EA 1KVRA 3FDXA 4HEA6 4JJ8A 3IUYA 4IIJF 1HM5A 1Z2DA 2WJGA 1CNEA 5LQDA 5HTOA 4O1HA 2Y2VA 1ORTA 4XUEA 3R3JA 5C34B 3UJAA 2AOTB 4XB2A 1JHAA 1VHQA 2AN5A 2L17A 1VJRA 2RGYA 3VAYA 4BMOB 1ZCJA 4DC9A 3H1AA 2XCRB 1X70A 4E21A 4QPDA 1GNPA 3VR5H 1XJ5A 2X15A 2A94A 3BWDD 5EY5B 2E18A 1ORRA 2DT5A 3TQRA 3L6CA 1QYCA 3WYAA 1TGVA 2F1HA 2ZDHA 3DVQX 1B3RA 3VVLA 3HABA 3BULA 3RBVA 1L8OA 3INGA 3CLHA 3U7IA 4QLAA 5G1OA 4KWEA 5HFJA 1JXOA 1V1RA 2VHWA 2X8BA 2FR0A 1YB1A 1VP9A 1ZZEA 3REFA 1VKJA 2GPYA 2PT7A 2GBPA 4JROA 3CLSD 1H5UA 3N6XA 5DM0A 3I76A 1G60A 1ULAA 4YTEA 3WIVA 3QVGB 3CEJA 4H1VA 4Q1AA 4OLFA 3K5HA 3C7CB 3CLRC 3EXHB 3AF2A 3PV0A 4DMRA 1RRGA 5F78A 2MU1A 3BXZA 3EBPA 4FLFA 2CUNA 3IP5A 5EWJA 1QDEA 4ZFNA 1CCWA 3UUFA 2Y27A 3SLRA 5CFPA 1B3BA 1YR9A 2AS0A 1RJ9B 4NZPA 3RFVA 1FOEB 2PZBA 1Q22A 5BMOA 3JZIA 4B3GA 1EM8B 3JYNA 4EARA 3G2OA 4WLNA 5HUQA 3PFFA 1VLHA 4ND7A 1TT5A 4AICA 2CEKA 1I3CA 3JWHA 3KM0A 4B8YA 4AKIA 2AN3A 4RNCA 1UZMA 4G5HA 3HB0A 3ZHYA 2WHQA 1NN0A 5L7YA 2QTFA 3LA6A 4NP6A 3G8DA 4FYWA 1JEQB 1Z0SA 4Z3OA 2IH5A 1PL0A 3LRPA 2REBA 4C0WA 4PRLA 4EKNB 1MJGA 4H59A 1RWVA 1KAEA 3HUFA 2ZRPA 1ZSNA 5C1BA 5F1OA 1A96A 1I2CA 4HTFB 2HW8A 1IJKA 3NQ41 2X1HA 4GOMD 4M46A 3TLGB 1TKBA 2NVOA 3A1EA 4HDQB 4MVJA 3VSDA 1P5HA 3CH4B 1Q0QA 2WFLA 1ENZA 1QP0A 1L7VC 1XTVA 1J2UA 2G4LA 1EGHA 4CQJA 2IS1A 2IK8A 4F45A 3HA7A 2IIQA 1XK7A 1J42A 2QW1A 4XX1A 4DV5B 4EX7A 4PYJA 3PT9A 4MB2A 4QO8A 3BSFA 3GRKA 1P1RA 5J40A 4UMVA 4D92A 2OCAA 2BFAA 1P5JA 2R2AA 2W83A 3K5PA 4YBZA 5B4VA 4W82A 2NZWA 4KPEC 3KAPA 5FF9A 3VGPA 5C81A 3DM9B 2PSHA 1WW3A 4M0LA 3TLEA 3WAKA 2P78A 2JA2A 4G4SO 3B20A 4B71A 2VYCA 1ZQ1A 2ZRBA 4XDYA 3GLIB 1WOYA 1EMDA 1ZD1A 1SOAA 4IHJB 1MA3A 2AXQA 2Q1TA 4NBNA 1HEYA 4UM9D 2PUVA 2JLWA 1YJ5A 4PSKA 4XSHA 2FQXA 2BHTA 2GA8A 2VP0A 2P69A 2DVMA 2LIVA 2EW2A 3HZHA 3MUNA 3W9BA 2IYTA 1V5WA 7REQA 5AI4A 1GGKA 2B4TO 4AX8A 4B8ZA 2Q4OA 4CEIB 3F3SA 1LPAB 3N8IA 2LV8A 3QI7A 3BAZA 4FIZA 1FYFA 4YV1A 4NHOA 4ZCMA 3EH2A 2HNKA 1JR4A 1KU0A 4QATA 5DHPA 1RYEA 3REQB 3RBXA 1TQ8A 3RU7A 4CFZA 5CCXA 1WIWA 4FOPA 4DJAA 4MUNA 1OAAA 3CWCA 4HEHA 2B4YA 1RQRA 4GMFA 4MTCA 4JJ4A 1OZ0A 1EINA 5IAJA 4DZTA 4CIAA 1A8HA 5CBKA 3OQPA 3G88A 3RYIA 1Z0KA 5K0TA 1QH1A 2R86A 5KMGB 3C16C 3G2KA 5D1NA 3SKVA 3ZQ6A 3FHCB 5AQ1A 3T1QA 5LQJA 3TRFA 5CBPB 1SB8A 1T1IA 4E22A 3Q5DA 2CJYA 3F5FA 4B0OA 1ZIOA 2DBZA 2Y92A 3D64A 3I04A 3I6MA 2Q62A 4KN6A 1DAMA 1E5QA 1QIDA 4K8OA 2IX9A 4V0KA 1LFDB 5LQMA 3NVKI 2WTNA 4KLZA 1NMZA 2RAFA 3K9LA 2REXB 4NL4H 3ZNOA 5CA1F 1UMCB 3LPDA 5UKDA 5K8CA 1K3UB 2CV0A 1P2GA 4OHRA 4B32A 3PPIA 4D56A 4MZDA 4G1BA 5CB6A 4IBOA 2C95A 2I7TA 3AP3A 5EJ8A 1P44A 1ZVQA 3QKSA 1IIBA 3I0ZA 5AKJA 3EDQA 2B2NA 1BOFA 2R8EA 3AVPA 3PQEA 4NYIR 5LP6A 2ZDQA 3SHOA 4EVRA 1APBA 3E22B 4HDRA 4MS4B 2CLFB 4EHIA 2QMYA 4Y30A 5FI1B 1XWWA 3BMQA 1CUVA 2BEWA 1GKIA 3RBAA 3JWPA 2F55A 1DTWB 1CIVA 1NUSA 3NT5A 3ZE2B 4NCBA 2YIMA 3CJRA 2K87A 3EC1A 3O95A 4WK6A 2ZKIA 4DRXB 2G1AA 3EWNA 2OECA 1KDOA 4I36A 3CT6A 3EXEB 4YMSA 1BFDA 2BOVA 1TCUA 1HFJA 4PXYA 5LP6B 4UNQA 5HE8A 3RIYA 4MZXA 5D3ZA 4DCPA 3A1VA 4NH0A 1FSFA 3I09A 4WXEA 4YB8A 3ZV4A 3G0HA 4Q9JA 5LFAA 1XD2A 2R8RA 4OL0A 4WCFA 3T4XA 4LHXA 4AT1A 1J8DA 2O50A 1BIFA 2XCTB 4G0WA 4BATA 1TA4A 2GPNA 2CLKB 4Y0AA 4EI8A 2J4FA 3OC0A 4A15A 1S2NA 2V65A 1XA4A 2JGIA 1ISRA 4Q5IA 5IN4A 4DSZA 3MINB 3EPKA 2X41A 4Q3KA 2R9VA 5I9TA 4X44A 4J3NA 4MKFA 3E8MA 4RENA 2XRYA 5BR7A 1B26A 2V6FA 4BMPB 4ZMSA 4WZBA 3KAQA 3HJBA 4ZDWA 2ERYA 1LSJA 2UVQA 3DVSX 3U4IA 3ZDAA 1XXHA 4M8NE 4OH7A 4CMEA 2XBMA 1VJ1A 2D1YA 3VR6A 4GEGA 4GLBA 2AOUB 5KNBD 5E6UB 1O77A 2FJ0A 2G9RA 1LS1A 2X42A 4FEAA 4TXHA 4D4JA 3D2AA 2BSAA 2WIKA 3D6UA 4Q3CA 2F3SA 3V00A 3IEVA 3QXSA 3QYFA 3A1TA 2RH4A 3EF0A 1U0LA 4PPFA 5IS2A 4OHMA 1DKNA 1W87A 3C3DA 4FGJA 2FEWB 1J9EA 3RVDA 4K6MA 3ZIDA 3ZWNA 3ROTA 3GHHA 3U7FB 2P3QA 1VGQA 1XPJA 2H4XA 3C6YA 3GNQA 4YNBA 3TIGA 1JLHA 4WBNF 4BVJA 3DHYA 3ZDQA 5EWLA 1ZA1A 3I1YA 1NL3A 3AC0A 2ZROA 1QX4A 2FI1A 1B16A 3Q6NA 3K9GA 4B3MB 4D8VA 4X20B 1DCKA 8ATCA 2PWBA 5JH7F 1ZAKA 1Q7GA 4Q7LA 5E4FA 4I1OA 2C0QA 2C57A 1G1MA 4Y1RA 3DYVA 3BCRA 4PO1A 1GM5A 3IAEA 2BEWB 2ABWA 1XVVA 5JJLA 4Y9DA 4UUOA 1W2HA 2XE7A 3JASB 1IZZA 2FQQA 2FPRA 2YIJA 2ZTLA 2H0AA 1IQUA 2WYHA 3PX3A 1R10A 4IX9A 2A4MA 3MIZA 2GJ9A 3WGQA 5I01A 2OUKA 2L19A 3TYXA 3B36A 4D81A 2J3IA 3RHTA 1NJ6A 4XKJA 4Z8YA 1U4SA 2Q6OA 2YY7A 3KFXA 2HEGA 3SFTA 3LPNA 3OD5A 4M1KA 1N2SA 2V6BA 3IKJA 3OH8A 2H48A 5B7PA 5GJBA 3NVDA 3OICA 1XRQA 1EK2A 1WA5A 2FR1A 2QM7A 2ZWVA 2OBNA 5H16A 5J5VA 4EYSA 1BSVA 3IKTA 3MHTA 5FTNA 3DKPA 4Q3LA 1RLUA 1Y1RA 3A7EA 1ZVVA 3LNCA 4CDMA 2UU9B 5AP9A 2P90A 3PZRA 5FOQA 5FOXA 2C5BA 4CZ2A 1L8XA 4M60A 3IP1A 4PNPA 4QRHA 5BVGB 4R0VA 1T9AA 5EERA 2H3HA 4K5QA 5JJ5A 2CLEB 5E9AA 2JFGA 2PRZA 3M6WA 1PJ2A 4OGWA 1GL9B 1XVUA 3DPUA 1SG9A 3ED5A 4V0QA 5I3CA 1ZD3A 1E9FA 5DTIA 3RVBA 1YR8A 1LDNA 4PX9A 3MRVA 3W79A 3MBIA 4G8BA 4UEOA 1ZCZA 4BO3A 3L8ZA 1BWSA 4Q82A 1IHXA 2Q29A 2UUCB 1BE1A 1EJ2A 2PFKA 3ZLTA 3AB8A 1VJ5A 3CPJB 4Y2VA 1M5TA 1K5HA 1V25A 2CD9A 2ZS8A 3K70B 1SCIA 3RGGA 3W2FA 3UNXA 4BFUA 2REQB 5AKHA 3AM1A 3CG0A 1C8BA 1ZONA 1LF5A 5KTOA 4TZKA 3IUMA 3BVPA 1CUAA 1BRMA 2JKYA 1RVDA 4M1WA 5B5SA 2AFHE 1KFJB 4M0PA 5AVYA 2DR2A 4LTNA 2Z1NA 3KEGA 4L73A 4IGKA 1A72A 2FRXA 2CL0X 1E1KA 1V1RB 2BHLA 1LI7A 3ZWPA 3ICQB 4DCJA 3KBBA 4OMCA 3O8QA 2I2DA 1MDFA 3MQ2A 2REQA 2O0LA 1RAGA 2DBVO 3G89A 2OY0A 3DMHA 4UNNA 5E9WA 3WDKA 5CB4B 2RGRA 5AOAA 1OZHA 5K3AA 1JDPA 5KHLB 1KEUA 4RTQA 1CW2B 1JDNA 2UUBB 3TIFA 4JI1B 4ED9A 2W8BA 1P2SA 1VPDA 4OLBA 4MH0R 3LVRE 1LJUA 3ZIAA 5JZVA 3DZGA 4Y6GB 3CNEA 3U26A 1P0PA 1SHUX 1H6AA 5TQ2A 2IHJA 1WCIA 1MVNA 1BJTA 3FNIA 2ZS7A 2X58A 4KLNA 4NYJQ 2NZ2A 1RBZA 1YCFA 2XUPA 4DFDA 5K7SA 5AT1A 4K05A 2GKSA 2P30A 2QJFA 3FTFA 4OX9Y 3DG9A 1UM8A 1SK9A 4HAIA 5IBRA 4F5EA 3I2FA 2GM4A 4L5JA 2XOKA 3JQRA 4MCAA 3HHEA 3I53A 4HY3A 1UDRA 3T4UA 2WTXA 2PKXA 4S35A 4QU8A 4IIJA 1WEHA 3WL7A 1F4LA 3HSKA 4A0GA 2XB4A 3DFIA 2PR7A 2BE7A 1ORHA 4WKNA 4Y6QA 5DLQC 1YC5A 5J9FA 5ULLA 4NS1A 4TKVA 2WHPB 3TX6A 1YFZA 4FDVA 5ECWA 5GJVC 2RCYA 1NG9A 5KWJA 4QPZA 1FSPA 2OC4A 1WE2A 2QTNA 3Q5GA 1R6XA 2Q3MA 1PG2A 1W30A 4LBZA 1OUMA 5JROA 1YVUA 4TV8A 1RKVA 3OC6A 3ZWDA 5IEJA 2WSLA 1TDJA 4WCVA 3DJYA 4MQUA 4BJ3A 3RQIA 1JQJC 3B3FA 3ZNQA 1RAIA 2CLCX 5IARA 3TAXA 3L5OA 4TV9B 1OYOA 2PM8A 4HPJB 2WJVA 4U2KA 4XJVA 5BN5B 1KOJA 3RWOA 2QMOA 3K9WA 1A2KC 3OE1A 4RV9A 1MO4A 5E3HA 5LB2A 1WUHS 1G38A 1RRFA 2ZTUA 1B0AA 1I4LD 3HKCB 4IDPA 3VU9A 1O6BA 1T4CB 4HS4A 1G7CA 1B6TA 2WKRA 3K0BA 2DXIA 2RK3A 1MO2A 2Q4DA 1H3EA 4J2OA 3SJCA 1CNMA 1TQDA 1U9JA 3GCXA 3UATA 2EAUA 5PNTA 1E5LA 2Q4EA 1QQBA 2G04A 5BY2A 2C2HA 4Z1OA 5F4ZA 2ZGVA 3AL3A 1STOA 4MB6A 2O06A 2VAWA 2MINA 3P26A 1RPAA 2WYIA 2ZUUA 3NBAA 2FX3A 2HTEA 2Z8XA 5JTUA 4C3VA 3AJ8A 4XLTA 5JCXA 4PX2A 1X2EA 3L0SA 1I7PA 3IILA 3Q85A 1EE9A 4WA7A 1ACJA 2BSXA 1K7XB 2P1DA 1E7MA 3FFTA 3B48A 1YDHA 2C2MA 3MAAC 3WGMA 4EPWA 1FJXA 1WCXA 1CJVC 1UAGA 3GEEA 4MK4A 4TROA 3NFYA 4YMLA 1A7KA 3LM8A 3FUVA 2L82A 4B17A 1NXPA 4BLVA 3JQFA 2F9FA 4TYPA 4Y67A 3R76A 1XDZA 2HTFA 1WUYA 2J4DA 1G5PA 4RYLA 4JI2B 2W11A 1G8FA 2CMKA 2R44A 2ZYGA 3NAMA 4JT8A 3DWIA 2I4NA 3OLYA 2HWKA 3THRA 1V7PC 2V1XA 4LWOA 6REQA 2WP8J 2EG9A 2NPIA 1SKAA 2BGKA 2WAXA 4OLJA 4Y0NA 4ZO7A 1H2FA 4DIMA 4HWGA 2Y66A 1ZNXA 3M33A 3C5VA 4L5YA 3GGPA 3TUZC 3KB6A 3LTEA 4EJSA 1OASA 5CGZA 4KTVE 3V6MA 1L4YA 1TKAA 2NO6A 2YY5A 4UNIA 3SSAA 4PN7A 2KM1A 2FEPA 2JI6A 4GI5A 2RHBA 2VNHA 1H0KA 3GLVA 4XB1A 2P67A 3NIGB 2P9EA 1U3FA 3IDSA 3IP9A 1P91A 2OP1A 2FB9A 2G0AA 2BIFA 3O7MA 3ANNA 2TECE 4HDSA 3A1FA 5CNJA 3FA2A 3K5IA 3D8UA 5ED4A 4MIOA 5D86A 4Z0HO 3FRJA 4AO6A 2QN8A 1XVIA 2IE0A 4LOLA 4RJKA 5E6RA 3K0FB 4J0KA 2C2WA 2OCXA 2J8ZA 4YP6A 1QQ7A 1HE5A 2FRDA 1IZ9A 4JXJA 3ZWCA 4EHNA 2EEPA 3DGEC 4OYRA 3JZMA 3RC8A 1QGYA 3AIOA 4BNDA 2VDWA 2PSDA 1G8HA 2AGVA 2C58A 2I6FA 3UA3A 3JQAA 3JZFA 3WB2A 4MRSA 1J5PA 2BP7B 3FCCA 3KJZA 4ZEOA 4OJNA 3V4LA 4Y9SA 5CCEA 3A1NA 1TM2A 4S3MA 2HF2A 2DPGA 2OBBA 3ICOA 2ZM5A 4LQDA 2E4AA 1N6IA 3RIGA 4A8JA 4CU5A 4F3NA 3JD0A 5J5AA 3HKEA 1OX4B 4BRSA 4JUDX 4QXAA 4P5PA 3RFTA 3D0KA 3RYHB 4M53A 1X7XB 1DBSA 3SR4A 4BNJA 4ACBA 4TWRA 3A6PC 2WU4A 1H2YA 2PFGA 3RVOA 1Z0FA 2NUPA 4JB0A 4ZOBA 3I62A 2C7QA 4CM4B 4QNMA 4CMBA 3NWEA 3STVA 3VTKA 1WB4A 4LZLA 3B5JA 3WYCA 4LF4B 2IVFA 2VR1A 2O54A 4C2TA 3O94A 4HNQA 2J0EA 1FFBA 1TZKA 3GY0A 3GMIA 4RPJA 4EYQA 3KQHA 3LPCA 1XZQA 1DE0A 1KJNA 3KQWA 1GTZA 2GYVA 2C4MA 1I32A 1OTXA 2W6ID 2FQYA 1OA1A 2ONKA 2ZCJA 1C7QA 2CXTA 4BNHA 1ZHOA 3FFAA 3RSSA 1JAXA 3FFBA 1VSTA 4K87A 2DGDA 1PTJA 2Z4RA 2G3YA 4RDCA 4B2IA 3HBAA 4BECA 1WLYA 4WQMA 2RI6A 2ZRNA 1EGAA 1E3LA 1O87A 2IYEA 4LXHA 2C8JA 1DS6A 1YRBA 2JHAA 4I6JA 2FSVC 2WOOA 4Y9TA 3E4CA 1TYEB 2PH5A 2E4VA 4DLRA 2NTNA 2Q2OA 2Q2QA 3D3QA 4GC9A 4LYJA 1DRWA 1RJEA 1DAPA 1KVSA 3X2FA 1BN7A 2ZVDA 4YGYA 1T1SA 2CGEA 2R97A 5EN4A 1M8JA 1YHYA 1ZMBA 2VPQA 3P2MA 2VAMA 1E5VA 1UPXA 3CUWA 4F2DA 4ZQGA 5AK0A 5FYQA 3QKRB 5HW0A 1PGPA 1C30B 4YO8A 1NMEA 1X14A 3U7JA 1AY0A 2EFDB 1D5WA 3FYCA 4HEJA 4A36A 1KVTA 3OWHA 3CNQS 5NULA 1FRNA 4OYYA 4D02A 3JAMA 1NW6A 1UJBA 1GFIA 3DH0A 1Q91A 1D0VA 1F2UA 1RHMA 3LHDA 4MO2A 4ON9A 3NHBA 1O5OA 3KAKA 3TI9A 1AQNA 1WF6A 1O9BA 3G7SA 3LF1A 4R84A 4LYHA 1MNQA 2PZFA 4LWQA 4RIEA 3AEUA 4PG4A 2AFIB 1AKVA 1MO6A 1TJ4A 2GPSA 2YBEA 5EE9A 3R7BA 2FSSA 4Q1VA 1LQUA 4XM0A 4ZAZA 1MT3A 1U2RA 3D4PA 1YUNA 3LU1A 3CZCA 1J6UA 2H17A 4NR0A 1C9DB 1XAHA 3FTCA 3T7RA 2QI9F 3TDMA 4JYZA 1MR3F 4U2FA 4NEQA 5CYPA 3DNFA 3TM4A 1MFPA 2V7TA 3HTXA 2A3RA 1P7WA 3IMGA 1V8FA 4DNQA 4TMKA 5JAPA 1KYXA 1M2JA 5JADA 3C8MA 2IUFA 4DWWA 5A4AA 5TY0A 1JZTA 1N0UA 3FJ1A 2PMKA 2XIJA 3QPCA 4H3VA 4K6OA 4RU1A 1H2RS 2CBXA 1EJ6A 5DWQA 3IJ5A 4EZEA 2N3ZA 3ZTYA 2LTAA 1SC9A 1F12A 2RHWA 3KKNA 2F8LA 1GU1A 3ME5A 4IXNA 4NATA 1S02A 1E61A 4X97A 4I66A 2IBMA 2IV2X 1DDGA 2W37A 3I1IA 4UVGA 1DAGA 4MTLA 3QLJA 2FN9A 2ZVPX 1P9OA 1W2WB 3PDWA 1MOZA 1QCCA 3M70A 1WQ4A 3FWKA 1QJ4A 2QNIA 4L0MA 4QFDA 4UTOA 2OCBA 5F4BA 5H02A 3VPDA 4F46A 3C48A 1FLVA 4HGOA 2LW7A 2D5LA 2G88A 3LQYA 4ZQHA 3DUFA 2L0XA 4EABA 2D2IA 1KOFA 2ZVJA 4KVGA 1CNFA 3BSWA 4GM0A 3FSGA 2FK7A 3FHLA 3L0PA 4DLZA 3S2FA 4HLUC 5BWCA 4D0GA 3DT8A 3TG2A 4H1TA 2RBKA 4AS2A 3JYHA 2CCKA 4RC9A 2XVAA 2GO7A 2W22A 1VC2A 3CZ9A 4NU0A 3KVRA 3GJSA 1TJPB 4MI1A 1WULS 1U7ZA 1H2ZA 2QX8A 2YV1A 1ODTC 4YP1A 1CIJA 3P32A 5EHNA 1C14A 1RC1A 1QCYA 1J97A 2LDBA 3COZA 4BDSA 4M1SA 5JY1A 1W4RA 2VVTA 4NAUA 4FLMA 1ZRNA 3O1IC 2XV1A 3IVAA 3QUTA 1LPBB 1UMBB 1HFWA 1P29A 3DFFA 2F17A 3GJXC 4ZV9A 1DEOA 2QMQA 1JLMA 1U0HC 2A0WA 2G9VA 2JH9A 2LKDA 1E2IA 1XDSA 2NTEA 3MMXA 3PFCA 3Q8XB 2PFSA 4O2BA 4D9CA 2IXTA 1FX0B 1TM7E 2FWIA 3HJUA 3OCUA 1H1TA 4PRZA 5B2FA 1UAYA 3EC2A 5ELXA 4ZGBA 1ULBA 2GESA 1D3AA 3BYZA 2VYVA 3KQUA 2AB0A 2L2QA 2C0CA 4MEJA 2OSBA 1EXMA 3EULA 3MUFA 5FWYA 1WZIA 4HLCA 1I4WA 1CRQA 1Z2PX 4HAWA 3ECCA 4YHHB 3NC4A 4F5WA 4N3BA 1P0CA 1WO8A 3T35A 1AA6A 3WLTA 4CKZA 2IKSA 4J4BA 3WLRA 3VO2A 5AO9A 4LOIA 4ETMA 4YAEA 3UAWA 4QSHA 5ALZA 2WHPA 3NHUA 5HBRA 1VE5A 1IHYA 4ZO8A 4V3BA 3T7KA 3RABA 1L3BA 5HKLA 3GVCA 2EWVA 2CEAA 3FNQA 2AZXA 3QVMA 3GQBA 1UBKS 1LVUA 1N3BA 1PF7E 4C7OB 1E2HA 3A2LA 3GPIA 4PSUA 4V0OA 1WXFA 4RDHA 3GLHE 3NDPA 3G2QA 3O8NA 4H31A 4P2GA 3B9RA 2R5NA 3QMMA 4QVGA 3EXG2 3S68A 4AIRA 4DCTA 2JFBA 2WYOA 1BJKA 5M7EA 2X8WA 3NTOA 2IYAA 1AHHA 3AY6A 3BWBA 1U1CA 3LBNA 3AG6A 1IZYA 4EFDA 1OLSA 4DKJA 1XTJA 1WU8A 1U5BB 3PUVA 3M6MD 4O6VA 5EC8A 4JLSA 3EHEA 1M7BA 2Y1DA 4KFCA 1ONBA 1G20A 1QO7A 1QIKA 1KJQA 3H04A 4N65A 2ZBVA 4X8OA 4XI9A 1FYXA 4RULA 3ROFA 5FHQA 4NDAA 4OHPA 4LW8A 3PHJA 4QDUA 3F6RA 4DQLA 1ID8A 1OC2A 1J4AA 2W48A 4DQKA 4PQFA 4F12A 3E9DA 1JT9A 3L0CA 3O8OB 4FUQA 4GHWA 2NG1A 3FCSB 3ZCRA 1GZ6A 3BIJA 3THWB 1YR6A 3DYBA 3O2QB 3MCAA 4I5FA 3B9PA 4F38A 4JDPA 2IXGA 1FCJA 4B8WA 2A2ZA 3LRTA 1HQDA 4L8VA 4NBLA 1PWYE 4MV7A 2W2LD 5ECDA 4ZGWA 2CUTA 5K4HA 2CNLA 3FI9A 4BNDB 4F1KA 3AO0B 4KLCA 1M33A 4G4JA 4HWTA 4ND3A 2NUAB 4F1JA 5BV1A 4ARBA 5L8VA 3NIDB 3BKWA 1KAMA 4EB8A 1WBDA 1NY5A 5HS4A 2GARA 3EA0A 4QUKA 4O2LA 3QIVA 5FL3A 5K0FA 4W5TA 1Z0UA 2BFEB 3I32A 1NP3A 2PEYA 2Q3FA 3HZZA 3VPCA 2OOSA 3RV3A 4EKEA 1GGJA 1R5JA 2R6GA 4DMFA 3U56A 1COZA 1C3LA 3TD9A 3VPSA 2OHFA 3CF2A 4HGYA 4RK1A 2YWBA 2BPOA 1KI3A 4KXXA 4MXDA 2FPSA 3ROMA 2IEZA 1Z7YA 1RXEA 4P53A 2JIPA 4RHEA 1GIAA 1H8HA 3ZHCA 2JFFA 4U0JA 4KN9S 2X9GA 4DNXA 2NU9A 4DGQA 1D2CA 4LC9A 3GWZA 3OM0A 3KRTA 1K8RA 4X95A 3WK9A 3A9VA 2B1GA 2H7YA 3IOBA 1XC7A 2UYQA 2L69A 3GD7A 3GJ8A 4PSDA 5F35A 1T2FA 5JCOC 1QS0A 2ZIFA 1Z33A 5KWIA 1AMOA 3PTAA 3B7GA 2A9QA 2IYPA 2P62A 1VIYA 1Y9ZA 2WIFA 1XTRA 2YHAA 5D00A 1X1RA 5DI3A 3WNDA 2R1UA 1SAYA 5AKYA 3SZGA 1XLTA 3TSOA 4CYMA 5LQCA 2NLOA 3FB4A 2Q2NA 3G2NA 3NBKA 3KX2A 4HQLA 4QU5A 4V02A 1VG1A 2WUWE 4WINA 3FBGA 4XYMA 5DBEX 5I9BA 1JFSA 1RZRD 3E3NA 3T1OA 1W29A 3D6JA 1DQSA 3N2YA 4O4JF 3OKPA 1PJ8A 4WZBB 4XYLA 3L07A 5L51A 1I3MA 3PHHA 2ACVA 3BZBA 4G0YA 4K3VA 5GTDA 1XQ9A 2J07A 2I8AA 2VQSA 3P9PA 3MTQA 3A25A 2ZSFA 4LIPD 1SZJG 4XM1A 4ETWA 3EF3A 2BMWA 3ZD7A 2CNDA 5L3VA 2VDNB 1TCAA 4ANFA 3PPXA 4UM5A 3AHFA 2FPGA 3NKFA 3AJAA 2Z5LA 4J90A 3EAGA 4TWZA 5KTSA 1MAUA 2Z08A 1YNOA 2ZYIA 1MHPA 1TLLA 4H35A 4R1MA 3BJRA 5ADHA 4BGVA 3WZMA 1XQXA 4WESB 4WZZA 3E2PA 3IKLA 4BLSA 1SKYE 3QEKA 4U3JB 1TJ5A 3C3BA 2P4EA 4QU9A 1E9EA 2GZ2A 4C5AA 1N2XA 4BQFA 4NNPA 1E0KA 2VYND 1HC7A 5FB3A 3TLBA 3CNNA 1CY4A 2QJWA 1IRIA 3O3NB 4OJTA 3H9UA 4PZ9A 3UW1A 3PX2A 2GHQA 3I6IA 2RHGB 4M9UA 2XF8A 4R6XA 4JYAB 3BWCA 3CONA 5T6BA 3FOEC 1XNHA 2RKOA 1KS9A 4A3SA 2Z58A 3WK6A 3I6BA 3MN1A 2RKWA 3G13A 3AR3A 4E2XA 4EJ6A 5KB3A 2XB9A 4HZUB 4LVCA 4PBSA 4JJZA 5FORA 5GQSA 3CCBA 3IQEA 4P2BA 3ZW8A 5BT8A 3K70C 2A7QA 1P3JA 2YBDA 3EA4A 2ZI4A 4GG1A 4CMCA 1TC2A 2AR0A 2ZM6B 1YBFA 4TKUB 4DWVA 1L5HB 4IJQA 1VYUA 2AUMA 1GN9A 1XXHB 2QQFA 4P4NA 1H42A 3M6XA 2G70A 3DBOB 1NXXA 3X1DA 2AFIE 3BIFA 3MAGA 3AMVA 3DZJA 3E5MA 3FNFA 1Z5GA 2NM0A 4MRRA 5KVQA 3EY4A 3BDIA 2P41A 4JC4A 1B0UA 5KSZA 3QGMA 4ZTZB 2JEYA 2O5EA 1SPBS 5IP5A 4FM9A 1QOPB 2F6RA 3OZGA 4FFOA 5H4HA 1HLPA 1NVVR 1Q0UA 3CLRD 3IOMA 4FKMA 2YZNA 3SEQA 2HT6A 1ATZA 1KERA 2Y8EA 4FI3C 1Z7EA 2JVJA 3E7PA 3I9MA 3TINA 5IDXA 4IRXA 2JJ1A 4K03A 3RI3A 1N5IA 2XF2A 1GUFA 2AMJA 1ESNA 2VI5A 3AEXA 1Z13A 4AG5A 3T4PA 2XBUA 3IPAA 2C9OA 3FROA 4K9MA 3GYGA 3F0TA 4C4YA 4KRFA 4AKSA 3SCZA 4INPA 3SI7A 1BE0A 3KLMX 5AI6A 1G8KA 1KEPA 2B98A 3P9IA 5I5EA 1IULA 5KAMA 3QUCA 4A8JB 2WK1A 1W2GA 4GUDA 1GQQA 2CBZA 5FBWB 2JJ2A 5GVRA 4YX9A 2XIQA 3I4LA 4ZK2A 1JLLB 3Q0IA 3W34A 3DVRX 3GNLA 5KTPA 2F00A 4EAQA 3MTAA 4RJLA 5HK9A 4PHFA 2G77B 1KJJA 2OBFA 1P62B 1E6MA 2ENUA 3GAZA 3INRA 4FFNA 4FIDA 1T0BA 1U0EA 1JSXA 4BYGA 4IF6A 3H4IA 3NGLA 1CERA 1KE1A 2VK2A 4X00A 3KXIA 2C42A 3G23A 1E1CA 3BL6A 4H27A 4UMFA 4Y2RA 5AMXA 4FMCF 3PWTA 5EINA 2PZEA 4DCNA 2NQTA 1BTOA 1CUDA 3A4MA 2PNJA 3RTCA 3WLNA 2FLVA 2OOKA 1PZFA 5DNEA 1OXTA 4I1VA 4EFLA 4RVNA 5B1HA 1U9ZA 1R4NA 2OD9A 2BFOA 4OO3A 4PM4A 3F2VA 3NLLA 3EDRA 1WXGA 3CXRA 1ISMA 1M5UA 5I8PA 2PMBA 1F20A 1NW8A 2H63A 3DQZA 1HT3A 3RC3A 4EJMA 4YRMA 3D6AA 2F43B 3ADOA 5BWLA 1NVFA 5KYUB 5P21A 2C61A 2QAGA 1IK4A 4TTVA 1FYWA 2NX2A 1VKRA 1J2EA 2X2FA 3IMKA 3I5YA 4GLFA 1YAJA 3LUCA 3W2GA 2E4WA 1G59A 3VR6H 3N8KA 3DHVA 1Y7PA 2K4MA 1P4RA 3CB2A 4F3RA 4AKGA 2ADFA 2BY4A 4B6QA 1G4UR 1YHNA 3IS3A 4Y2GA 1DAKA 4AJJA 2B99A 1GP2A 2W6JD 3QXXA 4MARA 3D3WA 1IJFA 3TZKA 1WKBA 4JC5A 4QJ5A 1IUPA 1CZLA 2FZEA 4UZEA 2VFAA 4Q93A 4B80A 1A88A 1V39A 3OZTA 3GC6A 3FKQA 2PKQO 3HR4A 3LQFA 3JYPA 3LY5A 3BFVA 3RRJA 1QQ5A 1U4NA 4HGNA 3R44A 2DQZA 3VSEA 1UMKA 4M8KA 3HGMA 2YWHA 4RANA 5FBRB 4BNMA 1Z8HA 2V7WA 4DC0A 2MSLA 4K9LA 3E27A 1ISGA 1PLLA 2CY0A 2VH1A 5EIBD 3L4BC 4BLWA 1YDEA 2FPOA 5B3JC 4YCCA 4IHJA 3WGVA 2PT5A 1T6YA 4RKQA 2VPYA 2WKWA 1X19A 3OWXA 4JAVC 1ESEA 1FYDA 4TTPA 4DSAA 1TTQB 4ZOLF 1R5OA 1J06A 2GNAA 3EGEA 3T7AA 3VDXA 4F7DA 2W2VA 2A0KA 1ZOIA 1R3DA 4KXFB 4O4LA 2PKRA 3SE7A 3VR0A 3WZ2A 4N0PA 1ZMXA 2HGSA 4JT9A 3UWOA 4BDTA 1KU6A 4P7GA 2WWVD 1KY4A 3RK4A 4DQ0A 3M5CA 4PC2A 1KH1A 3DZ8A 4FKBA 5FTWA 1W4BA 5BYJA 4WKBA 1W9MA 3CUYA 1BJRE 1JDTA 1LW6E 1R5BA 3SFVA 4DUPA 5CA1B 4L50A 4IXTA 1GA1A 1T15A 3G1TA 2O20A 2I2CA 1PIWA 3L0YA 5DX8A 1A77A 4JL6A 1DB3A 3WA7A 1O4WA 3O47A 1DT3A 3N2NA 4YCAA 4TV8B 2H57A 1XZIA 1C2YA 2Z1DA 3HBNA 4WNAA 3SQWA 1ISSA 1QYWA 4RMJA 2UYHA 4BFLA 4Z4CA 2EZ8A 3A1WA 1W1IA 2WT9A 2Z5VA 2JFPA 2QWXA 3NPMA 4AO7A 4O4HA 3HPRA 1C7IA 5TF0A 3H5NA 1YVPA 2XSZA 4EA8A 1RMTA 1H0SA 1SXJC 2P9JA 4BLOA 3RG2A 2JFNA 1HT2E 2WZCA 2UXCB 2X2OA 4I1UA 3DONA 4L6CA 2CK3D 1M0EA 3L1JA 3NIBA 3AFOA 1FMTA 4LSMA 1XZFA 1YI0A 1HDIA 2I6GA 2W8ZA 4FNAA 2GYWA 4GOLD 1FMFA 1N5KA 1Q20A 3K53A 4IY1A 4DPMA 4G0NA 2FHSA 1JAIA 1HZZC 1O94C 1ZN8A 5AHWA 3OIDA 5JPCA 5EIAA 1YRWA 1KAHA 3VHLB 3RC7A 1NVMB 4NFSA 5CLHA 3ROXA 1MW8X 4IPTA 1YB4A 4M87A 4EEXA 1W1WA 4TRJA 4HGRA 4OSEA 4A8TA 1ZITA 4IUYA 3IQDB 4DCUA 4ILKA 1VCIA 2AOXA 5IYZF 1K0UA 1X7YB 2Q6VA 2XYHA 4HDSB 4KBYA 1MORA 1AG9A 1IN6A 2ZSHA 4M3NA 1U8YA 2ZCUA 3O93A 1CPYA 4UFOA 2FFBA 2FEMA 2HHAA 2PX6A 3GCZA 4TM7A 2PBRA 5CB4A 2FSPA 2DKOA 2ZRMA 4R2IA 3RQSA 1DEKA 3HXKA 2ROQA 3WNQA 3X44A 4RY2A 2OPBA 5EZYB 5HSGA 4IDFA 5CH3A 4PIMA 2P6MA 4B40A 1UJNA 2JHCA 2W2NA 4K1XA 4FNMA 1CUXA 3GXBA 5FI0B 1N0VC 1WY5A 2OAP1 2YHSA 4MS3B 3V4RA 3FB1A 4OGKA 5K45A 3H17A 4PLZA 3OPQA 3A4LA 4F9TA 1QYIA 4D8TA 2VXYA 2JHGA 1IY8A 5E7IA 4PPNA 1ZY2A 5REQA 2IYLD 1E3QA 1M8PA 2EYUA 2ZT8A 2C99A 1D2MA 3OBIA 5LCXA 3WISA 5CNKA 2AMVA 4I3GA 4TLLB 1RHKA 2WVHA 3ABZA 1W5FA 4FK8A 1QAMA 2O1XA 4H15A 4UARA 5ALXA 2B1QA 1R8SA 1XMJA 4MMYB 2OCIA 1XNRB 2LPMA 4B4DA 4IM7A 1UJMA 4WXRA 1Y8RB 2NXWA 3SZOA 3NIFB 1C3XA 4B3TB 2BCGY 2P9BA 1YDMA 3Q6IA 3IPXA 1L1RA 1QCZA 2PS9A 3JARB 3ZVMA 4PYMA 3L7IA 1PS0A 1PFGA 1PT6A 4Q34A 3OIGA 1RM0A 1NR1A 1J1UA 1L5FA 4WVFA 1UDXA 4QTYA 3H65A 4PLPA 1HO3A 2G83A 3BZUA 3FPJA 3IR6A 2BH9A 2ZIXB 3LBFA 1JWBB 1E8MA 4QGAA 5DXFA 1KC3A 3CE9A 4EUFA 1XTKA 3VAAA 2VF2A 3CH6A 2A0YA 1U99A 4QUEA 1RYBA 1JAZA 1M2HA 1E8NA 3I58A 3WXMA 5AKLA 4EGJA 3TIIA 1QHXA 2GKOA 3D2LA 1KQGA 2XXAA 5TDHA 3W2TA 1ULHA 1QYRA 2A1TS 2EP8A 3HKDA 4JJIA 4EK9A 1HBJA 4WBNB 5EJ7A 2BDEA 1KETA 3R5JA 5IHXA 1AXGA 1V7ZA 1Z0AA 1B74A 4E4YA 2QLNA 1I13A 5DHFA 5BN5A 3HI4A 2IS6A 4KQMA 1GPLA 1SCKA 3IB6A 3WLEA 5C8XA 4Q4AA 3VU3A 4EDFA 3NPAA 1QAOA 4XCVA 3R9XB 3DFUA 4M9ZA 5LVAA 1DAEA 1D4FA 1Y34E 3CX8A 3TX2A 3VH1A 3M34A 3KTFA 3KZCA 1RIIA 2GN0A 4LZPA 5AVZA 3ZCPA 2XXAB 1YQGA 5KYTA 2QL5A 4WESA 2I76A 3S8EA 1MJGM 1CS4C 3LDHA 4LJ4A 4AZ3A 3FTNA 1V95A 3PRKE 3GFPA 1XYYA 1N8KA 2O1SA 4FTWA 3K6KA 2IU4A 4H7DA 1NWHA 1VI2A 1XCGB 2JJMA 1ZESA 2RK6A 3SEAA 4YLYA 3LO8A 3UXHA 3SDZA 3SOPA 2HWWA 2Q9CA 1Y5RA 1OFVA 2R1ZA 3TRJA 3ADDA 1DXQA 4C06A 1PK9A 4GKBA 4GL2A 3OPYA 3B3GA 2EKZA 4H6WA 3AR4A 3FPAA 2XOKD 4DMMA 4Q9DA 3VR4H 5L3QA 4FCTA 1ZRHA 1D6JA 3EEOA 1KDVA 1EFPB 1JYEA 3V7FA 3UUEA 3UN1A 4YECA 1SM4A 2IOFK 4I50F 2LZ0A 5B53A 2ZUTA 3T9CA 2ZRAA 3X1KA 4C0AC 4EL0A 2EYQA 2E9SA 4RETA 5KX5F 4IZIA 1KY2A 1VIDA 1ZMRA 3HE3A 4BNWA 3EBLA 4CEHA 4JJAA 3WV4A 2Q5LA 1JE1A 3U7RA 1ZYUA 2OHHA 4JGBA 4IILA 3V8NA 3FSRA 1H94A 4Z4HA 4ZARA 3KZ1E 1DHRA 5ALQA 4HXFB 5B3JA 1XYVA 4QXQA 3MD9A 2QI9C 3L4BA 3H9CA 4DWOA 1OX6A 4DMGA 1L2TA 1WVMA 1R0WA 1ZD9A 1ZMTA 2FR8A 2HK7A 2R6ZA 3CSSA 3NTRA 2M6KA 1II8B 3OEED 3TL6A 4GE3A 3AR9A 2C9MA 2ZAGA 5DNUA 4ZCRA 1C8VB 2ZSDA 3L4SO 2CUZA 4N3GA 4NICA 2W2LA 3OJFA 3I2IA 3UK6A 1ZVMA 4HYEA 1P0MA 3HU2A 3NT4A 5JWOA 2GFIA 4KN8A 5A6SA 1DXYA 3AILA 1AC5A 3K2EA 2ZB3A 5KWSA 2TYSB 5HCNA 3AOEA 3IDAA 1KQNA 4XQ9A 2EL9A 5IDYA 3RU9A 3ADBA 3QVLA 2OGUA 3TBKA 2OE2A 2BEUA 3TNDA 5ALUA 4PTYA 1XP5A 4PZUA 3V3KA 3VZSA 3WRWA 5KINB 5LNK1 8MHTA 2W6QA 2CXRA 3FN4A 1UJ4A 2WQZA 3C8DA 5LSAA 1HF3A 2Z6AA 1L4BA 1RAAA 1ZD2P 3IFSA 4KK4A 4RBNA 5DCLA 4B3SB 1L7BA 1IXZA 2RHDA 4TTSA 3IHLA 1U0BB 2BMFA 1RE0A 2OMKA 4A91A 5KIAA 2G5PA 4HDKB 3WNBA 4DN6A 3RDPA 4CLOA 2TMKA 1SELA 1FYEA 1VE1A 4I2NA 2ISSD 3IURA 5EZ5A 5BVGA 5HILA 1O5IA 1KYIA 1UP6A 1XCJA 1QFZA 5DNAA 3VJKA 4BP9A 4TVSA 1E60A 3T1YB 1SWVA 4UAGA 1Y3AA 2IVZA 4LRQA 4IEFB 3GG9A 4KQHA 4B7ZA 4XPIA 3O8RA 1JEDA 1SY7A 1YB2A 2K7FA 1GZ7A 2YNMD 4U5QA 1A5ZA 1CLEA 3UWKA 2QU7A 3QVGA 4YJHA 2QPTA 5J47A 2J4CA 4DHEA 3WGUA 1GAXA 2Q7OE 4EG4A 1RZRA 3GDOA 3CRNA 2QE6A 3ZCUA 5F12A 2Q1XA 2NTJA 3L4JA 2FPMA 4IICA 3IL2A 1WZ2A 2C4NA 2QNBA 5HF6A 2PSJA 2XW6A 5FADA 3TTVA 5K3OA 2FPPB 1JDUA 3CISA 1ZGHA 1HURA 1Y42X 4FHZA 5FBVB 2PQ0A 3HMQA 4YJ3B 4TQUS 5DP2A 1N5DA 2XOXA 3VPXA 4ZICA 5EHXA 5LNK6 3SVLA 3TCNA 1JP7A 2CD7A 2VDPB 4PGGA 3GUVA 3A6HA 4G63A 5KTNA 1CKEA 1W4CA 3NIWA 3NS7A 4KR7A 1K7FB 4ZT5A 3RH0A 3S27A 3HFJA 3WHPA 4AQ7A 1PP4A 4LFCB 2JD0A 4BBZA 1E63A 3CG4A 2AW3A 3QSYA 3AXSA 4B6OA 2GOYA 4HAUA 5JUWA 1CQXA 1KEZA 1K68A 2IZOA 3KQTA 4QDTA 4RD3A 5EWMA 1NV9A 2DERA 3F6EX 3JRNA 2OUIA 5TXGA 2V6JA 4Y2JA 1LV8A 1ODSA 3NFRA 2FZGA 2R7LA 1SXGA 2A0UA 3LUKA 1D03A 4ZPJA 3HCPA 2PRJA 4R8MA 4MI9A 4XW2A 3TKAA 3ZTTA 3ZDBA 1R0RE 3NJ4A 3QBDA 2UYYA 1U2DA 3NTXA 4MCIA 3S55A 4BNUA 4C6SA 4BB0A 2VEOA 4Q16A 5C3MA 3I61A 3DTVA 1QZUA 3IJPA 3HA2A 4YY3B 1PK7A 3G8AA 2SBTA 3K2IA 4IIUA 4Q9IA 5BRAA 5A0TA 4MV0A 5JJCA 1H0HA 2I71A 1SIBE 2RGCA 2VRBA 4BKOA 4Q4CA 5LZ5A 3SF8B 3EDCA 2HFJA 3OJCA 5HYVA 1SUEA 3H5AA 1JU3A 2GM9A 2SHKA 3LQKA 5DIZA 5B2EA 2Q5OA 1FTQA 3B1JA 2CV1A 3A3NA 3IQWA 2QTWB 2XUKA 5A5VA 4BAZA 3KOMA 1DL5A 1WZCA 1X0VA 4EG6A 1EM8A 1NUAA 5E9QA 3UHJA 4Q05A 2WNIA 1SCAA 2XNHA 1EA7A 3IGFA 3WV5A 4R69A 4AQDA 1PSDA 3EG5A 3N2ZB 3MFQA 1B8NA 4F9GA 4R3NA 4L6IA 1CR4A 1NRXA 3KPYA 4LY3A 3DAFA 3QRWA 1YFLA 1G0OA 1BX0A 3B85A 3ZHQA 5IABA 3OZBA 3A2KA 3BXGA 1T26A 2EF0A 2AE2A 1JRLA 1CVIA 5AVJA 2WJWA 2X14A 4NPHA 4QWWA 3UUGA 1SOMA 1X38A 1TLFA 2M2IA 4D9FA 4NHEA 4WKOA 5TEVA 4YCBA 2I29A 1AZWA 4PVCA 1JIKA 1UUFA 4XWGA 3RFCA 3TZEA 4RA6B 1S2GA 4Q6BA 1JQDA 4YC7A 2J0SA 5AXDA 2R4QA 4KNYA 3SYNA 1GITA 4U8GA 2R8BA 1IN4A 1NOIA 4KKXB 5F23A 2Y93A 3S99A 4MB0A 2PMEA 3SLKA 4IDNA 2R6FA 3DB2A 3UJ7A 1P9RA 1PD1A 2GCOB 1CSEE 2GSDA 4NOLA 4EUEA 1EK0A 1J0CA 4Q1DA 3BA1A 1K08A 1U6IA 4AWXA 4IV5A 5KQRA 1E4OA 4M9XA 1ZM3A 1GG2A 1ZEMA 3FPSA 3CURA 4MWDA 1NVGA 2HSGA 3SBDA 2PGLA 1XVAA 3L7YA 4XA8A 2RGDA 4WW0A 4LCBA 2D1SA 2VOJA 3A06A 4EI2A 2VKQA 2INGX 4N9WA 5D51S 3ESQA 3WGLA 5FJIA 4QBGB 1QFYA 3ICCA 4C43A 2DUNA 2CLMB 4X6YA 1BHJA 3ZWAA 4K40A 3R3XA 3QJ5A 4BVKA 1PTKA 3CZ4A 3COJA 5AESA 5KOIA 2JLXA 3MK31 2R5WA 4PHGA 4H7JA 5IAAA 1ZJ4A 3OTGA 3HCFA 5K03A 3AONB 1SZDA 1WTCA 1H1DA 5F52A 4NCAA 3ZXXA 5KSYA 1E2LA 5AUPB 3WQBA 4PFKA 3PBKA 2CL6X 1FK8A 2NO4A 4DA0A 2YW2A 1WMBA 3DMGA 3CF0A 5TPZD 4KB5A 3N53A 4MICA 3G02A 3O73A 4O0LA 2ZIGA 2HCRA 4LDAA 1UM9A 1G4HA 4OJKA 4OUDA 2NU6B 4D9NA 1IONA 3NNDA 1A2QA 4X1IA 2FNAA 4W1PA 4XUCA 4ZN6A 5JPDA 2WBLC 2I78A 2I66A 2WWTA 3UFBA 6ADHA 2XUHA 3X1YA 5A9RA 4Z2AA 3WO0A 1X86B 3W8DA 2OL4A 2AJTA 5CLGA 1XTIA 5IFKA 3VHXA 1ECPA 1CY8A 3E9MA 5E9JA 2FSUA 1FZQA 3EEIA 1TPZA 1U3VA 2R68A 3I9KA 4FEYA 5BSRA 1KYVA 3UK0A 1QR2A 1Y3BE 4ND8B 3ONVA 7ADHA 1Q7TA 1GL6A 1AZSC 4B2YA 4L16A 2IEBA 1I3KA 2FSIA 2O8EB 2XODA 5KC9A 1U0FA 2JPDA 1OSNA 3HVHA 4M4SA 2GMWA 4C21A 1M1NA 1S4QA 2ATVA 4HCJA 1FDOA 1QG4A 5D3MB 4HVTA 4L3VA 1ZGJA 5FBLB 2IDKA 3F2IA 3UEOA 1OV6A 4ETIA 4IQFA 2PBZA 1EZZA 1V7QA 2J5KA 2YFHA 1G5TA 1UOPA 1ACLA 3U4AA 3EVCA 3HMKA 3QY9A 4QOGA 1KFCB 5AVQA 3G2LA 1K1EA 3EZXA 3FMGA 3O9ZA 4UXHA 1P6UA 4RH3A 1XUOA 4LJ5A 1OBFO 3R9IA 4DJJA 4EB6B 1O5TA 2IHBA 3QNWA 5EMLA 1LRJA 2BW0A 1I6KA 2AC4A 5F51A 1XMQB 1KGSA 4X3OA 1CP2A 4M0MA 5DK6A 2PBLA 4KJXA 1UC9A 4D4HA 1WVIA 5C5EA 4KQ9A 1X8XA 5J59A 1PWZA 1QUEA 3KIPA 3U80A 1V26A 4OD0A 5ICGA 2BUAA 4JLKA 4CM7A 5CDYA 5C5CA 4GQAA 3B7WA 2HQSA 2ZJFA 1FUYB 1WZUA 4ZVVA 5C35A 1UBRS 5JVDB 1J56A 4NJOA 2FSFA 2RHJA 2W8BB 2XAAA 4XYGA 5HIMA 3Q3JB 2BEKA 3V8VA 4D4IA 4EGQA 5K8IA 2A9VA 2YQ4A 3B12A 1TPYA 2J48A 3EDMA 3FLAA 2XAUA 4TL8A 3KXLA 1KMIY 1XN1A 1FXSA 3HCEA 4H7KA 3PXBA 4NZZA 2HUPA 2P2NA 3MF4A 2Q0HA 2QEQA 1YE5A 1Q1AA 1SMKA 1HSZA 5JJIA 3TJZA 2FGJA 5KTTA 3VO9A 1E9AA 5HMMA 2ACKA 3KD2A 4PQRA 4YUWA 4D7AA 2O9JA 2P9CA 3H2KA 1L9XA 3C7TA 3AVVA 3U7QB 3QX8A 3FD8A 5CVUA 2QLLA 2BI4A 5DGHA 1C80A 3Q7EA 5F9FA 3VZCA 4G9GA 2VHEA 4DV4B 1CJUC 2YRFA 3CSUA 1AO3A 3TUJC 1GZDA 1YB6A 4MQFA 5DBFA 2YYAA 2B0JA 2WF7A 4JUIA 5DJ5A 3F9IA 2ZBUA 5ALMA 5AYVA 2EX1A 2GD0A 1KNXA 1MB3A 5EXDA 3SC2B 4J1TC 2PZAA 4F93B 5IG2A 2C3MA 3CWQA 3COSA 3SZMA 3VNBA 4DDHA 2AZDA 5IM4F 1NN3A 4GWLA 1P73A 4MQ4A 4OBBA 4MW6A 3TLZA 1A98A 3CN7A 2BFCA 4AJNA 2AOTA 1ML4A 3EWAA 3MHPA 2J41A 5I4CA 3H8SA 2HSZA 1I4TD 5C2JB 2HYIC 4HB4A 3DAPA 1P7VA 1HXHA 1NVXQ 1XTQA 3RHFA 3ZNPA 5BV7A 1E20A 3PDHA 4KQFA 4DCGA 1YKFA 4QT0A 1KEKA 1J8VA 3LHIA 4OM8A 3R7WB 4QULA 3F71A 4HYTA 2ZZMA 1B8OA 3E9EA 3ACBA 4QO7A 4QHTA 4TSRA 1Y8AA 4U2DA 5ALFA 1N77A 3BGIA 1NVKA 2XUIA 5FR1A 3RRFA 4CEJB 3R3UA 1DXOA 2XEXA 3AUKA 3AR2A 3E70C 1PFWA 3GT4A 1MVLA 1ZH8A 1MB9A 4MP8A 3KVNA 1DVRA 3F7NA 3II6X 2QTBA 5CDFA 2A0FA 3FJOA 4M1MA 3ZUPA 4F56A 3VKUA 1CG6A 3LDAA 3M6LA 1EK5A 1Q95A 1ZNWA 2FFQA 2RG1A 2Z2YA 3P2IA 3Q11A 5JDCC 4EZBA 1P2BA 5LU9A 4MYCA 4W5OA 1WMDA 3U4GA 2YDXA 3DJFA 1DZ3A 1R15A 2HIMA 3F6YA 4GFDA 4N7RA 4ZZ1A 1Y3FE 1JI3A 2ODAA 4GBMA 3ZLUA 1VSBA 1A9RA 2J33A 3AM3A 3M1YA 4BU1A 2EC5A 3RHSA 1MOPA 2H2FA 1QFXA 3LGXA 3V7YA 3L05A 4FMCB 3JAWA 3UB2A 3O4VA 4H3HB 4E15A 3Q1KA 1SCUB 1PL6A 4DBVO 1IN5A 3NAGA 2OZPA 2H9IA 2A0XA 3HZRA 3OP4A 3I8OA 3QVOA 3S1SA 4Q9NA 1J1IA 2BVNA 3B3JA 2W2OA 1UBHS 1A1VA 2BHSA 5AQEA 3H5TA 1K2VN 3AUXA 5I48A 3F1KA 1IC6A 3WFJA 1SPXA 1BMFD 5FUQA 2C5LA 4NESA 2O2JA 4CODB 3H16A 2P3SA 1NJFA 1UC4B 1CUCA 4JOBA 2QRMA 4TGLA 4L3OA 4OF4A 1P61B 4IGFA 3RBZA 4NAHA 2CSUA 1SZPA 3LKZA 2HM7A 4M1QA 4PS0A 3TO5A 3MGCA 3ROQA 1EHYA 1PVDA 1R6TA 3PRJA 4QPJC 2DE0X 5F21A 1RYNA 2IIBA 5HQ3B 5LZ2A 4RZSA 4JL5A 2O2DA 1E9DA 2WIJA 3ORSA 2RDMA 5AI0A 4MJLA 4EKDA 2VP2A 1IWBB 2JBWA 3ESDA 4FWTA 5DHSA 1T2NA 3AIMA 3WLFA 2VSXA 1S9DA 3FMOB 1VJTA 3W2HA 4ES6A 2PL3A 1PTJC 4QRDA 3K9HA 4FGZA 1H8ED 1KMNA 2QLFA 3GVIA 2XWJI 3OUUA 2BT4A 3TXXA 1GZ5A 3V2GA 1ILEA 3ISJA 3HKCA 3WSTA 4ZMBA 4F84A 1KQFA 3NJ8A 1NDUA 1D9ZA 5E2BA 4BVAA 3PFWO 2G1JA 3CT4A 2GBGA 3IR7A 1FTSA 1N8TA 3CUVA 3E84A 3ROPA 2XPCA 2AXPA 1PT5A 3T5MA 1IZ0A 2CHGA 2VT2A 3ZHZA 4DEYA 4ZYYA 3NP9A 4NFLA 2HWXA 4ER5A 5LXTA 4BC1A 2FETA 3VMMA 3AUJB 5KVSA 1UK9A 4PQEA 2YXPX 2F1RA 1FFXB 1CLUA 4FZ3A 4LJ9A 3FVRA 3WWEA 1BAPA 4ZDIA 5KVVA 2J0QA 2AA3A 4MJ3A 4GOXA 3S6JA 4I9HA 4N12A 4DLUA 2ZE6A 3GT0A 1P74A 4X6XA 1ZUHA 4Z7QB 2FCRA 2FMHA 1SHTX 1T24A 1SCUA 2NYUA 1NBIA 3Q6MA 4XIJA 3GA7A 5DPMA 4ZTBA 3K0HA 4A8JC 1OLSB 4NDZA 3PSHA 4BKQA 3Q87B 1KFEB 1L6IA 3RFFA 4AAYA 5BVHB 2PJRA 3KVYA 5AW0A 1NULA 1SKUA 4R9SA 2P5SA 1LJLA 1Z5PA 1VLLA 1JIQA 1A9PA 3L93A 3ZDDA 1TZ2A 2AFVA 3CZAA 5U4QA 4UC0A 4F4FA 2MSCB 1D1QA 4LQLA 4A9AA 3E7FA 3LW8A 5AVRA 3KLOA 5L3RA 5IVHA 1N4DA 1PX0A 2AN1A 2Z57A 4XB6B 2BF4A 4EB0A 4N7MA 1ZVKA 4C08A 1SURA 2CLOB 2HRZA 1BGVA 3W9UA 3DO5A 1N36B 2CHEA 3HO1A 3EOAI 3A1UA 2XDWA 3B2EA 5DN6A 3HRIA 2YVKA 4YDHB 4X94A 2ZYUX 3ZKWB 3PU6A 3K1AB 5AW9A 2P8JA 3NM5A 4ZCTA 3A04A 1T36B 1QV9A 4EHHA 2IPNA 2EF1A 3KKQA 3FCAA 4MUEA 4UFPA 1KZ9A 4FDUA 1Z6ZA 4AP5A 3OLQA 4JY7A 2VBCA 1AHIA 2QQ5A 3HG7A 4KE8A 1OPRA 1Z5OA 2IPLA 3NONA 4XFKA 5DDIP 5H7XA 3T3HA 3W05A 4W9NA 1GTRA 1NQTA 5CYOA 1DKLA 1ONPA 3WMXA 2C2XA 1PR9A 1ZK1A 5HTKA 3DE3X 3MOIA 1GCUA 4OYHA 1ZHFA 4PYIA 1A69A 1PR1A 2GD1O 4RPLA 1F5SA 4L5AA 2VQ6A 5CA0F 5BPFA 1QDUA 3I9NA 1KTIA 5CK4A 2JJ8A 5A71A 2I4MA 3HUTA 1B23P 3G2MA 4QSMA 5ALKA 4UVIA 1VBKA 2OHIA 1OFUX 3B1WA 5ELMA 3OBBA 1Y3CE 2IKQA 4HYQA 3SDSA 1L5VA 1KI2A 3QOWA 2V5UA 5AKIA 3QF4A 2I03A 4WE3A 5IKEA 5EI5A 2X9LA 3TVYA 5C8YA 1K8QA 1PBNA 2QZ4A 2V55B 3JQEA 2XLCA 4TXMA 3KSMA 5U1PA 1VI5A 4ID3A 4QGHA 5EIHA 2AZMA 3GV0A 4AY6A 1M6VA 2E2WA 2YQZA 1ZC4A 5ANRB 2AR7A 4DA7A 4Q02A 4DIOA 2JDID 2RK4A 5AK4A 2ZITA 3KALA 2NZXA 1TK2A 4JA0A 3CR8A 4EB3A 1VJGA 1GHTA 2NUPB 3ICPA 1RU3A 4HGPA 4RGVA 2NV0A 1TXGA 4YJFB 3FZEA 4RA6A 4Y3UA 3UM9A 2IYRA 1YQDA 1EH5A 4QARA 3VTFA 3QKWA 5C8YB 5J2TF 4RQTA 2A35A 2K7ZA 3CRZA 2G71A 5I4IA 1JEYA 3GN1A 5DM60 3WNZA 2O1EA 1NVEA 3O75A 4UUPA 3OVMA 3PUHA 4NEGA 2B36A 1OZGA 4MWZA 2J32A 3K8OE 5C7LO 3F4KA 1PZGA 3NUZA 4J7CA 1L7EA 4MV1A 2JH3A 2B9VA 1O95C 1L4NA 4DSNA 3BHMA 4CI9A 4Z49A 1K8XB 5IYZB 3KDPA 1P0IA 3VYWA 3FWHA 3U4MA 3EOBI 1W0JA 4MYRA 4X1YA 3H6GA 3KQYA 2PL9A 1T9GS 2OYCA 8AT1A 4EY5A 3BMCB 3WK8A 4Z1MA 3ROEA 5JI2E 1EVLA 1OFGA 2R25B 2RGBA 4F21A 4C87A 1EK1A 2YVLA 2OO3A 2IYOA 3PE4A 3QX9A 4IUDS 5A3SA 4BXOB 4XR4A 1U7XA 4KQ2A 2ZP1A 3KTAA 3ZS8A 2J6IA 1Z4MA 4GD3Q 2QMZA 3O92A 4HOYA 4O4IB 3W1WA 1N2CE 5B1SA 3IX7A 4PC3A 2B1RA 2FW9A 2Z56A 1GQOA 1QX3A 1OI2A 1JMKC 1GAEO 1FFYA 1NXOA 2XGJA 4CLXA 3PLRA 1MLDA 2YJTD 4LJSA 4WJZA 1PJ3A 5HBGA 3TPFA 2DWCA 4HNAB 3QFFA 3IBSA 4IFBA 4CEJA 1P33A 2IOYA 3AVOA 3H5IA 2DPHA 3WL8A 2BC9A 4YJKA 4X7MA 3DBLA 1BWQA 4KZPA 3WYDA 4RZUA 1R2QA 4AW9A 5JSKA 1NW9B 3GMDA 2DQ4A 3U13A 5TVGA 4UDOA 5CXQA 1RLOA 4N7BA 3LXXA 4ISCA 1KQOA 4JBLA 1JPNA 1Z62A 2PZJA 3ND8A 1Y4UA 3CS3A 2IXAA 5JCJD 1HDEA 1B1CA 1QYDA 1XL0A 2P9ZA 1T25A 4LYYA 5EHIA 3RJ5A 1RP1A 1N5MA 2W5UA 3QXJA 3JQ8A 1II8A 1CY0A 1ZKDA 3MG9A 5D7NA 5I7FA 4D8UA 1P1HA 4YQZA 2JFYA 3OIFA 4TKVB 2VJMB 2ZFUA 3KEQA 3WP0A 1QK5A 4W4TA 3DWEX 2WTUA 4NCHA 4W1QA 2V6GA 1M73E 1ZZGA 2PCLA 5A6SB 4DG5A 5HKKA 1I3LA 1U02A 4OBWA 4U8HA 3DD5A 1XU7A 3K6JA 2NO1A 5TX7A 5EFZA 1D2EA 4JFRA 1LDGA 4WN9A 2RCNA 4UKDA 1VOTA 3RASA 4F6LA 5IDQA 4RTSA 4YI5A 2JAPA 2A4KA 3EIEA 1XL1A 4UNS