3VXOA

Hla-a24 in complex with hiv-1 nef134-10(2f)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
total genus 75
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxoA01
4X99A 4XPBH 4MDIB 2C1PA 3H0TA 5JLZB 1HKLH 2OJEA 5EU5B 1QRND 4WW2C 1D9KA 1SEBA 3K8KA 4G6KL 1QPXA 3UDWC 5C0CD 4RIRB 1IARB 1KBGH 4R7NB 4OQ1A 3RVVC 4HK0B 1HH6B 2CKBB 3L5IA 4GMTH 4KMTH 3MC0A 3WUWB 5LWYL 4P23C 1XAUA 1JN6A 1K4CA 3TBVA 1AR2A 3HZYB 3QYCA 1NBVL 2O5YL 5IROC 2YRZA 1DVFC 5IFHL 2NY7H 4ACPA 1GGYA 1NEZG 1TMCA 4EI6B 2Z4QB 3GM0A 1MAML 3FOLA 1DBKH 3MBXH 4KAQL 4UMGA 3SOBL 3AROA 4UNVA 3MV8E 4PB9H 5D5ME 3WS6A 1L9MA 1XH3B 4OZFH 3SE9L 1NJ9B 4XRCA 5HGAB 1P1ZA 3C08L 5EU6D 4S1QL 3IDJB 1FN4A 1CDUA 4KMQA 5KW9H 4RGNE 2AW2A 4WHCA 4RMQA 43CAA 5EIIB 3U82B 1A1NB 2BC4A 1CLYL 1T5XA 4D94A 1JGDB 3ARDA 4OFYD 4M7KL 2HFFB 2B4CH 2IH3A 4UIMA 1INQB 4OIAA 5HHOE 3MRNB 1OAQH 1OAKH 3GMPB 1Q0XH 4U6HB 4JVWA 4NQCB 4JFFE 4K9EC 4PJCB 3KPLA 3TPUA 5EBWB 1A7BA 2FHCA 4OF7A 3FB7A 1JGUH 3MCLL 3N0PB 5C07A 4HKXA 3S96A 3VFRA 4ZUUB 4DGVH 4X7DC 5IR1A 3P9WB 2ESVE 4JPIB 3IKCB 3MLXH 1TFHA 4R4FH 5ACLA 4P59L 4E5XB 4KQ4H 4RIRA 4EVNB 3BE1L 4GKNB 5D1XA 1XF5A 3BAEL 1B6UA 2VO5A 3UAJC 3UAJD 3O3DB 3U1SL 2AEWA 1DLFL 1ZAGA 5BRZE 4Y16D 1QG3A 5EO0B 5BVPH 1SVZA 2V2TB 1L4IA 1F4WL 1X5KA 1RK0B 2HJLA 2ZG3A 4NO3B 2ADJB 5CBAB 2C5DC 1JJUA 3QFJE 2EKJA 1DEEB 3K2MC 1MHPL 5I75B 5BOPA 1JZ3A 2QBWA 4F80A 1ZLSL 3QFJB 3OKMB 3EBAA 2A83A 1UJ3A 4U3XA 1OP9A 3L7EB 1MH5A 3QEGL 4ODVH 1JHLL 1I8MB 1UWGH 3WNMA 3KYAA 1OQXA 4MDJA 3T77B 5DUBB 1PGRB 4XCFH 1ZVYA 2NY1B 3QG6A 2PYED 2I5YL 1MHCA 4ZXBA 1G9ML 2NY0D 3QG7H 2IFFH 1VADA 4JDTL 4IMLA 1ZEAH 1CYGA 2NNAB 4XAWL 4OLYH 5F1NA 1L7TH 3MCKB 3OGCB 5JZ7D 4YAQB 2VXUH 2ARWA 4O5LH 4JRXE 1YMMD 4WO4A 3D48R 1QYGL 3VG0L 5DJCB 2D7MA 4JRXB 4XB8A 4XNUL 4Z7OF 5C0RL 4DGIL 5JQ6H 3NFNB 2W0FA 2H6PA 3H42H 4PJDF 2BNRE 3MCG1 3AUVA 3GIZL 2RCSH 5J12C 2V5RA 2GEEA 3CCHB 4ZD3H 3IS0X 1SYVB 1G7QB 1VFAA 1UKTA 2XWTB 2YUWA 5IR1B 3L3OB 4JRYD 4PTTA 3BISA 3O11A 1GZPB 43C9B 1MREL 4NQVA 1EVUA 4HKBA 4HS8L 4K3JL 5I6XB 2MWCA 1QFWM 3R0NA 4CVZB 3IU4H 1MIEL 4XCEA 3FO9A 3DYMA 5D70L 3V6FA 1YNKH 1VESA 3QNXA 1OF2A 4X83A 1DBAL 3BIKB 1C08B 1T20B 2A9MH 4LLMB 1XT5A 3QPQC 2GJ6A 2BMKA 4JN2B 5HVHB 5H35B 5T1LA 4PB0H 2WUBH 2JJTC 4O51A 2AK4B 4OZIB 4PJ7B 5KSUA 4KVNL 2NY3D 5EBMB 3LSOA 3A0OA 3PNWB 2WWMC 4K3DL 2G2RA 3LS5L 2ATKB 5SWQB 1SY6L 1MCSA 3T0WA 4RBPH 2GJZB 4H25B 2QQNH 4XXDB 5GS3A 1KENH 4KUZH 4P2QE 3ARBA 3DMMB 3W39A 4LPXA 2J6EH 4MGXA 1Q94B 1TZIB 3IFLH 4IEFB 4YHZL 4KJPC 1DDHA 1FLTX 3I75B 5IESL 4K71B 4NC1E 5EU7C 1S5HB 1HE7A 4NZRH 3MJ9H 3EO1A 1TVHB 2PXYD 5ADPH 5EZOL 2OSLA 4YO0B 5HJ3B 2AABL 3MJ7A 3U7YL 1NCDL 1M6OB 1PYWA 4M9PA 1IM9D 2EC8A 4FQPA 4UIMB 3BFOA 2PO6D 3U0PB 3PQYB 3VJ6A 4YC2B 5DD3L 4Q9RL 1JHTA 1MFBL 4IRJA 3RIAF 5CKGA 2NZ9D 1F8TH 1KTKE 4MD4B 4LQ1A 2A6JA 4N0CA 4WUKL 3QQ4B 4EI5D 4KK9C 3F7YA 3S36X 4XMKH 3IKCA 1ED3B 1WVZA 3MV7E 4MAUL 3SE4C 1GVIA 1GOFA 5FKAA 3ARFB 5DMKB 1A5FH 5LJYH 4P2RD 1EV2E 3EUUA 1UT9A 3WDJA 3I3DA 3S4SB 1FPTL 3KVQA 1LP9E 1T7WA 5D6CB 3C2SA 5CS7A 2P8PB 3ZKND 5EUOB 4M9OA 1TVBB 5GZND 3E8UL 3G6AA 4TN9A 3ULUF 3KDMA 3QI9C 3VXRB 1XIWD 5L2KB 5MP6H 3HR5A 1JWUB 3B2UD 2NX5B 4KPHH 3C5ZA 5AYUL 3WNNA 2CDGB 4PGBB 3U0WH 3EOTH 4F9PC 4OD1H 1JTTA 2PR4L 4JJ5A 4MJIA 2AJ3A 4D9QD 4UT9L 4OUOA 2LU3A 3NIGF 1FYHB 4HS6A 4TTDD 4ZFOA 5TH2A 3MNWB 2CKNA 35C8H 4FNLH 3BZEA 5I1DB 4ZO9A 1LO2L 2XI9A 1T6WA 1LO5B 5D1QA 2IADA 3GMMA 4S1RH 1J1PH 3BPLC 5KN5A 5CJQH 4AG4H 4AYFA 5CZVH 4M6ML 3Q6FA 2XA8H 5IBLD 3RGHA 2FJFB 2J2ZA 3PHQB 4JDVB 2G75A 2VDRL 2X4RA 3N1PC 5HYQA 4HUWA 1E27B 2ZPKL 3BD3A 3EOAB 3JTSB 3MLYL 3UEZA 4H26B 1ZHNA 2FBJH 4U0RC 1UYWL 2ED9A 2I60L 1XF5B 3B5TA 2D7TH 1BOGB 4QRRD 4F3FA 4JRXD 4M6OL 2IANA 4Z7UF 3NH7L 2XYCA 4PJFE 3QXAB 4YGVA 1ND0A 5B8CB 4YDLC 1HQ4B 1PSKL 1YPZF 4X4YA 2J4WH 5HI4C 4BSWA 4HKJB 2VSDA 4L9LB 5T3XL 1NLBH 1AXTH 3BQUA 2IALA 3VFMA 5ICYB 1P5UA 3RWCA 2PW2B 3JVGC 4OSUH 2JJTA 4K8RL 2DWDB 1MH5B 1T7ZA 1MJJA 5D71H 5CP3A 5J1AB 2DYPA 4OIBA 1J5OH 3REWA 4K7FA 5IFAH 2C3HA 4YDKH 3LN5B 2DM7A 1ZVSA 4QWWC 4OZIF 3WFBL 4UDUA 2X7LA 1IE5A 3QDGD 2NTFB 2PF6A 3HE6A 1FGNH 3B9KC 5D7SL 5FIEA 3ARQA 2HFGH 1LK3L 4D8PA 1T1YA 3DRQB 1CICC 3R8QA 4Q0XL 3OKOA 2OTUA 2V6HA 1NC4B 4LCCC 4ODUB 5DRXB 3QUYC 4R26H 3PWLA 4HWBL 2WUCL 4LARL 4OCWL 4XBGA 1UM6L 4ELKA 3BRDA 3TO4A 4IOSD 4WHTA 1IGFL 4S0SD 2OXHA 3E1F1 4CNIA 1ORSA 3G6JA 4FP8L 1LDPH 4HJ0C 5GISL 1IAKB 2OR9H 4JPWH 5IW6A 2EDYA 3DMMD 2ZUWA 1NEUA 3K8MA 2DQGL 1HWGB 4QRRA 1T2QH 2CUHA 5AAWA 3LD8B 5JW3L 2A9NH 5DJXA 3RWDA 1EA9C 2A0LC 1P7QB 4AJ0A 1ZLVH 2FYYA 3FT3B 4BSVA 5GS0H 2C1OA 4XP6H 2HKFH 3PQYA 5MEND 4WU7B 4JFOA 1SJXA 2R39A 3VXMA 4ALAH 3I3BA 3IETA 3M07A 3U6RB 1BEYL 3TH3T 3S37X 4FMKA 2EZ0C 1BQSA 5E00A 1BP3B 4JFPA 1WUNT 3CSBA 4KMTL 4AENB 1U3YA 3L5HA 4PV9B 5EZIL 5IHZB 4CGTA 4G9FA 5B21A 1P7HL 4I1NB 5E7BA 4FTVD 5D2LA 5D1XC 5IFHH 3B6SA 3MV9D 2XQBL 3PHOA 5I19L 3BWAB 3TN0B 2WLYA 4OCNC 1WCBB 2ID5A 1NFKA 1FYTE 4Z7WB 2DI8A 5BO1L 3BRGC 4V3DB 5FYJE 1NBZB 5FUCE 4YQXL 5ADOL 4LU5L 3IFOB 1JWUA 4M7LH 4X6BA 5ICXA 1CLZH 2IH1A 3MV8B 4PD4K 2FX9H 1ZT7B 3OKKB 1GIGH 3GGWA 4AEFA 1FO0B 2MHAA 5DFVD 4HF5L 1SEBB 2CQVA 1X5HA 4XCCL 2D9QB 2G9HA 1O7SA 5KW9L 2YZ8A 1QFWL 1FE8H 2I25N 3TA3D 2ORBH 1AH1A 2OTWA 1F45A 1N5YL 2FEEI 3WUWA 5F96H 3TP4A 2RGSA 3F62A 4MD4A 4M7KH 2HYMA 3F8UB 5EWIL 4MVBA 1GCFA 1I7UA 4AMKH 5F9JB 2EYSB 1T1ZA 1FFOB 3SKUD 3V5KB 2VQUA 1PQZA 9CGTA 3QJFB 1UC6A 1A3RL 1X5GA 5E9DA 4NWTH 3VFVA 1ZA3B 4YHKL 1NC4D 4P4RA 4N68A 2UY7A 5DRWB 3DUHA 4XP5L 4U05A 5I1IH 1AI1H 1NSNL 4OKVA 1M7DA 1FFNA 2QQLL 4XTRC 3BEWB 5C09E 4JQVC 3KLHC 2O5XH 4Z7VA 1DBML 3MBEC 1QFWI 4Q6IA 3RWGB 4PP2A 3SKMB 5KOVC 4HWZB 4G6ML 4MQXC 3WO4C 3OF6D 3LN4A 4JHBA 4U6YA 1S9XA 4NC2B 3KYMA 5GZNC 5CUSH 4U7SA 4HLZG 1RUPL 5TDPB 1DVFB 4TNWK 3QNYA 4OCYH 2VLKD 4AL8H 1KB5B 2B2XL 1LHZA 1K5NB 3ZDZF 2F8VA 3O2DH 2BRRL 1ZLSH 2W91A 2DQTL 4X6DA 3QIUB 1EGJL 3SQOL 2CJUL 4JPIA 4HXBH 3BZ4B 2G5BA 5C07E 3GJEA 3UJIH 1I1YA 4PGDB 4OM0L 1WC7A 4UT7H 2HLFD 5D7IB 4RZCB 4A6YL 1MVFA 1BD2A 3KPRB 1QLEH 2AI0L 5AEAA 5F7UA 3QUXB 1HDMB 4WGWB 3L5XL 4GRWH 4ZAKC 1KCRL 2AXFB 3VWJA 5HYJB 5FAAA 2ZOKB 1MCNA 2PYFB 2VWEE 4G5ZL 5TFSL 5KJRL 3TF7A 1BECA 3GI8H 2EDJA 5HHMA 5TPWH 3VFWA 2JE8A 3QDHA 1T0NA 2B5IB 1JYVA 3P73A 3GBML 4PLNC 4ZD3L 2AEPL 5CD5D 2VR4A 4XT1C 3KGRA 4UZGA 4H5SB 4YJZL 2VABB 3B5GA 1IAMA 4F7PB 3VXUB 2P8MB 1NPUA 4ZFGL 4GXVH 4NNXB 5FB8A 3ROOB 4W4OA 1AO7D 2AJSL 1A7OH 1T20A 5DRZA 5I76B 4EBQL 1UXSB 2KZ1B 5J06A 4HCRL 5GGSY 1WICA 5DMJB 2A0LD 5CEYB 3IU4L 3ZTNH 15C8H 1SEQL 2VKXA 4OZHA 1FDLL 1K4DB 1E6OL 4M3KB 4M6AA 1CZ8H 2A9ML 4KMLB 3PV6A 2Y7QA 3RRQA 3K8LA 1A2YB 1KCUL 1AKJB 2LVEA 3QRGH 3X14B 4XMLL 3LQAL 1T4KA 2ARJQ 4M93C 2HMIC 1IC5L 3LVEA 2VDQH 3VFGL 4Z7UB 4ONHA 1Z0NA 1FAIL 5K9OA 1P6FA 1WCBA 3B43A 3O45B 5I73B 2IC2A 1T7YA 2F74A 4YPGB 1XIWB 4G8IB 5CWSA 4OLVL 1IM3B 4GG6A 1AO7B 1HH9B 1HHGA 3P9LA 3MV8A 4LGSB 3FOMB 2H2PD 4M5ZL 3MJ7B 2XZQH 1H8OA 2OP4H 3P0VH 3BHBB 3F12B 4POZC 3JBG7 4YHZH 3BHBA 3F12A 5I1KH 4YXHH 3BKJH 5D1ZD 2GK0A 3DARA 1J0HA 2W9EH 2BVTA 1KBGL 3H3PL 4U6XB 4BQ8A 3HUJF 3GSVB 4DUVA 1F58L 4OZFA 2YEZA 3H9ZA 1PKQE 4LFHD 5E2TH 2JB5L 2VN4A 1QSFD 4HK0A 4GAJL 3IDGA 4G8FA 3VCLA 1ADQA 1DUYB 4KKLC 4L4VB 2FX8L 3DROA 3T04D 3P4LA 5KSVA 5J9PA 2YPKB 2N7BA 5F9AC 2YPKA 1I9JH 4KQ3H 3WE6A 3PXHA 3SJVA 5FXCH 2HVJA 5IF0A 1BM3H 2DQCL 5IF0B 4H0GA 4MAUH 4KUCD 1YJDL 1Q94A 3CPLB 3MRHA 3B9AA 3OKEA 4MVBD 4C55A 1I9EA 1KIRA 1A1OA 3KXFD 3IJSB 4NN6C 5L2KA 3CZFB 5GJSL 4RGMB 2AJYL 5EBLB 3HAEG 2IH1B 4TRPH 3PL6D 3QHTC 2UVEA 4YO0A 5HJ3A 1NBYB 1RZGA 4B50A 1M7IB 4MWFA 3EJZC 2P5WB 1OAZH 2A38A 2YD7A 4UIKH 4PJXE 3T8XA 4TTGA 1EJOL 4NM8H 1MJUL 4PREB 4DW2H 4XPTL 1Z5LA 4AEIL 4L29A 4PY8I 1UWXH 2PR4H 4LKXB 5LCVH 3KS0H 4N90E 4NOFA 1VPOL 3G6JE 3QUZC 3FONA 5F9WB 3E2HA 1J1OL 2ICWJ 5HI3D 1GC1C 4KKBD 4O2EB 3MUZ1 4J4PC 4K7PX 3V5DA 4X6FA 2K7QA 3QEUB 4X9BA 1OARL 1X5FA 3ISWA 4MNQE 5IB2B 4NBYB 1YEGL 5C0CB 1V05A 4RZCA 2HJKB 3WKML 1AKJD 3NCJL 3QHZH 3WHE0 4FABL 2VQ1B 1IZKA 3LEXA 4KZEL 2VZ1A 4LSQL 1B88A 5SX4H 4WJ5B 3PDDA 4M61B 4PIRF 4X9GA 2XTLA 4YLQT 1G9MC 1TZHB 5DVLA 2F53D 4U1LA 3DSNA 3LKQB 1T22B 3KPSA 4OLZL 3PHSA 1MIML 1MHPH 1T0NB 5FHBH 3S9DB 5GS1B 3Q0HA 3VFMB 3UTOA 3L1OH 4XPHL 4C56E 1GYAA 4QRPD 2EYTA 5CJOL 4NUGL 4P2RB 3GSWA 1A9BA 4L3EE 4DWHA 4M62H 4M4PA 4QGTA 5DD5L 2F53E 2HLFC 2XG5A 1FBIL 3R06B 3KNBB 5I76A 4A2MA 1DFBH 1FNGB 5DJYA 3HI6L 4WI7A 1WIOA 5IOPB 1JK8A 4LAQH 5LQBL 1JK8B 5ALCL 5BRZD 4MXQC 4O2FB 1JGEA 2EDWA 4G8GE 3VXQB 1RZGB 1X4ZA 3BGMB 1H3WM 4KJPD 3EDKA 2FR4B 3TV3H 1CTOA 2VXUL 2NY4B 1Q9WB 4WY7L 4NZDA 1QO3B 1U8NB 4OD2A 5FO9A 4C83B 4HBQA 1HEZA 8FABB 1R0AL 1J11A 3KR3H 2NXZC 3T2NL 4BKLA 2R1XA 4PJIB 2B8OT 4R7DA 1T6VN 3QEQB 4PJAA 3ZTJG 1UM6H 3MRGB 2A6KB 1BFTA 4YIQA 2DLFH 5EU4A 5JDJA 4WUUA 2Q8BH 3OG4B 1XGUB 1NGZB 3PUCA 3QDJD 1IGML 2ICEA 3VG9C 1IGIL 3EJZD 3E3QC 1EHXA 4BZ2H 3WLBB 3DETD 2H8PB 2W92A 4NO5A 5D96C 3HNVL 3BRFA 1RIUH 1SY6A 5JW3H 4U1GB 1BWMA 1CDYA 4JFEB 1PDKA 1K6QL 3BKCL 4JZJA 3HZMB 4HH9A 3X12A 5GRZA 1ETZB 4PJXB 4CW1A 1TETH 4ORGB 1PJ9A 3IDGB 1I9IH 4K3DH 3WIHA 1YN7A 3QXUA 1NCBH 1NMAL 3EZ8A 3NOIA 4I4WA 3TFKA 4WW1A 1WWWX 4G9FB 1H3TA 4W4NA 4WTZG 1BX2A 4HEME 5M7QA 4P9ML 3BUYB 4WFFD 4C58B 3M45A 3D2UA 2ATKA 3IGAB 4O4YH 4JFXB 1EHNA 3FRPA 3IGAA 3WIIL 3OPZL 4GAYA 4JPVL 4QF1A 1MCJA 3MRQA 1KIRB 3QDJE 4KGJA 4O9HL 3SDCB 4IRSA 1DANU 3QFDA 1IC4L 1ZSDB 4JY4A 3HNSH 5BO1H 3VFOB 4JFED 3NGBC 3MO1B 4N0RA 3C60D 5CSZA 1LWRA 5JTWA 3D3VE 5GZOD 5IMKA 1A6AA 1NFDA 3WFEH 1RZIB 4XXCC 4LSTH 4QOKA 5E00B 3CFIC 2NY3B 3QXDB 1P4IL 4OJFL 4U6VH 3FT4A 4YR6A 3RWHB 5SWQA 4L3CA 4PJDB 3LDBB 4GG6E 4XZUA 4WO4C 2BOBB 2Y23A 5J56B 5DD0L 5BS0B 5D2LB 5H2BB 5IVXF 1B3JA 1UACL 1I3GL 4XAKD 3GSRA 4NRZB 5H94A 4HMDA 3PWNB 1JNHB 4OT1H 3RPKA 1OB1B 3AM8C 2X4NB 4N8CH 3RY4A 2Y4SA 3OXSB 1DSFH 1U8JB 4P46A 5BJTB 1UFUA 1OGTA 3MCLH 4WDIB 3GB7B 5IT2H 4X7FC 3C5ZC 4Z5RA 1ROWA 5IEHA 1XH3A 2EDNA 4TVPL 4RMTA 5DMYA 5LAXB 4L8SC 4J3XA 5HGBA 3WFZA 3U0PA 3G9AB 4OFYA 1RJCA 2ATPB 4H20H 3BP7B 1EO7A 1WT5A 4FNLL 4F7CA 5T1MA 3TN0D 5CEZD 1KUMA 3LH2H 1JGDA 1KACB 3ARDB 3IXTB 5DJYB 4F9LC 2VC2L 2WIMA 4NQDE 1YECH 5CZVL 5ITBL 3MNWA 5C86A 5E1HB 1AGDB 4YNYB 2AXGB 3OAYK 1BF2A 2LQRA 5J8OA 2VDRH 4J3UA 3MV7D 3MTRA 5ELIA 4JB9H 1JPGB 1RJZA 5IW1A 4JM4H 5JOPE 4OCSH 5IMOA 2X1OA 5HYFA 4HXBL 3QT2A 5GS2H 1IGYA 3OJDB 3VD5A 3SKNB 3WLWD 1QSEA 3NH7H 1JZ8A 4PP2B 3RUGE 1IKFH 3SKMA 4HV8A 1CGTA 2P8LB 1GGCL 5EN2A 1ZHNB 3HI5L 3S4SA 3C5JB 3BZFA 2J4WL 4GKNA 4PY8J 5FCUL 1FZKB 1I7TA 5BVJA 3K46A 4FQXC 1A1MB 2RFXB 1N0LA 2ZSWB 1KJ3H 2IANB 2CIIB 5HDLA 3U9PH 4CKVX 1ZEAL 3TVMA 3HNTL 4Y4FC 4P99A 3JWDH 2V2TA 5JW4N 1ZLWK 2YBRA 5HHQA 3PDOA 1D5MB 4OLWH 1AGFB 1R3JB 2AEPH 2PNDA 1QACA 1JZ7A 3JV5A 3PWPD 1NDMA 2Q86A 1CTNA 1UCBH 4JN1H 2AJZA 2PETA 2BJML 2GUOA 3ZHKA 4WI3A 1AIFA 4M03A 2AJSH 4RGMC 1XCTA 5TGBB 3MJ8A 4CU6A 3QUKB 4RRPG 3SDDD 4Z7WE 4DCQB 4WO4D 2QADC 3WXVL 1CIDA 3MLZH 1RFDH 1T04A 2JIXD 4PJBB 2ZJSH 4QRTA 2AXHA 1FL5B 4HUWB 4EOWH 2Q7NA 3RWFA 1QLRA 4MLSA 4RFEB 4ZUVB 4H26A 4PG2A 5E70A 1SQ2N 1U8HA 1S9VA 1B2WL 4N0UE 4QTHA 4OI9A 1HINL 3SDCA 3O4LD 2R2BB 3K81A 3FQNB 1QHOA 4YHLL 3TPUE 4HS3A 1A6VL 2GITB 4HIHA 5FOBA 4Y5XC 4R8WH 3WFDH 4ZUSA 3VD9A 1YMHB 1EBAA 5B22A 1T2XA 5GS0L 3VFNA 3VFNB 2HKFL 2H9GB 3GMRB 1NGPL 3U36A 4P3DA 1KIQA 3V2AR 1FC1A 5TE4H 4JO4H 2XZQL 4HX1B 4PG2C 3TYFB 4MD0A 1T1YB 3DRQA 1MCOH 2XN9D 1S5IH 1C08A 4K3EH 3QB7C 5C08E 3IFLL 1C8PA 5D2NE 3MACH 1MF2L 5HDBE 1DCLA 2PUQT 3ETBF 3RTQB 4NQSB 4HDIA 5T3ZL 1RHFA 2GCYA 5T33H 2BNRB 1T80A 5JIHA 4J3TA 1JPST 5CIPH 3CDYA 1I75A 2Y07H 5I74C 5B8CC 2J8UB 2ZUYA 4ODTL 4NKOB 5EUKA 1S7QA 3PL6B 5CSGA 5EUKB 2I9TB 1OAXL 4QRUB 5AAMA 4CNIB 1GGTA 1MLBB 4MJ5B 3CLFH 5CWSB 3MGAA 5DHYA 3I6LD 4OZFG 3QR2A 4WUKH 2JKXA 3UC0H 4X8JB 2EIEA 4Y19D 1JFQH 4X8JA 4XCCH 3IFPA 3X3GL 4S2SB 1KN4L 3BI9X 4LASL 3WNKA 1JRHH 3NPSC 1JVKA 3UROR 4OZIE 1A5FL 3BPLB 2C7UA 1GC1L 5TE7H 3NACL 2P5ED 1D5IH 2C3XA 4LHUG 3VXSD 1OAZL 1H5BC 2DBJA 4I5BA 4QHUA 3QUML 1HQRA 3NVQA 1W72L 3HPJB 4S10A 2W59A 4KI5C 3C8KA 4HC1L 4U2ZA 4YXKH 4JGJA 4NWTL 3VFPB 2OL3L 4R0LC 5IG7B 1CK0L 5E8DH 3P40A 4G8EB 3U0WL 4NQUA 1VHPA 2ICCA 3MLSH 4MA8L 1CL7I 2LU7A 4NWUL 3HRZA 1IAIH 3QUXC 3UXFA 2Y1VA 1NCAH 4M7ZB 4U1HB 1HNFA 3AB0B 3KLHD 3RA7H 1CF8H 5E6IA 5HD8D 4X6CF 5IBUB 1UCTA 3NFPA 4G6MH 3TNMB 3NFPB 3NCJH 3TNMA 4NUJA 3RTQA 2HWZH 1YC8A 5C1MB 3F6LA 1I7RB 3ARFC 4M6MH 3T0EE 2UWEB 3L5WA 4NQXB 1KV3A 2VDOL 2J5LC 4P0DA 1UJTA 3VXSA 3JUYA 4WENB 2P45B 4DZBB 2N4IA 3ARGA 3HG1D 3SGEI 2EXWC 1O7VA 1S7QB 3H0TB 1BBDL 1T5XB 3K3QA 2VXTL 3BO8A 4ONFL 5EOCJ 2I60H 4AIOA 1E28B 3ARRA 4YC2C 5CIPB 3O6FB 4MCYB 1KCVH 5TQ2L 4YFEA 5ERWB 5I1DA 3IAPA 3RIFK 1F90L 3LKSA 1MWAH 4LCWB 5ISZE 4UT7L 1T1ZB 4G8GA 2CDEB 5LQBH 1YA5A 3H9SD 4P5MA 4C83A 3ZTJH 1AO7E 5ANME 4Z76B 5EU5A 3FTGA 2IAMC 1HK6A 1RJYB 1V3JA 3C5SB 1I3UA 3OF6A 1A4KA 4PJ8D 5C3LD 5HYEA 4L3EA 3VWKB 2QQKH 3DOSA 5TPWL 1TJHL 1K4CB 5E6YA 5FUCC 3VFUB 4Q0XH 3OB0H 3JV4A 3QXAA 3LQAC 1FYTD 2WNGA 4JLRA 1SVCP 4PRBB 4ETQB 3WN5C 4NO0A 1QBMH 1GRWA 3TZVC 1OGAD 3MA7B 4HCRH 2Z8SA 5CBEA 3CAFA 4UV4H 1Y6NR 4HPYH 4KTEH 4JM2C 3QJHB 5HTSA 4XVUC 3DVNA 4M5YL 5LGHL 3ROOA 4QXWA 3DBXA 5IP4A 5D70H 2P46B 2R0ZH 3PWPE 3HNVH 1CWVA 1C7TA 4HGWA 5HGGS 1IAOA 2FZ3A 1FNSL 4JFEE 1R3LA 2W9LA 4ENEC 4X6CE 1JCKA 1YYLH 3FJTA 4LNVA 2FO4B 3QAZB 1BX2B 2CUMA 4PRID 3RNKA 4P2OD 2CKBH 5DYOB 2P5WE 1NMAH 5J89A 2PYFA 1NAMA 4LLYA 5CJBA 1CQKA 5J12B 3SGDH 1DEDA 2YN3A 1U8PA 3QEHA 1HILB 3E6FA 4G6FD 1JTOA 3VRLF 1EO5A 4LHUA 2ITDA 1MCPL 1T7XA 2VLJD 3TJHD 3OPZH 4GW4B 4JPVH 2OP4L 1CT8B 1CXKA 4E41D 5LGJB 1JTPA 3AY4A 4P3DB 3H3BC 4W4OC 4GKZB 1CFBA 2MTPA 3TVMD 3BH8B 3CUPA 3Q5OA 2P8MA 5I1EH 1XGTB 2R0LL 4GW5A 1RMFH 1CR9L 1KCSL 5I19H 3MFFA 4HG4J 6CGTA 1X3DA 1C5DB 1HOCA 4MS8D 2P47B 3GFUA 4KVCH 3UTSA 3MRPA 3MRPB 1Q9OB 2BVQB 1A2YA 2BVYA 3B3IB 3WFEL 2X10A 3D0VB 1BVZA 4U49A 5GGVH 2GCYB 3NCBB 4XHJC 3PV6B 4G43B 2W60A 1GIGL 4WUUE 3BIAX 3BPCA 3VXNB 3S8WA 3HAEA 3O81A 4FQIH 4WFEE 4B53A 4L4VA 4YHOL 3PWNA 1QSFA 4OLEA 4UV7L 4X4XA 4F33A 1I85C 1RHHA 1C5BL 4H25A 4XXDA 4KK9D 2GTZB 3OKDB 4QHLA 5F96L 3O6LL 1I3GH 2BOCB 3RBSA 1S9YB 2BY1A 1A7PL 1Q9LA 5HI3C 1SBSH 3GSOA 4KROB 2XKSA 1MCBA 1ORSB 1NMCB 4P9HC 4UIKL 1A3RH 2V5SA 2QJDA 4DKEH 1VACA 3MO1A 1YEJL 5AD0B 3IDMB 4YAQA 1VERA 3DV6B 1MJUH 4HWUA 3D9AH 3WN5B 1A6AB 4KV5E 4QLRA 3BPNC 5MP6L 1OF2B 2RHEA 2BSTB 1VPOH 3LPWA 1HSBB 1E28A 4RMWA 1R24A 3MLVH 1T5WA 1BZ7B 1UGNA 2MOVA 3PGFH 4EUPA 5T1LB 5H35A 4P46D 3X11B 1EEUA 3LH2L 4LLVA 1H3GA 4TSAL 5HD8C 4XNXH 2EEBA 4YDVB 3ARGD 4GKZA 4V2CB 1J1PL 4FABH 4U0RB 2IGFL 1FO0H 1JNHA 5F7DB 2DKUA 4XHQA 5IB2A 3I2CL 4XPFL 4OB5H 5FGCB 5TJWK 5LVEA 1RZ7H 4Y4FB 3SJVB 4J1UB 1YEFL 5C9KA 3HZVB 1UJ3C 1KJMA 4QXTB 2A77H 3ARWA 3L3KB 4BZ1H 4XAKE 3KDMB 3T0EA 4N0FA 4JO3L 2R8SH 4X6BB 3HMXA 3O2VL 3OB0K 1Z9LA 2N56A 2BNUA 1JV5A 3UTTA 3VH8A 4A6YH 1MRCL 1NCCL 1AGFA 3T65B 1OTSD 4MJ2A 4Y4HB 4JFYB 5DDHA 4N90D 3HNTH 3LZFH 2CLRB 4LLWB 1MEXH 3E2HB 3MMEA 2LAAA 1WBXA 4PJCA 4DTGH 1A0QH 4FFWD 2PYEA 4G5ZH 5KJRH 2HP4A 5L2KD 4MQ7B 4OFIA 3UYPA 3RQ3A 5DSCA 5IFAL 1B0RB 1UXWB 2Z8WC 3ME0A 4F7EA 1TLKA 3ECBB 1RSFA 4X6DE 2C1PB 3ULUD 4PJEF 5BQ7B 2FJFA 2FR4A 1RZKH 3DETC 5C2BL 3H2WA 1UH2A 5DJDB 5E8PA 3MLZL 1RFDL 4WEMB 4JKMA 5FM5O 5GZOC 3DXAB 3CSGA 4R90L 4M48L 5I18H 4BUGA 1T1XB 2Q8BL 2PTTA 1HILA 2R2BA 1T3FA 1GH7A 3IXAB 1WZLA 4KJYA 1CGXA 2A6KA 3HS0B 4FFZH 2GAZA 2L7UA 1KCUH 3FHQA 1MY7A 4PJCF 3MJ6A 4WRLA 2ZCKH 4DOHE 5CHNB 1IC1A 1UJ3B 4ONGL 1LEGB 3GMNB 4OTXH 5I73C 3MV01 1BD2E 4Q2ZB 1KPVA 2A73B 2HTLC 4YHYB 4MXVE 1KLGB 5HGDB 1QBLH 2NY7L 3M17A 5EC2A 1TETL 1W0VA 4OLXL 1ZWIB 2C3WA 2EKSB 3SO3B 1FVCB 3LN9A 4K8RC 2NXYD 3MNVA 4QRPE 1L9NA 3DNKA 1NC4A 4LLQB 3OGCA 1JNLH 1PY4A 1S7VB 2VXQH 3MACL 3FQXB 3P0VL 5L8JB 3ARZA 3W5NA 4P23A 4OZGE 3PP3H 2OQJB 2GJJA 4NP4L 4CN1A 1CLCA 4JG1H 5IVXE 1A7QH 3C60B 4OIIH 1AP2B 2QSCH 4O9HH 1R6VA 4P5KA 5DS8B 3G6DH 3FFDB 5DHYB 1D6EB 1QFPA 4HIXL 3W5MA 3GNMH 4E0RA 1CFSA 1GAFL 1GZPA 1QOKA 2F74B 3GHEL 3CLFL 1DANT 3CXDH 4PRHB 3G5XA 4MA1B 3QDME 4NO5B 3FL7A 3GKZA 1KB9J 2YXMA 3O6KL 2ZUSA 4FS0A 4HUUA 4OZHE 4F7PA 2OK0L 2AQ1A 4ZS6D 5CGYC 1MCWM 3P0YH 5I15H 4Y5XB 3NTCL 1FQ9C 3NPZB 3JVGA 5FECB 1LE5B 4LLMA 4WFHD 4X6DF 4OQTA 1YY9C 4R4FL 1ZGLP 2APXA 4JY5L 2YSSA 1QFWH 3HZYA 4ZDHB 3O41B 3QO0A 4G9FD 1KJVA 3FB8B 5FKPB 4PRNB 3TO2B 1XR9B 1PLGL 1XZ0A 1YY8A 2DLTA 4JZNB 1IFHL 1YN7B 3W0WD 4U3CA 1AKJA 1MJJB 5J1AA 3PGCA 3VI4E 5IB1B 3U1SH 4LSVH 1EX0A 2R56H 5A40E 1S7RB 4HG4K 4KDTA 3RX7A 5BXFA 4WTZA 1NQBA 3DXAD 1MCCA 2P5WD 2FGWH 1MJ7L 5I1IL 2E27H 2FJGA 1NSNH 3RVVD 3L3KA 4AM0B 3CLEL 1NCWH 1OARH 4G59A 5KBNC 1HH9A 5FGBC 2DTSA 3DI2B 1RU9L 3OJVC 2NW2A 3D1MC 4Z18A 2FL5A 3WEXA 5IEKA 3WJLA 3WEXB 5IEKB 2ZKHH 4YHNA 1N6VA 4HLJA 5JOEA 3MRLB 1EZVY 5DS8A 1MCFA 4OV5A 3PP3K 3RY6C 2Y72A 2MNUA 1T7VA 1EIBA 5T1MB 4OLYL 1GHFH 3BPOB 4EI5A 1FFPA 1FRGH 3S88L 2VLKB 4HKXB 2D31B 2Z9TA 3RX5A 3GM8A 2F54D 4F58H 1E6JL 4L8CB 2GKIA 3ILQC 3IAQA 3ECBA 3VWKD 5IV2A 1BFOB 1OWRM 2A6IA 2H41A 4G7VL 5KANI 4S11A 4WU7A 3HA0A 3HI5H 5FV2A 5L0QB 1KYOJ 2B0SL 4WDIA 2IBZY 4QRRE 1ITBB 3FAWA 5GS1C 1AC0A 2EZ0D 4D9LL 5MEOB 4OGAC 3HHRB 2EH7H 5EN2B 3ZE1E 4BELD 4MNGE 1H3XA 5D2LF 3TVMC 4PTUB 5IVXB 3F7RA 4ZSOE 1PFCA 4Z5RB 5IIEB 5MEQA 2WK2A 2HT4C 4XPGH 5C08D 4BA8A 3T65A 3R0MA 3BO8B 4XGZB 1G7MB 5CGYD 3WL9A 1R0AH 5MEPA 1XMWA 4JN1L 2Y06L 2VL5A 4PPTA 4JY6A 5HHQB 2VXVL 2A1WH 3EGSB 2FJGB 4PRHE 2FATH 3T0VA 3STLB 4XNZC 2DF3A 3TT3L 1D6VL 1RUKL 1OTUD 1A7OL 1FFOA 5I1JL 5I16A 5I16B 1I7ZA 1MPAH 32C2A 2VITA 15C8L 2UZIL 4IOIA 1LEIA 4EIZC 4X7SH 1WWCA 5DR5H 5IVZA 4QEGA 5DQJA 5FO9B 4MB4A 1YYLL 4IRSD 1N3NB 2DQDL 3LKPA 1T1XA 5IESH 2MPAL 2Z35A 3MJ9L 4XMLH 3V8OA 1H8SA 4AT6A 3WIHH 4UQ2B 4PGEA 5KVFL 4Y1AB 4PJ7E 3B2VH 1SYSA 3OR7B 3TBSB 4D0DA 4PGCB 3VFGH 1KG0A 4R3SB 4Y1AE 1DTUA 2CDFA 3EO9H 5DZNA 3MRJB 3UYRH 2YA0A 4HKBB 3CFBB 2NY5C 3TFKD 1J0JA 4ZPVA 5DMKA 5FKAB 4HUUB 4LKCB 4MVBC 4IHOA 5D6DC 1ZA6A 4OLVH 1DVFA 5JW4M 3I3EA 3PG2A 3OXRA 5EZJA 3A6BH 4ZS7H 2I9LB 4TUJB 1IC7L 3S5LA 5CCKL 2FZ3B 4OZIA 5DC0A 2YD1A 2XV6B 2QSVA 3T0AA 3ILPA 3INUL 4XGZA 3MRBB 4PLOB 2OQJA 4WHYH 2P4AB 5IM7B 1AFVH 1OAXH 4MA1C 3QNYB 1KJ2H 3CNKA 3UYOD 3FT2B 3B9KA 4P5KB 3SJVD 1LMKA 4MJIE 1LO4H 4U1JA 5BV7L 4LSTL 2BZDA 2EEDA 3EOTL 2ITDB 2R69H 1UB6B 1U58A 4UV7H 4XNYH 3G08B 1P4IH 2DIBA 3H9YA 3KPTA 2Y25A 4Z0XB 1BM3L 3QUMA 1JFQL 3X3GH 1DL7L 1I1AC 1XGQA 5D5MF 2CGRH 5AD0A 1KGCE 3MRMA 1A7PH 3VGAC 2UYLB 3GRWH 1LO2H 4L8DB 5TE7L 5ID0A 1R3IL 4DKEL 5GJSH 3D39B 3DX7A 4PRDA 5C08A 1FG2B 1IGTB 1RPQA 2H9GA 3GMRA 3PL6C 1P4BH 3UO1H 2C9AA 2ESVD 2LABA 4MMZC 2NX5E 3STZB 4ZSOB 4YGVB 1OSZB 2OL3H 1OP5H 3RFZC 4MD0B 2Q8AL 3ARBD 2VLJB 4F37K 4D0CB 4U3HA 4L9LA 3MRJA 1P84K 5I9QB 4QOKD 3LKNB 1ZT4A 2X70B 1NLDH 2ZOLA 2NZ9C 3TH2T 5LCVL 3KLDA 4L9DA 3V6ZB 3P2TA 2J1KA 4GUPA 4MSWB 4RWYL 5GGTA 5GPRA 3OKLB 3BYYA 5JXAL 5J3HD 2F53A 2ARJA 5DUPL 4WFFE 3GSXA 3NFSH 3W2DH 5JHLH 5EUOF 2IGFH 3N85L 4JZOA 4IDJH 1RZ7L 4FQHB 2XKUA 1J8HE 1AHWA 1KXVC 5A1AA 1F02I 1BJMA 4LSQH 3MROB 3KPQA 2Y6SC 1EAPA 5MEQB 3QQ3B 2EDHA 5I2IA 2IQ9L 4ZAKB 4FN0A 1QRNB 2HFGL 3MRLA 1AY1L 3ZE2F 3TJHA 3BDYH 1RIVL 1KTRL 4Q7DA 4UT6H 4Z7OE 1KNOA 5TQ2H 4HHAB 4HHAA 4JQXC 1LNUA 4AIXA 2DBLL 4L29B 5I71C 3ULVL 5CJOH 3QWOA 5D1QB 1S78C 1A64A 4RSVA 3LIZL 4P2QB 3UBXB 3CXHJ 4HWBH 2WUCH 4N0YL 3HZKA 2NY2C 5KAQG 2YPVL 1RVFH 1DBJL 3MLRH 3CDGA 5E2JA 4LEOB 4YR6B 4L8DA 1IMHC 4A6YB 1NGYA 5KANG 4LAQL 3PABB 4NRYA 2BNQE 1EEZA 4Y2DB 4HULB 4FP8H 2YK1H 1HSAB 2R1YA 4LPYA 5GSRB 5JHDA 2R23A 3LCYA 1OM3L 3IDNB 3STBA 3WD5L 3CFEB 1H15B 5D2NA 2DQGH 1OB1A 4AH2A 3L5WB 5HGAA 4YUEL 5FM8A 2B20A 4DN4L 3VXMD 3TBSA 3D69B 3KLSA 5F7LB 4NQEA 3MBEB 4IRJD 2DJSA 3IT8D 5HHXH 1QKZH 4CADA 2VUYA 4K71C 2NCMA 5INDA 4DJMA 1X4XA 2DYPB 1V3MA 1FFRA 2VE6A 4XPBL 4N8VA 2Q7YA 3TWCH 3ZL4H 3DV4A 2R0ZL 2DM3A 1P84J 4RFOH 5FA4B 1L8JA 1B2WH 1ZWIA 1NDMB 4ZG1A 2R2HB 4N0UA 1VKXA 1FNSH 5E5MA 2ESVA 4WCYH 5JHDE 4QTIH 3KAAA 4Q74A 1MSPA 3OAZK 3CH1A 3TH4T 3ILPB 4E5XA 4HFWB 2DLGA 4PDCE 3QIBC 1JL8A 2XN9A 1UKSA 1NUDA 1AQKH 5D7IE 1G7HB 5L0QC 4KRMB 3D5OF 1QSEE 4LU5H 3REVA 5HVHC 1D9KB 1ES0B 1NMCC 3BP5A 5HXMA 3V5HA 4K3EL 5B39B 4NQEE 5J6HB 2NXYC 4R7DB 2R4RL 2Z93A 3QA3B 1DQML 1JYNA 1JF1B 4PB9L 1BZ9B 1RK0A 2HJLB 4ODXA 4P3CL 4YEFA 4KHTL 3UTZA 4L4JA 2E7LC 5I66A 3O4LA 5DEZA 1ZA6B 3HE7C 1GAFH 2GSGA 2R0LH 5GGQH 4K7FB 1CT8A 3GHEH 5KVEL 2VZSA 1RI8A 4G7YL 1NGQL 4HJGA 4OLUL 2EIBA 1A7NH 4KWUA 2B4CL 4I9WD 2A83B 1FYTB 1TCRB 3CUPB 4QT5B 5KAQF 3BWUC 3B2UC 4OZHB 3RBGA 5CEXA 2VLJA 5KZCB 1ZHBA 5FYLH 1DUZA 3S3JA 3SDDA 1JI1A 4DQOH 3LY6A 3N1MC 2QQLH 5F1IA 2Z92B 1C5BH 4XBGB 2NNAA 3A67L 3MLXL 5AG9A 5DFWH 3NACH 2YUVA 4U1JB 3QQ9C 5JORA 3IJYB 5A16B 4ONOA 2MSPA 3EYVA 5I0ZA 1G7QA 3EYOA 2GT9B 2OI9B 3BE1H 1N5AA 2R0KH 4LP4A 4GAYB 2HT2C 2X9WA 2IPKB 4JGMA 3MUJA 5F89A 4HD9A 1DP0A 5D7LD 3LQZA 4OT1L 1QR1B 2XACC 3KXFA 1S7TA 2CO7B 5HHME 4XHJD 4RISL 4LMQI 4XCEB 3MLSL 1H3UA 2W0PA 4G80A 3QHFH 3W11D 1IAIL 1JNNL 3QAZC 2DQTH 2EDRA 5C0DB 1HCFX 2H8PA 5B38G 5GRYA 3C5ZD 3AREB 1FL6A 1N0XL 1A4JA 5K93A 3QUXD 4OFVA 1UWGL 5DGQA 3BX7C 3RUGA 3K1DA 2HWZL 1XGUA 3ZHLA 2AI0H 2A74A 2NYYD 4PBWD 1FLRL 5BW7C 1DQJA 4N8PA 1DQJB 3PWUA 3I9GL 3I2CH 2VKWA 5LKNA 2NX5D 4OUUB 4MJ4A 3BGFB 3OKMA 3VGDA 5DFVC 1HSAA 2R1YB 5GSRA 2P24A 4TSBH 4QHKI 5JHDB 5L2JB 1QSFB 4U2YA 4W6YB 1ODAA 4QRUA 4GO6B 3FOLB 1J8HA 1KCVL 4U1KA 1WCQA 1U8KB 5C07D 3I75A 3FO2A 3R8BB 2DQFB 5TE6H 4HIEB 3D6GA 3SE3A 5CEZE 1K2DA 1YQVL 4LCIH 1WLHA 2HJFA 4YHNB 2EECA 2HJFB 4Z7VE 3UTQA 4P2OB 1SEQH 3CFKB 3LZFL 4DZBA 1JPSL 1S7WB 1A47A 2DDQH 2YWZA 1AD9B 1FH5H 4MNGB 3WN5A 1L6XA 4QY8B 4HUKB 1DBBH 3NFNA 4YPGA 5DDHB 3DSFL 4DN3L 2VZOA 4OLWL 3TA3A 1N59A 1S7TB 2EO9A 2H32H 3CDGB 4GBXC 2VDNL 2VXVH 2EEAA 2Y5TB 1T83A 2AK4D 3ZYOA 5JW5A 4M8VA 1LQSR 1IM9B 2BOBA 3G5ZB 4C56A 4I8DA 2PCPA 4PJAF 5D9SA 3ZSSA 5E6ID 3ZKMD 2VIRA 1QBML 3QNZA 4RMSA 4Y4FA 4EI6A 3I02A 3QUXA 4PJGA 2WP3T 3UP1A 1CD0A 1OTUC 2UZIH 5IVNA 3KJ6L 5IJVB 1PZ5B 3RJDA 5GJTH 3U4EB 4CBPA 1VGKA 3L3DA 1AHWC 3L6FA 3NCMA 3VXOB 4HFUL 3FQUB 1F3JB 2V17L 4YX2H 2XQYG 3VRJA 4Y5YC 1OOAA 3SCMC 4NDMA 1F58H 1UZ8B 1KTDA 3P30H 4F8QA 5EO0A 4HCRA 5JA9A 5TH2B 5BZDB 2ATPA 4XC3H 1A22B 4KDWA 1FORH 1DZBA 5E2TL 1I4FB 5HHOB 3GSNA 1NCDH 3WFDL 2IH3B 4OLXH 1MCIA 1FGVL 3T0EC 3PIQB 3ROLB 1ZTXH 4JFFB 2EYRA 5D4QA 2YPLB 4PLJD 1KPVB 1MWAB 4DKDC 4Q9RH 4LRIC 1XF3B 1MCPH 3M17B 1ZV5A 5EC2B 4L5FH 1MUJB 4QHNB 2BSSA 4HC1A 3T8XB 3GSUB 4TQEH 1XF2B 1HYRC 1Z9MA 2ADFH 2H2SC 4F2MA 5KSBA 1DQQA 3DVGB 2R0WH 1KEGL 4TTDC 1DQQB 1V5JA 4RQQB 1DQLL 5C6TL 1ZHLB 4JRYB 3VI4F 1CFVH 4NN5C 4TRPL 5IROA 3U9UA 5DJ0B 4Y1AA 2BNRD 5DJ0A 1T0MA 5IBTH 3L3JA 1KIPA 1MCRA 1MFNA 4L4VE 4NC0B 4NSKA 5IMMA 3G08A 1F4HA 1F3RB 1F6LL 3LPGA 3QI9D 3G5YB 5JXEC 5GGUB 1NMBH 1VFMA 4G8IA 4GQ9H 1SHMA 2YKLH 4EZMA 4LLAA 5IMOB 3MLUH 1IRAY 1VFBA 3H7LA 2F15A 3FQRB 4M02A 4OAWB 1YMHA 3PDOB 2VRAA 4OF8A 1IVLA 1RK1B 1IAII 5BW7A 3DLQR 3TIEA 4QYOA 3KPRE 4Q2ZA 4BUHA 1MQ8A 3MRRB 1YEGH 4FQ2H 1ADQL 4PJXA 4XVJH 4Y7MA 4WI9A 2X7LB 1N64L 5D1XD 3JTTB 1OWWA 1CGYA 1G6VK 3D0LA 3QUKA 2JELL 1CE6B 2V5TA 4AK1A 4ZUTA 2Q8AH 4XTRD 4PJ9B 5FUOH 3CFDA 1A3LL 5L2KE 1TZGL 2F8OA 4J6RH 1FZJB 3KNBA 4MNQA 4OUUA 1L0XA 5A2KH 1CFQB 4Y19B 3HAEB 1AGEB 3ZE0F 4DVBB 2EYRB 5SX5H 5FO7B 4HXAL 1CICB 4XNQB 2E7CA 3MRHB 2PXYB 4XP1H 3G04B 4EIGB 2NLJA 3CLEH 2X89A 4RGNC 1RIHH 2EH8L 3OTTA 5DUPH 2KDGA 3U2SB 4PJIF 4WI4A 3CU7A 5I8OL 5L9DL 4XNXL 4NQED 4XBEL 4PJEB 5ITFB 1TQCC 2ZKHL 4PJ7F 5GQBA 1FZOA 2B1AL 1AXTL 3PWPA 3CFKA 5D7IF 1HCVA 4YE4L 1U6AL 12E8L 3FO9B 4K8RH 5JPNB 5E24E 3TV3L 5EU6A 3WJJC 1OAYH 1Y18A 2YSSB 5A43C 1R3HA 4WUUB 2DQJH 3C6LC 1O0VA 3MZGB 4NFBA 4TSCL 1LDSA 3H9SE 4QHMB 5D7SH 1RZ8A 2DS4A 3ES6B 4PJFB 4RBPK 4LOUC 3DJ9A 3G5ZA 4C56B 3IDXH 4ZYKA 4G7VH 2ZUQB 1S7SB 4N5UA 1NCCH 3NZHL 2F53B 5F70A 4U1SB 5IWLA 2D7QA 3HB3C 1JMXA 3BJLA 3HG1B 3RZCC 3BP6A 4BM7A 4PFEA 1X6NA 1OLLA 3QH3B 1CXHA 3TF7C 1BVKB 2YK1L 4LRIA 1KXTB 1Q9LB 4OCRH 5ICXB 2Q20A 4GQPH 2B5IC 4R2GD 5DA0B 1J18A 1VENA 1QRNA 2OR9L 4JPWL 4MXVF 5J13C 3TO4D 1JPTH 2X1XR 3GSWB 5F7KC 4PREA 1PAMA 1XF4B 1P9MA 4OM1L 3E3QE 5KVDL 1CDHA 5JLZA 4HMEA 3RY5A 3KPPB 4ZPTB 3MUY1 2X4OA 1MFDL 1I3VA 1TQBB 1AQDB 1NCBL 3TT3H 2BSTA 2NLJB 1FFPB 1RUKH 1HKFA 4LVNC 4WFED 2WSKA 2X42A 4ODHL 3MRNA 4TVPE 4UV4L 4YBLC 3CMGA 3X11A 4F8TA 1IM9A 2K3TA 1BVLB 4Y16A 3ZE0E 1GZQA 5HHOD 4EI5B 3PABA 5AZEL 4PJ5A 3PWPB 4Y4KC 3QQ4A 1BHGA 2HT4D 3GKWH 2Z31A 4PP1D 1WBZA 1M7DB 2MPAH 2VITB 5EG6C 3RI5K 3DX9A 4Z76A 1K85A 4ELMF 2IBGA 1BGXL 2C1OB 5KVFH 3WV0A 3C2AL 3PJSA 3IU3A 3L5JA 2PO6C 4GS7B 5DZOA 3EDDA 1AD0A 4WTXA 4FZEL 2VLLB 5DJAA 1VEPA 4L4VD 3WO4B 1FVDB 3IDJA 2OJZH 1IILE 3FQRA 1Z3GL 5I8CB 4WW2F 5F1KC 5SWZE 2H26A 2FIKA 4D0BB 2CDFB 5IIEA 1YEKH 4XP9H 2J12B 3O6FC 2IALB 4U6VL 1FVEB 3DTXB 3MRFB 4X7TB 4OIIL 5JZ7C 1GL4B 4PRIB 4J2XA 1FFQA 3BP4A 5FDYA 1G9EA 3BP4B 1HIML 1MCDA 3I6LE 3UJJL 1FL3A 4ENED 4PRIE 1P9MC 5HGHA 1KLGA 2UWEA 2UZXB 1ZVSB 3LKSB 1RZJL 4OLUH 2XT1B 3INUH 1EDQA 2FIRT 4AMKL 3S5LB 5D7IA 2WIIA 2EDBA 1X7QB 4K23H 5TF0A 1R3LB 3BW9A 32C2B 1HEZB 4EI5C 2OK0H 2NY5L 2G75B 2X4RB 4X80H 5H8DA 5BV7H 4YH6A 3U9UB 2CK2A 2R69L 3GIVB 4KZDL 4L3EB 4UINH 5D2LE 3VFWB 3CVHH 2FLRT 1DBMH 1SYSB 3I85A 3CIQA 5E9DE 3E0GA 4XWOC 3FHAA 3VDCA 5DMIH 5E9DB 3O4LE 1XGQB 2BSRB 1KT2A 1PKOA 2R56L 5F6IC 1KPRA 2X4PB 4M1DH 2ENSA 4G42B 4PJXF 3T4YB 4GW1A 4JM4L 1CE1H 3EYQC 3D9AL 1P53A 1NLDL 1OT2A 3O2DL 4JFOB 4RA0C 4WUUD 1GOHA 3HKFA 2CXGA 5CAYB 3X14A 3MV9B 3FQWB 1B4JH 4NRXA 3SQOH 2HN7A 1J1XL 5CJXC 4RWYH 3OB8A 5HYSG 3I50L 1GGCH 3NAAH 1RU9H 3BKMH 3WXWL 1I8IB 3BSZL 4NJ9H 1YJDC 5JHLL 2CD0A 2IFGA 1E4WL 3N9GL 3EYVB 4LDEB 3N85H 2VAAB 5DI8B 5EOQL 1U58B 5SWSE 3V6ZA 4I3GA 1GGBL 3V4UH 2W9DL 3G04A 3S3PA 2HTKD 3L5XH 3LB6C 3EHBC 1KCRH 3NN8A 5BJTA 1F13A 3EOBA 3NN8B 5C0BE 1SYVA 4XPFH 5K9OB 2X4UB 3F7VA 3W9EA 3V52H 3ORJA 4QXGH 4D9RE 1CDIA 4PGJA 5K9JH 4XB7A 3D39D 1UEMA 1OLZA 3BDYL 4EXPX 2BJMH 5DYOA 3LRHA 2MKLC 3GMOA 1FSKC 1IL1B 1CN4A 4RGNB 3WJJA 4PY7A 5J3HC 1IEBA 2B0SH 1YEIL 2AV7B 1AQDA 1R3HB 2AXFA 5HYJA 3R1GH 5IQ7L 4LSRL 4Y5VA 3ARFD 5GRJH 1I9RL 1KNOB 3HCVB 1FH5L 3C8KB 4X6EB 3CC5A 3O11B 43C9A 3GSNH 5F6HJ 1BFVH 2IPUG 3G6JF 3NCFB 3OX8B 3OX8A 4D3CL 1D5XB 1OSPH 4JO1L 4H0IA 3OKLA 3QJFA 4CVZA 5F88A 5JNYA 4TPRL 3ERYA 1NGYB 3QRGL 3RVTC 1B6DA 2YHGA 5KSVB 3AS3A 1A6VH 1CBVL 3QIBB 3O3BA 4CDGC 4K94C 1G9NL 4I48B 1U8JA 1JGVL 2VDQL 3JXAA 4P46B 2EE6A 1C16B 4HT1L 4B7LA 4EJ1C 3D3VB 4NGHH 3RDTC 2VLRA 1NGPH 1FP5A 1LK2A 3VRJB 1S8DA 4UOW0 3SHSA 4ZAKA 5ACZA 1VACB 1UVQB 2BCKB 2A6DB 2HH0L 1KLUB 2Y7QB 1OL0A 3S3SA 4PJBE 3VXNA 2HLAB 2G2RB 4X7SL 1U95B 3PGDB 2I24N 2E9WA 4PGBA 5I2IB 1A6WL 1YY9D 1VGEL 2P5WA 3W0WE 4LPUA 2BVEA 2HRPL 4LKXA 2BVUA 2VR5A 1NAMH 4CJ0A 3VXPA 3U48A 1C7SA 1F4XH 3EO0B 2W9EL 4XPAL 3KYNA 3BEVA 1FORL 2YRLA 2OZ4H 3VWJD 1CGSL 1FIGH 3N50A 1OTSC 1WIUA 5HY9A 1JPFA 1LE9B 1QBLL 4GAJH 3KJ4B 1I7ZB 3DX8A 4WWKB 5ALBL 4L5FL 1LEKA 3I6GA 5D2NB 5MENA 4U6XA 1JUFA 1CS6A 3K1KC 1KIPB 5KSBE 3CH8A 5GGRA 1YUHB 3CC5B 4Q6IC 4P3CH 4FHBD 4DAGH 4FFEX 5GS1A 3TCLB 2NPLX 1Q8MA 3SDYH 4HK3J 1GC1H 5C0IA 5C8JA 3U30C 3MV7A 4XMPL 1J0YA 4JLRB 4WHYG 5SWSB 3LRGA 3NA9H 3HI1B 3QI9B 1KG0B 4R3SA 5I71B 2O61A 3ZE2E 4L3ED 1ED3A 4KRPD 1U3ZA 1I4FA 4DGYL 3B9EA 5GIRA 1A7NL 1FNGA 3MLUL 5DJ8B 2X44D 1U93B 3S35X 3MOAL 1INQA 5LBSL 5E99L 2YPLA 1HZHL 4UDTB 3OXRB 1V7NL 3FN9A 2X5PA 4M8QA 5ISZA 2FGZA 1YEHH 4KJQD 2A6DA 2ZCHH 4BH7A 2WIIB 4OFPA 5DO2C 4NHCL 1I1FB 4MNHB 1NANI 2NQCA 3H9HA 2O5YH 3A67H 4HIIA 3OKOB 3F58L 2K9UA 3VDBA 4HIIB 1FL5A 1VFUA 4LLQA 2IWGA 4RMRA 4LVOC 1IBGH 4LNRB 3L3JB 4NSKB 1DBKL 5CFHA 2R0KL 3ZKQD 4NKMB 4LDLB 4B41A 3P4NA 1H3PL 1XIWC 1NBQA 4RA3A 3MR9A 4Q9QH 4LSPL 4WNQA 4AT6B 1D5ZA 4NNPL 4Y8DC 1FC2D 4RISH 1V8HA 4HXAH 4KKBC 2GSGB 4KKLD 4ONFH 4OV6F 2F5AH 1KFAH 5FUZL 2BSRA 2ICEB 4KTDH 4XVSL 1AO7A 3EOYG 4H5SA 1XFPA 2FSEB 4X5WA 4S1SH 4HX1A 3RZWA 1X9QA 4PY7B 4TVPD 1I8KB 4JZJB 3F65A 3NFSL 3W2DL 4OBRA 5EOCL 5SX5K 3RGVA 1NJ9A 3VMNA 1HOCB 4JJHA 1I85A 1AXSB 4KK6D 1N6QH 2HRLA 1U6AH 4HEPG 1TJIH 3VXMB 5B8CA 1BPVA 4IJ3B 3MODL 2HN7B 1YYML 1SBBA 3LV3B 5BRZB 1DUZB 5IBUG 5AZ2H 3WLWC 4KKAD 2VL4A 3MA7A 5L88L 3W0WA 5F88B 3KPOB 1U8MA 4MYWB 1I8MA 4F58L 3MRIB 3EYFA 1II4E 4E41A 4QRQA 2QL1A 3SDXA 4JDZB 3JV6A 3BN3B 3HMXH 5F89B 5HYSB 3T2NH 4GJTB 2YD5A 2WBJB 3GO1H 5L2JA 4D8PB 3QFDB 4GBXD 4YZFF 3KHOA 5GSVA 1GXEA 1MHCB 1U36A 3O4OC 4RCAA 2IQAB 1P6AB 5DFTA 1DBJH 1NANH 4L8BA 4TUKL 5E8OA 4HPYL 4KTEL 1AJ7H 1XIWA 4WWID 5DEFB 4AM0A 4KRPC 4KK8C 5K59E 3AREA 1UB5A 5ANMB 5LGHH 5E2UL 4LP5A 3UX9B 4WI6A 2MCPH 2DLHA 3RIFF 2NW2B 1SJEB 2XWJA 2A2QT 4DN3H 1OM3H 4QOKB 5C0EB 1FJ1B 2DICA 1X5IA 3FMGL 3EYSL 3MGTB 1RIUL 1LILA 1VB9A 3T2OA 4UNTA 4OZFB 4I18B 1EVTC 2DQHH 1QNZH 5FO8B 4MZ3A 5FKPA 4BFEA 2EYSA 3X17A 2UY6A 3ARUA 4NKDA 2NY1C 4NNYB 2X6MA 3QG7L 4PV8A 1UZ6E 2GHWB 4L3CB 4PJDA 4PJHA 3K4DA 5JR1H 4X5XA 4X6FB 3DROB 3PGCB 2FBOJ 2Q3ZA 2B1HL 3OAUL 1B4RA 2G60H 5E4EB 1U8LA 1ZHKB 2H2PC 5ESAB 2V7NA 1RUML 3W11C 2BMKB 4JN2A 4JM2A 4X6CB 5F3BA 5FYKL 3CPLA 3SJVE 2DIJA 3RPIB 5DHXB 4WCYL 1JRHI 5D72H 1NBZA 5I1EL 4OKDA 5EBGA 1EO8L 4WEBH 1IQWH 1IGCH 1EAPB 5F6HI 4LRNL 5MI0B 3MOBL 4NT6A 5D1ZA 1S9XB 2MHAB 4IM8A 3EW3B 3BGAA 3VXPB 2D03L 5FYJL 4PUBH 1MELA 4ZS6C 1KIUA 4J7RA 2IF7A 4FQLH 3KLAB 1GJIA 1WBXB 1BQUA 5ERWA 2NY4D 3LRSA 1NCTA 5HHOA 4Z7WA 2R4RH 3TBWB 4FG6D 3LS4H 1BAFH 4DFIA 2Q3AA 1LD9A 2ADFL 4L8CA 5JUEL 3KPSD 2XRAH 1MNUH 1CGVA 4JY4B 4P4KB 5C9JA 3B9KD 3ARDD 1RZJH 2IPUK 4QNPE 5BCAA 25C8H 1LEIB 2HTLD 5CSZB 5IBTL 5C0GB 4K23L 5KVEH 5E2VH 1T5WB 3ULVE 2XN9E 1JHTB 3BYTA 4IRJB 1EFXB 2FJHB 4RQQA 2QHRH 3M8OH 5EUOA 5E08L 4APQB 1X5YA 2ZOKA 4NKDB 6FABL 3D2UD 5IMMB 2RJMA 1DQTA 5FYLD 4UINL 2C4XA 3KJ4C 4ZQKB 3UTTD 4TVPH 1CIUA 2AJUH 4JKWA 4UOJA 1NGZA 5DJ8A 1A9EA 5F3HA 1RURH 5GRUL 4JFFA 2X9YA 2FDBP 3HE7D 2FHFA 1KJMB 3O2WH 2HT3D 4X4ZA 3BZEB 5HGDA 2NY2D 3GRWL 1CD1B 1EFQA 2OL3B 4HJGB 2J6EA 4TUOA 5MEOA 3RVWC 2VC2H 3MUHL 1CXFA 4X7EC 2QTEA 2YR3A 1WQVT 5K9KA 1MCHA 4OB5L 3C6LB 3NIFE 1VADB 3MNVB 2VZVA 2V2XA 1QQDB 4IOIB 4P23B 1WC7B 3HC0A 4FFYH 3OHXA 1BD2D 3SPVB 5JIIA 5D5MA 1B4JL 1PX4A 3F7QA 5C0ND 4BZ1L 4OZGB 3U46A 3UDWA 1JGLH 1T4KB 3NAAL 4JCLA 1MY5A 5LG1A 5DA4A 2XTJD 2XKNA 4XBEH 2ZCLL 3EFFB 4ZUWA 4NQDB 3TGXA 4ZODA 2OTPA 2B1AH 1P2CB 4M1GH 1Q1JH 4B5EA 1DR9A 3HN3A 3O4OB 3DIFB 4H8WH 5DJDA 2PW2A 3UTPD 2G5RA 3V6FB 4OD1L 1FNEA 4XX1E 4G42A 3JWDL 4XBPB 1QA9A 3ARYA 5FYJD 4UBDD 5LXGH 3H7BA 1OAUH 2EIDA 1SJVA 3MPCA 4O2CB 5EDXA 2JLLA 1NGXB 1RIVH 3H9SA 2VOTA 3JUZA 1EAJA 1IGJA 2DBLH 3ULVH 4O58H 3D0LB 1MQKL 5I1HL 2YD3A 2A74B 4X9FA 4ODSH 5I1GL 2VAAA 4EDWL 2DD8L 4MJ6B 4XNQA 1OSPL 3IJHB 1QR4A 1S7RA 2VH5L 4JO1H 4XVTH 5DUML 5MERB 5A3ID 1ZHKA 4JZJC 4NQDD 3D85B 5I1CL 4J1UA 4LCCA 3WNLA 4PJCE 1QBBA 3LEYL 5HDQH 3F7VB 3W9EB 4B0MM 1N5AB 1URLA 1KOAA 4M6OH 3QUYA 2BNQD 2JB6B 4M7JL 4LOUD 5DJ6A 2I07A 4KDVA 1OPGH 1UA6L 1PYWB 1I1AB 1ZS8A 3FO0L 1DN0B 3U0TA 3AXLA 1DN0A 4X5LA 3P9MA 4ODHH 5ETUA 4AIZA 5L7XL 3FN0L 3M1BA 1MI5A 3AS1A 3KYNB 5CKAA 1FL6B 5KSAB 3BP7A 3F5WA 5IW3A 5TDOA 1MRFH 2UZYB 2VXQL 2HRPH 1MCOL 4NP4H 4MQTB 4HFUH 2IG2L 1IAKA 5IW6B 4XPAH 3G5VB 4GMTL 4YNYA 1QSFE 2QSCL 3FT4B 2BP3A 4YXLH 3V0WH 4LGPB 3QCTH 3DYOA 3RWDB 5IHZA 3SKOA 2FNBA 3THML 2GK0B 5T33L 3LN5A 5HVFB 2V7NB 4JAMA 1JFMA 1R5IB 1WFTA 5C09A 2WY3A 1A6TB 5GGTH 2P5EA 4HQQH 5B39G 4L8SA 3NZ8A 1KB5L 3CXDL 3U6RA 1IGFH 1QFOA 4Y5YB 3MLTA 3C8DA 1QSEB 3OXSA 3HMWH 3ZDXE 2R29L 5FF6B 3FFCE 2CRIA 2Q6WB 3OG6B 1OGTB 3ARGB 3QCUH 1DUYA 1YEKL 5EIIA 3FQUA 5CEZL 4JJ5B 2XZCH 3QEQD 3WKNA 4JO2H 2R9HD 2R9HC 1J0IA 4NDMB 2ZUXA 1F97A 1JI2A 2JK5A 1YEDA 1DQLH 2D7NA 4KHTH 3IDIA 4PJHE 2WINB 2AEQL 2J8UE 1AGBA 1M05A 5D2NC 3TBWA 2FO1A 1PG7W 1MLBA 3SY0B 2L7JA 1U2CA 4LF3B 3DVIA 4MAYA 5E99H 4GBXB 4E42B 1OAQL 1W72H 1BZQK 2EIZB 4P5MB 3AAZA 3T09A 1XCTB 3KHQA 4YHIA 3LHPH 3QDMB 2EC9T 3I6GB 4EUPH 1ZANL 1KPUA 5DQJB 4DGVL 5DC4B 5D5MB 4HUVB 3L95B 3BW9B 3C9NA 4PJGB 2LVCA 3IETB 5LWYH 4R97C 4ISVB 1NCWL 5J0BA 3FFDA 2EDEA 1T3FB 3MBED 4FQ2L 4DFHA 3O8XA 5EFIA 4APQC 4XVJL 1XGPB 1PQZB 1XGPA 5DT1L 3FCTA 4KUCF 3HE6D 4V2BA 1RUQL 4PRBA 1HHIB 3DMMC 3S4SG 1PG7L 5T1LD 1A1MA 2RFXA 1JYWA 1ZE3C 4GXUN 5ADOH 1ACYL 3MBXL 4KAQH 4GAGH 3G5XB 3OAYH 1A3LH 3DUUB 1VA9A 4NNPH 2AKRB 3MRFA 1KCKA 1Q38A 2CIIA 4Y4KB 1T03L 2E7HA 3VFSB 1R5IA 2AEIT 4OQTL 1TMCB 3BPNB 4HF5H 2H26B 3ZSTA 4P46C 3ZYZA 1KYOK 4D0BA 1I8KA 3NZ8B 1BLNA 4XNMB 3CFEA 1E6JH 2FEDC 1A8JH 1BBDH 1P4LB 5HDBF 5HBBA 5HHPB 2VXTH 3QJHA 1G7LB 4WFHE 2I27N 2ESVB 5C0JA 5K9KB 4WGVB 1EMTH 2FO4A 2CRMA 3CMOH 4QGYA 3BGMA 4WV1C 5KTEL 4L1HA 3FQXA 4BFIA 3WS3A 1J8KA 2P5EE 1YYMH 1NFIB 3FB6A 1U3HA 5CJ8A 1F5WA 12E8H 1OVZA 1GGIL 2H6PB 3SO5A 2VLKE 4P5TD 5DRNA 5DK3A 1FSKB 2DJ4A 4XPGL 3QIUA 3PL6A 4Z0XA 2F8XC 3RDTA 3OWEA 3ZKXC 3CU1A 3OKYA 3TPUB 3H42L 3HMXL 2RCSL 5DJ6B 3KXFB 3VW3H 3Q6GH 2VISA 2RIKA 2A1WL 4O02L 3V6OC 5CUSL 1MI5E 1AJ7L 4PJBF 3UZQA 2XWJB 4QRPB 3MRCA 3MV11 3ULVF 1ZLWH 1LP9F 1MI5B 4JFDA 3HAEH 1WITA 3MGTA 3BH8A 1KCGC 4GRLB 3TBTB 4I18C 4GLRI 3S98A 2L4OA 3GSNL 2BRRH 3GSQA 3ZZ1A 2APTA 4JVUA 2WQ8A 5DR5L 1N8ZB 4U1NA 2VLKA 3P73B 3KYMB 3TT1L 2OLDA 4GKSA 4JQIH 4TOYL 2WUBL 1DBBL 1ZXQA 3KS0J 3CZJA 3IS1X 3QEGH 4XZUB 3SDDC 4KVNH 4GRWF 1WTLA 2CR3A 2V7HB 3ARBB 5KVDH 4TULL 4MNQB 5HHPA 1QLEL 3PWVA 1D5BA 3CXHK 3EO9L 3UYRL 4FQ1L 2E7LA 2JCCA 2GT9A 1F6AB 4S1DC 4KY1H 5DK2A 4L4TA 4APQD 5DK2B 4KK8D 3QUYB 4H88H 1FV1A 1QVOB 4KJQC 4IIQA 1S7UA 1ZMYA 3NIFF 4M43L 4PGZA 4Z7QE 1YNTA 2NXYB 5C2UB 1IAOB 1FAKT 4M1CC 4PJEA 5I30L 3QPQD 5ITFA 1FG9C 1F4XL 5E9DD 4PS4L 1RULH 4WI2A 2CMRL 4QXUL 5EZLA 2V17H 4YX2L 5JORB 5ADPL 5T1KD 5JXED 1PX3A 1CGWA 3MOBH 3U7YH 1P7KB 5EIQA 2XXMB 4P2RE 1MJ8H 4IJ3C 3L3GA 2X4OB 5F93C 3WIFA 3C60C 1YPZE 3CK0L 4H0HB 3QXWA 2MJWA 5BS0D 1J9CT 3MRMB 5DD3H 1MFEH 1NUNB 4LHUB 3BQUC 3AAZB 2E5EA 2XWTA 2YPLE 3RVXC 1JN6B 4DUXA 4GRMB 4H1LA 4XP9L 3SO3C 5I17B 3LQMA 1LP9A 2Z31B 2HVJB 5D6CA 4P5TC 3PWJB 2VLMD 1LK2B 1RJYA 3MLTB 1QFHA 4YHYC 3ULUH 1KEMH 4ZO7A 1A1OB 3VD3A 2KUTA 2RQ8A 3PP4H 4UTAH 3U4BH 2ICWA 3WHE1 1J86A 1HHIA 2VLME 4PV9A 3P4MA 2BVPB 3TESA 5CINH 1NMBL 1T89A 4ZFOB 5HYIA 4Y2DC 1J0ZA 1HZHH 2DKSA 4MNGA 5I1LB 2Q7YB 4AEEA 1T2JA 3EGSA 4V1DD 3FZUD 4U1KB 4X7TA 2ZCHL 4YHML 3P77A 4G3YH 4LLWA 1CG9A 2ED7A 3LOWA 1WISA 2JB5H 2VUOA 3ARGC 2ZUVA 3FB7B 1Z0MA 5EUOE 5DMIL 2BSSB 2EE9A 3CFJB 1GSMA 1TDQA 4PLJC 4FXKB 1OP5K 2CK0L 1LNUB 2WBKA 4HWNA 1M7XA 4I0CC 1MCEA 5F9JA 2DM4A 2XNAB 2V9TA 2VLRE 2IQ9H 1ND0B 3L6FB 1AY1H 3O3EB 4XMKL 1A14L 1CVSC 1G6RA 1KFAL 1G7JB 5JDSA 3MA9L 4P2YA 4N0CD 5ICYA 1J1XH 4NRYB 3HC4H 3C8HA 4Z7NF 1BIIB 1E0OB 2GITA 4HIHB 5B3JF 3VXRD 1B9ZA 5M94B 5ID0B 3I02B 4XI5D 1MFAL 5T3XH 2YA1A 3LIZH 2YBRB 2AVGA 1Q1JL 1E4XL 1QPPA 4NO0D 1P4LA 4M6NH 3DECA 4UDUB 4H8WL 1N6QL 4XPTH 1KT2B 3U4EA 3IJSA 1AXIB 1BJ1J 1FYTA 1TCRA 4QT5A 3QO1A 4O2CA 1ZKAA 4KFZC 4Y88A 3IDYB 1I7TB 1AIFB 4YDKL 4LSDA 4U1NB 5ENWB 4XXCA 5LXGL 4XRCB 3EHBD 1HHHB 2J7LA 4KJWC 2J88H 2R4SH 3V7AE 4GXUM 3WD5H 4N8VG 4I3RH 2H1PH 5DK0A 3LV3A 5BRZA 1S9WB 4MJ6A 4JVPA 1A1NA 2BC4B 3BUTA 4JKLA 3WKMH 2AJ3B 1EERB 4WHTB 3VRIA 2M26A 5DTFB 4S1RL 5HI5C 1INDL 4DEPB 4YK4B 2GY5A 4JFQB 1S7XB 4KZEH 3R1GL 4U1MB 2DD8H 1HI6B 4JRXA 3P4NB 4M48H 4NQCA 2VLRD 2VH5H 4XVTL 5DUMH 3QEUA 5CP7A 5TQ0L 1U41A 1EHAA 1N7MH 2WBJA 3GSUA 4C54A 3LEYH 3RZCA 4KI5D 1KTLA 4F7EB 4WFGD 1RD6A 5IHUL 5E8NA 4I77H 2BNQB 4OCRL 5DZLA 2BNQA 2W0KA 5DF0A 4P4KD 3AY4C 4RAVB 4FTVA 4EUPG 3EOAA 3V4VL 1NEZA 3TIEB 4I0KA 1IL1A 4PJAB 3MV9E 1OSZA 4PG9B 4CU8A 3TO4C 1G6RB 4HT1H 4NCC2 2ADGB 5L7XH 1IGJB 2WV3A 1ZT4B 2X70A 3LKNA 5HYJD 1KF9B 1TVDA 1VFBB 3IVKB 1K8IB 2P1YA 4X4YB 3ESVF 2QV2A 3QIWB 5GS0D 4LHUD 3WFCH 2VDLH 5C0FB 2D7OA 5EA0H 1HKLL 3TYGL 2F5BL 5CHNA 2OCFD 4PV8B 3W81A 4L4TB 2DL9A 2J8OA 3OKDA 3DMMA 5D72L 2D0HA 1TCMA 3HE6B 5GGQL 4K3GA 5D6DA 4LRNH 3ULUE 3P4MB 2E8YA 5DXWA 1N4XH 1I1AA 3HRPA 4R4ND 1IGIH 1SJEA 1S5HA 1FNHA 3IFPB 3VXSB 4G9FE 1FIEA 2ENYA 5HVWA 4I9WE 3IDIB 2BXYA 1Y6MR 3NIGE 2EDKA 3QWOB 3LS4L 1AP2A 1LDPL 4FG6C 1I7UB 4QHUB 1L0QA 5E6ZA 4R7NA 2FLBT 4IRSB 1FE8L 4R4BA 3ULSB 3KLAA 1LO0L 5J1TC 1DQDH 1CDGA 2PO6A 3B5HA 4PJHB 4XNZB 2BVOA 1HIMH 2OZ4A 4G8EA 1U3HC 2X4TA 1Q9KB 2X4SB 5KS9B 1Q9KA 4YPJA 3EYQD 3CFJA 5BV7B 4HUVA 2E7LE 2WANA 3MOAH 4I0PB 5C9JB 2OYPA 4LAJH 4LVHC 3MRDA 4G6AD 1CXEA 3TZVD 1QRNE 1HQRB 3RWGA 1ZANH 3MYZA 4O4YL 4I48A 2C4FT 4NO2B 4JM2B 4X6CA 3D3VA 1K8IA 1MJ7H 3ES6A 4PJFA 3GK8L 4LLDA 3PWUB 5IEHB 1N0XH 3P0GB 4Y4KA 5C8JB 1KLUA 3BUYA 3DVFA 4GSDH 3ARDC 4XX1G 4N5EA 5BZDA 2VE6B 4KQ4L 4EEEA 3RIAK 2F19L 1RQ5A 1ACYH 4QF1B 2ZWLT 1B0GB 4RGOH 7FABH 3K2UL 3PIQA 4NPYB 3IYLW 3WL9B 3EO0A 3U83A 4CJ1A 1LEGA 1RUPH 3KPMA 4OQTH 5E94B 2HG5A 1K8DB 2FX7L 3O6FA 4MCYA 4JY6B 5E4IA 5MI0C 4AL8L 5D7JC 3QWQB 5HHNA 1HHJA 2G5BB 3VA6A 5SV3A 1JZ6A 3QRFM 1DDHB 3Q48A 1BFSA 1FRGL 3S88H 1JWSA 3WHXB 5GS0C 2F5AL 4XC1L 5KSBB 3EDFA 3TEUA 5F71A 4J4PD 5SX4I 1N5YH 1EK3A 2WW8A 2J8HA 5EULV 4JRYA 1C5CH 5A16A 3I50H 3JWDC 3MGOB 3EAKA 2KPNA 4WO4B 4PLKC 1GGIH 1MHEA 4YHKH 5D1ZC 1JPSH 1J88A 4OZ4A 4PGEB 4UQ2A 4D9LH 1QEWB 2D31A 4XP5H 4FFWC 3SEPA 4XAWH 1AI1L 5JOPD 4OCLC 2LU4A 4MX7A 3WUZA 1W8NA 4ZQKA 2KL6A 4LLUB 1DEEA 5GIRB 3MRDB 5IGXH 1NC2A 5D8JH 5CD3A 3LKRA 2VDNH 2L0DA 4TUJA 1GOGA 1INEL 3TBTA 3BEWA 3LKQA 3WMSA 3RGVB 3VXSE 1S3KH 2V2XB 4O58L 5I1HH 1MQKH 4LVNB 4Q97A 4RAUA 2GJ6B 4HWZA 3HC0B 2EYTB 3SKJH 4LSRH 4NCDA 4JB9L 3HFML 4KH2A 1MIEH 2WBJC 4N1CA 3RWEB 5J13B 4H8WC 1WF5A 4LFHG 3LSOB 5FM5M 3ROLA 1G7MA 1NL0L 3RX8A 5CZXD 2XWBA 5DVOA 4IBLT 4G6FB 2KQMA 2AXGA 4UTBH 4KI5F 4MZ2A 2PXYA 4UAOB 1KC5L 3MUGA 3S7GA 4M7JH 1UG9A 3GMLA 1W72B 1N2RA 4XC3L 5FCUH 1N6UA 3NABL 4OF0A 4OM0H 1J05A 5HVGB 5J1SC 2WLZA 4N9OB 1JGVH 1KJ3L 4PRHD 4UUJA 3LS5H 4JHWH 4J3SA 2E6JA 2VDKH 3ZDYF 5D96B 4KUZL 2G60L 4RFEA 2VAJA 1XR8A 5IMLB 4Y5XA 3T4YA 4LHJB 1U8PB 3IB4A 2FH8A 2Z35B 4PJHF 5DEGA 3AU1A 1A6WH 1FJ1A 1WZMA 4EUPB 1OT1A 3QCTL 5I74B 4PGCA 3ARVA 1IGCL 4OAWA 3WXVH 5H2BA 2X4TB 1KN2H 1CGSH 4LCWE 2NXZB 3LKRB 1MFEL 4BQ6A 4ZTPL 4NHUA 5GGSB 2ZJSL 1CCZA 4FFVC 2FX8H 4GW1B 1XGRA 1KJ2L 3SKOB 4FQLL 5CMAB 1E6OH 1HHKB 4F7MB 5EZJB 1UXSA 3DRTA 4EN3B 4IIQB 5HYSA 4POZD 1F6FB 4KKCD 3HZVA 2XXCB 5J6GB 5CJXA 3QQ3A 1MVUA 5KOMC 5A2IH 4MWFB 1XEDA 4D9RD 4JRYE 5HGBB 5FOJA 2B7DT 4R8WL 1JF6A 4DAGL 4PTUA 3T0DA 2VR9A 2AEQH 5FGRA 3TCXA 4LIQL 3SDXF 1Z9OA 4MA7L 1EZVX 3T08A 4YEEA 1YNLL 5CINL 1CDCA 1VCAA 2GFBA 3M1BB 5D7LE 3CFCL 4ZFFA 5IJKC 1N59B 4HS3B 4W68A 4DW2L 3L7FB 1HYSC 4CMMA 2X4UA 3FO1A 1T1WB 2O26U 5HHNB 3O45A 5F1SA 5DVNA 1M71B 1M71A 2R1WA 4JREC 5I17A 1MCLA 2AJUL 3C87A 3QZWA 5LGKA 3UPAA 4Y4HC 3QDMA 1P7QA 1EBPA 2CXKA 4P3WA 3BZFB 3D69A 3VFPA 1EEQA 5E03A 4HKZA 3FKUS 2BNRA 5F7NC 4GMSL 4NN5B 5FDWB 1UVQA 4EDXA 3IXAA 2ZOLB 5IVXA 3BXNA 2ZPKH 1AGCA 4OLZH 1A14H 3JWNC 1D5MA 5FHBL 4OZGF 3MA9H 3FB5B 1EJ6A 4LQFL 4W70A 3HC4L 3WBDA 3P3YA 2DLIA 3V95A 5JOFA 3QH3A 2AJZB 4UT6L 4O2FA 3MMEB 5DD5H 5E6IC 3ZKMC 3QUMH 3CMOL 4NFDA 4CVUA 4S1SL 3KPLB 3VXTA 1NFDF 5ENWA 5JW4Q 3EJYD 4IRJC 1OP3K 3T0EB 1UADC 5KS9F 3RY6A 2EIZA 2XN9B 4NM8L 2OMBA 5DK0B 2OJEB 3CGTA 2FWOB 1TJIL 5BQ7A 5D1QC 4ZPTA 4I2XA 1KJ2A 1T89C 4ODWA 4JFYA 3K4ZA 3SPVA 3HPJA 5AZ2L 2H1PL 5IJKA 4KC3B 4JANB 4U1IB 4PP1C 3CVHB 1NFIA 5L88H 1EPFA 2FHBA 1JYXA 4OD3L 3U46B 1EFXA 4YDIL 1NCNA 2NW3B 1JPTL 5DRNB 5I66B 4YUEH 4FQXD 2CDEA 4DN4H 2QEJA 1G0YR 4WWKA 3QHZL 3GO1L 1F00I 2N1KA 4K7PL 5I0DA 3S34L 3U36B 1N7ML 1IGMH 4PRAA 4ZMAT 5HHXL 2I26N 3DHMA 2VZ3A 1JMZA 4X5WB 5IHUH 3AS0A 3HUJE 4J4PA 1PY9A 5E2UH 3TWCL 4XBPA 4JQIL 4TOYH 4QHMA 2IMNA 4MNHA 3MV9A 3FQWA 2ADIA 2VXSH 3BD5A 4M62L 5CD5C 2DTMH 3KYOB 4U6YB 3QO0B 3OV6A 4L3AA 1FBIH 5CP3H 1PW3A 2X09A 1OPGL 2DLEA 4P2OC 3LMJH 4BFIB 3UTTE 2HAZA 2DWDA 2MQ3A 3KPRD 3OHXB 4FQ1H 1Q0YH 4FMFA 1U8MB 3VE0B 4U1MA 1SMAA 1XGYH 2XPGA 3MREA 2IPKA 5A3IC 3FFCD 4QWWD 4F7TB 2F5BH 4M43H 4F7TA 2Q76A 1DLHA 1TJHH 1H3VA 1WZ1H 3WIIH 5EO1B 5E5UB 1U8IA 3BGFC 1JF5A 1UWEH 3MCKA 5C0BD 3UJJH 3U7AA 5EU6E 1QRKA 1NFDE 2VERN 4LNRA 1BJ8A 2FSEA 3FOMA 1MJ8L 4KRPB 2GSIA 1N4XL 3GGWB 5EU6B 4XCYA 1IQWL 3RUGB 1HDMA 5TF1H 2FB4H 4HPOH 4J3OC 2NY6B 3MFFB 4MS8C 3CCHA 5ICZB 5DMGD 5FEBA 2VLJE 5SWZB 2ZSVB 4CMHC 3DO3A 4X8XA 3T3MF 3LKOB 4YQXH 3G6JB 4X80L 1JF1A 3D0VA 4M7LL 5IG7A 2CRYA 2WMPA 2YD6A 5E7FA 1N8ZA 5IHLB 2V5YA 3RU8H 3QDJA 3ZT7A 4HAFA 5CEZH 3QDJB 3HLAB 5I8KL 1LO0H 1DQDL 2P24B 3BJ91 2BDNL 1D7FA 3GI9H 3UZEA 2ORBL 3RGVC 2DB8A 3OR6B 1UACH 4OGYH 3VWJC 3U4BL 3PJSB 4MB3A 4NUJB 2JCCB 3D87B 3RVUC 1K2DB 5JMRA 5IKCB 1WSST 2OI9C 1TTFA 1H15A 3QIUC 3DPBA 1DSFL 3OZ9H 5DJAB 4XP4H 4HIJB 3RNKB 4AENA 4GG8B 3M8OL 5F7FA 2PW1B 4F7CB 2WQRA 4K07A 3OKKA 4JR9H 5D1ZB 3JV0A 1GPOH 4MLIA 4YHMH 1IQDB 4J3VA 1JWMA 5BXFB 5C0EA 4H20L 2O5XL 5TDPA 2DN7A 1P7KA 2F19H 5F7YC 3O0RH 4QY8A 3QDAA 1AGBB 1M05B 2YD9A 2ZUTA 3VXUD 4NQVB 4I18A