3VXOA

Hla-a24 in complex with hiv-1 nef134-10(2f)
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 75
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxoA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxoA01
4KK8D 4ZMAT 5A2KH 4JZOA 3P0YL 2FEDD 2HN7A 2XI9A 1MRCH 3MNWA 3LB6D 3V5HB 4G9DA 1A4JA 3SDAA 4MNGE 5EA0L 3QJFA 1VHPA 2OJEA 4OB5L 3QNYA 4LHUB 5BOZG 4MWFB 5DD0H 2M2DA 5IHZA 4I18C 3PQYA 1WBZB 3S35H 1MIEH 5HPMA 5HYIA 1JNJA 4UUJB 3OAUL 4OIBA 1FLRL 3V5DA 4IDJH 3KWWB 1CXKA 2VIRA 1BGXL 4ZG1A 4OJFL 4PLJD 5IW1B 2DM4A 4P9MH 3VRIB 1FIGH 1IC5H 2EDNA 3ESUF 1TETL 3QUMH 3DBXB 1S5HA 5CBEB 4R9HA 2F5BH 1O7VA 1KCVL 3IDIA 5KS9A 5EPMB 4QTHB 2DTSA 3P9LB 3QUYA 1YMMA 4R0LC 1K3IA 4X9IA 5BO1H 1M6OA 4OD2A 5DEZA 4NQVB 1AD9B 3UEZA 4GMSL 3BP6B 2N1KA 3AREA 1JPGA 3GI8H 4OM1L 3U7WL 2ATPB 4R97C 3TBYA 1N7MH 1WIUA 4Z0XB 4CBPA 3GHEL 1E6JH 4K2UL 3QO0B 1Y6NR 35C8L 1YPZE 4J4PA 2VXQL 4PBXA 5J6GA 4ODXB 3SDYH 4YFLF 4LVNB 4OZGA 4LF3B 4NQCA 2H32B 3VFMA 2EDYA 2H26B 3PGFH 1J0KA 5E8EB 3WS3B 1I3GH 4OCNC 1S7XA 1C1EL 1BM3H 4X7TB 3M8OH 1ITBB 4HIHB 3V2AR 1I9IH 3FFCE 1U6AH 1WC7A 4M7KH 3FQWA 4LRNH 3Q6GL 2LVEA 5JXEA 4JRWA 5LWYH 3JVGA 3RWEA 2BFVL 1OD9A 4L8DB 4MDJB 3UZVB 2QEJA 1HCVA 4PTUA 3I2CL 3IJYA 4MD5A 5D6DA 3EYVB 2XNAA 1BZQK 5DJYB 1U41A 3TN0D 4JFEB 4BA8A 1MHCB 3CFBA 2ZWLT 3PDOA 2JELL 5I1GL 4L5FL 1GSMA 3C09B 3SDXA 4HGMA 5KG9B 4RX4D 1WITA 2R0ZH 3P9WB 2EXYD 3MRIB 1I1AA 3IFPB 2Z31C 4JLRA 4PJAA 5E2UH 1FN4A 3FB8A 2VDLL 2X4RA 4HD9A 4YBQD 2D7TL 3UX9B 2X4OB 1R3HB 3IDJB 3ULUD 1FYTA 1RQ5A 3PUCA 4OD1H 2O61B 4CJ0A 3DI2B 4WUUB 5JDSA 4YDKL 1F6FB 3RZWA 3I3BA 4NDMA 3ULVL 1IAIL 3QUXD 2JB6A 4LCWD 5L2KD 1XGRA 1UA6L 1R3JA 4ZO7A 5A16A 1FO0B 4UDUA 3FB7A 4XH2B 3ARFA 2QSCL 1WBZA 4MCYB 2DQCL 3O6LH 4DN4H 1KNOB 2Y7QB 2W1NA 3FO1B 4WHYG 1YN7B 2A6JA 2EXWD 3QULA 4CKVX 1QQDB 4PTTA 1J12A 5M7QA 4K3EH 2KQNA 5D7JC 4HPOH 5EOTA 1WBYB 5C08E 1XCTB 2DYPD 5FYLD 4FFZH 4L8SA 5HYJB 3B9DA 3RGHA 4CVUA 2AJSH 2YD9A 4Y2DD 4BFBD 4KI5C 1P2CB 2FR4A 4RQQB 1T66C 2VDOL 4L4VA 3VMNA 1JBJA 3SKOB 3KXFA 5E6ID 5EPMA 3CDGB 2VH5H 1Q9LA 1MRDH 1NDMA 3FFCD 2E3VA 3GNML 4L3EB 1A9BA 5I1AA 1MUJA 1NEZG 3IAPA 1X5FA 4HCRA 1T7WA 4NP4H 4P9ML 5CWSA 1WV7T 3VE0B 5HVWA 3ES6B 1GXEA 4URTB 5IFJA 4FTVB 1MHHA 3SBWA 3KWWA 1EERB 3MYJB 3OX8B 4LSRL 2ZCKH 8CGTA 1DBBL 4Y4HA 5IMMA 2W9DH 4DZBB 4LHJB 2VYRE 4RGOH 3E2HA 1M71B 1AGDB 4J2XA 2YPVH 1MLBA 1C5CH 1CD1B 4GXUN 5D8JH 2PXYA 1H3VA 2NX5A 5D7IF 3NACH 4N9GA 5GRXG 5KVFL 4FQ1L 2DICA 4GRMA 3V0WH 4ZUSA 2OR9H 1T21B 4QWWC 4MSWA 3NPZB 1GGYA 3DETC 1PSKH 5KSAD 1DEEA 3K1KC 5GGVY 1J1XL 1T5XA 2GCYA 3QWRD 2OTPA 5JIPA 1KUMA 2BSRB 3MBEA 1HDMB 1KG0B 3KLAB 4BK5A 3DX7B 5T5FH 5GXBB 1LO3H 3TF7C 5D7JA 3V5HA 1QFOA 4P59H 2CDGA 4ODTL 4LLDB 4XXCA 3RL1B 5LCVH 3UCRA 4L8SC 5DTFB 4OCXH 1M7IB 1W0WB 4MD0A 4V1DD 4HKJA 2A1WL 3UPAA 2GIYA 5K9QI 4Z5RB 5HGBA 1AE6L 2X9WA 3RWFB 2X6MA 2B0SL 2NYYC 4WI9A 3MXWH 1JHTA 5IWLA 2HVKA 4K94H 4G8FB 3K4AA 4XCNB 1U3HB 1FGVH 1OM3L 4CN4A 1J8HB 4H1LA 3OJDA 3V0VA 2DWDB 1YPZB 2ZNWA 4C56E 1BF8A 2H6PA 4IEFB 3FMGL 3QIWD 4LAQH 1KJ2A 1DQLL 2IFFL 5FYJH 1PG7H 1H9VA 4KVNH 4XNYH 1BFOB 2CKBB 4XP1H 4BFIA 5E2TL 4WO4D 2UZYB 1JHKH 3ARFB 3HR5B 5D70L 1YJDH 2M8XA 3O6KL 3NIFE 1EA9C 5KG9A 5JOFB 4PV8A 2YN5A 5CD5D 2H3NA 4I48B 3RUGE 2O5ZL 5JQ6H 3P4NB 1ODAA 1NMAH 3RU8H 1GGIH 3CH1A 3GMNA 4GKZB 4K9EH 5LXGL 3KPQA 4M6ML 3RHWF 4B7LA 1S3KH 1URLA 3DXAD 1OQOA 4QYOB 2D3VA 1NLDH 1I85A 3PE9A 3QFJE 3O6FB 4KI1A 4XHJC 4ZAKC 3CFKB 3Q5OA 4WI8A 4L5FH 5C71A 5HHQB 2BCKA 4KRPC 1K4DA 5JORA 1JV5B 1A2YB 3Q2CA 1YEGL 3OXRA 5T1LD 3B43A 1GGIL 2HT4D 1RIVL 3NH7L 4LLWA 4R97B 1ZHKA 1JI1A 3B9KD 4AIOA 3P30H 2MQ3A 5MI0C 3NA9L 4G9FE 1M71A 3IFOB 3MNVA 1PX4A 3HN3A 4WNQA 4PY7A 4PJFA 2CO7B 1J86A 2CIKA 1N0LA 3I6KB 5IJKA 2DM7A 4XP5L 3LV3B 2C4FT 1EAJA 3UC0H 4ZNCD 2DQEH 2XQBH 4HXAH 3TO4C 2FDBP 5GISH 3FO9B 3W39A 4PRHE 4EN3C 4P2RB 3L6FB 4JO4L 9CGTA 5E1HB 4J4PD 4O5LL 1L8JA 1QHOA 3TM6A 5EZOH 1LE5A 3QBTB 2IANE 5ID0B 2IPTL 5BVJA 5IJVA 2BSTB 3PNWB 1ZVSA 1GGCL 4BQBA 3DVGB 4XPFL 1KGCD 3MBXL 1I7ZB 3NOIA 3C5ZB 3HMXH 4AEHH 4ALAL 5IV2A 4RGMC 4L3ED 3PGDA 4PJXB 5CSGA 3MV01 4K7FB 1GZPA 5DHYA 5D1ZB 3P9LA 3QUYB 3QUXC 3CUPB 1FJ1A 4LVOB 4XBEL 5FK9A 1E27A 1QSED 1T21A 5EC2B 1I7UB 4JFZL 5E2WH 3BW9A 3MLUL 5F7UA 4G6KL 4NN6B 1CL7I 3FB5B 3MRKA 2D31B 3T3PE 2G75B 3VCLB 2AK4E 3MLPA 3VGEA 5A2IH 4NGHH 4N5UA 4TQEL 5JXAL 1JWMA 4D9QE 3ZYZA 4M7LL 4EZMA 5HJ3B 4ZTPL 3ARWA 4DUWA 2BVTA 1A7RL 4ETQB 1ZXQA 4R3SA 2BK8A 4AENB 4PJ8A 4BQCA 1FL5A 3G6AA 1S8DA 3S3SA 1A3RL 2X42A 3EOYG 1KCUL 1F02I 4X5WB 1A64A 4G8FA 1EUUA 4Y89A 4AMKL 4PGJA 2BC4A 3G5YA 2H45A 2ERJC 1HOCB 2WBJD 4U6VL 1XIWC 2HT2D 4HUWB 4MS8C 5DJ6B 4XVTL 3CXHK 3IJYB 1A5FH 5CCKL 3KPLA 4ZAKD 5DA0B 2D0GA 4U3CA 1A0QL 4I0KA 4OZHB 1XH3B 2I07B 1S7WB 5IHUL 4QY8B 3C87A 4HIEA 3D0VA 4PJ5A 3EUUA 4PRHD 2DM2A 1CICD 4KDVA 5ESAB 1ED3A 1VEMA 2E8ZA 1A7PH 4NOBA 4JZJA 1FYTD 4MXQC 3IETB 5IESH 3L7FB 2BJMH 4HKZB 4IMKA 1QLFA 3CFJA 3QNZB 1VFAA 1IGYB 4DN3L 4D8PB 4K7PH 2R1YA 4H20L 1OAQH 4JDTL 4XGZB 2RGSA 4G80A 4K3EL 1ZWIA 4JO1H 5HI5D 2XTJE 3CDYA 1I8LC 5AZEL 1DBJH 3O2DH 4MQTB 1MFNA 1FO0A 1JE6A 1YQVL 2ZSVA 3S36L 4F7EB 4UDUB 1P53A 1U8KB 5DHXB 5H2BB 4NQVA 2LVCA 3RHWK 3C2SA 1CU4L 1CLZL 1WZKA 3GRWH 2FJFB 3H0TA 2AJSL 2Q6WB 3MLSH 2W38A 5I17B 1I1FA 4JFYB 4OLYH 2CDEB 2G60L 4OM0H 3QCUH 4ZOEA 3H3PH 4HBQA 1TJHL 4WFEE 4UINL 1JGDB 1IGTB 1P4IL 3MJ9A 4MNQB 4PRDA 4G8GD 1KYOK 3IFPA 1B0GA 4M7JL 4C83A 1T83A 3RKDD 1T6VN 5ALCL 1JP5A 3B2VL 2P46B 4X6CF 1ZSDA 4PLOB 3BZ4A 1CFTA 4PB9H 4A6YL 3NBNA 3UDWC 3LN5B 4XAWL 4APQB 5C0CD 5IFJB 5FDWB 1IJ9A 3MXVH 2ENSA 4MCZA 1FV1B 5C3TA 2DIJA 3EBAA 1EK3A 2M1KA 1H3PL 3KPRA 4YXLL 1NL0H 4JN2B 4N0UB 4OFKA 2VR4A 3CFKA 4TSCH 4HUVA 3C5ZA 1G1CA 1C5BL 1CTOA 1X5XA 5BRZB 1PYWB 2C3HA 1S8DB 2HT4C 3ZZ1A 1JK8B 2IGFH 4OCYL 3VXOA 3WDHA 1PQZA 2OXGA 4NSKA 3BP7A 4ODBD 4D0BB 1CCZA 4PJAE 1RZFL 4PJIF 3HMWL 1U8QA 5DJ0B 2AW2A 3LKSA 1C7SA 2GAZB 2F54B 4FZ8H 4UIKL 1U95A 4LNRA 4ZPTB 2F58L 2GHWB 4HX1A 4V3DB 1IGML 1L7IL 4ERSH 1I8KA 4XPAH 3BXNB 3E3QA 1BQSA 4YAQB 4Z5RA 4LRIC 3K74B 1HHGB 3LKOA 4NUGH 2VZUA 3HE7B 3S6CA 2IWGA 4C4KO 3RVTD 1A6AB 2MMXA 1SEQH 1AKJA 3OJDB 4LLUA 1CD1A 5HHMB 3WEXA 1BZ9A 1E28A 5HYEA 5IR1A 5F1NA 3V4UH 1IKFL 3ARSA 2W9EL 4AIZB 3S35L 2UVEA 3GSNA 2DL2A 4NCDA 2NW2A 2NY2C 2AK1L 1AGBA 1OTSD 3MTRA 4LCCC 1JFQL 3HC3L 5I15H 3VXRA 4TUJA 1RZ7L 2R4SH 2I07A 1U58A 4S0TD 1OWRM 2VJXA 1WTLA 3MRHB 1T20A 3FOMB 5C0IA 4WV1A 1FIGL 1FSKC 5MENB 1A6UH 1ETZB 2AEQL 4RMQA 1HI6A 3TIDB 4OGYL 5T1LB 2Y9RT 2DAVA 3NZHH 2VDMH 3CLEL 3U9UB 4MJ4A 3FRUA 4U1IB 2ARWA 2AQ2A 3KPPB 1BD2B 2YA1A 4X4XB 5D6CA 5FYKU 1QRNE 3HC0B 4QOKD 4P5TA 3SCMB 2BXYA 5L2JA 4PJBA 1BOGA 1F8TL 1KN4H 2VABA 4E5XB 3LAFA 4OV6F 5DD6B 4R90L 5D1QB 1HXYA 4Y4KA 1ROWA 1WLHA 3H6JA 5K9KA 5FUCE 4MJ6A 3SE4A 1UB5A 3OMZA 5DK2B 3HR5A 2VC2L 3MUZ1 1EEYB 1M7IA 1XGYH 4ORZC 2VAAA 5DRZA 4FABH 1WIPA 4OZ4A 5KW9H 4NP4L 4M7LT 4XNUL 4HS3B 4U0RC 2ICEB 4XB7A 1NFDF 4K07A 4PP1D 4GAYB 4ZSOE 5TPWH 4KUZH 3IETA 1QLFB 1SM3L 3SE8L 1LNUB 2I60L 4Y4FB 2N7AA 3AMLA 2EEDA 1CG9B 4BSWB 2BHYA 4KHXH 4U1GC 2RQ8A 1NFKA 3RNKA 1H3WM 1YDPA 4LLMB 1ZVHA 2HFGL 2FHCA 5E6ZA 3SN6N 3W0WB 4PREA 3OB8A 1E4XH 2DQDL 4MB4A 4ETYA 1FFOA 4PS4L 3MOQA 4OZFH 1WF5A 1G7PA 3RL2A 4E0RB 4QT5A 1NC4B 3DI3B 2EDEA 3OXRB 1HYRC 2IPUK 4OGYH 1NGYA 2MHAA 1VDGA 2PR4L 4I0CC 4JKKA 4JANB 2W0FB 4JGUA 1NCUA 2QL1A 4LSTL 3DUSA 4N8VG 3W5NA 5J6HA 1KIQA 2DQTL 2CRYA 2OLDA 3EO0A 3UTZB 4PJFF 4Z7UE 2HWZL 1CF8L 2WK2A 3N85H 2LTQB 2NXYC 3MA9H 3RY4A 2WNGA 5ISZD 1KF9B 1NFIB 3KR3H 4CVXA 4GKZA 2HAZA 2UZIL 3SY0B 2WLYA 1EEUA 2NW2B 4M02A 3FO9A 1V8HA 4BQ9A 1J8KA 3PABA 4ZUWB 4YK4C 3ZDZE 1RZKH 3X13B 4XZUB 3X3GH 2MJWA 2BSSB 3BP6A 4U6HB 2ICWB 4X8JA 5E2WL 3WCYA 2EIZA 5C0DA 2X4NA 4YBQC 2YUZA 3RGVB 4XBEH 1F11B 4OZFA 3MLVL 1QFHA 5IQ7L 1GAFL 5E94B 2Z31A 3FT2A 2IBGA 3DX6B 3JSSA 3GSNH 5AAWA 5LGJB 5I15L 3ULUH 4XVSL 2EE2A 1IGMH 5K59E 2J8OA 1V3LA 1LEGA 3TYFA 1MCSA 1I1YB 3ZHLA 3RI5K 2ZPKH 4E41E 2EDBA 3SDCB 4GKSB 1C12A 1M05B 4DGIH 4LQFL 4HWBH 1PX3A 1I3VA 2XFXA 5HD8C 5GS0L 1U91B 4HUXB 5DSCA 1ZLSH 2B4CH 1IEBA 5EU6D 2QTEA 4QCIB 5F9AC 1KB5L 1VGEH 4O2FB 4FQCL 1U2HA 2DWDA 4UQ3B 12E8L 3GSVA 2HFTA 3QO0A 1DSFL 4G5ZL 4X7FC 4MLSA 1OY3B 4NZUL 2X70A 2OZ4H 1B4JH 2MSPA 1YN6B 3LD8B 2YMXL 3BIAX 3IAGC 5CKGA 1N7ML 3S36X 4XP6H 4P57B 1KCGC 3WNLA 3DV4A 4JFFA 3TCLB 4DUXA 1TMCB 3BDYH 1U3HD 1JNNH 3QZWB 5HI3C 1ADQH 4PG9B 4CVZB 3IJSB 3QUXB 4KI5E 3OR7B 4ONOA 5JW4R 3S96A 3V5KB 1A6PA 1BOGB 4K71C 43CAA 2GUOA 2WWKT 1FO0L 3NCJL 4PJCA 1N0XL 1DLHB 1A7OH 3D3VA 4HDIA 4L3EE 5E8DH 4K55A 2PYEA 2GEEA 2Q6WA 1SMOA 1FBIL 1QEWB 1T04B 4OJFH 4YH6A 3ZDXE 1FVDB 3TBWB 2FSEA 1UM6L 1V3MA 4AEEA 2XN9A 3BD3A 5HHXL 3C6LB 5JOEA 2CH8A 3MGTB 4P3DA 3B9EA 4X4MA 1NMAL 2HLFC 1B90A 3MCG1 4OQTL 4QKXB 2IFGA 5HVHC 5MENE 2XWJA 1I1RA 3OKLA 4OI7A 4DAGL 2X7LB 2HG5B 3QEGH 4PRAA 3I3EA 4OB5H 5A40E 1WZ1H 1D9KA 4U6XB 5T1LA 4XGZA 1EHNA 2UVFA 1EGJA 5CSBA 3C6LC 3CDCA 2AK4D 3EAKA 4YHNB 3S4SA 2DKMA 4JJ5A 5MEOB 1S9WB 1QD0A 4KHTL 3K8LA 3N1GC 4JCLA 4P5TB 4P5MB 1FIEA 3QIBB 4B5EA 3RIAF 5T1KB 4KVCL 4R4BB 1X4XA 3BGMA 4PJ5E 5CD3A 3B5TA 2HT2C 2J8UF 4JM4L 1UZ6F 2FJFA 3H0TB 4FZEL 5FV2A 3FO1A 3A6CL 2CLVB 3D25B 4FQQA 2V6HA 4JRYA 4HQQH 4OKDA 1XF3B 4YO0B 3MPCA 3MBED 4L8SB 4PJXF 1JGDA 1PG7X 2B1HH 4ZAKA 3OZ9H 3GMQA 3V7MA 4M1DH 1PKOA 5KW9L 1BOYA 1Q8MA 1ZGLB 5BS0B 1LO3L 2Q7YA 4IMLA 3U9PH 1NGWA 3VXPB 1AO7D 1T66D 4JDTH 2C3WA 4JQXA 3FZUC 4RNRB 3TLRA 5DUPL 1DQQA 1RD6A 3V9FA 4XZUA 4TPRL 1QSEA 2VDKH 5L88H 1QZ1A 3NCBB 4JR9L 1DVFA 1QSVA 5E2VL 2IBBA 3CXHJ 2AJVH 1EAPB 4LVEA 3INUH 1AH1A 5GRUL 2F54D 3CVIL 2QR0B 4JHAH 5FO7B 4TSBH 3OKEA 4I3SH 3FTGB 1XCQB 5INDA 4DCQB 2F8XC 3DVIA 1E4JA 1F3JA 2AXFB 1W72B 5DTFA 3STZB 4Z7UB 4X6CB 5EORH 3O8XA 4QXTB 1MHEA 4E9LA 1HH6B 1BEYH 5HXMA 1I9EA 2VLRA 1LDSA 4EDWH 2EDHA 2YEZA 5C07B 4X4ME 2ITCA 2A38A 4KKLD 2NXYD 1AGBB 4D2NA 2P4AB 1Q94B 3PP4L 3E1F1 1K8DB 1MCOH 2ZUTA 3O4OB 5KAQG 2F8OA 4Y5XA 2IC2A 4JY5L 5E9DE 2EEAA 2A6IA 2BY1A 4X5WA 5JQHC 2MKWA 2AJ3A 1KJMB 2NPLX 3D39B 1A47A 2ZP0T 4QHNA 2V2WB 5FUZL 5A3IC 2FZ3A 3BVNA 3BKYL 3AGVA 1R24A 3O6FC 3OBAA 3IB4A 5GZOC 1NAMH 2QADC 1YY8B 3CFEB 5HDLA 3IU3A 1FNSL 1GC1H 2A74A 2VDPH 2DF3A 3C5JB 4X7SL 4I5BA 1WWCA 3WO4B 4JPWH 4PRPD 1FLTX 4ZSOB 3HRZB 5HDBE 4Q2ZA 1ZHNB 1Q1JL 3V7AE 1YEIH 4LOUD 1SEQL 2EDWA 4WUKH 1I75A 4JG1H 4I77L 1S9VB 5EU7E 3QUXA 3G5ZB 3RUGF 5FFLA 5J13C 2HJKB 2VXTH 4JM2D 2X9XA 4YHOH 3RGVD 3ZHDA 3G04B 4BK4A 2Q20A 1DLFL 1KTDB 4OIIL 3UC0L 4LHUD 1NMBH 4D0DA 3RNQA 3B9AA 2FSEB 3CVHA 2EH8H 5I1CH 3DROA 3QFDB 5E70A 4EVNB 3SGJA 4WTWA 1P9MC 3FT4A 3U7YL 3E2HC 5EUOF 3GMPA 3HG1D 4NQDB 1D5BB 4Y16D 5EU3B 4JGMA 3E8UL 1U8PA 1LO0H 1ZHBB 5JUEL 5IVXA 4J3UA 3T0DA 4LSDA 3SEPA 5B8CB 2K3TA 4FFVC 2MKLC 5D5MB 1PD6A 4HS8H 3TBTA 3TH2T 3VGFA 1HHHB 1UADC 3LV3A 3L3IA 3MJ9L 4XCEB 4A2LA 3SO3C 2AJYL 4MXVF 4MJIE 2E7HA 3VFTB 2OTUB 3O2VH 4WFFE 1I1AD 4P4KB 5JO5A 3VXUA 2DS4A 4YXKH 3SE9L 1F4XH 2YZ1A 2RFXA 5LBSL 3T2NL 4PBVC 5DMKB 2C3GA 1IM9D 4WWKA 1MFBL 5HBBA 2HA1A 3KGRA 1VFOA 2BNRB 4KGJA 5FO9B 1RY7B 4H26A 4B41A 4I0PD 3LHPL 2A9MH 1X5LA 1QP1A 1JWUB 3R1GH 4X6BA 4I2XA 4OF5A 1JHKL 5D2NE 2DBLH 3O2DA 4JN2A 4N0UA 2OI9C 3TO2A 5FHAL 5CGMA 5IVZB 4YHPA 4YEEA 3KLHC 1TJIH 1U9KA 1VSCA 3QWRA 1SQ2N 4IMLB 1C08A 2BMKA 5E1AB 5B4MD 3U83A 1HYSD 2RAMA 3MLZL 1BX2B 2BDNL 3RWGB 1ZANL 1RK0B 5TQ0H 5FYLL 5D1QA 3IXAA 3VCLA 3SKJL 1JNLL 4WCYL 4W70A 3RIFK 3MXWL 3CXDH 2FX8H 2O5YL 4PJIE 5FKPA 5JR1L 4GW4B 4JM2B 4NWTL 3VDCA 3RVVD 5FDYA 5CEXB 2IQAA 3T08A 2EDJA 15C8L 5I1KH 3GHBH 2J8UE 3FMGH 1J0ZA 3VW3L 4GG8A 1W8OA 3DYPA 3SBWC 2BJML 4NN6C 1PW3A 1N2RA 4F15B 1CZ8L 5HHVL 3R4DA 2J1KA 3T8XA 4UOW0 3RJQB 3C8KA 5IBLD 5D72H 1TQCB 5I74C 1FZOB 1LE9A 3RQ3A 2W92A 1ZGLA 1BVZA 2A0LD 5BS0A 2A6DA 4JAMB 4HKXA 5CJQL 4PRPB 3MRPA 4FXLA 2VLRD 1O5DT 1WZMA 4P57A 5F21B 2KH2B 3HNSL 3SGDH 1L0XA 3D1MC 4RDQG 4Q6IC 1CBVH 2RJMA 4N8VB 4BSJA 1DVFB 4U1SA 4Z95L 4MMXC 3MV7E 3T65A 4I3RL 1UWXK 3LKRB 2YWZA 3KJ6L 4MVBD 4Z7UA 4YHLL 1AXTL 1EO5A 1A21A 4F2MB 1NGXB 2IALB 3FRUB 4U1IA 2L0DA 3IFLL 5DJ6A 3O4LA 1UZ8B 4GUPA 2P5WD 3ZDZF 4W6WB 5D72L 3QEUB 4RFOL 4D0DB 4YFLI 2DLFL 2JIXB 1F3RB 3PWPD 5C0NC 1HZHL 4BKLB 4RAUA 3FB5A 4MXVE 4YFEA 4PRAB 4TNWK 3T2OA 2D03H 1N59B 2C26A 4A6YB 4LCIL 3D18A 3T1WA 1I1AC 2CDEA 4WUUA 5JDSB 5FCUL 4IIQA 5HDQH 2DJUA 2NQCA 3L9RA 4H8WL 4KRLB 4OQ1A 4ERSL 2E6JA 1K6QH 4M93C 3SDCA 1NLBH 4K8RH 4J8RA 4YC2B 2ADJB 1Y0LA 1UCBL 5HD8D 1RK0A 7FABL 5KSAC 5E5UB 2C1OB 3D85D 1OB1A 2N7BA 1N6VA 5GS1C 5MP6H 1FVEB 1YYLH 3ARFC 4CW1A 5JIHA 3BGFB 5IMKB 1CDHA 3LKNB 3JBG7 4GMTH 1V7NH 1KIRA 1YEJL 3D3VD 4CVWA 4M43H 4CMHB 1UB6B 2OK0L 3EYFA 1YN6A 2EDXA 1INQB 2R39A 1JTPA 4XAKE 2JTDA 3RGVC 4LSSH 4POUB 3IVKB 5IFHL 2QQLH 3GKZA 2A6KA 4JZJC 1IAIH 4Y4KC 4GG8B 3VFGL 4J3WA 4HWEH 2V9RA 3EIFA 3MXVL 3K2UL 3TNNA 4I0PB 2R1YB 2R2BB 2NY0B 4OLUH 2APWA 2GJ6B 5GS3A 3RWJA 1CFVL 4F7CB 1LMKA 5ADPH 4XTRD 1RU9L 3U4EB 4O2CA 3ZDXF 2FR4B 1CT8B 2HN7B 4OD3H 2YN3A 4KRPB 3MUGA 4XCYB 2NY2B 4XXDA 1IBGL 1TLKA 3KPMB 1J1OH 1QYGH 3UYOD 1NLDL 2Z92A 4JM2F 4TSAH 1MELA 5L2KB 4U0QB 4UMGA 3OKLB 1FSKB 1CWVA 4HJ0C 2P5EB 4RWYL 4HJ0D 3RTQD 3PQYD 5I17A 4YDVB 1LDPL 2DMBA 2VZVA 3ZE0F 4X6BB 4Y1AB 1T1XA 2VDRL 1RIHH 1IQDB 4TULL 2QHRL 4UU9A 3LS4H 1C1EH 4H1LG 1RZGA 2VLME 1A7NH 3QIUD 3ZTJG 3LN4A 3W2DH 1Q9WB 3VFNB 4XC1L 3PL6D 4HHAB 4Q0XL 4PRPA 5SWZA 2A9NH 2WWKO 1FZJB 2IH3A 4LCWB 3TV3L 3UBXB 5TDPB 1A1MA 4WUKL 4Z0XA 2R15A 1OAXL 4KZDH 1PVHA 1OAZH 2C1PA 1CDIA 1ETZA 1I3RB 3VXMA 1JF5A 3V6ZA 4X6EB 4JQIL 4JRYB 3HZMA 4LKCA 4X7SH 1IAOA 5I19H 3VXME 4JDZA 5DVKA 4PJIB 1KLGB 3LPWA 4AQ1B 4Z78B 5FECB 4XHJD 4FQLH 3LRHA 3TN0C 3DO7A 2ZUUA 3INUL 5FKAB 1T22B 4XNZC 3WHE0 3GUTB 5EFIA 3ARYA 3BH8B 1FHGA 1NCTA 4ONHB 4OIAA 3O3AA 5CJXA 2DQJL 5IM7A 3T0BA 3MV11 4PDCE 1D5MB 4I3RH 1U8NB 3TIEA 5GZNC 1S7TB 2E9IA 3KPRE 2AJ3B 3VXSE 4XCNA 5C09A 3GSUB 2BY3A 3B2UC 3MRGB 4MAUL 5JZ7C 1S7RA 5HYJD 1S9YA 3RZCB 1IRAY 5CJ5A 6CGTA 2FGWL 5TJWK 4KAQH 4ELMF 4X6FA 5LJYH 2P24A 2XWBA 4Z77A 2A6DB 4JFEA 5CJQH 1MJ8H 3AY4C 3FONB 1I8LA 3T2PA 5GHWL 3ULVF 3ARBC 3BPCA 3IU4H 3ULVD 4P46B 4POZD 3FFCB 3FO2A 1TIUA 5EZJB 4U1GB 4AM0B 3DECA 3GO1L 3CC5B 4M3JA 5E95B 5I8EB 4JJHA 5HHQA 5I73C 2P5EE 3HI6H 3ECBA 4Y4FA 1BBDH 4M6NL 5GGTH 3CX5J 3FJTA 1OAZL 4F15C 1DDHB 1UEYA 1DFBL 1BVKB 2HH0L 1CVSC 4X0KB 3QDGE 4X98A 3DBXA 2V17L 5JW5A 5C2UB 1RI8A 3RDTA 4NO3A 4BJLA 1DN2A 3PP3H 5I1HH 5INCB 4QHKJ 4Z8FH 2MPAH 5TF1H 3L3HB 4XBPA 2Y7QA 5EB9A 1MCBA 4GT7A 4NN7B 3TZVC 3NMEA 4G8EB 2YUWA 3PL6A 1WCQA 5IT2H 5KSUA 3MLZH 1C08B 2BMKB 1AIFB 2J6EL 3ZKSD 2FECL 2YKLL 1QACA 1DQDH 1GRWA 3RA7L 4Y5YA 3CFCL 4Q9RL 5T33L 5F88A 1KEGH 3WKML 5ITBH 3VXMD 1TJIL 5K9JH 2Z8SA 4RRPG 3KNBB 1CXFA 3VXUE 2DD8H 3IGAA 4ZAKB 4M9PA 2A9NL 2X44D 3VFTA 1FVCB 3LB6C 5IF0A 4HKBA 1TTGA 5GGUB 1I8IA 3DX8B 3DTXB 1DN0B 2J88H 2VL5A 1QSFB 4HBCL 2EH7L 4HIXL 1IKNC 3VJ6B 2UY7A 3GK8L 5H94B 2QHRH 1F97A 2ESVE 2VKXA 3ULVH 1M7DB 4QT5B 1RIHL 2VDRH 5F6IB 2NY0C 4XRCA 1QQDA 1UH3A 4PTTB 1HE7A 1I7UA 4KROB 1K4CA 1NGQL 2AKRB 3V4VL 2YR3A 2CKNA 1T2QH 4EI5D 3EFDL 4U1LB 3T2NH 1TTFA 4KXZI 4JDZB 3GBMH 2XRAL 4YHPB 3I6GA 2R2HB 4CU8A 4XP9L 4JO3H 3HNVL 1AP2B 4ZQKA 4U1MA 12E8H 3IAQA 5I1GH 3HNTL 3UPRA 4M43L 4GAYA 5ACMA 3BYYA 5EG6C 4GRWE 4KGLA 3PG2A 3ZYOA 2ZOLA 4KROC 2QSTA 1I9JL 2SEBB 1W0VB 4HHAA 3QDGB 4GRLD 4PR5A 4UILH 3RTQC 1JPTH 4X8JB 1NC2B 4QHNB 2QQKH 4HWEL 2Q76A 3NCMA 1MLCA 5E99L 3EDKA 4WFFD 5ISZA 3F6LA 4DZBA 2X4QA 5L8KB 1NCAL 1PJ9A 1KTLA 2PN5A 5LGJA 1IZJA 3WFCH 4EOWH 3BQUA 1NBVL 4Y88A 1XGQA 3O4LB 5E2TH 5FOBA 2L7UA 2MNUA 1NEZB 4YHOL 1UXWA 4XTRC 4XNYL 4XP1L 3EYUH 2YUXA 5EBMB 2V2TA 5IK3B 5J1AB 3B3IB 2E6QA 1AXSB 4FQJH 4P2OB 3BO8A 1B3JA 4HC1L 5CJOL 3MO1A 1RUAH 3G5ZA 3PXJA 1TVBB 5I1IL 1MF2L 2BRRL 1ZTXH 1HEZA 1S7RB 1KG0A 1Z6JT 3MV8D 5JLZA 4FFYH 4NNPH 2XA8L 3E0GA 1A7BA 1K6QL 3STLB 4TVPE 1R5WA 2HKFH 3RPIA 2DTML 3LKPA 5SWSD 4L3CA 4QF1B 2E27L 1DCLA 1DUZA 4FXKB 3QUML 5LAXA 4IHOB 1R0AL 4FP8L 1Z9MA 2CLZA 3BH9B 2PR4H 1U0QA 3MRCB 5D1XB 3HZMB 2XG5A 4Z95H 4LSPL 2EZ0C 1FG2A 3VFRB 5SV4A 4NJAL 4OCMC 1JTOA 5DMIL 4OI8A 4H8WC 4YGVB 1Z9LA 4L8CA 5HVGB 3ULSB 1G6RH 1G0XA 3QG6A 3R0NA 4O00A 4R4FH 1F90H 2UWEE 5K33A 1T5WB 3ZHKA 4U1HA 3RY6C 3SDCD 4R4BA 5C7XL 2BNQA 4LDEB 4NO0B 2VLKB 3MRDA 1G7IA 2WY3A 1MCCA 4FQ1H 4IS6A 1U8IB 3MCKB 25C8L 1A2YA 4I4WA 3RWDB 2ZCHL 3R0MA 4ZXBD 4Z6AT 2V9TA 2CMRH 1BLNA 5DUPH 3GGWB 1UM4H 3OKKA 1FNLA 3HZKA 4GQPH 4AG4L 4UNVA 1AJ7L 1GPOL 3FN0H 2Z0BA 1U8JB 2ZUXA 3BKCL 4QXGL 5C2BH 2DWEA 3NFSH 1YEEH 3RWIB 4BQ6A 4WHTB 5F7FA 2HTLD 1K85A 4ZTOH 3AC0A 4RRPA 3S34H 4QRSA 4QHKI 1MWAA 3GKWH 2AV7B 3QWOA 1Y0LB 3P73A 1ZSDB 2VR5A 1EGJL 5CIPA 4RISH 2O5YH 5BRZA 1NKRA 1GL4B 5ETUA 1WBXA 5DUMH 3RVTC 4HDIB 5GSRB 1J9CT 4MJIA 3TVMB 2FO4A 1IM3A 4P2OD 2CLVA 5IB3A 2VRAA 5KZCB 4FABL 1UQSB 1UENA 4EUPA 2CKBA 4UV4H 1T0PB 1T1YA 2NY2D 1IGIL 4L4VD 2NYYD 1F45A 3O4LD 5JPMA 5GRJH 2YXFA 4FHBD 5CS7A 3C8HA 2AP2A 4UT6H 3O6LL 4MVBC 3HS0A 4CN6A 1ND0A 1Z3GH 4WGWB 2VQUA 5KSUB 3LS5H 4S1DC 4Q9BA 1RFDH 2MWCA 2H9GB 5E6YA 3M17B 4G6JL 1BPVA 3P77B 3WFZA 1NC2D 1YECH 3QEGL 4MNGB 2CO6B 5DQDL 3VE0A 4ZUVA 5FGSA 4JDVA 2FL5B 1AC0A 1WZLA 4J23A 4LIQL 5TF0A 2I9LB 4AK1A 5HYSB 1YNTA 3DIFB 5DRWB 3K8MA 4Z7NE 4L4JA 2IADA 1R5WB 4QGTA 1TNMA 3O2VL 5D9SA 3MFGB 5F1NB 2F74B 4X6DB 1BFSA 3VJ6A 1RZKC 5ESQB 3F58H 3VWKA 5E8DL 4Q2ZB 1AY1L 2YZ8A 4PYHA 4RFEB 2AJZA 4WU5A 1YMMB 4XMLL 3B9KC 1LILA 3PV6A 5ANME 5AYUH 5KVEL 2O5XL 1D5ZB 2Z93A 4YGAB 5BVPH 2DTMH 3I2CH 5EULV 2YHGA 1T20B 3FOMA 1XR9B 3BW9B 2AGJL 1ADQL 3BDYL 4OLWL 3QG6B 2D7OA 1HEZB 3GJEB 3MREA 4P3CL 3S5LA 4LSUL 5KTEL 4V1DE 1DBAL 2LU7A 1XIWA 1RMFH 1MEXH 1RZFH 4FQJL 5IKCB 3CFEA 1S7XB 3WIHA 1FORL 4P46A 4HS8L 3S8WA 4KK5C 3QXAA 4PGEB 4F58L 3SCMA 3DARA 1P6FA 5GGRY 5K59F 5ID0A 1KB5H 5LAXB 1AQKL 4HK0A 1FL3B 3CFJB 4MNHA 4Q9QH 4YHMH 1UFUA 3TZVD 2QR0A 3SGEH 1MAKA 1E6JL 4HWBL 4QRRB 5KSBB 1RMFL 3KLHD 2VQ1A 4J3TA 2X4PA 2CLRA 1H3GA 1FG2B 4GW1B 3L3IB 2QQKL 3KPTA 2LU3A 4XNMA 4YX2H 3V6FA 3TBSA 2PO6A 4G9FA 3MLTB 4M03A 4OV5A 2AGJH 1NEZA 3IXTB 3LRSB 3P9MB 1F2QA 4I0PC 1T5WA 2ICWI 3GFUA 1ZLUK 4XAWH 4FQ2H 3G9VA 5A1AA 4Y5VC 1FFPB 5EOCJ 1G7JA 4K3JL 3P4LA 3PWLA 2VXTL 1WIOA 4BZ2L 3HNTH 4F33A 5KN5A 4XVUC 5JOFA 2P24B 2IPKA 2F53B 2HYMA 3QIWA 1QLEH 4JB9H 1JZ6A 1U93A 3QNXB 3HE7D 2ITDB 3DXAE 1FZMA 2YXMA 3OAUH 2D7QA 5I8CA 4NO0D 3GI9L 4JRYE 5DRNB 2APFA 1YDPB 2Z4QA 3NABH 1DUZB 3VWJA 5F8QC 2FH6A 1NAML 3E6FA 5C6PB 3SDXF 1HSBB 5I1LB 5F9DC 4DEPB 2GTZB 2VLKE 2BVEA 5A2LH 4KKCD 3N1MC 5C0AE 5DDHB 1CU4H 2DQIL 3MC0A 1HIML 1KNOA 4ZDHB 3HFMH 1YEFH 2DQTH 3PWNB 3P77A 5FUZH 4O58H 5GZND 4ONGH 4PLNC 4ZXBA 1F5WA 1YQVH 5D4QA 4JHZA 4LARH 4RBPH 1KJ3L 1XR8A 1DBJL 5I9QB 1NAKL 4CAGA 4Y2OA 3MRRB 1FV1A 4XCYA 1OP3K 2XOTA 1TJHH 1RJZB 3CPLA 1S7WA 4OUUB 3U9PL 5BJTB 5ITBL 5EH1A 2R2EB 3ZT5A 1LEIB 5F7EL 4P23A 2DL9A 2RB8A 2XZAL 4GJTB 3MUY1 1F6AB 1S5IH 4XH2A 3O6FD 2VWEC 3DHMA 5BOPA 3TO2B 5F9OH 5CINL 5I8OL 1R3IL 4I3SL 5EO1B 1YEDB 5T3ZE 2R0KL 2XACC 3OXSB 4NUJA 1U8HB 3VXSD 2X2YA 1QNZH 5CEYB 3WBDA 4U1KB 2I9TB 5I8OH 3TNMA 3KNBA 1MI5A 3D9AL 3L3JB 4Z8FL 5CP3H 4HFUH 3HI1B 3DOSA 3U2SA 4WW1B 2W9LA 3QFJB 4U7KA 2DQUL 4TVPH 4XNZB 3D2UD 4UI2A 3RWIA 3T3ME 3G08B 5DQJB 4JO1L 1ZEAL 2I9LA 3DGGB 4K9EC 3QWQB 3H9YA 2PYFA 3QUZB 1JZ3A 3P2TA 2DQUH 1NAKH 2FHBA 4AEIL 2VERN 4PJXA 3ARPA 3JUZA 3TGXA 4WJ5A 5MEPA 1MFDH 3M45A 3REVA 3FCTA 1H8NA 5IVOA 2XTJD 1AR1C 2C3VB 1NSNH 3IYLW 4V1DB 3HZVA 4MA8H 1P7QB 2DKSA 2GT9A 1E4KC 3BP7B 4JM4H 4TQEH 1ES0A 3MLWL 5J0BA 3OJVC 4QHMA 4Z7WA 1EXUA 1FZOA 1MJJA 4NHUB 4JFDA 4OKVA 3NZHL 4D9QD 2ED7A 5F71A 3EYOA 4MDIB 1CGSH 3ZTNH 3DTXA 4GKSA 1M4KA 2YSSA 4I2XE 4YHZL 4BKLA 2Q3ZA 4AMKH 5DHVA 3MRHA 1KCUH 4U6YA 3CVHH 1N0XH 1XZ0B 2NY0D 1MIML 4LCYA 2P7TB 3BD5A 3KPSD 2B4CC 4ZUUA 4X6DF 4LKXB 2HJLA 1IFHL 4YZFE 3BP4B 3ROLA 5TE4H 1RSFA 4AQOA 1HINL 3FONA 3UJTL 3MV9E 4G3YL 1MRFL 3VG0L 1BJ8A 2F5AL 3RUGA 3AS1A 4CADA 2ESVD 2GSGB 2NNAA 3MJ8A 5GS1B 3CK0H 3PHOA 4JKMA 2VABB 3CD4A 4U6TA 4E5XA 2VDNL 4JY4B 1BWWA 2CSPA 3S4SG 3P4OA 1GIGH 4I4WB 3ZDYF 3K81A 5E0QA 3MUHL 4RSVA 1FH5H 1TDQA 2YA2A 5CD5C 3HPLB 5IEKB 4M6OH 3V0VB 4K7PX 3HE6C 5FF6B 1BVKA 1A7QL 5FB8B 2Q3AA 2CRMA 2E7MA 4XPTH 1OCWH 3OWEA 5HYQA 3BISA 2IG2L 2A77L 3C5SA 3H9SE 4RMWA 4OZIA 5KZCD 3VFUA 2BZDA 4POYA 5I75C 2XQYK 5B38A 4KJWD 2IPTH 3BH9A 5D71H 2IBZY 5EU4B 3C5ZD 5J57B 3TFKD 4Q9QL 2LAAA 2GITB 3ZE2F 3ARZA 2O26U 1JV5A 1KN2H 3SDXE 2VQ1B 2VOTA 5LVEA 3F58L 3TVMA 1VB9A 4HGWB 5AZ2L 1SEBA 5GRWA 5JLZB 2FX9H 5TFSL 2OL3A 1DQJA 1JN6A 4HWZB 2ZPKL 3ESVF 4HZLB 2P5WB 1YMHB 1G7PB 3IDNB 3WFHA 3EDFA 1D5XB 2R2EA 2EEBA 1DQTA 3BIKB 4M8QB 1H5BC 4E41A 2R8SH 4OTXL 3ALXA 1NH6A 4RA3A 2IJ0C 2Y1VA 3RZCD 4UT9L 4J3XA 3O3BA 4TUOB 4D3CL 3BRGC 1MCPL 2EH7H 4HIXH 1LD9B 3T0EB 1JPSL 4JGJA 1LQVA 3ULVC 3K8KA 2WSKA 5A2JH 4NHUA 3QSKB 2D7NA 3WIHL 5KVDH 4O2EA 1CK0H 3OG4B 4PJ9B 1N6QL 3GB7B 4UV4L 2DI9A 1Q9WA 5DQJA 1NBYB 1X44A 3MRDB 3MLWH 4JFFE 2PCPA 3WE6B 3WJJC 1W0VA 5ID1A 4M5ZL 2NTFB 1WGOA 4N9OB 5D1QC 1AGFA 3WHXB 2AERT 4WHYH 1NKOA 4WJ5B 1BHGA 3QQ3B 3SE8H 4FFWC 4LCCB 3V6ZB 2W0KA 3GKWL 2AI0L 1RULL 1A3LH 1JF1B 1MFEH 2ZG1A 2A73A 1FE8H 3BN3B 2ARJB 4EUPH 3EYFB 3GSOB 3FQTB 1EEYA 4JG0L 4PJEA 4AEIH 5I1HL 3WLBB 5GJTL 1JGUL 1DQLH 2IFFH 1XGYL 5I16A 4WU7A 2CKBL 1SJVA 3CU7A 3MRFA 1KENL 4X99B 1ZEAH 4L8BB 1BBJA 5I71B 1HCFX 4JY4A 4HS6A 1GC1C 1IAIM 3JVGC 3P4OB 4I5BB 4HUXA 3AREB 4KHXL 5CEYA 3SDXB 3QHZH 3NFPB 3LQAC 4RIRB 4NC1E 5C8JA 4S1DD 3C60B 4K94L 4U1NB 3TT1H 2ILLA 3U4EA 1AGCB 4O2CB 5FYJD 3DLQR 1E6OH 2IADB 4EXKA 4NQCB 5IHUH 5F93C 1AXTH 5D8JL 2LFGA 2X4SA 1E4WH 7CGTA 3RP1A 5E4EC 3VFUB 2V5MA 5FECA 4PRBB 4DJMA 5B22A 5CCKH 4NJAH 2R23B 1QFWM 3CLEH 4JANA 4V2BA 1LWRA 3MJ8B 3NA4A 4N1EA 1CBVL 3TESA 4KJYA 3EGSB 4F7PA 4Y19D 3UTSE 4G7VH 1A6UL 2HVJB 3O3DA 4LSQL 5F97E 2FB4H 2G5BA 4G6ML 3WN5C 1E4WL 5K9QG 4H25A 2NXYB 3ARDC 3RX5A 1XF5A 2QQNL 3SOBL 1A3RH 2HTLC 3WFBH 1WICA 1LGVA 2WBJA 2OTWA 2ESVB 2PO6D 5C08A 2EDFA 5GS2D 1CFQA 1XFPA 2JB5H 4DKEH 5EZIH 2ITDA 4JFDE 1ERNA 4WTZG 2J5LC 3U9UA 1R5IA 1ZTXL 3W9EB 3REWA 32C2A 5ESAA 3TYGH 1QRNA 4G6AD 1U8MB 2FJGA 1LO5A 4LU5H 5C0RH 2G2RA 4W4OA 4ZUUB 1LO2L 3HE6B 5GJTH 1BQUA 5IMOB 4M9OA 5DT1H 5GS0C 3ROLB 4NWTH 4F7MB 4Y8AA 4J3OC 4WY7L 3MLTA 4EOWL 4OV5B 2VDQL 3FQUA 1MPAL 2DQGL 3WL9B 1NJ9A 3AB0C 4HFWB 5DQ9B 4IOFD 5E99H 1MHCA 3CFBB 3QXVA 1VEPA 5C1MB 3DRQA 2WBJC 4YQXL 2AK4A 5F9JA 2W9EH 1G9EA 4NWUH 4PGDA 3AAZB 1AHWA 4IBLT 1IEBB 2YRZA 3B8YA 2H2SD 3D85A 1CK0L 4FQXA 4HS3A 1FN4B 3ARED 2XTLA 4HCRH 2WIIA 3DMMC 3LIZH 4UT7H 2QHLA 3F62A 4TSAL 3IDXH 4WTZA 3WHE1 1FZMB 2XV6B 1QTYT 5J06A 1OTTC 1H3XA 1QYGL 3OGOE 5GZOD 4CNIB 1F00I 2WANA 5FKPB 4TSCL 4AM0A 5DEGA 3CAFA 1DJSA 3DGGA 1H3PH 4HK3J 5IF0B 3WXWH 2Q86B 5CWSB 1G6VK 2WMPA 4LHUG 1T7VA 1NUGA 1VFBB 4OCRL 4DVBB 3C9NB 5CSZB 2EC8A 4MNGA 5D6DC 3T4YB 5CJBA 5E2UL 1MFAH 5C0ND 2XA3A 3OAZK 2AJYH 3RDTB 2QQLL 4JFPB 2IGFL 5ISZE 1GGBH 3C5ZC 4JPIA 1DQJB 2V5YA 1OSPH 1FG9C 3MV8A 4XBPB 3UTQA 4JPKL 3ARQA 3QG7H 4CVXB 4LNRB 1EXUB 1FQ9C 5AD0B 4NCC2 1BFTA 1EV2E 1UVQA 3QCUL 1RVFH 4K9EL 4MWFA 5DEFB 5EBMA 2NZIA 5GGSY 4BSVA 5F7HA 4JKPL 4JVPA 1OAKH 1JK8A 4RBPK 1AQDB 3TO4B 2FCBA 3MLXH 3U2SB 3BKML 1S78D 2ICWA 5J1TC 4M7KL 3DX7A 1YJDL 4PJEF 3L3OA 1CDUA 4CU7A 1U3YA 3QUZA 4YR6B 3NCFB 1E28B 1QBLH 1PG7L 3QJFB 5DT1L 3P4MB 2FH8A 1MAJA 2A0LC 3F7VA 1QUNA 5IW3A 2NXZB 2V17H 1CLYH 4LAQL 2H1PL 3GIZL 3BQUB 2C5DC 4GRMB 5F1SA 1T80A 3QXAB 4M7ZB 3BX7C 3KPRD 1UACL 1FYTE 3OXSA 4JREB 4NUJB 1AD0A 3QUYC 5IT2L 3FQNB 1EBAA 1GC1L 1T5XB 2GCYB 5ERWB 4Z7WF 5HYJE 1EFQA 2MQCA 1QVOB 4XX1G 5MENA 1JPFB 2Q8AH 4QHUA 2A1WH 4LLYA 1JCKA 3BZFB 2XT1B 4YDJA 2KBGA 2PXYD 2JJSA 5I16B 1G7QB 4IJ3C 1XT5A 4YHLH 3CVHL 5D2NB 4HG4K 4IRJA 4P49A 5ICXB 1JRHI 5E6IC 2EKSB 2FGWH 3AAZA 3BKCH 4QXGH 4RZCB 1D5BA 3C5JA 4O02H 1S7QA 2R0LH 2ZG3A 4KI5D 3BE1H 1R5IB 5SWZD 2CR3A 4P9HH 5CJ8A 3WN5B 1DBKH 1B6DA 5D7LA 1UC6A 4GAGH 2OSLB 3T77A 1CLCA 2CXKA 3VFPB 3WNOA 1MIEL 2BNRD 4GRWH 4Q6IB 2VAJA 4YHKL 4OGXL 2YPLD 2AS5M 2GTWA 4Y4HD 2H32A 3VFMB 1EEZB 3WIIL 3BD4A 1YPZA 5GRUH 4H1LH 2BNQD 4L8CB 4WGVB 2IANA 1V7ML 5H35A 5DJ8B 4EDXA 4P4KA 5FOBB 5GGSA 1SBSL 1K8DA 1NJ9B 2YPVL 2MQ0A 4KV5F 4G7VL 4W6YB 3PWJA 3UJIL 5BV7B 2XZCH 3T4YA 1DE4A 1U3HC 2CKBH 3LDBC 2XIDA 2YPLA 5CILH 2ADFH 3CSPA 2OTWB 4KMTH 4ZOCA 2PETA 4PRIA 5ANMB 2WIIB 3UXFA 3L5JA 5KSVA 2XPGA 4ISVB 1I8MB 3MV8B 2CPCA 1QNZL 4ZUTB 3EHBC 3UTOA 3ZSSA 3AXLB 4U0RB 2R56H 2R0KH 3S4SB 1ZHNA 4FFVD 4WEMB 5JXAH 1ND0B 3CXDL 2JK5B 4M4RA 4NBYB 4M5ZH 2A6KB 4HV8A 4M61B 3QEHA 4PJ5D 4FZEH 4JQIH 2OMBA 2CIIB 2VITB 3O6FA 4AH2B 1NGYB 3HHRB 2R0WH 3WXVH 2RCSL 2A6JB 4GKOA 2ZCLL 1U8OA 3G6JE 4DQOH 4I0PA 4PGZA 1R6VA 4Y16A 1YY9C 5FF6A 4UB0H 1OGAB 4QWWD 2ZKHL 3NIGF 4R2GB 3ULSA 1UKTA 4FG6C 2YPKB 4ONGL 5DQ9A 5HYQB 5GPRA 4O58L 2GK0A 4PY7B 1EMTH 3ABZA 1OQXA 5A3ID 2A2QT 4OCSH 1WAAE 4YPGA 5SWZE 5DXWA 4DAGH 2FGZA 5E5MB 2F8VA 4H0HB 5HHOD 5KANI 5E56A 3WUWA 4KDWA 3QA3B 3FQXA 5JIIA 1QKZL 1Y6KR 2FHFA 3S5LG 1IQDA 2FD6L 4U2ZA 4NZTL 1A6VL 2ID5A 4L4VB 4FTVE 2B7DT 5F1IB 1OSPL 2VXUL 1CGYA 5IJKC 2BNQE 1VACA 5DEGB 5GISL 1G0DA 1BJMA 1QR1B 2B8OT 4N0YH 3BQUD 4LGSB 2PCPB 2FD6H 2Z8WC 3BEVA 1S3KL 2HFEB 5JUEH 1PZ5A 4M6MH 1HH6A 4PRBA 4HMEA 5FKAA 3DV6A 1QKZH 5C70A 3BIKA 4M8QA 4XNQA 3GIVB 3MCLH 1AFVH 2XWTB 3RGVA 2EXWC 4JY6B 3QXTA 1SJEB 3BPOC 1E0OB 2WWMD 4JKLA 1R3KA 3EFFB 4K94C 4LRNL 3O6KH 4O9HH 4HBCH 1AQKH 3O9WB 1MH5A 4PP2B 3IDIB 4Z7OF 4XT1C 5KS9E 2NNAB 5GS1A 5FA4B 1BBJB 1I1FB 4UT7L 1FH5L 3GB7A 5FYKD 4LCIH 1ZKAA 3TJHC 4MD0B 4H0GA 3SE4C 3VDAA 2GI7A 5EIIA 5C0BA 5HJ3A 4XHQA 5K9JL 2G5RA 7FABH 3BPOB 1KEGL 1J05A 3T0AA 4ZFFB 4NCC1 3R8BB 5DFVD 3LH2H 2F53A 2FJGB 5CUSH 1KFAH 3CH8A 4N8VA 3LCYA 2F5AH 5K9OB 1CFTB 4GMSH 2NY3B 1B6UA 4L4TB 3GSVB 5DJ2A 1I1CA 3DMMA 4GKNA 3UZQA 3VWKC 3DO3A 1EZVX 5DURB 3RKPA 1A7QH 4DVRL 1MIMH 1LK2B 4QRRD 5ALBH 5EC1A 4LCUA 4ODTH 5BQ7A 4G9FB 4QXUL 1Z0NA 3S37X 4FFEX 2X89A 5CILL 2AK4B 4S0UC 3IKKA 1CE1H 4DK6A 4F80A 3GMPB 1SJHB 4FQXD 2ZNXA 4N0CA 1UJTA 1ACYH 3PP4H 4PRID 3TPKA 4CJ1A 1AO7B 5T1KD 1CIUA 1G7MA 2NY5H 3VG0H 4FTVD 1FC2D 1N3NB 2WUBH 1KIRB 5EOTB 5TDNB 4N0RA 1V7MH 2GW5A 3OKNA 3EJYC 5BJTA 5JOPD 1T7YA 3AU1B 4OLEA 1YECL 2BY2A 3FO0H 5IKCA 4JZOB 5KVMC 5AUMB 2OI9B 4ZPVB 3UYPA 1MY7A 2X1OA 5GGTA 3BZDA 1WK0A 3C6LD 3S37L 4W4OC 4LSQH 1KXQE 1ZHLA 4P5KB 2Y5EA 5EOCH 4OGAC 5HHVH 4KKAD 1H8OA 2EIBA 1IC7H 2V9QA 5JPNA 3T77B 5BW7A 1C5DB 1DBBH 5EO0B 1RZ8A 3GMMB 3RPKA 1N5AB 2HKHH 3SE3C 1UCTA 3H42L 3HC4L 1TXKA 2BVOA 4KY1L 4TUKH 3WFDH 4NN7C 5IMLA 1KC5H 1P9MA 4X8XA 5IW1A 4Z76A 2EO1A 4CMMB 2ZUSA 4N8CH 3UTSD 4OUUA 1PYWA 2KDGA 1MLBB 1CR9L 3KYMB 1IGCL 4F33B 5KN5B 3G9AB 3A6CH 5EUOB 3Q1SH 1XGUB 4NYLB 3WHXA 5EBWB 3L3DB 1KB9J 1KENH 3VW3H 5HI3D 3MMEA 4Y16C 1L4IA 2VLJE 3GHBL 4JN1L 2R2BA 2OL3H 3VD7A 1ONQB 5ENWA 1L9MA 3HI1A 3VFSA 2DBLL 2GJJA 2PTTA 3OKOB 4N0CC 4ZODA 1X5ZA 3VWJB 3OKEB 4TN9A 4YK4B 2D4DA 4M61A 4QOKA 3BZEB 2CXGA 5GRVL 2VE6B 1IAMA 3NIDE 3EOTL 3C9NA 5CSZA 2VTFA 3QRGL 2ITCB 1R3IH 2DMCA 4IDLA 1F90L 1OAKL 3R8QA 5KSAB 3HRPA 1QSFD 3A67H 2V2TB 3ET9F 3LKNA 3HPJB 5AWNH 1GHFL 5F7EH 4YXKL 4G6AC 3DMMB 2GFBA 1RJZA 3CPLB 3FTGA 5TGBA 3E2HB 3RVVC 1HXYB 1J8HA 1T83C 1UWEL 3PGCB 2HRLA 4N90D 1YJDC 4DN4L 1AR2A 3GSNB 4NQCD 4Z7NF 5HVFB 3VRJB 2D0FA 3EYVA 2QADD 3MFFA 4DGVL 3OJMB 1I7TB 3UTSB 5IB1B 1LO0L 1A9EB 3EYOB 5EC2A 4L29B 1I3UA 4OLXL 5DFVC 3U46B 5B8CC 1G9NC 3ALWA 2ARJQ 1OSZB 5GGRA 5DMGD 5JHDE 2FO1A 5CGYC 4OD1L 1YC8A 2WW8A 3K2UH 3QQ9C 4HUMB 4UV7L 3NCYS 4YR6A 3TIDA 1J8HD 3VFPA 5DVOA 2BOBB 3N1PC 5TFSH 4JPIB 3EOAB 4PPTA 4MA7L 1MJUH 4LKCB 3HA0A 5CJOH 1CFQB 2KUTA 4OZIB 3SGJC 4ODWB 2IBZX 1D6VL 4NFCA 4G9FD 2AEPL 4FRWA 5HGBB 1IGFH 2NY6B 3IDXL 3QPXL 4X4YB 1LK2A 4GMTL 4K3JH 2QLVB 2B4CL 3OKYA 1RZIB 3MOBH 4ENED 2VXQH 3FN3A 3FB7B 4QTIH 4MCYA 3BRFA 5IW6B 3ZO0A 3ULUC 4QHUB 4X98B 4ZS7H 1IGJA 3Q6FA 4PRNA 4UNUA 3DUUA 4NQXA 4ZYKB 5DF0A 4QLRA 1PEZA 5HHMD 3U4AA 4PJDA 3WL9A 4P2CG 3I02B 2L7JA 2BNUA 2G9HB 4FNLL 4R2GD 4RMRA 1KCRH 4IIQB 4QY8A 5C0BB 4IS6B 4UAOC 3UAJD 5FHBL 4JLRB 3FB8B 2H41A 1FNFA 1DL7L 3WDIA 4WFGE 5JMRA 2P7TA 2HFFB 4ODSL 2EECA 1D6VH 4TNWF 1WFNA 5I8EA 2XRAH 2Z35B 2BSSA 5ERWA 1KLGA 4Z78A 3IRZA 4BH8B 4X4ZA 1HZHH 1ZGLP 1IC1A 1YC7A 1EZVY 1IL1A 3F5WA 3ARXA 5EC1B 5CP3A 1G7LB 1IFHH 5HY9A 4FG6D 3MOAL 4NKQB 3O3AB 5GGQL 3OR6B 4UTBH 4JM2C 5JPMB 1HKFA 4OSUL 4A6YH 1MAMH 1M7DA 5DJXB 3U30B 1SJHA 2Y36H 1AGFB 3IFNH 2UUDH 3FN9A 4JZNA 1Q0XL 4JY5H 1T1WA 3SKNA 3RZCC 5FO9A 1CGSL 4XCCL 1QPPA 4ISVA 1I8MA 2NY3C 1FLRH 2GY7B 3MMEB 3AY4A 2I5YL 3UYRH 3G6JA 2OI9A 4U33A 4PJ9C 2Y72A 2EO9A 4EI6B 1CGWA 4WI5A 4OZIF 1KIUA 2V2XB 1L9NA 3SJVB 1CR9H 2AJVL 3G5VA 1MFDL 3KPSA 5DC9B 3ES6A 3E6HB 2BP3A 4MJ5B 3C60A 1X5AA 3QXUA 3RJDA 1HH9A 3W11D 5FCSH 1X5KA 2UWEF 3I84A 5DI8B 1PLGL 2MOVA 1WBYA 4KVCH 3CJJA 4NSKB 5KSBF 3TT3L 4UDTA 2YPLE 3DRTA 1D6EB 2VZSA 3SGKC 2VC2H 4EBQH 2NX5B 4M1CD 2AQ3A 2VLMD 4WI7A 3D9AH 1QSEE 3L3GB 4HUWA 3CSGA 2C7UB 1MFEL 4UTAL 3GSWB 5EU6B 1GH7A 4C54A 5C0BD 2E7CA 3HLAB 1SMAA 4F8QA 1J0HA 5AAMA 1CE6A 3N9GH 3QB7C 3BGAA 4LSVL 3JV4A 1OPGL 2F53D 3UYRL 1OF2A 1CS6A 2FLBT 4RA0C 1BQLH 1JPFA 1ZS8B 4RGNE 5JXEC 3O8XD 5E6IA 1KIPB 1N6QH 4QNPF 5I73B 3IS0X 1IKNA 3I02A 4KHTH 4DZ8B 3U0TB 3RPIB 1Q0XH 4LSPH 4XMPH 2P47B 1CE1L 1EO8H 1KJ3H 4G7YH 1RUKL 5F70A 3P0VL 4LLAA 3KPNA 2CUIA 5HDBF 2ZCHH 4N5EA 3G6AB 4LCUB 1BZ7A 3FRPG 4MSWB 3WLWD 3JUYA 3LHPH 4HUNB 3QIBA 4ONHA 25C8H 43CAB 2BVPA 3BT2L 5HSFA 3EDJA 4KRPD 4C55A 5C7XH 1T6WA 1GGUA 3PWLB 3O45A 1EO7A 5DSCB 4K3DL 2AABH 3MROB 4GH7B 4ELKA 3QH3B 1K2DA 5CUSL 4D9LL 3Q6FB 1F4WH 4MXWL 4S0SD 4AIZA 5SWSA 4AY0A 1XF3A 4N5EC 1NMCC 4R7NB 5C0FA 5GGSB 4GG6F 5T3ZD 4H88L 2J12B 5C6TL 2DB8A 3MLUH 2VISA 3H7BA 3F7PC 3L9RB 4Q0XH 1VEOA 1QR4A 1YA5A 1CL7H 4FP8H 3ISWA 1REIA 1S78C 2QADB 5SWQB 1KN2L 2R69H 4M8VA 1OTUC 2W59A 2EYSB 3ARGA 5LQBH 4O9HL 3VH8G 2YPLB 3EDEA 4R26H 4F57H 1VFAB 4GS7C 1N5AA 1YPZF 4MA1B 3RKDC 5DJZA 3AVEA 4FOMA 1MVUB 1U93B 4JJ5B 5MEOA 1OLZA 1ZE3C 5K9KB 5ECJE 4HUUA 4G8GE 1FAIH 4KJPC 2AXJA 4R6UA 5I18H 4ZO9A 1GOHA 4RWYH 3PDOB 3GSNL 3SJVA 3V8CA 2C4XA 4QRSB 5D7IB 4LHUA 1G7LA 4QTIL 3QDMD 1OW0C 1TZHB 1KB5A 4K3HA 3EYUL 3MRIA 2XWJB 2AEPH 4MA1C 4GG6A 3CDFA 2NY4C 1RUPH 4GRLA 4NZTH 1HHIB 2JJUA 3GRWA 4U1KA 3GGWA 4F7TB 5GS2H 3SQBA 2K9UA 3Q3GA 4PUBL 3VGAC 3S7GA 2G75A 3FB6B 1JGVL 1IGTA 3ROOB 2VZ1A 3VFSB 4OGAD 1FNSH 4UV7H 4NZRH 5FGCB 3VXPA 1RIVH 3NH7H 5F96L 2NY6C 3DSFL 1RJYB 3B9VA 2HWZH 1SY6H 3BKYH 4HH9B 1SYVB 1ZT4A 2FEEI 5JW3L 4MAYA 5ELIA 1EH9A 1LVEA 3DUSB 5J9PB 4H88H 4GFTB 4F9LC 5SX4I 3C8DA 1E4XL 2DQDH 5F1IA 4KK6D 1UKSA 4FQHB 3CSYB 1TZGH 1MHEB 3JWOL 2LV4A 3N06B 3LKQB 4QHMB 4Z7WB 1GZPB 3GMQB 5DHYB 4DTGL 4NFDA 3BPLC 2HFEA 4WO4A 3B4NA 1S5HB 1ZA6A 5CBEA 1CIDA 1FL6A 4PY8I 3D85B 3PV7A 3GRWL 1BLNB 1IILE 3J7HA 3UPRB 1MCHA 5EDXA 2YSSB 4YE4L 5E2VH 1CICB 1RIUH 5I66B 5TQ2H 1NGZA 1DQQB 5TF1L 1FFRA 5F6HJ 5EU5A 3ZKQD 4B53A 3V52L 3N1FC 2CRIA 2DLHA 4PJHA 4XMPL 4ELKB 4MAYC 2F54A 5HVHB 3K46A 1WWWX 3AROA 1BF2A 5DJAB 4TOYL 4OZIE 4LFHD 2OJEB 3SO5A 4TTDD 1DQDL 1RJCA 1QFUL 1FCCA 5I1DB 4KV5E 5I8KL 1KCSH 5JNYA 3T0XA 1A7PL 4L1DA 1XGTA 4J1UB 1XAUA 1TVHA 2GFBB 2WWMC 4FQPA 5C09B 4GBXB 5B38G 5TE6H 2MPAL 5FYKH 4P2RE 4ZD3H 2DJ4A 1T7XA 2VXSH 5D7KE 4UOJA 2CJUH 1NCDL 2OCFD 1RZJC 4KMTL 2V2WA 2VLJA 5KOVC 1CFSA 3TBSB 5HI4C 4Z77B 2VDML 5IB1A 3UTSA 3TT3H 3BE1L 1QFWI 2CK0H 3BZEA 4ONFL 3PHOB 1BBDL 4KK9C 1XIWB 5DWUL 5HYSG 3KYAA 4KK8C 5FM5O 4C83B 1KCLA 2Q7NA 3L3KA 4PP1C 3A0OA 1OF2B 3MA7B 1YEFL 3H9HB 5GIRB 3S96B 3NPSC 4UQ3A 2Q8BH 2VLJD 3RI5F 3D0LB 1JZ8A 1CDYA 5CEZL 1YYML 3BSZL 4XCEA 4PLKD 4KAQL 1FVDA 3TBWA 3SKOA 1CG9A 1UACH 2AJZB 3Q0HA 1JN6B 4HIIA 4U3HA 2JB6B 5HGGS 5E03A 2JLLA 1QSFE 5I1KL 5DJ8A 2AEQH 4FS0A 4ZDHA 1EDQA 4FFWD 1NCNA 5CBAB 2BNQB 4NO0A 3DYMA 2R2CA 5DJXA 4DVRH 3KXFE 4JFZH 4S1SH 4HMCA 5ALBL 5GGRB 3L5XL 5DGQA 5E00B 3V7AG 1AC6A 2BRQA 4PJDF 3W9DB 5L0QC 1HYSC 4KKBC 3TZVA 5C3LD 1NUDA 1NFDB 4GRLB 1LD9A 4PJ7E 5IWLC 3T0EA 1IGYA 5TQ0L 2X9YA 4F37F 3LSOA 2GK0B 1N8ZB 4N90E 4X5XA 3MRQB 5CP7B 1FVCA 1A6ZA 5LGHH 3BMWA 2LE9A 4RZCA 1T2XA 1U95B 2WM0A 1A1NA 2ADGB 1B4JL 5IOPA 2FX7L 2XQYG 4WHTA 4N8PA 3AS2A 3BGMB 1IZKA 1FL3A 3EHBD 1J8HE 3SJVE 2B39A 4E41D 2C4FU 4J6RL 3ZKXB 4APQA 1ORSB 4ELMB 2DIAA 5EO9B 5B39A 4RGNC 2YBRA 1Y6MR 2A9ML 1YEKH 5D7KD 1GGBL 2EDDA 2VIRB 3NAAL 4GO6B 1IVLA 2D0HA 1A6AA 3MGAA 5BZWA 1CFVH 4PJFB 1VFUA 3RAJH 2R2HA 1W2KT 5GRVK 1U92B 3LMJL 1NC4A 5D93C 2P8PA 4Z0BL 3C08L 4NC1C 4Y19B 1HNFA 1UYWH 3KS0J 5D7SL 5ESVB 1X6NA 2ORBH 4N0YL 1QLRA 4DGVH 4JVWA 4F7TA 4YDLC 2Z35A 4ZXBC 1U3JA 4IRZH 1CFBA 2X41A 4WW2B 4XWOD 3QEQE 1V3KA 3X3GL 1OTUD 2KZ1B 1Y18A 3D87B 3E8UH 4PJCF 2NY7H 4NRZB 5FA3A 3EJYD 3ZLQC 3F12A 2L4OA 1A9BB 4BUGA 3VD4A 3A67L 2P43B 4WUUE 2O5ZH 3LKOB 6FABH 5JQ6L 3QR2A 4NPYB 5C0AA 5DI8A 3RX8A 4U1SB 2APXA 3DV4B 5D2LE 3TCLA 1MREL 1GZQA 4Z7VE 3V6OE 2HMIC 4WY7H 1BVLA 3WNMA 2Y07L 4L4TE 1N2RB 1LK3L 5C9JB 3TN0B 4J6RH 1DR9A 1DBMH 5DD6A 3T0WA 4GLRI 1INDL 4L8DA 1EVUA 1V7NL 3GSXA 3KYOB 3OL2A 4CW1B 5KS9B 1UZ8A 1WSST 2XICA 5T33H 1MCFA 2NW3B 3MNWB 4K7PL 4PJ7A 3GI8L 4OM1H 3U7WH 5ICZA 5MHSD 5CBAA 3RVWC 4K8RL 5EZIL 5T1DH 5BO1L 5KVGH 2CGRH 1KLUA 1VKXA 1L7TL 2GKIA 5JXED 4LIQE 2ICEA 5BRZE 3W9DA 4H8WH 2EYSA 3ARGB 1HI6B 1IGJB 4PRNB 3S36H 3WFBL 1T0NA 5HHPA 4ZTOL 2CK2A 4NFBA 4ESKA 4M7ZC 4P59L 3PJSB 4Q58C 2BNUB 2G9HA 3H42H 5CP7A 3EJZC 4P2YA 2B2XH 2ADFL 2WUCL 2FJHA 1JGEB 4U2YA 4DUVA 4XPGL 5D7LE 5T5FL 2EIDA 5MEPB 3IDMA 1XGRB 2XZCL 4IDJL 4X7DC 2GJ6E 4LLQA 3CZFB 3OAYH 3L5WB 1MCNA 2JB5L 1JI2A 4DKEL 3NPSB 3QDJA 4S11A 2DQFB 4QRUA 4PTUB 2J6EA 1TVDA 1CD9B 3HPLA 2PYEE 1MJJB 5KVFH 3P0YH 5F7YC 4V3EB 1JPST 4R4FL 4OCWL 4XWGL 2XN9B 2F9BT 3C6LA 4JFHD 1ZK9A 5J11B 4EIGB 1PEWA 3C5SB 1MCIA 3M07A 4ZFOL 2CK0L 4Y8DC 3K1DA 4LSRH 3CZJA 4XX1E 3C60C 1T2JA 3P40A 4NKMB 1J18A 1D5IL 2GK2A 3BN9D 3UTPD 4F7EA 3O6MH 2ZUQB 3PWPB 4ZOAA 3HNSH 4KTEH 4WFED 2D7PA 1AHWC 2NY3D 4L4TD 2EXYC 4X9HA 2EDKA 3BWUC 2DYPA 4HG4J 2C1OA 1OB1B 4HQQL 1RULH 4XVJL 3U1SL 5C0GB 4U7SA 4DW2H 3WO4C 1A02N 1HHHA 3HMXL 4ALAH 4MS8D 5A16B 4MHHI 2CR6A 5B3NA 4ODUA 1CFNA 2BX5A 3DVGA 3EOBA 4TYUA 1Q0YH 2XKUA 4R3SB 4EJ1C 3FKUS 5HPMB 1FL6B 4PJ7F 1T22A 3RWCB 3TA3D 1W8NA 3GUTA 2K1MA 4AJ0A 5BRZD 4XC1H 4MQ7B 1RUQL 1N4XL 4R8WL 2XFXB 3C6SB 1A7NL 4OLVL 2DQCH 1NFIA 1LNUA 3TN0A 2D9CA 1Q72L 1G9ML 4ZS6C 3FQTA 3IDYC 1OOAA 3VWJC 3C2AH 4XI5C 4YUEH 1SVZA 1HDMA 1MVFA 1MREH 3SPVA 3MBXH 1WAAA 4L1HA 4RFNB 4EI5A 2XN9D 3GSRA 3KPMA 4RMTA 2DDQH 3PP3K 4G8IB 3ARBA 2GJ6D 1FZJA 4LPTA 4R2GC 3UBXA 5FUOL 4XVUD 3SE3A 4XPBH 1KPVB 2X4NB 4B7IA 1YNKL 5H37G 1CE6B 3QG7L 4ETQA 2FX9L 2Y6SD 4O5LH 5K93A 5KVDL 3I9GL 4DKAA 4HGWA 5E08L 5IB5A 2PYED 4LLVB 3FQNA 1A7OL 1ZVSB 2APTA 4HXAL 1N6UA 1HSAA 4HH8A 4PJGB 1IQWH 4HJJL 4NNXB 3NCJH 3HNVH 2EDLA 3I9GH 4W4NA 3TYFB 4IRJC 1DLHA 4DZ8A 4POZC 4LEOA 3GMLA 3D3VB 3LQMA 2VLJB 4NRYB 4Y2DB 3WS3A 1NC4D 1MFAL 3QXDB 5DJDB 3PHQA 1NGQH 1RZIA 3V4VH 4APQC 1Z0MA 3L3DA 3L5WA 3RAJL 3WSQL 1JUFB 2IG2H 1KTRL 4LMQE 4WW2A 3FT4B 4PJHB 5IFHH 3HCVA 3MV8E 1U6AL 2CDFB 1MHHB 4P2QE 3UZEA 2F19H 1I3GL 4JZJB 1EX0A 4M6OL 2UWEB 3R06B 1AKJB 3WIFA 2HJFB 5ALCH 5IVXB 3KLDA 3TCXA 4HAGA 2EDQA 2Z9TA 5GS0H 5D1ZC 3MR9B 5F7KC 2ADIA 4PY8J 4XPBL 3LEXB 5I75B 3VRLE 3ZKND 1MCDA 4OLYL 5E8NA 3MRNB 5D1XC 5T5NF 2NCMA 2NR6D 4M62L 1DN0A 2VL5B 1IEAB 1QSFA 3K2MC 3SCMD 2APBA 3D2UB 1DDHA 4F7PB 5DK3A 3VXTA 3HB3D 1TITA 3ULUL 3AM8C 2B0SH 4L3AA 2V7NA 5HPOA 1QRND 4QOKE 1OWWA 2XZQH 3VA6A 5C0GA 3H9ZA 3MLVH 4JFED 1BFOA 1FZKB 4WU7B 3GSQB 1N4XH 5HY9B 3WFEL 3O2DL 5J89A 4R4ND 4XCFH 1A6TB 5HHNA 2E7BA 1A9EA 5DYOA 5I30L 3IXTA 3P9MA 1R3JB 4F9PC 1T7ZA 5FAAA 3RX7A 5EUKB 3KAAA 2VKWA 4DK3A 4MMZC 4NQSB 5F7WC 2CIIA 2VITA 4PV9A 1SBBA 3T09A 32C2B 2HVKB 5IESL 1ZAGA 3HG1A 4XWOC 2HLFD 3QDHA 5D7JD 4WWKC 3OHXB 5DD0L 4D0BA 3FAWA 1CQYA 2OR9L 3RBSA 4WO4C 3BPLB 2Q8BL 3KPQB 3IU4L 2Y4SA 4TSBL 2ICCA 4F7MA 1H0DB 2AXGA 5JW4N 5HGDA 3LQZA 1HHKA 3O3UN 4X4YA 3CDGA 3ARBB 1B9ZA 5JO5B 5IB2B 5HTSA 4OF3A 3CZFA 3K80A 3BXNA 3KPSB 3LQAL 5GSVA 4MAUH 1KOAA 1VA9A 5I2IA 1CVRA 5IB4B 4LCWE 4MAYB 5IGXL 4JRXD 2H2PD 5ACZB 2HFGH 3ZE1F 2HG5A 5EBLA 1SBSH 5D5MF 4M1GH 3NGBB 4MQ7A 1MHPL 4NO5B 4HXBH 1ZVYA 4IRSA 4ZTPH 5HGHB 1NDGA 5T1DL 1FNHA 2O93L 3RVUD 2WBWB 1KCKA 1L6XA 3D69A 3O81A 5I19L 3IVKA 3Q5TA 4PP8C 4YJZL 4KDTC 1DBKL 1ORSA 1K5NA 1FFNB 1U8LB 2R0LL 3TNNB 5IUSA 1LE5B 3RWGA 3JV4B 4XNQB 1DUYA 3BJLA 1CDJA 5E00A 1AGEA 4GXVH 4XRCB 2QSCH 3I6LE 1P7QA 1S9VA 2DN7A 3O0RL 3IS1X 5C9JA 1B88A 5TQ2L 1IT9L 3LSOB 4FMKA 3IKCB 1GVIA 1ORQA 2YEZB 3U7AA 1BZ9B 3VI3F 2W91A 5EU6E 4HIHA 3HMXA 4P46D 2FRGP 1UVQB 3TPUA 1KBGL 5SWZB 2XZAH 3BO8B 2D7TH 1VFMA 4OQTH 5C0EB 5C0JB 1WVZA 1L0YA 4S2SA 1MCKA 5B21A 4EXPX 3EYQC 1R5VA 2PTVA 4E42B 1ZGLM 1JL8A 1VKXB 1H5BA 3EFFA 4U1NA 3BZFA 4YDJB 5DS8B 3PWVB 5C07E 5DR5L 1LO4L 3SKMB 3GSRB 3L3OB 1N64L 2V2XA 4BFEA 1UM5L 2DQEL 2XQBL 1KIPA 1FNEA 3SJVD 3TJHD 3MOAH 2FJHB 1MFBH 2IH3B 4LCWA 1UEMA 1P84K 4UNTA 3H8NA 4C56D 4YXHL 3CUPA 2EE9A 3SE9H 5HYFA 2W65B 1UJ3C 3HG1B 4Y5XB 3V6BR 1HOCA 2NY7L 1YNLH 5K9OA 3LKRA 5AZ2H 3VRIA 5HHXH 2OZ4L 5DD1L 1BM3L 1QG3A 2X1QA 3Q48A 2VUOA 4U31A 4F8TA 2XTJC 4PGCA 3BPNB 2J8UB 4NQEA 4OQTA 2OK0H 1I9RL 3KG5A 5EBGA 4EUPB 3ILPB 4ZO8A 1HQ4A 1G7IB 4QRPE 5C09E 5D71L 2NY1C 1IC4L 1JWMB 1A6TA 3T1FB 4RGNB 1VPOL 5I2IB 4MYWB 2VISB 3H7BB 4NKDA 1P6AB 5EU4A 1FAIL 1PDKA 4J4PC 5EIQA 3VMPA 2YD4A 1JVKA 1S9YB 5GGVL 4TNVF 4RMVA 3EYQD 1NFDA 3KYKH 5F44A 2WP3T 5GRZA 2VDQH 3LEVL 4XPTL 2PW2A 2UYLB 3IFOA 1CXLA 2FL5A 5D70H 5IQ7H 1T3FB 5FYJU 1EEZA 3WNPA 3LEXA 5HDQL 5IMLB 4NJ9L 4LVHB 4Z7QE 1IC5L 4CU6A 5F7DA 3LIZL 1NCBH 8FABB 5L8LB 4EI5C 3ILQC 5IOPB 4OZHA 3FQWB 4XI5D 4JG1L 3VXQB 1C5BH 3D5OF 2Z8RA 4QRUB 4NN5C 1C5DA 1S9KC 1YNLL 2JJVA 3ARTA 2BVQB 5EO9A 3GMRA 4XBGA 2PUQT 4QRQB 5J3HC 3QDMB 3QH3A 2W0FA 2AAVA 5IQ9A 2XNAB 4LVHC 3KR3L 4Y5YC 5E7FA 5EA0H 3QQ4A 3OKDA 3QYCA 4O51A 2V5RA 2W07A 1U92A 4NKMA 1LEKA 2VNCA 3ROOA 3H7LA 5DR5H 1HN1A 1BGXH 4XPHH 4WRLA 2GJZA 2XY1A 3QEHB 4UINH 1FFQA 4NNYB 3FQXB 3V95A 1R5VB 4E42A 4Z7QF 1OTSC 2X1PA 4QGYA 4DFIA 4J3SA 5BZDA 5DRWA 5FYKL 1IM3B 3MRJB 4ZD3L 4JM2A 2ENYA 4UBDD 5L9DL 4OZFB 3N9GL 4WEUD 3NTCH 1KJVA 1EJOL 1X7QA 1O7SA 4G6JH 3VG9B 2Z92B 3QPQD 1AGDA 2XG4A 4OUOA 5E4EB 2HT3D 1ORQB 4JFFB 4U1MB 4P5TD 1NCWH 4NQDE 4L8BA 1JHTB 2YOCA 1IM9B 3S98A 5ID1B 3PHQB 1MI5D 3BDXA 1KPRA 2CD0A 1E4KA 3V5KA 3GBNH 1XR9A 5KJRH 1JUFA 5DJ0A 2DM3A 4WDIA 2OM5A 4ZFGL 1XF2B 4MQXC 1JGUH 2ARJA 2X4TA 5IEHA 2DBJA 1QFWL 5DD5L 1UM4L 4OF8A 3O9WA 1NANH 2NMSA 2Z8VC 4HF5H 4PP2A 3KXFB 4XC3L 3RZCA 1TZIB 5ISZB 3F8UB 2VQTA 2HJFA 3U6RB 3BOVA 1FAKT 3MFFB 3QNXA 3ZE1E 4ODUB 5F9WC 4OFIA 1JNLH 1SM3H 4WCYH 1OAUH 2YC1A 1KXVC 3QHZL 4TTGA 1ADQA 4NKDB 3E6FB 1OSZA 3RWCA 1AGEB 2LTQC 5E7BA 3GIVA 3B3IA 5DMGC 1PKQA 2G5BB 2IMNA 1PQZB 4LOUC 3CSYA 4FQHA 3O41B 1D9KD 4PBWD 3RWEB 2E9BA 4IOIA 4D8PA 1AI1L 4NRYA 4Y2DA 5B3JE 2Y5TB 1S9XB 2PO6B 2M26A 3WLWC 1Q9KB 2JCCA 2X1XR 4LARL 2R23A 2KQMA 3I85A 2J7LA 1QBBA 2A74B 1CDGA 2P8MA 1WZ1L 5D2NA 1EJOH 1S7TA 2VZOA 4YBHA 3WUWB 1F8TH 4S2SB 2HMID 4PGBA 4NOFA 1G6RL 3WMSA 3HE7A 3KLAA 3MBEB 4EQ2A 3MJ7B 4PUBH 5J6GB 3PL6C 5H8DA 4X6DE 1RUML 2H3NB 3QIUC 1NPUA 4WEBH 4FQIH 1RUPL 3WV0A 3BWAA 2IH1A 1KSRA 3G04A 1NGPH 4ZPVA 1KJ2H 4HKJB 4XCFL 4QXUH 1LEKB 3LY6A 1JTTA 4U1JA 4PRDB 4P5KA 4BZ2H 4Y2DC 2Q7YB 5CLTA 5H35B 3LEYL 3W0WA 4PREB 4KJQD 3NIGE 5HGAB 3WFCL 4Z0BH 3NCYP 1BECA 4DOHE 5JW4Q 1QBMH 1JGVH 3T04D 4XPFH 4NM8H 4WIQA 2BVQA 2J8UA 4NQEB 3Q6GH 4S1RH 3CLFH 2VLLB 2HT3C 4AL8H 3QIWB 5INCA 4Z76B 3OB0H 3TO4D 5I1IH 4X7CC 4BFIB 3M8OL 1T1XB 1W72A 3STZA 1A4KB 1IC4H 2Q1EA 1V5JA 3KPRB 4DGYH 1NCBL 3OKDB 4F58H 1RZJH 3VD9A 4PGDB 5DRNA 1FORH 2AXHA 4FMFA 1ZLWK 3X3FH 3DX9A 1A1NB 2ADGA 1AP2A 5J13B 3B83A 1MEXL 1S7SA 1PKQE 4ODVH 1FFNA 2GQHA 35C8H 4LSUH 4J8RB 5DA4A 5JPNB 1EPFA 2Z31D 3VXTB 5DMYA 3LPGA 3V5DB 1OLLA 2XKNA 3JTTA 3DMMD 2IAMC 4M5YH 4Y4KB 3RTQB 1D3CA 1CDCA 4YXHH 3MYJA 2GAZA 2VZTA 1FYHB 2PYFB 2OS7A 1FCGA 1TTUA 3LEYH 5DK2A 4OFDA 4OF6A 3GJFK 5BVPL 1KPUA 4OCYH 1F3JB 4PJAF 2FYYA 2IMMA 3B5GA 1HILA 2ZOKA 2BHZA 2J88L 4S1SL 1TETH 3K7UA 1WCBB 1KB9K 3GSWA 1WBXB 5EU6A 4WV1C 1R3LB 4MA3A 1YEDA 1P4IH 5GJSH 3KPOA 1F4WL 4MXWH 4Y5VA 3SGDI 1FRGL 2QSQA 5TGBB 1B0RB 3QZWG 4P2OA 3V6OC 3EFDH 4JFQA 5L2KE 2WIMA 4IIQC 1BEYL 1NAMA 3OQ3B 4UOW1 4LSVH 3MJ6A 1H0DA 1YNTB 3D39A 4IRSD 1CF8H 2HP4A 2CUHA 3CVIH 4JHAL 3QRGH 2NY6D 2WAHA 4Y7MA 4HEME 2K7PA 3KS0H 3U36A 2VE6A 5GQBA 4J3VA 3B2VH 1LO4H 4M6AA 4G7YL 1ZLVH 4QRTA 1Z5LA 4LPCA 5C0IB 3AMKA 5CAYB 3MJ7A 4KI5F 5DD3L 1NC2A 5BZDB 3VD5A 2BSTA 3I50L 2GUOB 5INDB 3DIFA 4OZGB 5DLMH 4D9RE 2PXYB 4OFVA 2WINA 1OPGH 4JFDD 4WI6A 4YGVA 3QUZC 2OR8A 4DW2L 3WNKA 2JCCB 5C0FB 2HRPH 2R4RL 2ZSVB 2DOCA 1IEAA 2FIKB 3ZMRA 3X17A 3BYTA 4LP4A 3TH4T 1T1ZB 1H3TA 4JHWL 4Y1AD 3VXSA 2P5WE 1XZ0A 1D5IH 2ICWJ 2P45B 1T0MA 4YHIB 4MGXA 1A5FL 3LDBB 4AG4H 4XVTH 1B2WL 1OGAE 3GBNL 3MV7A 4PJEE 1IAOB