3VXPA

Hla-a24 in complex with hiv-1 nef134-10(6l)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 74
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxpA01
4NJ9H 5FYKE 3B43A 4S2SB 5FDWB 5HVFB 4JM4H 4EDXA 4OCSL 3M07A 3VRLF 4D2NA 5IT2L 4F9PA 3KYKH 2H8PB 4RWHA 1NAKH 5D1ZA 2OR8A 3UPRB 2ZSWA 5FGCE 4Z7QE 4LASL 5C08E 3ZYOA 4P59L 3VXNA 3KLHC 4LLAA 3C6SA 4PJIA 3OKOA 3CH1A 4C56B 2AJVH 4KUZH 3GFUA 3VA2C 3F7VA 4JFXB 1ZANL 1Q0YL 4X4YB 2A77L 5J12C 1YPZE 1HINH 1NAMH 3TGXA 1UZ6E 3X3FH 2UV3A 3SDXE 4BK5A 2X4PB 4MLIA 3U36B 4LPVA 3U4EA 3HI5L 1GGBL 4OZ4B 5E5MB 1NFKA 2C5DC 4AM0B 3AM8C 1QBLH 5F7DB 4J3XA 4MD0A 4NWUH 1YN6A 3UDWA 4QRTA 3V79C 4Z95H 5FOBB 5D2NA 2EXYC 4G3YH 1EZVX 1YEJL 5TQ0L 3QEQA 3RX5A 4PS4H 5HSFA 1IGIL 1NPUA 2KZ1B 4GMSH 4K8RC 4Z6AT 2PW2B 1SQ2N 2UYLB 1E6OL 2DI8A 2NTFB 4KHTL 4MJ4A 5JHDE 3RWFB 1N5AB 2XKSA 1BMGA 1MH5A 2VNCA 5CSGA 1KEGL 2HRLA 1HH9B 1TPXB 1EBAA 2CKBA 3A67L 4X4XA 5ERWA 4Z7VF 4OQTA 2WBJD 4HMDA 2E9JA 4JRWA 5I1GH 3QDJA 3KVQA 1P1ZB 4K94L 1DVFD 1AJ7L 4GAYB 1G6RL 1VACA 4AL8L 4OUUB 1ZVSA 1J8HA 4Y4FD 3TBWA 2VXTL 4AEFA 3N0PB 3EZ8A 5IW3A 1BJMA 4M4PA 4MAUL 4H8WH 5CZKA 4QY8A 1JCKA 1QBBA 1CBVL 2VDNH 3RKDD 1J1PH 5E8EA 5I6XB 1CL7L 3BPOC 5CD3A 4XRCB 1ZWIA 2OM5A 3JTSA 1TNMA 2C1PB 3OXRB 4HKBA 3WXVH 4B53A 3O6LL 4G43A 4Y19E 3TIDA 1EHXA 2N1KA 3SDAD 2ERJB 1JGUH 4RAUB 5KVDL 2R2HB 2B5IC 3LVEA 1CFSA 1AQKH 4Z76B 1IGJA 4NN6C 5F7EL 1WTLA 1TZIB 1Z0MA 2RQ8A 4R4NC 5DJ8B 1WT5A 2EH7H 3OAUH 1TZHB 2HJKB 4H88L 4N8VA 4UV7L 4Y2DA 1EGJA 2BCKB 5L6YL 3KYOB 1YY9D 2EZ0C 1INQA 1FFQA 3MFGB 2Z35B 1AP2A 2DQHL 4YHNA 4NJ9L 3H3KA 5AAMA 4X6DE 4XMKH 4QOKA 1GCFA 2BVTA 4JM4L 2FJGA 1J1XH 4NGHH 5HPMB 4QHLA 1FFPB 1NGWA 5KVFL 1NAKL 3FOLA 3NZHL 4JM2A 3MCLH 3KDMA 3QUXB 3TNMA 1WK0A 1CI5A 3F7RA 4TULH 2AJVL 4KUZL 1NUFA 4ODVH 1LE5B 2E8YA 2IQAB 1ND0B 1P4LB 2VYRE 3L3GB 1RZIA 3HZYA 1GOHA 1HINL 1NAML 1A6PA 2XY1A 3VXUE 3X3FL 4ZTPH 5EO9B 4HD9A 5D70H 2FZ3A 3M8OH 4OLVH 5FCUH 5E00B 2Y06H 4R9HA 3UBXI 1E6JH 3O6FD 1QOKA 1RUAL 5D7IB 4A2MA 3LN4A 3QZWG 1NDGB 1QBLL 2BSTB 2R1XB 5KVMC 1KIUA 3VFNB 3T4AA 1EFXD 4ZS7H 3L3OA 5F7HA 2F5BH 4Y4HB 4Z95L 5EZIH 1I3RA 4G3YL 3GSOA 4R97B 4ZSOE 4NKOB 1EAJA 4P2YA 4PS4L 3RWIB 4GXUN 3EYFA 5MENB 3VJ6B 3GMLB 4GMSL 4GH7B 1U8PB 5DR5H 5KOMC 4B7LA 2C9AA 1TTFA 1AXTH 2BHZA 4WNQA 1A4JA 4LKXA 1XGUA 4WWKC 3VFMB 1HI6B 3G04B 3E8UH 4NQVB 3WFHB 3LQAC 5CJ8A 5I1GL 1S5IH 2YC1B 2CK0L 2P49B 2YBRA 1X4ZA 4WFFE 3UC0H 2VABB 1QSFB 3MRLB 1CXHA 3LQMA 3UJJL 5SX4H 2XG5A 5K33A 1J86A 4H8WL 3DX9B 1R24B 4NQEB 4OLXH 1MPAH 1AXSB 2VDNL 5IEKA 1F11A 5ID1A 3RVUD 2WW8A 3H9HB 5DUPL 2C3HA 1AD0B 2EDWA 3G5ZB 1W0YT 5C0AA 2GCYA 4LHUB 3HS0A 5LAXA 5IHBA 3SY0B 3GI8L 3TA3C 3TNNA 3WXVL 4OFKA 3JV5A 3GIVB 1JGUL 3DROB 5D72H 1AQKL 1FL6B 2H32A 5JW5B 4MVBA 2QV2A 3GJFA 3GSQB 3QUYB 4KTDH 2EH7L 3OAUL 1B0GB 1TNNA 1OM3H 3SE3C 1OGTA 3CSYA 4FQJH 3HR5A 2FSEA 5C70A 1N2RA 2G60H 5HDBF 1A2YB 3R0MA 5I1KH 5JHDD 5HXMA 3TN0C 4TUJA 3O2VH 3R8BB 4XMKL 5IFJA 3K0WA 5TDPA 1J1XL 3HUJE 1JN6A 1U8NA 3LEVL 4IHOA 43C9B 2EDFA 3CFBA 3TJEH 4EIZC 5F1NB 2HWZL 4HLZG 1A3LH 1TTGA 2YXMA 3NPZB 3TBTB 1FP5A 1FZMA 3N1MC 2P5EB 3S35H 2NY1C 3CFKB 1I4FA 1ADQH 4JFPA 1H8NA 3CLFH 3LKNB 4TULL 3VRJA 3SCMA 3HHRB 1MVUA 3LQZB 4HUVB 4MCYB 4YDLC 3I6GA 2GSGA 1GGIH 4PJ5A 2VWEC 2DI9A 3D3VB 3B9KA 5ICXB 4Z7NE 3Q6GH 3TFKD 4WI7A 5KSAA 3RVWC 1Y0LA 3DIFB 4ZTPL 4B5EA 1PLGL 4I18A 5D70L 4OLVL 3M8OL 5FCUL 1MLCA 2Y06L 3L9RB 1BREA 4FXKB 1E6JL 4Y19D 2X4UB 2IPUK 3QRFM 2P8PA 1JK8B 1IJ9A 1I3GH 1OCWH 5BZDA 3STBA 5BVPH 3WIIH 3SKNA 4ZS7L 3QI9D 3IXAB 3FONA 4H5SA 2F5BL 2EDJA 4FXLA 5EZIL 1BZ7A 3QJFA 3RBGA 3RGVA 4UINH 5E2UL 4OZFG 5DR5L 3BPLB 2DYPA 5LGKA 2JJSC 2A73B 1AXTL 3FO1B 1ZT1B 5D5MB 1INDH 1YUHA 2OX5A 2PCPA 3ARPA 3E8UL 1QLFA 4HMEA 3FJTA 5DK0A 3QQ9D 5D1XB 3BO8B 3UC0L 4KJWC 2MHAB 4NQDB 5E5RB 4V1DA 3MLSL 3VXUD 3HMXH 1QSZA 4OLXL 2HKFH 1W0WA 4Q74A 4QRQB 1UKTA 1MIML 3J7HA 3G08B 1JRHL 2I27N 3L3DA 4CVZB 2W07A 1A9BB 3PP3H 3QIWB 2X4RB 1ACYH 3VD9A 1DUYA 4B50A 5CEZH 1JF1B 5D72L 1CQKA 5CBEA 1Z3GL 2B8OT 2AI0H 4KTDL 3PQYA 3LHPH 3B2UD 1R3KA 4PJEF 4PBXA 5J8OA 2BC4A 2VIRB 4FQJL 1K3IA 1U8LA 3RZCA 5IB1A 2Q7YA 5EB9A 2G60L 4QXTA 5HHNA 3OX8A 1D9KC 3O2VL 3IYLW 3N06B 4EN3A 4LLYB 5D7IE 5E56A 1UQSB 3WIFA 1A3LL 4JJHA 4LGSB 2ICWI 3SE9H 5D1QC 4MQ7B 3ILPA 3S35L 2YOCA 1IT9H 2JIXB 4DJMA 1ADQL 2FWOA 5JPMB 1DUZA 2V9QA 3FRPA 2DOCA 3DETD 5MENE 5C8JB 2O5ZH 3I3EA 1GGIL 4MWFB 1AY1H 1C12B 4Z5RB 3QAZC 3ZDZE 5EBMA 3Q6GL 4WU5B 4MNHB 5EIQA 4BYHA 3AGVA 4XXDB 1RUPH 5FO9A 1PAMA 3E6FA 4WHTB 3KPLA 1T04A 2V9TA 2VLJA 3LRGA 4ZAKB 5E8NA 2C4FT 4NO0A 1CD1A 5MHSE 2CDFB 1N8ZB 5CIPB 3HB3D 4GQ9H 1OCWL 5E9DB 2OI9A 5BVPL 3WIIL 1O7SA 4LNVA 3S9DB 3O8XB 1UXSB 2MKLC 1OTUC 2OTUB 4C56D 4X5WB 5IB2A 2B20A 5DRWB 1HHHB 4OV6F 4U1JA 4X7EC 3ZE2E 4NQEE 4X6EA 1DBAH 4HV8A 3WNOA 1MFCH 5D9SA 2W1NA 3KG5A 2QKIA 4PRPB 5GRWA 1OP5H 4V3EB 5INDA 4P23C 3T1WA 5C0DA 3MJGX 1DBJH 1SJHA 4FXGA 4IDJH 4FNLH 1ZHKA 3QFDA 1INDL 1X5KA 3GMMA 3ULVC 3NPSC 3MRPA 4G6KH 4RGMB 4UDUB 3V7MA 5ITFA 4I0PA 3MREA 1DL7L 1R5WB 4L4TA 1KNOB 3KPMA 3QPQD 1FAKT 3MV01 2JKXA 2PR4H 5KANI 4F9LC 4DUVA 1BQUA 3HLAA 3U30B 4LLVB 3U1SH 1QNZH 5CSZB 5C0GB 2IANA 4Y16C 3HMXL 4HJGB 5I8CA 4AEEA 4MB3A 3S4SB 2HKFL 1ZHLB 2APWA 4HIEA 4JZJB 1MNUH 4EDWH 1IEAB 4WHDA 3TT3L 4Q9QH 2R29L 1HE7A 1KELH 2W60B 3RNQB 2XTJB 1ACYL 1RSFA 1WEJL 3BVNA 1K4DB 2NW3B 1RZ8B 4ODSL 5HHQA 2D0HA 2AI0L 3BKMH 3LHPL 1UWGH 4TQEH 1ZLWH 5C0CA 5DUMH 1M71B 1QEWB 3D3VE 3WNMA 1JPTH 3MUGA 1KJVB 1S9XB 3STZA 2IPKB 4LSSH 3SDXF 4U1HB 5IW6B 2ZUTA 3AS2A 4HUNB 4IMLA 1V8HA 1T0MA 2CLRA 1EO8H 4KVNH 3KS0J 1RK1B 1F02I 5ITBH 3VD4A 1YDPB 1XIWB 1OWWA 3SE9L 4M7ZB 1D7FA 1I7UA 1U91A 1IT9L 5IOPB 3KYAA 4DGYH 5DJ2B 4CN1A 5GGTH 3RWGA 5ALBH 3L1OH 2X10A 1RFDH 3K46A 4M7LT 2O5ZL 3GEWB 4XNYH 1LQVA 5TGBA 1AY1L 1RV6X 4JFYB 4YX2H 5FYLE 3OZ9L 4GKOA 1RUPL 3VE0A 3MRDA 1KACB 2HVJB 4O51A 2EC8A 4U1KB 4OB5H 4R3SA 4Z0BL 3IXTA 4N0YH 4WW2F 2A6IA 4PY7B 1TETH 3QUXD 3CC5A 5C0EB 4PJDB 1UWEH 3AREA 4RMTA 5IMKA 2GAZB 3C60C 4GG6A 2PUQT 4NQDE 4NN5B 4RIRB 3CIQA 5GISH 2Q6WA 4LKCB 4N0CA 1C1EL 4YBLB 2Y6SC 5DFTA 1DBAL 4LVOC 4CW1A 1MFCL 2Z31C 3LDBB 2FX8H 4MXQD 1FZKA 5KSUA 2Q8BH 4HSQA 3EBAA 4HS8H 4OQTH 1AGFA 2D9CA 1EAPA 4IDJL 3B8SA 4FNLL 4CJ1A 5KN5A 4KZEH 3BGFC 4RGOL 4HPYH 4G6KL 1T1WB 2FLRT 1S7TB 4Y4HD 2VXSH 4JY5H 4CU8A 1EEZA 1LHZA 1YMHB 5E6IB 3L7FA 5MEND 1WGOA 4LLUA 5JQHC 3HCVA 4ZUUA 3U1SL 1QNZL 1LD9B 1IARB 2ZJSH 4YUEH 5ADOH 1I1YB 1JGEB 4JHBA 1FVCB 1IKNA 4XX1E 1MNUL 4U0RC 3SDDA 4EDWL 3ARDC 5MHSD 3K4ZA 5GGUA 1A6UH 4UILH 1MAJA 3VG9C 4Q9QL 1KELL 4QHNA 3QDMA 5JMRA 3VFUB 3K1KC 4G9DB 2BHYA 1BVZA 3DWTA 2A83B 2VQ1A 3RTQC 1R5VB 2OZ4H 4RSVA 2ZUXA 4UIMA 2DM4A 1OLLA 1QSFD 3NIDE 5DD6A 1ULVA 3BKML 4PB9H 4UT6L 1UWGL 1I8MB 4NQED 5DUML 3C09C 3EDDA 3MGTA 4H25B 4P2QB 1JPTL 5E7BA 1QFWI 2LU7A 3ZHLA 1ED3B 5HI3C 4LSSL 1RURH 3L3KA 2YPKA 5SX5K 1YEIH 3KXFB 1EO8L 1KC5L 2PYEB 5ITBL 1T1YB 3FB5A 2Z92B 5E9DE 4OV5A 3GZKA 4DVBA 1CGUA 3BIKA 2FH6A 2DQEL 3JWOC 3LN9A 1I1CA 4PLOB 1JHTA 1NANH 3QEGL 5B39B 3LAFA 1JZ3A 4ONOA 5EOCJ 4DGYL 1X5LA 3NACH 3ZE0F 5GGTL 5ALBL 3L1OL 3FTGB 2VB5A 1DBMH 3QRGH 1RFDL 4ZUWB 4XNYL 3V95A 1LDPH 2IAMB 3PABB 4YX2L 4Z18A 3CLEH 4YHOH 4XPBH 2QL1A 2A74A 5LGHL 3FQXA 1D5ZA 3QDGB 5BQ7A 1E27A 4N0YL 1XGPB 5FA4B 2P5ED 3MJ7B 4CN4A 1TETL 4S0UC 2W91A 5IFAH 2F5AH 1UWEL 4LPXA 5SWSA 3WV0A 1XR8A 2DQTH 1X5GA 5GRZA 1OAQL 1W0VA 4K7PH 4XNXL 1W8NA 1NFIB 3D3VD 5HHPB 3BZ4B 5GISL 1AO7A 1P2CA 4IRSA 3S4SG 1J11A 1RVFL 3CXHK 4FFZH 4FZ8H 4XT1C 1F6LL 1CE1H 4P5TA 3QEHA 4JO4H 3CSPA 4YHMH 1F8TH 2FJHA 2FX8L 2NNAA 2Z8VC 1UFUA 5J06A 3INUH 5KJRH 4QCIA 5DSCA 2Q8BL 3G5XA 3KS0H 4HS8L 4G8GB 3QO1B 4OQTL 1MCHA 2AJXH 3BPNC 4BSJA 8CGTA 1BWMA 1Q9WA 4EI6B 4KZEL 2XTJE 5I16B 3QEUB 4HPYL 3EJYD 3P9MA 3EJZD 2F74A 3LN5A 1OTTD 2VXSL 3VWJC 1JTPA 4GW4A 5C2UB 1D5BA 1QD0A 4PD4J 4AT6B 1HIMH 4LQFH 5E7FA 2ZJSL 3FN3A 1PGRB 4YUEL 2FGZA 4L8SA 5F1KC 5ADOL 2VLKD 1HEZB 2Q3AA 1FN4B 2CXGA 1ONQA 3O6MH 2GFBB 4YHPA 4F7CB 4QRSB 3I6LE 1A6UL 4UILL 2ENSA 1KTRL 3IETB 4ZUSA 3P4NB 2IFFH 1G7JA 5A2FA 5D1XD 1NCNA 2XOTA 2OZ4L 2BVQB 3ZTJH 4PJ8A 4KROC 1XFPA 4WIQA 1EGJL 4BFIB 4JZOB 3WJLA 1OAUH 4L4VD 4PB9L 3PIQB 2EDBA 3OXSB 4N90E 32C2A 5BJTB 1SY6H 4XBEH 5FGRA 1RURL 2E3VA 4Y5XC 2OJEB 5MEOA 1G7LA 1H9VA 4QF1A 1UJ3A 3A0OA 1YEIL 5E0QA 5DS8A 3QIWD 5E08H 3CD4A 2RIKA 3TT1H 4Q97A 3DECA 2V9RA 1ZAGA 1MREH 4EDXB 3B9AA 5FYJU 2IMMA 4PJDE 2LTQC 1T5WA 5IV2A 1RHFA 5D1ZB 1MFEH 4DQOH 2ZSWB 4WGVB 5JIKA 4PJHA 4P49A 2EYTA 2DLFH 3NACL 4WUKH 4EZMA 1G9NH 4ONGH 3VXNB 5GGVH 1SVCP 4L9LC 5F3BA 1DBML 1S9YB 2NY3C 2XZCH 1SYSA 3AS1A 3QRGL 3C6SB 4PJIB 3OKOB 1F42A 4HUUA 1LDPL 1UH4A 1F58H 2VZ3A 4HK3N 1FNAA 3SKOB 2WAHA 3CLEL 3F7VB 1UYWH 3X12A 3PGFH 4U1GC 1NFDA 2HLFD 3F12A 1JYVA 3WUWG 3VU2A 3X11B 3LH2H 3U4EB 2AJZA 2JIXD 5IFAL 2L7JA 1G7HA 1MOEA 4WRLA 3MLWL 4Q6IC 2X9WA 1IM9A 5HYSG 3ZKND 2DQTL 3S96A 4S0SD 1N3NA 4MCZA 2XFXA 3ARFB 3I50H 1FYTA 4MD0B 1YN6B 5HY9A 3ISWA 1HXYA 2P8LA 4QRTB 1R3HA 1OOAA 5AYUH 3V0VB 3V9FA 3H2WA 3RIAF 3QEQB 5EPMB 1CE1L 2GJJA 3TZVA 1F8TL 5KJRL 4ZAKD 3MJ8A 5C6TH 3INUL 4FQ1H 1GC1H 3ZO0A 2I9LA 4UZGA 1BFVH 3FB8A 1P7QA 4FQXA 4BUGA 2AJXL 1U0QA 5E9DD 3K2MC 1N5YH 4E42A 3OR6A 1D6VH 4JO3H 2APVA 3O8XD 4QT5A 2KH2B 2EDTA 5IGXL 3PUCA 2CKBB 4F2MA 4X4XB 1JTOA 3BDBA 3NCJH 5FUCC 5ERWB 2OXGA 3BPCA 3DSFH 1OVZA 3OWEA 3IKKA 3QDJB 5LWYH 4XWOD 4U3CA 2OMBA 4JY6A 1C16A 1VACB 4P2QE 4OJFH 3AS3A 4YDIH 3VGFA 1ZVSB 4U2YA 4PRPD 1HIML 4LQFL 3TBWB 3UEZA 4DK6A 3AXLA 3A6CH 3VXRA 2KUTA 4EUPA 4LGRB 3HTLX 4QY8B 3KXFE 2CMRH 3O6ML 5E8EB 2VRAA 1XGRA 3HZVA 1F4YH 2PYEE 4FTVA 3HMWL 3OKNA 2IFFL 5I18L 5CD3B 1ZWIB 3JTSB 1QLRA 1M7IB 4HKBB 3STLB 3TIDB 1DVFC 3ZSTA 1JZ6A 1CFSB 1OAUL 3DMMA 5F71A 1IGJB 2E7CA 5JXAH 1T7ZA 3IDXH 1DJSA 4N8VB 2XQYK 3WMSA 5ID0A 4LLMA 4XBEL 3MODH 1INQB 1T66D 3PJSA 4YHNB 1AP2B 1JFQL 2MQCA 3QDGE 4NUGH 2NTSP 3F6LA 5E08L 1RK0A 2NZ9C 4QOKB 2XTJD 3MLXH 5HGHA 5IQ7H 1MREL 1M1SA 2FJGB 2W65A 4QO1A 3SDAC 3N1GC 1K9TA 1PZ5A 1NGWB 3EYUH 1HWHB 4KI5E 4A2LA 1MFEL 4DQOL 3FOLB 4QHKI 4JM2B 2EO9A 2XZQH 4L8BA 2DLFL 4WUKL 2EEBA 3KDMB 1G9NL 1GVIA 4ONGL 5GGVL 1U93A 4DGIH 3FQUA 2XZCL 5D6DA 5F88A 1YY9C 1D6EB 1F58L 3MR9A 3QWRA 3UTTA 4OGAD 1UYWL 3PGFL 3IDNB 3HZYB 4LU5L 1RZIB 3BZDA 4W4OA 3I6LD 3HRZA 4G8GE 4HK0A 4UOW0 4OSUL 1PDKA 5EU4B 5J3HD 2FZ3B 1RJYA 2X42A 5IIEA 3MNZA 1EEUA 4J3OC 4NPYA 1MCRA 3HPLB 5HJ3A 1TTUA 3HC3L 1C5BH 3LN4B 4M03A 2J6EA 3MNWB 1TJHH 1P7KB 4O2FA 3T4AB 3I50L 4U1NA 5JOEA 1BQSA 4HC1A 4JRYA 3V8OA 1LP9A 1F6AA 3V0WH 1MWAA 2NY0D 1WLHA 1ZV5A 1I3RB 4POYA 1U58A 3GSOB 3EZJB 5AYUL 1MHPH 3GM8A 3EYFB 1MIEH 3VGAB 1Z5LB 2DBLH 5C6TL 5I1IL 3EOAA 2V2XA 1GC1L 1BFVL 3W81A 4IRJB 3F62A 1N5YL 2ATKA 1D6VL 4JO3L 1W2KT 3GKWH 4WNQB 1A4JB 2V2WA 4LKXB 3NCJL 1EXUA 1XGUB 3T0AA 2NY4C 1AD9A 3DSFL 2J5LB 1ZA6A 1VESA 2PXYA 5LWYL 3LKSA 5I19H 4YDJB 3P4OB 2YBRB 4U1SA 4OLZH 3AMLA 4OJFL 1OP9A 4YDIL 1R3IH 1AR1D 3DBXA 4XNZC 4LGPB 5DFVD 1A7PH 2D03H 5E2JA 3A6CL 4W6XB 1FORH 4D9RE 3MXVH 2CMRL 3T8XA 5IEKB 1FZOB 5ID1B 1F4YL 1H8SA 3P4MA 4MD5B 5C0AB 2GCYB 3TO4A 3HS0B 5LAXB 2EKSA 1GAFH 5BXFB 4Z77A 3MJ6A 2WWMD 4P5KA 4R2GC 3RDTD 5HBBA 5GS0H 3OJVC 2H32B 2E6PA 3OJ2C 4PJIE 3GJFB 4DEPC 3IDXL 4ZS6C 1OGTB 2VN7A 3CSYB 5AAWA 1P53A 3PWNA 3RVUC 3MODL 3HR5B 5E2VH 2FSEB 2EH8H 2HG5B 2K1MA 1I1AA 4NUGL 2C3VB 4Y8DC 4MAYD 4TUJB 5D5MF 4F15B 2N7BA 3MLXL 5IQ7L 1H3PH 1QPPA 5IFJB 5TDPB 3EKCA 5AUMA 1J87A 3ZHKA 2DN7A 4CKVX 1JN6B 5CMAA 3CFBB 2DTSA 5TH2A 1T3FA 4AG4H 1CGSH 4F7MA 2XZQL 4LOUD 1U2HA 1FZMB 1AHWA 4P2QD 2BNQA 4DGIL 3OAYK 1I4FB 4JFPB 5FUOH 4P4KB 3FAXA 5D2NE 1KLGA 5DT1H 3VRJB 3SCMB 1T2QH 1MVUB 3QEQE 4GRLC 2ZPKH 3HNTH 3W9EA 3KR3H 1CIUA 3DVNA 2GSGB 3I6GB 4PJ5B 5GRJH 3B9KB 2AJYL 2PYED 2FJFB 5KSAB 3FO9A 1Y0LB 2W9EL 4WW2C 4I18B 5L8JB 1FG2A 1MLCB 4QTIH 1AKJB 3MPCA 5GRYA 5GZND 5T1LA 3MOBH 3GMOA 2KBGA 2BOBA 3K4AA 2P8PB 2CGRH 1RIUH 1MCDA 3ZT6A 1C5BL 5BZDB 4LFHG 3SKNB 3QDJE 3O3BA 4P9HH 4G7YH 3FONB 4KRPB 3Q3GA 4H5SB 3V0WL 2H3NA 1J8HE 5DXWA 1FFNA 4OF0A 1BZ7B 3UTSA 3QJFB 3ES6A 1MHPL 1MIEL 3RGVB 3QDGD 1F4AA 1VFMA 2DBLL 2F8OA 1G7QA 1U3HA 3PWLA 1A1OA 2ITCA 3D39A 4K2UH 3C2AH 5AG9A 4CVWA 1WF5A 2ZUQC 3ETBF 3QHZH 5DRZB 3FAWA 3BWAB 4KI5D 3MRHA 1FO0H 3GKWL 1K6QL 3C8KA 1KV3A 1YUHB 1NJ9B 3QI9C 2PCPB 3QXVA 3TPKA 4I3RH 3T0ED 5I19L 2B7DT 1ES0A 2FGWH 3HE7A 3VXOB 4OLZL 3I9GH 4FQHA 1R3IL 3OGOE 2XZZA 1A7PL 1Q9KA 4NO2A 4V1DB 4JE4B 4P46A 5B4MC 3O3DB 4WHCA 1UJTA 1W0WB 3GMPB 4QOKE 2QEJA 4TNVK 4NRZA 5I15H 1UGNA 3L3DB 4HBQA 2ADGA 5JO5A 4OGZA 3CXDL 2FX9L 1GAFL 4ZO9A 1IRAY 3QQ9C 4WDIA 5DUBB 2DBJA 7FABH 1DUYB 1JHLH 5HGDA 5C09A 2H2PD 5GS0L 4X5LA 4GKNA 1A6VH 5IHZA 4TSAH 3PQYB 5DMGC 1UM5H 3ALXA 1R3KB 5GPRA 2A0LD 3U9UA 2ED7A 3RZCB 2YKLH 1U8LB 4KDWA 5E2VL 2EH8L 3JWDH 5IB1B 25C8H 2ZKHH 5SV4A 2W38A 5FCSH 4QXTB 1CDUA 1YJDH 5HHNB 4DZ8A 3OX8B 3OGCA 2ED9A 1X3DA 3S3PA 2PN5A 1H3PL 1CIDA 4NHCH 3SKMA 3MZGB 4EN3B 4LVHB 3EGSA 1KEMH 1C5CH 4QLRA 3F7YA 3FQTB 4P9MH 1EERB 4OI8A 4AG4L 1CGSL 3BIBX 3W0WA 1Q72H 1A9EA 4LSTH 2FWOB 1QSVA 5GSRA 3R1GH 1LEKA 1T2QL 1DUZB 2OQJA 3HNTL 3V6FA 2WWKO 3KR3L 3RL1A 2CR3A 5GRJL 4AIZA 1CE6A 3SQOL 2R9HD 4X6CA 4CNIA 2WUCH 4DKAA 5FO9B 3E6FB 3IDIA 2OS7A 4QTIL 5I1HH 3KPLB 3MOBL 1T04B 2VLJB 4ZXBC 3RUGA 3IDGA 4S1DD 3EHBD 3VGHA 1CD1B 4H1LH 3KPQB 2CGRL 1RIUL 5I8OH 2OI9B 3VMPA 1T20A 2KDGA 2MKWA 2ARJA 4RWYL 4P9HL 1I85A 4G7YL 3KPSA 3OBAA 2QSVA 5IB2B 1LWRA 1WUNT 5F9WC 4BQ6A 2Y07H 1HDMA 1RHHA 3DOSA 1S7UA 4U1JB 4RAHA 5L88H 4OCMC 4X6EB 1BQHA 4HV8B 5HDOA 5DVOA 5D9SB 3C2AL 3MX0A 1MUJB 3TBVA 5KVGH 5INDB 5C0AE 5C0DB 3HB3C 1REIA 1SJHB 3QHZL 4FXGB 1MCJA 3OHXA 1FO0L 4HWEH 3ARFD 3GMMB 1O0VA 4KQ4H 4I3RL 4AH2A 4IRZH 4LSQH 4I0PB 3HFML 3MREB 5ITFB 4YZFF 3ZTJG 3ERYA 4L4TB 3WFBL 4EIGB 2FGWL 3KPMB 3QEQD 1JZ2A 3A6BH 4BK4A 3I9GL 4MJIA 4MXVE 3SGKC 3B9EA 3F6IA 4IOFD 2VDLH 2Q87A 3D25A 1MAMH 4F33B 2IANB 4YIQA 3IFNH 2EDEA 2R1YA 4PUBL 5K9KA 2GIYA 2M2DA 4HIEB 1QKZH 5E1HB 3WJJC 1CXFA 4PJDF 4LBEA 2X4SA 5HVGB 3QDJD 1JZ7A 1BX2A 3QPQC 7FABL 3BVNB 1BFOA 1JHLL 3RA7H 2UZIH 1OTSD 4PPTA 1Q1JH 5ETUB 5HHQB 1A6VL 4J4PD 3DI2B 1UM5L 5HYQA 5C0CB 4X6FA 5D7LD 3BP7B 4PJ5E 2YKLL 1TPXC 3MUGB 25C8L 2ZKHL 3STZB 2FL5A 1NMCB 1YJDL 3BRGC 4KK6C 5EUOA 1VGEH 2XN9A 1MCSA 4IMLB 2AKRA 1T0MB 1C8PA 2VQTA 1CFQB 2AEPH 1GYAA 5I1LA 1CLZH 1KEML 3CFEA 5CD5C 5ISZD 1C5CL 4P9ML 3O3UN 3QISA 4I8DA 3J8F7 4CMHB 2G5RA 2A9MH 1Q72L 1I7UB 1U91B 3QUZA 2DLGA 3DRTA 4LSTL 3VXPA 4YGVA 3N1FC 3R1GL 3QA3A 1NL0H 2WBJA 3RWGB 4LRIC 3WL9A 2XACC 4KJYA 3OPZH 1JVKA 5I6XC 2CKNA 1F4HA 2Y4SA 4YDKH 5LG1A 5TGBB 4NZRH 4QOKD 1HNGA 4Y4FA 5E4EB 2WUCL 2E6JA 3MRDB 1PKQA 5I1HL 5JXEA 4JM2D 4R3SB 4XVUD 3IXTB 4Z0XA 2A6IB 4Q0XH 5I8OL 3CC5B 3GRWH 1QTYT 2VZTA 3AREB 5DVNA 5EDXA 5IMKB 4GG6B 2Y07L 2RBLA 4H0HB 4JQVC 3OKMA 4PJXA 4V1DE 4XBGA 3TIEA 2M1KA 1KGCE 4L8DA 4KMTH 3GBLA 4Z8FH 2WP3T 1F97A 5BV7B 1TLKA 4OM1H 6CGTA 5HPOA 1ZTXH 3JVGC 3MXWH 1FZKB 5KVGL 1VKXA 4CBPA 3JUZA 3OSKA 1EAPB 4HWEL 5KN5B 1FNGA 1CDGA 4KQ4L 3R0NA 5ECJE 4JFFB 3S88H 1TJIH 3SPVA 3G6DH 3W82A 5A3ID 2V5SA 2AXFA 3GJEA 4LSQL 5IJKC 3ULUH 2FO4A 5EZOH 1PG7L 4JQIH 3A6BL 3PQYE 5D7JA 3W11D 1UACH 4KRNA 3C5JA 3AB0B 3L7FB 3FQRA 4LLUB 3HCVB 4YBHA 3KPNA 2VDLL 4ZUUB 1MAML 1JYNA 2DIAA 3WLBA 1KB9K 4K9EL 2HT2C 4IRJD 3IFNL 4ORGA 1ZHBA 1QKZL 3SDDB 5EO1A 4LCCA 1YN7A 5GGUB 4QHMA 4F7PA 4KI5F 4HQQL 3PGCA 4Y4HC 5BRZA 2K7QA 3DX6B 4QHNB 4XXCA 3QDMB 3VFGH 1L6ZA 3RA7L 4UIMB 2UZIL 4HUXA 3O6FA 5DD6B 5B38A 1Q1JL 3FT3A 4HF5H 4L8CA 3I75A 3MGTB 5CJXC 5FOJA 5GS2H 1EFXA 4OI7A 2EE3A 4FQ2H 4RFOH 4UI2A 4N1HB 1CDYA 5DFWH 3L3KB 2YPKB 5C0AD 3BMWA 4U6VL 4JCMA 2HTKD 2QR0A 2XWTA 5KBNC 2VLJE 2AEPL 1CLZL 4M9OA 4M1CD 4MA7H 3FB5B 2YD9A 4YEFA 4DVBB 2R39A 3BIKB 5CJBA 3LRHA 4XH2A 3S36X 2E6QA 4UNTA 3O2WH 3ET9F 4LSDA 1JHTB 1LEGA 4P0DA 1VEMA 1E4KC 1ITCA 1NL0L 2B1AH 3DVIA 1R0AH 2W0KA 3MRNA 3PDDA 3U0TA 1LO0H 5T3XH 1G9MH 1PSKL 4YDKL 3WNNA 4NZRL 2Y7QA 4U3XA 1F13A 2D31A 5JPNA 1FGNH 5K59F 4H26A 1HHGA 2A74B 3RP1A 5B21A 1D5ZB 5I1JH 2GEEA 5BQ7B 4GBXA 5E1AB 2J7LA 3QUYC 1E27B 4Q0XL 3S37H 1JI1A 5A16A 4RBPK 3AROA 3LPGA 1HSAA 4P4KD 4YHZL 4L4TE 5SWSB 3SCMD 4MS8A 1LGVA 1P5VA 1W0VB 3MNVA 4UUJA 1ZHNA 4PJ5D 3B9KD 1AO7B 1P2CB 2IANE 4IRSB 5KSAD 3UTOA 4KMTL 4MX7A 4UQ2A 3F5WA 1BEYH 4Z8FL 1UA6H 4OM1L 4P5TB 2WINA 3FN0H 3QEHB 1AKJD 1ZTXL 2FJHB 3OTTA 2NNAB 4QCIB 1OW0A 5DSCB 3CK0L 3KNBA 4DUWA 1JF5A 5TE4H 1Q9WB 2P5WA 4C58B 5JW4Q 3S88L 1TJIL 1T2JA 3G6DL 3P9MB 2F74B 2MJWA 4RFNB 3NOIA 4PRID 3ULUL 5EZOL 1JZ8A 4GS7B 4JQIL 4GW4B 1D5BB 1ZKAA 1UACL 3RGVD 5DF0A 5C0CE 2JLLA 3HI6H 1VFUA 3LKRA 3REWA 1NC4A 5DQ9A 4L8SB 5FO7A 2R0LH 4IDLA 1TCMA 3QULB 3FT4A 1ONQB 2X70A 4YHPB 3DGGB 4M48H 8FABA 1I9JL 3EJZC 4OT1H 2WSKA 2UZXB 3H7BB 3TCXA 3TFKA 3MRKA 1EHLH 1KYOK 4ZUSB 1Q9LB 3VFGL 1G7JB 3V6OA 3MA7A 4X7FC 1C08A 3NCMA 3PDOB 4F58H 1UG9A 4PJ8B 5EWIL 3BPLC 4HT1L 1KB5H 2D7TH 3GJFK 2FECI 4K3JL 4V1DD 4HF5L 3TVMA 2GITA 1KGCD 3NCYS 4HIIA 3ZLQC 4UQ3A 32C2B 4FQ2L 1ETZA 4U6XA 2VC2H 3PWUA 1T83C 5IROA 5MEOB 1TXKA 1G7LB 2LU3A 4QF1B 3QXTA 1UJ3B 1ZVYA 1XCTA 4M62L 5DS8B 5K9OA 1NLDL 5D1XC 5JLZA 2CK2A 4ODWA 2XQYG 4MA7L 2MMXA 4WTZG 4YPGA 1T5WB 2X41A 1INEL 5IV2B 3O2WL 3TV3H 1OT1A 2IH1A 3PQYD 4PJHB 4GG6E 4BQ9A 2EYTB 3NA4A 1A7OH 2CDEA 3MLZH 2Y1VA 3QWOA 2B1AL 5F3BB 1R0AL 1OB1A 1LK3H 1LO0L 1SYSB 5FGBC 4QTHA 1G9ML 5T3XL 1FBIL 3QXWA 5JHLH 3GO1L 1TVBA 3X12B 4EN3D 4OCLC 1NFDB 1FGNL 4BFBD 2YA2A 1Q0XH 1JHKL 4GLRI 1MJUH 3F12B 2GUOA 5I1EH 5I1JL 5CJOH 4FFWD 3K8KA 4KDTC 4QKXB 2F53D 3MRMA 4HC1L 1ITBB 2AJZB 3S37L 2VL5A 1CLOH 1G7HB 2P1YA 1Q94A 1IM9B 3IU4H 3S96B 1N3NB 2GSIA 4MCZB 2XFXB 3QZWA 5FKAA 5DMKA 1FYTB 3GGWB 1HXYB 4KGLA 1R3HB 1TDQA 4EI5B 3CGTA 3VD7A 1BEYL 3BAEH 2GQHA 5F6HI 1UA6L 2ID5A 3FN0L 1FHGA 3B9DA 2VLJD 3HPJB 3MJ8B 3HA0A 3MGOB 4HLJA 2I9LB 4JB9H 3FB8B 1HK6A 5IQ9A 3IS1X 4FRWA 4JM2F 5TE4L 3RVVD 3QDME 4J1UA 4QT5B 3MRBA 3WS6C 4F2MB 3FFDB 1CZ8H 1IQWH 3TEUA 1JTTA 3QG7H 3FL7A 3JV4A 2D7PA 3ARGB 5H8DA 3VD5A 4Y89A 2NY6B 3SE3A 1KIPA 2BSSA 3HI6L 1EO5A 4JY6B 4EQ2A 1NGPH 3UJIH 4KTYA 3RFZC 4ZAKC 2HMID 2OTPA 3KPRA 2R0LL 3BXNA 3VXRB 2O61A 3MJ9A 4EUPB 2BP3A 3QH3A 3C5ZB 4G6AD 4OKDA 1XGRB 3HZVB 4M48L 4S2SA 3K3QA 4FTVB 5FYJL 4OT1L 4DOHB 1EHLL 4HH9B 4I0PD 1A1MA 4L4TD 1QLRB 3S7GA 2HFTA 1SMAA 1H5BB 5A40E 2MCG1 2D7TL 1L0XA 3QSKB 5GSVA 2IAND 1CDCA 3DMMB 4HKXA 4ZOEA 5LGJA 3Q0HA 2HN7A 3MRJA 4C56A 5JOPE 4CADB 1UXWA 3OG4B 5J89A 4X4YA 3TF7C 5D71H 2V5TA 5HHXH 1F4WH 1MFAL 2ZOLA 3NIFE 1RK0B 5HGHB 1GHFH 3U30C 4PGEA 1RZFL 4D0CB 1LK2A 2D7MA 1PZ5B 5SWSE 2PTUA 2VXQH 4H1LG 1CDJA 3OB8A 4AM0A 1OGAA 5C0CD 1A7OL 4L8BB 4TVSa 2QADC 3MLZL 4M8VA 1U93B 5GS0D 3FQUB 1QFWH 2X4NA 1Z9MA 2ARWA 3MR9B 4HCRH 3PHOA 5JHLL 4NDMB 3U0WL 3UTTB 1EMTH 1DQDL 4NHUA 2PW2A 5J9PA 1Q0XL 4HK0B 3HRZB 2FCBA 5LXGL 5I1EL 1I3VA 1DE4A 2JJSA 5EU3A 5JDSA 5D7KD 3UBXG 5BS0A 1RJYB 3DNKA 5IIEB 3V4PH 4NPYB 2IFGA 5HJ3B 1T21A 4OLYH 5I71B 5FK9A 3NFSH 2RAMA 1DP0A 4MXVF 5F93C 1WCBA 2AAVA 1ORSA 4O2FB 2G2RA 1P1ZA 1OP3K 1RIVH 4JRYB 5DD5H 4EVNB 1LP9B 3VD3A 1MWAB 5E5UB 4PFEA 2R56H 2NX5A 3BAEL 3SDCA 2L0DA 5F7NC 1XIWC 3W5NA 2DLTA 3EOAB 4QNPE 4JJ5A 2V2XB 4O02H 4AIXA 4OZFA 4CVXA 1HZHH 1JWSA 1OSZA 2ATKB 2BZDA 3ARED 2ZNWA 2H26A 1LO4H 4MGXA 1K8DA 2C1PA 4XP1H 2V2WB 2AJSL 1EXUB 3D48R 2VDMH 5TDNA 2G5BA 1AD9B 4U3HA 3AUVA 1ZA6B 5FAAA 2PXYB 1J0JA 5FUZH 4DN3H 1EJOH 3I02A 4LK4A 4DKEH 2L7UA 4U1SB 5IBUB 3NZ8A 1NGPL 3UJIL 3DVGA 4UAOB 3DBXB 2B39A 4WUUA 1HHKB 1FSKB 5T3ZH 1U2CA 4GRWE 5B3JE 3NFNA 3T8XB 4RISH 2BNUA 3VDCA 4LCIH 2E7LE 1A47A 1A64A 4JFFD 3P4MB 4I1NB 4J7RA 4NN5C 3TO4B 4JRXD 2EKSB 4YBLC 5D96C 1S7WA 1FQ9C 4ODHH 4PJHE 4NNPH 3M17A 4Z77B 3QIBA 4QHKJ 3K8LA 1IL1A 2BJMH 4P5KB 1YEHL 5IM7A 3LDBC 5A1AA 2UY6A 1H3VA 5DFVC 3BISA 4H0IA 2IBBA 3PWNB 1DCLA 1QYGH 3K74B 3SDDD 2VITA 1NFDE 1OAKH 1P4LA 3L3GA 3T0VA 5D71L 5HHXL 1OPGH 1I1AB 3SO3B 1F4WL 5TQ2H 3QDMD 4E5XA 3DYPA 4F3FA 2J2ZA 4PRAA 1Z9OA 5E6IC 1GHFL 1Y6KR 4OF6A 2VSDA 2NCMA 3MLPA 4MXQA 3UX9B 2WWMC 5CMAB 4RNRA 5M94B 2VXQL 5EH1A 5TH2B 1HYRC 1T3FB 1J0ZA 4F7MB 4LSUL 5LQBL 5C86A 3DURA 4R90H 4PREA 4NKIH 5TDOA 3IS0X 3TYFA 1AHWB 3SBWA 4S10A 1FYTE 4YO0B 3H9YA 3O9WB 1QFWL 4FOMA 5AWNH 3BJ91 1DSFH 2EDKA 4HCRL 1V3KA 1EMTL 3W9EB 5KS9A 3MGAA 2NQCA 3P73A 3I2CL 3RQ3A 4HKJA 2ZP0T 1VDGA 1WBXB 3FO9B 1N0LA 1AGBA 2YMXH 2EE2A 1T1XA 2VTFA 1FG2B 5T1LB 3ZE1E 2XA8H 5DLML 3GMOB 4JKPH 3V4PL 4K3HA 4LOUC 2BOBB 4MJ5A 1A5FH 4OLYL 5DRNA 3NFSL 5J57B 4HS3A 3CVHA 3O3BB 3MRRA 3UZVB 4XMPH 4DKFH 5F1SA 1RIVL 4F9LA 5JOPD 4U1MA 5DD5L 3L5IA 4HFUH 1UWXH 5I66A 3Q3GB 2H3NB 2VABA 4FABH 1QSFA 3ULUE 2R56L 3B3IA 4QGTA 3UTSB 3VXRE 5DO2D 3ES6B 3K80A 3DVFA 2AVGA 1VADA 2I60H 4UTAL 1U3YA 4X8XA 1G7QB 2XXMB 2ITCB 1G6RA 1RAMA 1MSPA 4FTVE 4DOHE 2FEEL 3HR6A 1HZHL 5T33H 1AD0A 1II4E 5TJWK 2PYFA 5SWSD 2Z0BA 2ZWLT 1LO4L 3MRHB 4P57A 4XP1L 3SY0A 3WBDA 3V7AE 4QXUH 2V2TA 4ZNCD 3C8KB 2IAMC 4U1IB 1HXMA 3AY4C 1EA9C 3DROA 1AO7D 4IRSD 5FUZL 4DN3L 1LQSR 1EJOL 5E4IA 1LMKA 5EA0H 5I9QB 3HE7B 4FQHB 1FC1A 4M6MH 4JFZH 3ALWA 3JTTA 4UTBL 3S35X 1Q9KB 4NO2B 1MY7A 5T3ZL 2GY5A 2RJMA 4P46B 2DQIH 5JTWA 2AXJA 4LARH 4N1EA 4JO1H 4KI5C 1XZ0A 2EE6A 4NRZB 3WDIA 4S0TD 5HHMA 2ADGB 5JO5B 1YEFH 3ARYA 3AMKA 1WIPA 3MFFA 5J7CC 2I5YH 4WDIB 4NNPL 3SGJA 4BQ8A 2P5EA 2X5PA 1I8LA 5HGDB 2J3SA 5C09B 3FZUD 4GKNB 4PP1D 4AEHH 3OAZK 4XGZB 3UTTE 3U9UB 1QYGL 1OAKL 4J3SA 3DUUA 1OPGL 5T3XE 1MHEA 4DZ8B 3OGCB 5TQ2L 1QFWM 1K85A 5CKAA 1UB6B 2CH8A 2YD7A 4RRPG 3SKMB 1SYVA 4Y1AB 4PJ8D 5A2LH 2QSCL 3EGSB 4FXKA 1NAMA 3F7YB 4B0MM 2FIRT 3MQIA 5GS1A 4R90L 3VRLE 4NKIL 2HTLD 4JRYE 4ZQKA 1LP9E 1A9EB 4K8RH 1EEYA 5GSRB 3IU3B 3NGBC 5AWNL 1DSFL 1LEKB 2OQJB 3V6FB 3KHOA 4LPUA 3RL1B 2Z4QA 2PTVA 4AIZB 1CE6B 4NRYB 4X6CB 4W6YB 4CNIB 1A6TA 4RCAA 3KWWA 3IDIB 2VLKA 3FO1A 3ARWA 2XA8L 3RUGB 2VO5A 3IDGB 4JKPL 1ZT1A 2C3WA 5D5MA 1A5FL 2EIDA 4M93B 1QFHA 1T20B 2ARJB 3JZ7A 4DKFL 3GNMH 3KPSB 5F72S 4UIKH 4HFUL 1IGYB 2AS5M 4FABL 1HDMB 1RHHB 3LZFH 1X5HA 3WN5A 4X80H 2R9HC 2UVEA 5GJTH 1S7UB 4L4VA 1NDMB 4CVUA 3O4OB 1BQHB 2I60L 4M5ZH 4J6RH 5D1ZC 4X9HA 2L4OA 1FLRH 4M61A 3TBVB 5T33L 4XAWL 4KK5D 3MLRL 2AQ1A 4JGJA 1A3RL 3OHXB 1IM9D 3MRCA 4QXUL 2VR5A 3ARZA 5FYJE 1UCBH 4AH2B 3RPIA 3U82B 1X5FA 4EI5D 2ZUVA 5EA0L 1KBGH 5KANG 2FD6H 4MJIB 2DIJA 4M6ML 4JFZL 5CLTA 3D25B 1U8JB 5A2JH 1IEHA 4YIQB 1LO5A 4LARL 2R1YB 4LDEB 4JO1L 3X17A 4R4BA 1H3UA 1YEFL 2IBZX 4LBEB 5EU7E 3SHSA 3UDWC 2X4SB 2OMNA 5D2NC 1VCAA 4UBDC 4GG6F 2I5YL 3ARGD 1KF9B 1BX2B 2CIIB 3OKKA 1BFOB 5CFHA 2BNQE 3IDUA 3I85A 1JPST 3ULUD 2NY5H 4KUCD 1YEDA 4PBVC 5HYQB 2EICA 3S98A 2ZCLH 1GL4B 1Q38A 4X6FB 3C5ZD 3VXQA 1C12A 1JV5A 1FL5A 4WU5A 4MNHA 4MQTB 3WLWD 5LVEA 5EUOB 4G6FB 1LE9A 4KKLD 2XN9B 2AKRB 3LKPA 1P69B 5I1LB 3T09A 2DICA 3CFEB 4CMMA 5CGTA 1OTSC 1VERA 5FXCH 2OTUA 3QUZB 4KJQD 4K8RL 5D6CA 4YGVB 1J10A 3UTSE 1YMMB 4KJYB 1VEPA 3PXJA 1AI1H 2BY1A 1FNHA 5GS2D 5E99H 3D39E 3L7EA 1MRCH 2OK0H 1I1FA 2ZSVA 4LP4A 4LLDA 4MQSB 4PRPA 3S5LG 3WKML 1J5OH 1PKQB 2FBJH 2DJ4A 4XP5L 2J8OA 3LQAH 1PY4A 3QQ4A 5J11B 1T03L 1WT5C 2PNDA 5EC2A 1MJJA 4Y2DC 4NZUH 5TFSH 1S78D 4WFEE 2H9GA 3QPXH 5IVXA 2ZCKH 5DJDA 2OP4H 2DQGH 1IC4H 1T7WA 2Z93A 4UIKL 3QWRD 3UTTD 2YRZA 3SOBH 1B6DA 3P2TA 2O5YL 4HIHA 2LFGA 3LZFL 4LLVA 3F8UB 5GJTL 3OKMB 4PJXB 1IGFH 4PJBB 4ZODA 4XBGB 1HQRA 3D69A 2VR4A 5CSZA 5T3XD 3TIEB 4L8DB 4XP9H 1A6ZA 2J8UB 1NMAH 4M5ZL 3S4SA 4J6RL 4NQTA 2P45B 4JM2C 1KCLA 4JZJA 4XVUC 4OAWA 5ESAA 1FLRL 4TVPH 1VKXB 4NN7B 5IK3A 3HE6B 1FNGB 1F3JA 4XWGH 3HRPA 4DFIA 5F8QC 1UCBL 4JRYD 4X9BA 1K4DA 3SPVB 5C09E 1P84J 2AXFB 1RZ8A 3GJEB 3WEXA 1KBGL 3CDGA 2OJZH 5D7JB 2FD6L 3MJ9H 3C5JB 3BSZL 3FQRB 4OZIB 4CL7A 1M71A 3KPNB 4HG4J 2Y23A 4R6UA 3WLBB 5DI8B 2DJSA 2DS4A 2W92A 1WICA 3EDJA 3NIFF 4ORGB 1WAAA 1P84K 5E8DH 3CFDA 1ZHBB 1NEZG 5GGSY 2KQMA 3MO1A 5EO1B 4LCCB 1YN7B 4GKZA 1WWBX 1ZGLM 3RAJH 4QHMB 4F7PB 3PGCB 5KW9H 5BRZB 4HG4K 3MRIA 2PXYD 5I1AA 3PHSA 2VKXA 3D0VA 3W0WE 3WFZA 5DHVA 3VGAC 3P0YH 1AE6H 1H15B 3BP5A 4HUXB 2AK4B 1V05A 3S34H 3DHJA 2NY5L 4PRBA 3H3PH 2ZCLL 3RIFK 4WFGD 3WNKA 2YR3A 3I75B 3MROA 1EFXB 4RX4D 2CLVA 4URTB 1JGDA 3CX2A 2XZAL 4ZD3H 1ADQA 4ZOBA 4X6CE 1DBKL 1I9RH 3OG6B 5FF6A 3TO4D 2J5LC 5F9OH 2QR0B 2FHCA 1Y6MR 5HDBE 1S3KL 3RUGE 4U1KA 1KCKA 3W9DB 3T77A 1QR4A 3KPPA 5FYJD 1F5WA 4M7JH 2JK5A 4Y5VA 1ZGLP 3IVKA 4XH2B 4WHYH 3PHQA 1XAUA 5F6IB 3KPSE 3PV7A 4DCQA 1LEGB 1CTOA 2D7NA 3VXSA 5MP6H 4OKVB 4APQA 3OV6A 3MRNB 1AI1L 1JIBA 4LKCA 1MFNA 3U0TB 1I1AD 1CQYA 5GHWH 5HI5D 4QNPF 5HYFA 5DQJA 2F19H 2Y7QB 2HTKC 5E99L 1MRCL 3WCYA 2D31B 4K7PY 1U6AH 1PG7W 5JPNB 2FR4B 4W4NA 3ZKXB 4TUOB 4H26B 4M1CC 1J5OL 1HHGB 2FBJL 5IHLB 2E7HA 3LQAL 1CD0A 4GBXB 4MVBC 4GUPA 4O00A 3WUWA 4D3CH 2R0WH 5A16B 3O9WD 1S7TA 1HSAB 3PGDA 4WU7A 3QPXL 2ZCKL 2DQGL 1IC4L 4MJIE 3SOBL 3MNVB 4UUJB 4NRXA 4F15C 4TNWF 1E4WL 5HYSA 5IVNA 3EO0A 1S9KC 1IGFL 4LLWA 3RDTA 2DQUH 4OZFH 4XP9L 3RHWF 4MX7B 4UQ2B 3F5WB 1NMAL 3V5KA 1RMFH 1QLEH 5KSBF 1I1YA 2WINB 4XCCH 4JHAH 2DF3A 4X7SH 5HD8D 1AQDA 3VFSA 3L5XH 3KNBB 4I3GA 4PJHF 4JQXA 4YWGH 1KENL 4MAYA 3SCMC 3VFUA 2QQNH 2CJUH 2YD2A 2P5WB 3GHBH 1OQOA 2A83A 1R5VA 2R0ZH 5B3NA 1MQKH 1A8JH 1MF2L 3MBXH 4Z78A 3B9KC 5K9QI 2RHEA 3B4NA 3UTSD 2XKNA 5KSAC 4Y0GA 3MJ9L 5FM5O 3FQWA 4I18C 1JP5A 4OLWH 4KMLB 5KOVC 3GI9H 3G6AA 1S5HA 2UVFA 3LKRB 3REWB 1NC4B 5DQ9B 5FO7B 5EUOE 5E8DL 2YPLA 2XN9E 2NXYD 3FT4B 2X70B 1P9MA 2YA0A 3FKUS 3RAJL 3ALPA 4KRPC 2OL3H 5GRVL 3ZKSD 3C08L 4WFED 3CNKA 3MA7B 4NQCA 3HE7D 4P99A 3RGVC 3HC4L 1AE6L 3TC9A 5JOFA 4NC2B 4P3WA 4XVTH 1KFAH 3BGAA 4YGAB 3IF1A 3R8QA 2VXVH 3H3PL 3QHTC 4JDZA 1XF2A 3TVMB 2GITB 1EUTA 5I73B 4G8FB 4ZUWA 1HH6A 1P4BH 4HIIB 1LO2H 1ETZB 1N6VA 5DRXA 4ZD3L 1H0DA 1GC1C 1KOAA 1I9RL 1TVHA 1JNNH 2OSLA 1PKQE 5F9OL 3ZE1F 1XCTB 4L3AA 2LVCA 5K9OB 2F9BT 2MTPA 4OLEA 2RFXA 5JLZB 4ODWB 1UEMA 4P2RA 4M7JL 5C09D 4GOSA 4YPGB 3G6JA 3IFPA 2IH1B 1T7XA 5CINH 3ULUF 5C9KA 5MP6L 4KUCF 35C8H 1NFIA 4IM8A 3FO2A 3QWOB 2DD8L 1OB1B 2LE9A 3T0EA 4JLRB 1ZLVK 2F19L 3MV8A 3OF6A 4RMVA 5EC1B 1TVBB 1I7RA 4CN6A 1U6AL 2CPCA 4FFVC 4Y1AD 1NC2B 5F96H 4MQXC 4JVWA 4LL9A 2GUOB 2IPTL 3F58H 3S36L 3CVHH 5IG7B 1W72H 4L3CB 2XIDA 1A6AA 3QEUA 4D3CL 2R0WL 5F1IB 2VL5B 3D0LA 2FBOJ 3T4YA 3RZCC 1Q94B 3EAKA 5F21B 3RIFF 2GSIB 2AQ3A 1U36A 3QZWB 5FKAB 1TZGH 5DMKB 3BN9C 3BW9A 4EN3C 2DQUL 1RZJC 4YJZL 1RMFL 1QLEL 4U49A 2A2QT 1MCOL 4XCCL 4YC2B 4FFWC 4JHAL 3OMZA 1ZSDA 1OSPH 3U46B 4OBSA 4X7SL 4OCRL 1FGVH 4XZUA 3L5XL 5DZOA 5IQ9B 2H2SD 3MLVH 5BRZE 1J88A 4YWGL 4Y4KA 2BRQA 1RJLB 3BKJH 4J1UB 3ESVF 3GHBL 3UYPA 1FPTL 3KPSD 4WO4A 2R0ZL 1MQKL 3MBXL 4BFIA 5FHAH 3LEYH 4PV9A 4JZOA 3JV4B 1FRGH 2IQ9H 4PJ7F 4FHBD 4OLWL 2SEBA 2BSSB 5I1DA 4ZYKA 5IMOB 3GI9L 3MZTA 3KPRB 1IAOA 1Q9OA 3BXNB 2O61B 4Q2ZA 4WEBH 2OI9C 3CFJB 5CP7A 3QH3B 3TN0B 3KPTA 4PTUA 4BUHA 4OI9A 5KZCD 2OL3L 2XICA 3EYOA 1O7VA 4XC3L 2ADFH 3I3BA 1A1MB 5F44A 4O58H 2KQNA 3IFLH 1LP9F 2P7TA 4MJID 4U7MA 4K7FA 4XVTL 4GFTB 1KFAL 4N68A 2X4OA 5GSVB 2HT4D 2HMIC 1FCCA 4RGNB 1S9YA 4HKXB 5LGJB 4V2BA 1P4BL 1LO2L 2HN7B 3MRJB 4G9FA 4W70A 1UXWB 4OF8A 3SKOA 4FG6D 4Z7WA 5GGTA 5T3ZD 4OD3H 3P11H 4G80A 2ZOLB 5A2IH 4KRLB 5HGGS 3X11A 3QYCA 2EDRA 4WI3A 4OCXH 4PGEB 1LK2B 3MA9H 2X4TA 4PLNC 4JANA 5ESVA 5CINL 1OGAB 4ISVA 3LS5H 5E8PA 2FEDD 3ARFA 1CFVH 4BQBA 1V5JA 5K9JH 1XGYL 2YZ8A 1A0QH 2P4AB 1RY7B 2X4NB 3OKDA 3TCLA 4M00A 1PD6A 4G6FD 3V0VA 3PHOB 5EPMA 4ZPVB 2XN9D 1YA5A 1KTKE 5F6HJ 4AIOA 1JPGB 5F96L 4NHUB 3S8WA 1A7QH 5ALCH 5EOQH 3MV11 5J9PB 2DIBA 2JJWA 2V6HA 4JFEA 2OXHA 1DE4B 3IDJA 4Y5YA 3CVHL 5EU3B 5JDSB 2DQCH 4NM4H 1T0NB 5BS0B 5DJYA 1W72L 2P5WE 3QUZD 4A6YH 2ILLA 4OFPA 2Q8AL 1T21B 4OLUH 3GBNL 5FK9B 1YMMD 3D85A 4MXWL 1WCBB 4M1GH 1ORSB 3LSOA 2BNRA 2G2RB 1IAII 1TZGL 2BSRA 5B8CC 5EFIA 1LEIA 3GSNH 3M45A 1WFUA 2NX5B 3SDCB 4J4PA 3HZKB 5CAYB 4CMHC 5JXED 5CZXC 3MSPA 1OSPL 4GXUM 4JJ5B 5D7LA 4MDJA 3UCRA 1FGVL 1ZLVH 4OZFB 4CVXB 1JWUA 3MLVL 4LLQB 1JWSB 1OSZB 1QACA 3BE1H 3BKJL 2WANA 3V6OE 5J13B 2H26B 4WY7H 4BZYA 1K8DB 5T1DH 2EC9U 1QSEA 1M7IA 3STLA 5TDNB 4L5FH 3E2HA 5SX4I 5ISZA 5L9DL 2G5BB 1D5XA 1KPRA 5E4EC 3ZDXE 1NUGA 3RPKA 3I02B 2IQ9L 3D2UA 4P2CG 4XVJH 2OZ4A 3NZ8B 5DJZB 3DVGB 1YQ2A 1JRHI 4F37F 4WUUB 4PJAA 4CAGA 1U41A 2NZIA 3HE6D 4WEBL 4YXHH 3NFNB 1KIRA 4LQ1A 5GGSA 4FP8H 2BNUB 3JWOH 4G8IA 2PTTA 2JJVA 3MBEA 2ADFL 4J2XA 3LKQA 1A7RH 2HFFA 4O58L 3KYKL 5EZLA 3IFLL 4BA8A 4N0CC 1MEXH 2DL9A 3VH8G 5D7JD 1S7WB 3DRQA 3M17B 3QIBB 5D1QB 5BV7C 1IL1B 2OTWA 5IM7B 5EN2A 1BWWA 5CP3H 4ZOAA 3CFCH 4JZNA 3VGGA 1D6EA 4N9GA 4WI2A 4ALAH 2YUVA 3S3JA 4ERSH 1KN4H 2VITB 4NO5A 3IDNA 1BD2B 4P5MA 4D0BA 3GMRA 1GZPA 4OD3L 2XQBH 4PGBA 2F54D 3P11L 5BRZD 1B6UA 5EU4A 3RJDA 3V52H 4E5XB 4F3FB 4PRAB 4ZXBA 2ICEA 4NSKA 2XT1B 2IMNA 1PYWA 2AK4D 3HPLA 2VLRA 3MA9L 4RAVA 4RNRB 2WBKA 3DURB 3MNWA 1BGXH 3LS5L 4PREB 1P7KA 3TYFB 5TDOB 3C8DA 1CFVL 3Q5OA 1IKNC 4NWUL 1A0QL 1FNLA 1L4IA 3ZE0E 3ROOA 1BLNA 3NTCH 5KS9B 4YXLH 4NO3A 2EIEA 3P73B 1Z5LA 1Y18A 1A7QL 4HKJB 5EOQL 3BUYA 4OFYD 2UUDK 1CFBA 1AGBB 3FFCD 1N59B 2BVYA 4IRJA 2R69H 1T1XB 4Z9KB 4BFGA 2DQCL 1EJ6A 3F65A 5ESQA 4JDVA 4S1QH 1XEDA 1X6NA 4MJ5B 4OLUL 4LEXH 5DRNB 1CCZA 1KTDA 3GB7A 4HS3B 3CVHB 3MRRB 1RZKH 3FHQA 1W72B 5A2KH 3H6JA 4U2ZA 4YDJA 4U1MB 3P4OA 4K8RD 5I66B 3KPRE 4KQ3H 3B3IB 4Y16B 3VW3H 3TLRA 2R1WA 1VADB 4GLRH 4GBXD 5AG8A 1J1PL 1FZOA 1G6RB 4LIQH 3BQUA 3ZKMD 3SJVA 3A6OA 3QUMH 4MD5A 4HWBH 4ODUB 2PYFB 3R06A 2YEZA 4MS8D 4P57B 1RI8A 5BXFA 2V2TB 4UV4H 2Y5EA 3RX7A 3ZYJA 1HXMB 3LV3A 3HG1B 2VLLB 4HXBH 4RGNE 4E41B 5DO2C 4C83A 4MA3A 2QHLA 4XVJL 4C56E 4X6CF 2BMKA 1U8IA 3JTTB 5FECA 2HG5A 3O41A 4YXHL 3OJMB 3RUGF 2C3VA 4FP8L 4RMRA 1XZ0B 4G6MH 2P5WD 1DQJB 1ZS8A 1KCGC 1SY6A 3LRSA 5HHMB 4NGHL 5DHVH 5MI0B 1E28B 1A7RL 3MFFB 4ODXA 4IRSC 2NYYC 1MEXL 4HS6A 5C0IA 4J3UA 4R4ND 1OGAE 3V0AC 4P5TC 2QQKH 3MCLL 3QBTB 4WHYG 2P8MA 3FQNA 5IBLC 4ZDHA 1NC4D 3CFCL 4P4KA 4GW1A 1KCUH 4HK3J 2QQQA 4ODVL 4ALAL 4MJ6A 4ERSL 1KN4L 2DTMH 4NHUE 5FO8A 1AH1A 1DLHA 5C92A 5JQ6H 2XQBL 3DUUB 4JKWA 2FJFA 4RFNC 1MHEB 5CILH 2WP3O 3V52L 5I8KH 4GS7C 5BS0E 1MJ8H 1F3DJ 1AKJA 1SYVB 1ZVHA 5IESH 5M95B 2DQJH 1NAMB 1IKFH 1KXVC 3KJ6H 3VMOA 3OB0K 3DYMA 5I75B 3TVMD 5GS1B 3RZWA 4H20H 4L8SC 4PP1C 3ZHDA 4ZQKB 4KTEH 3QWQB 2WIIB 4NKDA 1EEYB 1KSRA 5ANMB 2QSQA 4PRIA 4MMXC 2NX5E 3DHMA 12E8H 4K9EC 3NTCL 4YXLL 2Z4QB 1URLA 5DC9B 4RDQG 4NYLA 4PJ8C 3X13B 3WIHH 4XB8A 1A6TB 3KWWB 2R69L 4U6HA 2E9WA 2VLKB 3WJLC 1JGLH 5DRZA 4IOIA 3BWAA 3BGFB 3UMTA 4X98B 2HTLC 4LEXL 1NJ9A 2HJLA 3BT2H 3G9AB 5IJKA 2VERN 1S5IL 1RZKL 1UJ3C 3EYVA 3VXOA 4I9WD 4R0LA 1NC2D 4KQ3L 5EUOF 4PR5A 4WUUE 3WN5B 3WE6A 2E7LC 5IFHH 4MB5A 4L4VB 1XGQA 3O3DA 1MPAL 4LIQL 3GMPA 4WWKD 4M61B 2JCCF 3NN8A 4HWBL 3QNZA 3VG9B 3EFDH 4UOW1 3HI1A 1ZT7A 3MRCB 5DUBA 3ESUF 4PTTA 1L9NA 4HXBL 3RPIB 1I8KA 2BY2A 2N4IA 5HTSA 3PWJA 4PY8I 1L7TH 1DEDA 3C09B 2E9BA 1OM3L 2N7AA 2YD4A 1YEGH 5F3HA 2KKQA 3BGMB 1X4YA 1I7TA 1RJCA 4DKDC 5I1KL 1LO5B 4OF7A 5HI4C 1U42A 4G6ML 1BHGA 2EEDA 3CDCA 4R4BB 3NVQA 1FLTX 5IF0B 3FQTA 3MUJA 3TJEL 3OKKB 5GZOC 3TZVC 2QQKL 3ARQA 3UO1H 2F53A 4N0RA 4PJXF 4PJBF 1T7VA 4GJTB 3IJHA 2J8UF 3KPRD 3CLFL 1RIHH 2QJDA 1YEDB 1KJ2A 4FQXC 3V6BR 3TN0D 5KS9E 3D5OF 2DTML 5T5FH 3VXQB 4M6NH 1JV5B 1FL5B 5JQ6L 5I8KL 1LE9B 4MNGA 1MJ8L 2UWEB 1OAXH 3LKPB 4ZMAT 2XPGA 3QG6B 2DMCA 5IESL 1H3WM 2DQJL 1WVZA 2NY6C 4LP5A 4XP4H 6FABH 4CMMB 1EHAA 3KJ6L 3KPQA 2H6PB 1I3GL 4RGND 3ULUC 4H20L 4OZIF 2F15A 5T1KA 4LCYB 4UDTA 5DTFA 3DPBA 1SJVA 2RR3A 4KTEL 1P6AB 1QBAA 1L0QA 5D6CB 4OZHF 2PO6A 4FZEH 1QSFE 2XA3A 4CDHA 12E8L 2MCPH 3RVWD 4MB4A 4HXAH 3WLWC 4PRHD 1PG7X 2O5XH 4HULB 4PGDA 4UINL 3CZFA 4X99A 3L7EB 1I1FB 2ZSVB 4LLDB 3WIHL 3SGDI 1MUJA 1ORQA 3BPNB 5JA9A 2Y25A 1JGLL 3DMMC 3QQ4B 1OGAD 1UKQA 5EC2B 4KJQC 1MJJB 4XNMB 3BT2L 3L6FA 5FYKH 3HAEH 1CGWA 5FKPA 1AR2A 5IVXB 2H9GB 5HDQH 4IJ3B 1NGXA 5DJDB 2CRZA 1WWCA 1YQVH 4TOYH 5BVJA 2Z93B 2RGSA 3NAAH 5TE7H 3P77A 4PIRF 4HIHB 4JPWH 5IFHL 2C4XA 3D69B 1HQRB 4F33A 1A6ZB 2BOCA 3QHFH 2W0LA 5BMFH 3QXUA 5BS0D 1FE8H 1F3DH 3C6LA 1YNLH 2GI7A 5ESAB 4OAWB 5HHME 1WTGT 4CU7A 1CICA 3O45B 5IK3B 3EFDL 5HHVH 3H7LA 5EG6C 1S78C 5D6DC 5D8JH 2DRUA 1F3JB 2HKHH 1UM4H 2P5EE 4WTXA 5CEZL 4PGZA 4NUJA 3WEXB 3MACH 1HCFX 4LPYA 4W4OC 2NX5D 1MRFH 1P6FA 5ETUA 5B22A 3L3HA 3SDCD 3CDGB 1L7TL 4KHXH 4KI1A 3RVXC 4HMCA 3KJ4B 4F7EA 4HFWA 3BP7A 1YEGL 4XPGH 4GQPH 1AGCA 4Y5XB 1FVDB 4RFEA 1FFRA 3CFDB 5HVWA 3CSBA 5HGBA 3NCBB 2FX7H 1R3JA 1GGYA 3MO1B 1CFQA 3IAPA 4GKZB 1CXLA 3MRIB 2LTQB 5I1AB 1T6VN 3D0VB 2F8XC 2VDQH 4LAQH 5DHVB 4X8JA 3BP5B 1HN1A 4PRBB 3CVIH 4WUUD 2NY3B 3E1F1 5DDHA 1ZLUK 1D9KD 1N4XH 2E5EA 3L3JB 4K55A 5T1MA 3U9PH 5I1CH 3MROB 2GK0A 2BFVH 4PRNB 5DJXA 2CLVB 1JGDB 4M6NL 1YY8A 5JA8B 2NY0B 5FF6B 2VLKE 2WV3A 2PXYC 1OAXL 3QIBD 6FABL 4XP4L 5D1QD 4PRDB 5D5ME 3KPPB 4MNQA 3T77B 3ULSA 4Y5VB 2JK5B 4UAOC 4GQ9L 3IVKB 4QHUA 3MV9A 5DURD 3PHQB 2WUBH 4WTZA 4DCQB 4CGTA 4RZCA 4FZEL 3VXSB 4XP6H 4R8WH 4APQB 1BD2D 4MA1B 4L4VE 3IDYB 1C7TA 1E4JA 5DGQA 2O5XL 3TO4C 5DQJB 4UT7H 1OQXA 3SEPA 4HH8A 5I74B 5FDYA 1KJMA 1U8OA 1DBJL 4NBYB 2V5MA 3CSGA 5CJ5A 1L9MA 4Q9BA 1OTUD 4GUPB 3WUWB 3REVB 2B1HH 4WJ5A 4JFFA 5FYKL 3WKNA 1WFNA 3ZDXF 3GUTA 2I24N 3PGDB 4WU7B 5HDQL 3P0VH 4JRXA 1YQVL 4TOYL 1I1AC 1FO0A 3U2SA 3ECBB 3NAAL 2PR4L 5TE7L 4QRUB 4IIQA 4NRXB 1WC7A 5HYSB 4JPWL 3UJTH 1OWRM 3EO0B 3ARBA 4LLWB 4LCWB 3EIFA 3RDTB 2A6JA 5EU7C 3V5KB 3T1FA 4P2OA 4XC1H 4C59B 1YEEH 4NFDA 3QIUA 2YD8A 4J8RA 1DQMH 1YNLL 5LBSH 1AHWC 2FHBA 1AQDB 4NQXA 3VFSB 2R2EA 5HHVL 2XKUA 4C55A 2K3TA 5CSBA 3DX6A 5D8JL 4MAYB 1U8HA 1B0WA 1UM4L 3IRZA 4OGXH 4AJ0A 4HKZA 4M3KB 4Z78B 3LEXA 1BP3B 4PDCE 3MACL 1MRFL 2XKNB 4MA8H 4Y16D 4KHXL 3ZT7A 3WO3B 4TQEL 3FQWB 3VRIB 1OAZH 3E0GA 2QHRH 1GIGH 3G6AB 1S5HB 4XNQA 4XPGL 5HD8C 3TF7A 5BW7A 3RIAK 2ICES 2YPLB 4U6YA 1NSNH 1UB5A 1GJIA 3UTZA 3ZTNH 4DTGH 4GG8A 1G7IA 4KVNL 5I2IB 2E27H 1IZJA 3HG1D 5L8LB 2AW2A 5CJQH 4E41D 4NQCB 2VJXA 2VDQL 3CUPA 1JGVH 5JOFB 1U3HC 1M7DA 1F6FB 3S37X 3IF1B 1XF2B 4JDZB 5IEHA 1LNUA 7CGTA 1N4XL 1HH6B 5I1CL 3U9PL 2BFVL 1HYSD 4YFLI 3MUY1 5DRXB 1RU9H 4OIAA 1H0DB 4PRPE 5HHMD 1TVHB 2ESVA 2OSLB 1QG3A 4HJJH 3RWHB 2CIKA 4OB5L 2RFXB 5E1AA 5I9QC 2EYSA 4P2RB 3CXHJ 3IJYA 2AXGB 3G6JB 2WUBL 3IFPB 4P46C 5GRXG 4JFQA 2APFA 3LPFA 4H1LA 3HZMB 4XP6L 3Q1SH 3FO2B 3W5MA 2MQ3A 3TWCH 3GSWA 4P48A 3T0EB 2AV1A 3MV8B 4UT7L 4IS6B 3QNXA 3S3SA 1I7RB 4DWHA 5JIHA 3PL6A 4PYGA 4Z7UA 5FFLA 4YR6A 3V4VH 3VFWA 1T22A 4OBRA 4FQCH 1A6AB 2B1HL 5GIRA 1U8QA 4Q9CA 4TTGA 3UBXA 4G6JH 3D0LB 2NY4B 3T4YB 4PJFA 3P0VL 5E2WH 4JY5L 5GRUH 3RI5F 1I3UA 1MCEA 2Y6SD 3FB7A 5KVEH 2AP2A 4XBPA 3BW9B 3UJTL 5ACMA 4U0QB 5L0QC 1NGQH 2X6MA 4MZ3A 1WAAE 3HNVH 4XC1L 5F7FA 1YEEL 1WZMA 3QULA 1DQML 1LDSA 1LILA 1M05A 1ZSDB 5DQDH 2CR6A 1SBBA 3DGGA 2EDQA 4O2CB 4XZUB 5C08B 3H7BA 2LABA 5J1SC 1Q9LA 1HILA 4Y4KB 3U7AA 4FA8A 5CGMA 3IJSA 3D1MC 3PDOA 4OGXL 5JMOC 4WO4B 2GY7B 4X9IA 4HBCH 2X1XR 4D9QD 4PV9B 2HT3D 1IC1A 4MA8L 4JEGB 1OAZL 4YZFE 2SEBB 5I1DB 2QHRL 4U6TA 4PG2C 4ZYKB 2DMKA 1GIGL 3ARDD 5TPWH 1Q8MA 1IAOB 1Q9OB 4Q2ZB 2H2SC 5CP7B 2V7HA 1NSNL 4PTUB 2HLAA 2GYSA 1I85C 5I76A 4D9LH 4DTGL 4TYUA 5KSBA 1FNSH 2NY7H 5JW4N 5GGRY 2E27L 4HEPG 1FC2D 3EYOB 4WEMB 4NOBA 4HDIB 5CJQL 4WI8A 3VCLB 2P7TB 3O4OC 2PKDA 4NZJA 2J1KA 4K7FB 3VXSE 4UU9B 2BX5A 2X4OB 4YEEA 4GRLB 4MHHI 4G9FB 2V5YA 4Z7WB 4RDQF 3EO9H 4HX1A 5CWSA 2ATPA 4YHOL 5I0ZA 3PV6A 4XPBL 4HAFA 4KGJA 4S11A 1ZA3B 4N5EA 2G9HA 5C6WH 1JWMA 2JF1A 4G80B 4AYFA 5FEBA 4WV1A 2NR6D 1AFVH 5SX5H 4U4BA 2F5AL 2X4TB 2XWBA 2HT4C 3BZFA 4JANB 5ESVB 5F9DC 1SEQH 4ISVB 1T7YA 5E8PB 2QLVB 4M3JA 4K7PL 2ZG3A 3Q1SL 3GRWA 3GGWA 4QRPA 3TCLB 3OKDB 2CLZB 2AGJH 4FFZL 1DEEA 4FZ8L 4M1DH 4EI5A 5TF1H 5IT2H 4JO4L 4YHML 3HPJA 3MGOA 3SGEI 4JFEB 1K8IB 3V4VL 4Y5YB 3IDJB 1BQLH 4P59H 1GPOH 2CO6B 2A9NH 4ZFGH 4V2CB 5DJYB 4FQCL 5ELIA 2VISB 3I6KA 4G6JL 5EOCH 4LCUA 3FFDA 1EX0A 5E2WL 3D85B 2CUMA 5GRUL 1IQDA 3LSOB 2AXHA 5KVEL 2BNRB 3ARGA 4ZFOA 5JNYB 4XCFH 3L5WA 2BSRB 5EFIB 5CEZE 1LEIB 4GKSB 5IB3A 3RWCA 3HI5H 5DA0B 1JYXA 3HNVL 2YPLE 4KKCD 3C5ZA 5D7LB 1U8MA 5E2TH 3WO4B 3PF2A 3UYRH 4MDJB 3LIZH 1JWUB 2DM3A 2EDDA 5BOPA 1SM3H 4HH9A 2WBJC 4NQCE 1QSEB 5HVHC 3E2HB 4HBCL 1H5BA 5GQBA 5ISZB 1D5XB 2IALA 4Y4FC 3U7WH 5KS9F 1KPRB 3D2UB 5D93B 1RUMH 4RA0C 4CADA 5JXEC 1YZZA 1ZE3C 3DO3A 5J11C 1SY6L 4F7TA 3RKDC 4PJAB 1MLBA 2YD1A 1KIRB 4YLQT 5GGSB 2JJTA 5HYEA 4G8IB 1FNSL 2NY7L 3TT1L 3V4UH 4P2RE 2PTTB 4HGKC 3MBEB 2C26A 5DJ6B 2PW1A 3LKQB 4D0CA 2HFFB 4E9LA 1ZEAH 5EZLB 3G6JE 4BH8A 1KJ2H 3DRQB 4YHYB 3VWKA 4MAUH 5LCVH 5JORA 3MCKA 3QXDA 3ROLA 2OTWB 2C7UA 5EN2B 1BOGA 1CXIA 3T0EE 3CZJA 3E3QA 4NN7C 4JZNB 3MV8E 4N9GB 4Y7MA 4NDMA 1S7XA 3EO9L 3VXMA 2MSPA 1J18A 4NO5B 4PJ7A 4P5MB 4D0BB 3BHBA 4JPIA 1TQBC 3O6LH 3GMRB 4G7VH 1GZPB 4PGBB 4YHKH 1S9WA 5ACLA 1NBYA 4FQIH 4XI5D 4UB0H 3LH2L 4ZXBB 5D7JC 5F7EH 2ICEB 4NSKB 1PYWB 4UV7H 3V5HA 2VLRB 4RAVB 4RRPA 4XHJD 3VFOA 2R2BA 3TH2T 2NY3D 4PLJD 3HAEG 2HVKA 2DQHH 4J3TA 2ICWA 4EVNA 4J12A 4LNRA 4LCCC 1MAKA 2IPUG 1YC7A 2AGJL 3ROOB 2EDNA 4M1DL 1BLNB 5TF1L 4XXCC 4NO3B 3BRDA 3TJHA 1DN2A 2GTWA 3MV7D 1Y18B 5KVFH 3NZHH 3UPCA 4FQ1L 3BUYB 3N9GH 5M7QA 2UZYB 3O6FC 1BQLL 1JBJA 1GPOL 3O2DH 2A9NL 4ZFGL 5K59E 1TCRA 5ESQB 4JDVB 2DLHA 2EE9A 5EOCL 3VXSD 4APQD 2Z8WC 1BVLA 1KTDB 3GB7B 4WI5A 3DO7A 5CHNA 5DJ0A 4XCFL 3BI9X 4ZO6A 1NUNB 4J3VA 5L2KD 3T2NH 3HUJB 3UTPE 1HHKA 5J6GA 1RUAH 2R1WB 4K3EH 3AFLA 2B4CH 5E2TL 3UYRL 5F6IC 3LIZL 4RX4A 3BQUB 5DEFA 3SJVB 3T3ME 1SM3L 1FAIH 4GW5B 2MOVA 5FYLH 3R06B 1EK3A 2YEZB 3VI4F 4OZGF 4WENB 2G75A 3LV3B 4C4KT 1A3QA 4QRRA 3N85H 4LCWD 3U7WL 3ZKXC 4C83B 4MA3B 1FZJA 1RUML 3HC0A 4FQQA 1GGCH 4G9FE 5JXAL 4WFHE 4GBXC 1MCPH 4EOWH 2BMKB 4Z7WE 1F00I 1U8IB 1KB5A 1CTNA 5FA3A 3ZKMC 5FECB 3O41B 2ZOKA 4PP8C 4JR9H 1FFOA 3L5HA 4MS8C 1ZS8B 2CK0H 2WQRA 3CFIC 3V4UL 3LRSB 5JW3H 3BDYH 4HUWA 5CKGA 1S9VA 4HUKB 4ODXB 1ZEAL 3UJJH 1WV7T 4XCEA 3EYUL 4HS6B 1KJ2L 1FYHB 5C0IB 1HHIA 2JB5H 5LCVL 4HZLA 2X1PA 5CEZD 2P8MB 4YO0A 3FQNB 5FM8A 3O9WA 1OW0C 4ZDHB 4XCYA 1MCBA 1MHCA 4GW1B 4YFDB 5DUPH 3T0DA 4UNUA 5C0FB 2YPLD 4KPHH 4M7LH 4TTDD 5F8RC 4MJ6B 4C54A 3QFJA 2NZ9D 2EEAA 4NKMB 5FO8B 3GI8H 4FFEX 4G7VL 1DLHB 2WK2A 4LVNB 4YHKL 4JFEE 4OQ1A 4FQIL 1WBXA 4UB0L 4KK9D 4NQCD 3GMQA 3CCHA 1MFBH 1J0KA 1BFTA 1X44A 2ZUWA 1PKOA 2CRMA 3FT2A 1TJHL 2VUYA 1X5IA 2BNRE 3C9NA 4EBQH 4NKDB 2P48B 2EDYA 2EYRB 4PRIB 3TFKC 1MCKA 3LEVH 3V6OC 2HWZH 5D7LE 1R3LA 4NYLB 1EPFA 1EV2E 4GXVH 5J1AA 4P2RD 3N9GL 3CU7A 3ARUA 3O2DL 4U6HB 2DLEA 2WQ8A 1K4CA 2Z91A 3S5LA 3U83A 3TVMC 2AJ3B 4IOIB 5I73C 5GJSH 4HUMB 1QSEE 3MC0A 3GSRA 3IDMB 4XVSH 4U1IA 5ISZE 3TESA 4WGWB 2HJLB 2NY5C 5IROC 3C8HA 3FMGH 5CBAB 3WNLA 2CUHA 5CIPH 2FLBT 3MV8D 4X4MA 3EYVB 3OF6D 5SV3A 1PLGH 5GS3A 4G8EA 4R0LB 2NLJA 3BP6A 4PR5B 3LMJH 3O11A 4PJAE 3T2NL 2D03L 3WE6B 4L9DA 2WLYA 1XGQB 2UWEF 4K3EL 3RY6A 1FORL 2B4CL 3MXVL 1CVSC 1IC7H 1SEBB 1AIFB 1S7QA 3VFRA 3NN8B 2NY4D 3QNZB 1FAIL 5FYLL 3HI1B 1NCAH 1ZT7B 2ZNXA 4PJ9A 3MYJA 5F7YC 2GJ6A 4PTTB 1XH3A 3PP3K 5DHXB 5E2UH 5FYKD 3N85L 1I8KB 1IAIH 2ENYA 4KDVA 1RZGA 3PWJB 2E8ZA 1CWVA 1GGCL 1U9KA 1WISA 1MCPL 4XGZA 4EOWL 4XB7A 2D9QB 2E7MA 2W0FA 4I5BA 5F3HB 1I7TB 5C08D 4JR9L 4Y4KD 1UB6A 5GGRA 4WO4D 1QBMH 1JMXA 1M6OA 4Y1AA 5JW3L 1E4XI 3BDYL 5I17A 5IVXF 2WMPA 1NEZA 2VLRE 3K1DA 4R2GD 5J0BA 2P24A 2FIKA 3DV4A 2ITDB 3O6KH 2JB5L 2YN3A 3MLSH 2IC2A 4ZS6D 4EQ3A 4RMUA 4IMKA 1DBBH 4L1DA 2F53B 3B2UC 1BVKA 4YC2C 1FL3A 3IJHB 3DSNA 5FUOL 3LKOA 1MIMH 3IU3A 5DT1L 3UTPD 1JRHH 1KJ2B 3GSUA 4AK1A 3AU1A 3AS0A 2ZPKL 4KPHL 4M7LL 2P44B 3MYZA 3I3DA 1KCSH 1EH9A 4NRYA 2YRLA 4HCRA 4MNGB 1Z3GH 2VR9A 4JY4B 4OM0H 2ZCHH 2XPGB 1MFBL 3BMVA 2ADJA 3UAJD 5T1KB 4GRLD 4UDTB 5DTFB 2AJUH 4R7NA 4UNVA 4G9FD 4EBQL 4WFHD 3DETC 4KZDH 3GSVA 1IGYA 2PO6B 4HIJA 1IVLA 4KJPD 3KGRA 1RPQA 3RRQA 5C07A 1WAAF 3TBSA 4O9HH 1N26A 4ZUVA 2D4FA 1JNJA 5IVZA 1NDMA 3FCTB 4PGDB 5C2BH 1DLFH 3CZFB 4X99B 4YXKH 3OAYH 2JELH 4GXVL 4K2UL 2JJUA 1A21A 3SJVE 3RL2A 4BQCA 3Q5YA 1ORQB 3QDAA 1OAYH 4G59A 4RGNC 3T2PA 5C0JA 3FO0H 5GJSL 4KV5F 4R7DA 1OP5K 4N0FA 1A1NA 4XVSL 2DWDB 1XGTA 3DI3B 3L6FB 4FS0A 5FKPB 2VAJA 3FMGL 3SE4A 1CD9B 1NGXB 1UC6A 1Z9SA 5BVJB 5JUEH 1BIHA 5DD0H 4LPTA 3IKCA 4PY8J 3P77B 4NFCA 3LMJL 1U8JA 4JFED 1HKLH 4U7SA 2BOCB 1IC7L 2BHUA 2DQDH 1PQZA 3DXAA 2BXYA 1WITA 3C6LB 1TFHA 3CDFA 3O4LA 5I15L 4LSRH 1CICB 1NCAL 3D85D 3TM6A 4OD2A 3RX8A 1K2DA 4X0KB 2BNRD 4FN0A 2CIIA 4LFHD 2GTZB 5JIPA 4Y2OA 2ICWJ 1IAIL 4NUJB 3L3HB 4TSAL 5B4MD 3BD5A 4GMTH 4N0UA 1MY5A 2EC9T 4HFWB 4F7EB 2FNBA 1KTLA 1G84A 3JWDL 2DLIA 1AGCB 1ZLWK 4RFEB 3RKPA 5D7SH 3DYOA 1GOFA 1DL7H 5HGBB 2ARJQ 4YE4H 1R3JB 1QBML 1QSED 4NHCL 1ZXQA 1A7BA 1NBQA 2BK8A 3O6KL 1DANU 2JCCA 3SDCC 4NC0B 3D2UD 5DMGD 5DJAA 1A6WH 1DBBL 1OT2A 1F2XK 1T89A 4X8JB 3MRQB 3BP4A 4PRIE 1DDHA 2X09A 4ETQA 1YMMA 5DDHB 5C0RH 1NBZA 5DEZA 5IHUH 4X9FA 4ELKA 4WW1A 5T1MB 3SE8H 3TT3H 2GK0B 2R29H 5J13C 5DJXB 2YZ1A 1CU4H 2EXWD 1KCSL 1YY8B 1WEJH 1EIBA