3VXPA

Hla-a24 in complex with hiv-1 nef134-10(6l)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
molecule tags Immune system
source organism Homo sapiens
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
total genus 74
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxpA01
1TETH 1OP3H 4M43L 1DDHA 3EUUA 4WI9A 2FWOA 1WZ1L 1L0XA 4M7JH 4L5FL 4X0KB 2NY3D 2C3WA 5SWZD 2BSTB 3ECBA 4ZPVB 5EIIA 1S9KC 3UTOA 2BNRB 1HHKA 4MJ6A 2ATKB 4EZMA 3ZYOA 4UILH 1CDUA 5C2BL 4PFEA 5CGYD 2QQLL 4MJIE 4LASL 5IVXF 2JJSA 2ZJSH 1ULVA 3MLWL 1JMZA 2B1AL 2WSKA 3HCVB 3SJVD 3D0LB 1ZHBB 4Z7OE 1AO7E 1E4XL 3DVNA 3BXNA 4Q2ZB 3HR5B 2FX7L 4OJFL 5KN5B 3VE0B 3HS0B 3O4LD 1SEBA 4XWGH 5GZOC 1FFOA 1IGFH 4P2OB 2VN7A 5IMLB 4MXQA 1VACA 3QIWD 4R90L 3RVVC 2OM5A 1JNNL 5IWLA 2R1YB 5GGTA 1KPRB 3IRZA 2ICCA 3HC0B 4JRXD 1UJ3C 4V1DE 1QBML 5T3XH 2ZPKL 4HFWB 1FFQA 2HG5B 3BXNB 4CMMA 1LGVA 3IU3A 3V7AE 4JY5H 4JVWA 1KCSH 4YHNA 1AR1C 3CGTA 5GGUA 3MBED 2FB4H 3IETB 1JPFA 3UROR 5TDNA 4XNMA 3C09B 3AAZA 1YA5A 3QQ9C 3MODH 4GW1A 4JPWH 4PJ7E 5K9QG 5HYIA 5EUOA 4EXKA 4HIXL 2OTWB 5EO1B 2R9HD 1T7VA 3ULSB 1RAMA 4JFZL 4N90E 4K3GA 4HCRL 5JZ7D 4HUUA 5ANMB 5E7BA 3WKMH 3M45A 4I3GA 3UC0L 5D7IB 3ARYA 4D0CB 3OL2A 2VISA 1EK3A 1MQKL 2HJLB 4NQSA 3PP4L 1M6OB 5KJRL 4XPBH 4MNQE 4HH8A 4JY4B 5CLWA 3H42H 1I7ZB 1RZ7H 4G9FB 4RMQA 3QNYB 2XQYG 3S4SA 3QEGL 4JPKL 4C56B 1D5ZB 1OAYL 1F45A 4HWEH 1ZV5A 3E2HC 4Z7NF 2EYRB 1V7MH 32C2B 1OPGH 2JIXD 4IRSA 1BEYH 3EOYG 3ZE1F 4D9QE 5HDQL 3GUTA 5JHLL 4LSRL 5BQ7A 1FYTA 3CFEA 1YNKH 4XC1H 5DJYA 4QRQA 2DIJA 5F72S 4XVTH 3WUWA 4H20H 4OB5H 4OLYL 2BJML 1A1MA 1EAPA 3QUZC 1T83A 1N0LA 2SEBB 4APQB 4IMKA 2K3TA 1V7ML 4YE4H 4Y8DC 2R4RH 4E41A 4YXKL 1KCUH 2FGWL 5F21B 4K8RC 5GGSA 1GL4B 3N9GH 4HPYL 4MA7L 4JJHA 1NDGA 4H0GA 5M95B 1KEMH 3WSQH 3QFJE 3QIWB 3MGAA 3IDJA 2L4OA 1FZJA 1S3KL 4HUKB 2DKUA 4KUCD 3JTTB 2EEAA 4O4YL 2Q7YB 4PJXB 3TFKD 2ESVB 4M6NL 1IM9B 5I75C 1T66D 2OP4L 3H7BB 3KS0H 2ATKA 4HLZH 5FV2A 3FN3A 3SO3B 4YHPA 4OUUA 3QXAA 2NY0D 3MO1A 2P43B 3MRNB 3GMNB 5FO9B 4KK5D 5HHQB 4N8PA 3U82B 3S5LA 3ARTA 1BZ7A 1JHLL 5C09B 4BQBA 5I1KH 3DV4A 2NY3B 1YJDC 4NRZB 3H9YA 3NFNA 5E4EB 2NY6B 1Q9LA 3PWJB 4NUGH 2GFBA 3STBA 2DQTH 3DO7A 4GW5B 2AS5M 2ICES 4Y8AA 2IAMA 4DKEL 4HDIA 1U8KB 5ESAB 4D0BA 3D85A 3HC3H 3AMKA 2Z8SA 1N7MH 5A2FA 2HJFA 5DD0L 5HHNA 4OZGE 4FQJH 5KVEH 4FQCL 2VRAA 5D70L 5DC9B 2I5YL 1CDBA 5CEXA 2V2XA 1OWWA 1P5UA 3SDYH 5F7LB 4WW1A 3TV3L 1LNUA 4L1DA 3MLWH 3RUGA 2W9EH 5IEHA 3ARDC 3H3PL 1BX2A 2XTJE 5EN2A 1FG9C 4FQCH 5SWQA 4WV1C 2V7NB 2VXUH 2ZG3A 5GZOD 1UZ6F 2AV7B 2F8OA 4IRJD 4UV4L 3OKYA 1B0GA 2ZKHH 4M7ZC 4Q2ZA 1BF2A 2GSIA 3BPCB 4MS8A 3BGAA 4HJJL 4XX1G 1VERA 3OKEA 1MH5A 4TUKL 2X6MA 2Z4QA 3AS0A 4NOFA 5IMLA 1OB1A 1JP5A 3K81A 2EDWA 4KPHL 3U83A 1IARB 1FRGL 5JR1L 5DT1L 3CMOL 4J1UB 3CPLB 4Q9RL 3G5VA 1CDGA 2PTUA 3FO1A 3QUXD 1ADQA 1AR1D 3EFDH 3VFRA 4MA1B 4R26L 2WK2A 4LIQH 4X4YB 2J12B 3ECBB 4M3JA 4AEEA 5H94B 5D7KD 3MOAH 2ZUVA 1NCCL 1IMHC 3MRLB 1QRNB 4FXKB 4JG1H 5D5MA 4L29B 5GS0L 1QSFE 4UB0L 1KFAH 1KCKA 3WIIL 2OR8A 4IRSD 1U8MB 4JLRB 4RFEB 2FEDD 1OSZB 1MIEL 2JJWA 5BS0E 4M7LT 4UUJA 3QIUA 5DTFB 5EOTA 3B83A 4PV8B 2B4CL 4OZHA 3ARFA 2OXGA 3LB6D 3FFCD 1CE1H 5ALBL 1GGCH 2H6PB 3QHFH 5I1CL 2NY5L 1MWAL 3T3PF 3LN9A 1QKZH 3HKFA 3QNYA 4ZDHB 1P7QA 1ES0B 1LP9A 3VGDA 1MHPH 5DJ6B 2Z8RA 4PGDA 3LH2H 3Q5TA 1OLLA 4GG6F 4JHAH 3DUSA 1NMAL 5CGYC 2JF1A 5JIIA 2BNQE 2HWZH 1BM3L 2X4UA 3JV6B 1ZWIB 2GTWB 4GAFB 1ZE3C 4JREC 4H0IA 3X3GH 4C58B 5I30H 4MJ4A 1MY5A 3BIKA 3L5WA 3O9WD 3V6BR 1MRCL 4H26B 5DK2A 3FT2A 1NAKH 1A7PH 4WI2A 5E8NA 4PR5B 2DTML 3MV7A 4ONGH 4P59H 4EI5B 5I19H 3WHE0 1NUDA 3VFRB 5ACMA 4Y19D 1XIWB 2OR9L 4IIQA 3MJ9L 1YEHL 3LDBB 3G5XA 2CPCA 5IK3A 1CIUA 4X9HA 3FO9A 5SV4A 2APWA 4GKNA 3EYSL 1L8JA 3JWNC 3QI9B 1BF8A 2NY0B 4MMXC 4P48A 5JW4Q 3WHXB 5IFHH 5C0BE 5HI5C 4G9FD 4LGPB 5LGHL 3VG9B 3ARDB 5T1LA 1TXKA 4Y4KC 5B38A 1ONQA 4N0RA 1QFOA 1LEKA 4EQ2A 2Q8AH 4PRAA 3QUML 3B4NA 4N0YH 4W4OC 5ADOH 1BIIB 4NKMB 3QBTB 1Y18A 1X9QA 2FEDC 3REWA 3CDGB 5IHLB 4F37K 1N6QH 1MCRA 2OMNA 1H9VA 3FQXA 4P23C 3P0GB 3LB6C 2P5WB 2YD8A 2ATPA 3FQWB 1Y6KR 3KG5A 5KSVA 2VDNH 3G9AB 3EZJB 2Q86A 1W72B 1NCWH 1U92A 2CK0L 2E6QA 3CFKB 5LBSH 2YUVA 1V05A 2R69H 3GMLA 2E27L 3UO1H 5ACZB 1JWMA 2IAMB 3PF2A 1NC2D 4XH2B 1ODAA 1FNEB 4TVPE 1NSNH 3H9HB 2A73B 5EO0A 1HIMH 2XWBB 1ZS8B 5IVXB 4C83B 1CIDA 2XTJC 1WWBX 4FFWC 5K9JL 4ZS6D 4HHAB 5L8LB 4PB0L 4Q6IA 5I18L 1DL7H 5I75B 4XCEA 5FYJU 3HG1A 3MLUH 5F9JA 1F58H 2V5SA 3U30C 2V2XB 5HYQA 1CL7H 3GSWA 2W60B 1CXEA 4DKEH 1HXYB 5F6IB 4YBQD 5A43C 4Y4KA 3FFDB 1U3YA 5GS0D 1XGQA 1P1ZB 4LVEA 1N3NB 3TH2T 2Q3AA 2AXGB 1G9EA 1ZHNA 3SOBL 3UEZA 1NAMB 3Q6FB 3SE4C 5I8KL 3O6FB 1T89A 3U4BL 3C6SB 5LGHH 4MAUH 5D6CB 3VCLA 43C9B 2ERJC 3JWDL 2HMIC 1U91A 1A21A 4LRIC 4P3WA 3S3SA 1LO0H 1ACYL 2WW8A 3WFDH 2ICWI 4OF6A 1DBAH 1NC4D 2N56A 5TPWH 4NNXB 2A6KA 2HT4D 3IKCA 4LLWA 4QRPE 4G43B 3SKOA 4Y1AB 1MHEA 1NANH 1NQBA 2QADC 1W0YT 1BQUA 2V9RA 3GK8H 4IJ3C 1LHZA 4TVSa 4D3CL 2OQJB 4JR9L 1RUKH 1EH9A 5FUOH 2H26B 5E2JA 3VXSD 4UINH 2EDXA 3T77B 2AQ1A 5BRZA 3QJHB 3FOMB 2L7JA 4I2XE 5TDNB 4XCCL 2O5XH 2OR7A 5KSUA 3VFOB 1BVZA 3PHOB 3RA7L 1QSFB 4JM2B 4KDVA 4K3EH 1HHKB 2X5PA 5I6XC 2C3XA 4UOW0 4WI5A 1CFTA 4AYFA 1QSEA 2PTVA 5JW5B 3QR2A 4FABL 3BUYB 4PJBB 3HLAA 2DL2A 1J5OL 4HK3J 1FVDA 5DD3L 3BP6A 5HYSA 4KJYB 2Y06L 4WFFD 5DRZB 2DJUA 2ED9A 1JRHL 3HS0A 5EZJB 2ADGA 3L3DA 4OV5A 1AGDB 2VL5B 1HHHB 3OJVC 5GS0H 3PGCA 4GG6B 1OGTA 3ZE1E 2CMRL 3RVXC 3S4SB 5ADPH 2QSTA 1PQZA 4IS6B 3C2AL 4TSCL 3RVTC 4WFFE 3GIVA 1NLDL 3B5GA 2YXMA 3QO1B 3MLVL 3ZSSA 2B5IB 3N1PC 3J8F7 3MRGA 3TF7A 3QIBC 4P9MH 5I1EH 5CEZE 1OGTB 1TVDA 3Q3GB 4GXVL 2GW5A 5B38G 2EC9U 1X5YA 1KCRH 3EOBB 4U7MA 2OTWA 5EA0L 4RGNE 4MJ5B 1IAIH 2DWEA 2N1KA 2IAMC 1EXUB 3IGAA 4DVBB 3FQRA 5BV7B 1P2CB 1JMXA 1DL7L 2B1HL 3WFEL 4HKXB 5JMOC 4KI5F 3FQTB 3K0WA 5KZCB 3FRPG 3HZYB 5C0BB 3W5NA 4F7EA 4GMSH 5GSRA 4QNPF 4NBZB 4Y19E 1A14H 3CDYA 2P5WA 4QT5A 3GMMB 2GK0B 1ITCA 4N9GA 4FTVB 4KAQH 1JF1A 5EU4B 3BRFA 5F1NB 3EZ8A 3TNMA 5CD3A 3U9UB 4GQPH 5FHAH 4WTZG 3ROLA 3V5HA 5B3NA 2Q86B 3ZDZE 3KPRB 4YFLI 1IC7H 1AKJD 2X9YA 1F97A 1D5BB 1NSNL 5I74C 5C08E 1QOKA 4MD5A 3B8YA 2PO6D 1NEZA 9CGTA 3MJ7B 3MACH 2P5EE 1QHPA 3QCTL 5CEZL 4OLWL 5DDHA 2MSPA 3SDAB 3WNPA 4YDLB 4POUB 4J2XA 4PJ5E 1U3JA 1YMME 4DFHA 3Q1SL 1E4WL 4U4BA 1S8DA 2AJYL 4DN4L 3AMLA 2PF6A 2YBRA 5FO7A 4CVXA 1A2YB 4R97B 1HNFA 4HZAA 4JO2L 1AIFA 2DQIL 1RIVH 4XPHL 2B4CC 1LE9A 1CGSL 2IPKB 1G7JB 4XPGH 4PUBH 3OPZL 3EYOB 4P3DA 3RZCD 1R5VB 2D0HA 3IDMA 4G6JL 3SKUD 1MJ7H 5IBTH 3TO2A 1XGQB 4X6CE 3MGOA 5IB2A 1GHFL 4L3CB 5LCVH 3VXSA 3L5IA 3EW3B 3V4UL 5EZLA 5CEZD 5IFHL 3BE1L 4W4NA 3S97C 2NW2A 3PG2A 1HKLL 2CXKA 4ONHA 3UYPA 5EU3B 2UWEA 3KPSE 1RFDL 1QFUL 2AK1L 3FONB 3VGEA 5F9DC 1JGEA 1LO4H 1MRDL 2KQNA 3T4YA 5GXBB 4Z0BL 3N85L 1FYTD 5DXWA 5J13B 1FAKT 2EEBA 3BD4A 3D2UA 1E28B 4LVNC 1M1SA 3MV9E 3QIUC 3MLZL 5I30L 1P7QB 1ZT7B 5GRJH 4XCCH 3MBXH 3MLYL 3QB7C 2RBLA 4P46B 1PSKL 4DQOH 4FFZH 3BKYH 1SEBB 4B50A 3LRGA 1MRFH 3D39A 3B2VH 3V6FB 5JORB 5ID0A 2QEJA 3DXAA 4DJMA 5C6PB 3T0EA 4V2BA 2GY5A 5GS0C 3K3QA 5HHXH 1WLHA 3T1FA 4GXUM 3GRWA 3NZHL 5C92A 1ERNA 5AG8A 5DHVH 1EUUA 3C5ZB 1MJJB 3BGFC 1Z6JT 2PYED 2R8SH 3BDBA 3NIGF 5MEOB 5DEFB 4Y1AD 1FZOA 4ZFFA 4HKXA 5TE4L 4RZCA 1CK0L 5L2KD 3SE3C 1CS6A 3GI8H 5ESVA 1M7IB 3VFMA 4PJ8C 3QXDA 5I0ZA 4DW2L 4I77H 3SKJH 1QRND 5BMFL 3MRDA 3K4AA 2JLLA 2YD3A 4KKCC 1A6AA 3VXQB 4KROC 2FB4L 1NGPL 5D1ZA 1C12B 3EBAA 1U8NB 3UTTB 4G8EA 1MEXL 1YN7A 3PUCA 4K07A 4DZ8A 1HH6B 4Y5XB 1QA9B 4XXCA 3NIFF 5J8OA 5LGKA 3PWNA 1LWRA 4FOMA 3ULUD 2PW2A 3KAAA 5D2LF 4DN4H 3I3DA 1I3UA 1HKFA 2HH0H 1CGTA 2D7OA 4HS3A 1CF8H 2NY4C 5SWSD 1G7PA 4PGZA 4A6YB 3O3EA 3HMWH 2NXYB 2X40A 3JZ7A 4HUWB 5L7XL 4U1SA 4UI2A 4AH2B 2LE9A 5L88H 3MLUL 4ZUTA 3CU1A 3G5XB 4N1EA 4XCYA 5EO9B 3LN5B 2ZCKL 4J3XA 3RWGA 1U8NA 4ZMAT 1IGFL 5HHQA 4J3OC 1DUYB 3SO3C 1FJ1A 4IDLA 1KB5B 1XMWA 4X9IA 4HD9A 3SDXA 1ZS8A 4NQEE 4MJIA 3TBWB 4O9HL 3RZCA 3B8SA 3HR6A 4KQ3L 5C8JB 3G08A 4HQQH 2VDQL 3PHQB 2QQLH 2XRAH 5IMMA 2QKIB 3QIWC 5LAXA 3WS6C 2R56L 3BP4A 2E7LA 3OBAA 1AQDB 5ILTL 4I4WB 3U4AA 1JGDA 5K9QI 2DQTL 3AS2A 4IOIA 4MNGB 1P84K 8CGTA 1U8IB 1JN6A 1TVHB 4J8RB 4OLXL 1CXFA 2D7MA 1JL8A 4TSAH 4HEME 5JXEA 3SKJL 4DUWA 3TZVC 1DEEB 4PJDF 1EGJH 3U0PB 4G6ML 4IEFB 5BVJA 4N0YL 3MRCA 4JPIA 2VLME 4WU5A 3VH8B 3V4PL 5D2NC 1QLEH 4S11A 3PHQA 1JGDB 4ORZC 4LKCB 4P2RE 4MWFA 4WFEE 1KEML 1E6OL 4U6XB 2CLRB 3DBXB 3R06A 2CRIA 5I19L 5JA8B 3WFHB 1WEJL 1S3KH 4X7TA 2DLEA 3CJJA 3HI1A 2P8MA 1A6PA 5DEGB 3T0WA 3RVWC 4EI5D 3UJIH 4TTDC 6FABL 3Q0HA 3UTSE 2ORBH 5HGBB 4NC0B 2A6IB 2Q6WB 3FO1B 4PLOB 1QYGH 3MFFB 1UKSA 1KJ2H 3CK0H 3D85B 2ICWA 4OD3H 3JUYA 2XWJB 2X10A 1I9JH 1UCBH 2CQVA 4PJ5A 3DX9A 2FZ3A 4PRPD 3RDTD 2Z35B 3UTSD 2F19L 1A7NL 5J13C 4V3DB 2Y25A 3QEUA 1U8HA 2XA3A 3CDFA 4H1LH 3NCFB 3MXVH 1OAYH 5FK9A 4X7FC 5D2NB 5FA3A 1QRNA 4FXKA 5CP3A 1G7JA 1RIUL 1I9JL 3FO2B 1QFUH 4TVPH 1CN4A 4LHUA 3GBMH 4HHAA 3CFDA 3GBNL 4HULB 5BS0A 4PRDA 5IOPA 1XCQB 4JRXE 5L2KB 3EJYC 4OAWA 3OAZH 3GSVA 4UOJA 1FN4A 2VMFA 4L4TE 2VR9A 5LQBH 3V0WL 4ENED 1PD6A 5LGJA 1ACYH 1CU4H 3BVNB 3VXUA 4HDIB 2YPLE 5FGCE 1PKQE 4M5ZL 1NC4B 4FFYH 2CO6B 3FN0H 4NM4H 1FGVL 4JE4B 1J8HE 4Z5RB 4U2ZA 2APTA 3IVKA 3L95B 4KU1A 1WC7A 4HIIB 3I3BA 2R1WA 3RAJL 3BZ4A 1D9KC 2FCBA 4QRTB 3L3JA 4AIZB 4BZ1H 3DARA 1NAML 4YDLC 5DD6A 3P73B 2NY7H 2VB5A 3DMMB 3MRDB 4PJIA 3CX5J 4NHCH 4U1GB 2BSRA 3EKCA 4OZFG 3UTPD 4WFHE 3CXDL 5EIVA 1YPZB 32C2A 1OSPH 2KQMA 3SDYL 1MCJA 1F8TL 2XN9E 1NCNA 2L7UA 3WFBH 35C8L 5FOBA 5K93A 1I85C 1RJLA 4YWGH 2ZJSL 5BRZB 1FFNB 4Z0XA 3FO0L 2UZYB 1OF2A 1T7ZA 3HFML 5D7LB 3VXME 1Z3GL 2GQHA 2WBKA 1S9XB 4P5KB 5C2BH 2NX5A 4JO3L 5TH2B 4B0MM 3QQ3A 1I8LC 4HEPG 1N8ZA 5HDLA 5D5ME 2DD8L 3TJEH 4NQVB 5DMKB 1U3HC 4YHZH 3SDCA 1KBGH 4WW2C 4ELKA 1TLKA 4O2EA 5EU5B 3C6LB 3K80A 4PBXA 1XF4A 5J11C 1IC1A 3FT2B 1KPUB 3QJFA 1K5NA 3V6OC 4V2CB 2MTPA 4WHTA 3TJHD 3QUMH 4XNYL 2M1KA 5ACZA 5CP7A 3RUGE 4LCWB 3DX7A 3IJYB 3QUKB 1W72A 4W4OA 4L8BA 4RGND 3NBNA 4P49A 2DQGH 2FATL 3QZWA 1TNNA 4NUJA 1BQLL 2B5IC 4RBPK 4LVHB 2KDGA 4KTYA 3ZYJA 5E1AB 1NJ9B 4Q74A 4YX2H 1S7RA 2X9WA 1J7VR 3MRNA 2NX5E 4X98A 1NFIB 4NHUA 5IBUB 1QBLH 4JG0L 4MXWH 5A2IH 2XG4A 1KACB 4QTHB 1P4LB 5SWZE 1GC1C 3V2AR 2GEEA 5FAAA 1C8PA 4PD4K 3W0WB 4LEXH 4OCRH 4BKLA 5KS9A 3BZFA 5I1AB 4ZOAA 4LSUH 3B2VL 4BH7A 1Z9LA 2BRRH 4PD4J 2Y5TB 3ROOB 1N59A 3PDOA 3QXWA 1FP5A 4YHOL 4LSQH 4OFIA 4JZJA 3VWKD 5DI8A 1I9IH 4C56D 8FABA 4OAWB 3PJSB 3JV4A 4YK4B 1C16B 5FV1L 3FB8A 5C9KA 3AB0C 4MZ2A 3TA3A 4XAKD 4XPTL 4ZO9A 4MCYA 1I7UB 1BM3H 3QWRD 4IMKC 3DETD 3RKPA 3NCYP 2GTZB 5JPNA 3NTCH 4JM2F 4JZNB 3PL6B 1CD8A 4NQTA 2AJ3A 3P0YH 2Z93A 2R2EA 3ET9F 4N8CH 4C56E 1MRDH 4U0RC 1CZ8L 5GS1B 3IYLW 1S7VB 4LF3A 1KEGL 5F9OL 2V7NA 3LN4A 3KPRA 4N5UA 4LP4A 4RQQA 3QNZB 5A2KH 3LQAL 3HRZB 1FG2B 1IFHH 2BC4A 3P9MB 4WW2A 4YXHL 4CKVX 5KS9E 4O2CB 4F57H 2C7UB 2FX8H 4XGZA 1AD9B 1UWGL 4ZNEE 5I15L 4OFPA 1QFWM 4JFED 4Z7UE 3I9GH 4ZFZB 3QFDB 3O2DL 4ZYKB 5ISZD 1EEYA 4F9LC 1FN4B 2VDKL 4PJ8A 3DLQR 2BFVH 5ETUB 3MUGA 1TJGL 1RK0B 3GFUA 4NM8L 1U3HB 3VFVB 3L7FB 5C0GA 5J4MA 4OQ1A 4EIGB 2QHLA 3LN4B 4UOW1 4ELME 4OF8A 2R2HA 2YUZA 3CNKA 1DQLH 4QXTB 2C4FT 1U8PA 4PG2A 2R23B 4ZUSA 1J18A 4U33A 1RZJL 2VLKA 2E9JA 4UV4H 1A7OH 3HE7D 4PRBA 3O6LH 5GGVH 1LK3L 1VFAA 1TMCB 1RHHB 2D03H 2GK2A 4Z7QF 3RUGF 1WIOA 3EJZC 1JNHA 4BELD 2XFXB 2J3SA 1JTTA 2EZ0C 4LPCA 5KSBF 3M8OH 5CLTA 4BZ2L 2XQBH 3TT1H 2RCSH 3DMMC 4XHQA 5DEFA 1UVQB 4QRPA 3TFKA 5INCA 3CSYA 1B3JA 1T2QL 2VC2H 2V2TB 1PJ9A 3VFOA 5D2LA 5CJBA 4KAQL 5CUSH 1GC1H 5GJSH 1BD2A 3O8XC 4X8JA 4PS4H 4OIIL 1J0HA 3FFCA 4PJFB 1ORQB 4RMSA 3MV11 3DTXA 2IH3B 3CXHJ 3CSBA 1FIEA 1R3JA 2GY7B 4L5FH 4RRPA 2HH0L 4AG4H 3MA7B 1MNUH 4YZFF 1ZGLM 4OBSA 1KJ3L 3BKJL 5CINL 5GRVL 2DQJH 5DJ2B 2QHRL 4PJ7B 4LCUB 1GAFL 4MGXA 3GNML 3FFCB 3TM6A 2A1WH 2D4FA 3QDME 5C0IA 3IFOA 4OZIE 4CDHA 3HA0A 5D7LE 2WANA 2E6JA 1XR8A 1FYTB 3PL6D 1BD2B 2CKBL 3GMQB 3ARVA 4HUVB 5DR5H 4HUWA 1B4RA 4GG6A 1R0AL 1ZHLA 5I1KL 4NNYA 2CIKA 1G7PB 4WUUA 4F7PA 5D7IE 5IFAL 1YZZA 5J06A 1FE8L 5HYJA 2HLFD 1ADQL 2LTQC 4NHUE 3GMPB 3P11H 4PJEE 5A16A 4PJGA 2GTWA 5HVGB 2BVOB 4HSQA 1OAQL 1OD9A 4XCEB 3NOIA 1O0VA 3LHPH 1TPXB 3CH1B 3SKMB 3IFLL 1HEZB 4F15B 3QXVA 3LQAH 2FHFA 4ZTPH 4OCMC 4MDIB 5E5MA 2XA8L 3ULVD 3D2UD 1FL6B 4DZBB 5HYJB 3BZEA 2VQ1A 3R8BB 2MHAB 1CI5A 1AGBA 4HG4J 2E7BA 1KTDB 1AIFB 1FZJB 5DRNB 1L6ZA 1AR2A 2VXSL 1FG2A 3MBXL 3QH3B 4NO0A 2CLVB 1HSAA 4FFVD 2AJVH 1BZ9A 1BOGA 3ULUL 3T3ME 3ZL4L 1MRFL 5BZDA 4Q9QL 3ZKXB 3NTCL 4MA3B 5EC1B 4LPWA 5FO9A 1F3JB 2W65A 4UBDD 2QR0B 5E5MB 5IB4A 3QA3B 2HN7A 4OSUH 4MCYB 2X4SA 4Q6IB 5B3JE 1IT9L 1CTNA 3U0WL 3O11A 3T0VA 4TN9A 1W72L 1YYLL 2BVTA 2ERJB 3STLA 1A9BA 4MXVE 5IBLC 5CD5C 1RZGA 5FGRA 3MNWA 4J1UA 1YDPA 2D0GA 2FIKA 5L6YL 3HMXA 1KV3A 4F7PB 2WQRA 4XNXH 1UZ6E 4L3EE 5C08B 1E28A 1OAQH 3EJJX 1KJ2A 1AGEB 1MIEH 3HE6A 5JIKA 5IB3B 3CSPA 2P46B 3QDGD 4F7EB 1ZANL 1X5HA 1KYOK 4XP9L 1IM3A 1WFNA 1TVBB 3GJFK 4QHMA 4G6MH 3N06B 2EYTB 5E8DL 5ENWA 3TZVD 3OKDA 2OK0H 3IDUA 2G60H 3V6FA 1DBAL 4Y16A 2FR4B 1JI1A 3STLB 4Y4KD 3B9AA 4YX2L 3CX2A 3T2PA 2FO4B 2F8XC 2OJZL 2R29H 4DAGL 4KK8D 5F96L 4JFYB 1RZIB 2VLKE 5INDA 3MRPA 4E5XA 3NACL 1CGSH 2DQJL 2OJEA 4HIIA 4M7ZB 5B39B 5KVFH 4M1DH 4JO2H 5C9JA 1LVEA 3IKKA 1T7YA 1MNUL 4LCIH 5FYJH 1J05B 2AERT 3IXAB 4U1KA 5FFLA 3PIQB 2R2HB 3TV3H 1SBSL 2X09A 2R0ZH 3BPLB 3PXJA 4LCCC 1HXYA 4X6DE 5F97E 1ZT4A 3P0VL 2GJJA 5ABDE 5GJSL 1AFVL 4XC3L 4UNVA 3P9MA 4WW2B 4YHZL 5I73C 1ZLSH 4YDVA 1S5HA 5IW6A 5ALCL 5IB5B 4GKSA 2ZUQB 1MFEH 2RCSL 2DQFB 1OSZA 5DMIH 4M9OA 3WIHA 3V0AC 4EVNB 1UA6L 1Z5LB 3EDFA 3MOBH 1EX0A 2YD5A 4JDTH 4PR5A 2DIAA 3BPLC 3DVIA 3SGDH 3VA6A 1E4XH 3CAFA 4U1KB 3QSKB 5IJVA 4PDCE 1D5IL 1K2DA 2H2PC 2VXVL 1JZ7A 3VG9C 3ZDZF 1FGNL 3C87A 1ED3B 1EEUA 1T22B 2ZUYA 1N6QL 4NZTH 1ROWA 5IW3A 4TNVF 1S9VA 2PR4L 2OZ4H 1U0QA 3S34L 2NR6D 3VXPA 3H9SA 3DUHA 2VDNL 2ZZUT 1NGPH 5EB9A 4UT7H 5C3TA 3PP3H 1VSCA 3FB5A 4KVNH 1ES0A 5E9DD 1Z0NA 4LPXA 4UTAH 2H32H 4PJFF 5GGVL 1TJIL 5GJTL 4PJ8D 5KW9H 5M94B 1TETL 3QHZH 2NYYC 3PGDB 2WUCH 1OT2A 4M5ZH 4EDXB 1MCPH 2VWEE 2VN4A 4ZXBA 5IJKA 3E3QA 5FUCC 3HZVA 5DJXA 2W9DL 2X89A 5F7DB 3U36B 3O3BA 3HMXL 5GISL 5HGAA 4KRPC 1OM3L 5F1SA 4WWKC 2HLFC 1CFNB 5AZ2L 4GS7C 1WCQA 3V8CA 3ILQD 1R3KA 5F7YC 1BD2E 4RFNB 1N2RB 3FB7B 5DC4B 3U7AA 3FRPA 3DUUA 3JV0A 3FO9B 1F4AA 1ZVYA 4JFPB 3JTCA 4U31A 3HZVB 1OAXH 2X4SB 3WSQL 2XZQL 3AROA 1RU9L 1A6TA 5SWZA 1J87A 2ZUXA 4NO3A 1HWGB 3GGWB 1BWWA 4M4RA 3BKYL 4XXDA 3ZLQC 1OQXA 2QSCH 2JB5L 3MRJB 3PDOB 4PIRF 1OP3K 1TNMA 3BSZL 4GQ9H 2NY1D 4S1RL 1UCBL 1ZA6A 3VFTB 4LNRA 5EBLA 4X7SH 4R2GB 4UTBH 3QHTC 5F89A 1NCBH 3WS6A 4D8PB 1Z9OA 2P8LB 1FORL 2ENYA 4MXQD 4GMTL 2IFFH 1A7NH 5SV3A 5MENB 4LLVA 4LEOB 1IAII 1I7ZA 4EN3C 3QUYA 2XQYK 4JEGB 4PJAE 4MJIB 3TBWA 4DKFL 2W0FA 1BFOB 1NBYA 4JZNA 4RSVA 4E0RB 3S36H 5DRWA 4PB9L 5AYUL 4R97C 1GPOL 4ZTOH 5J1AA 1A4JB 1F90H 4EN3B 4OFDA 1VFUA 1N64L 2BX5A 4OUUB 1V3LA 1FIGH 3TYFB 3H42L 3CLEL 3LS5H 1G9ML 2BVQA 2XA8H 5EC2B 2YC1B 3S3PA 3CD4A 3EAKA 1A9EA 5I1AA 3TWCL 3AC0A 4U6VH 4UU9A 5LWYH 1HN1A 2WBJA 4YPGB 2CKBH 2D9QB 3KWWA 3PWLA 3ZT5A 5JQHC 3V4PH 3CDGA 4H8WL 3LSOB 3NIDF 5DLMH 2EXWC 4TSBL 4WU5B 3VH8A 4OGAD 3TA3B 3V7AG 1CDJA 3TBSB 3KYNB 2I07B 1KC5H 2JCCF 4N8VA 3PQYE 4ODHH 1IGJA 1TQBC 3QUXA 2I9TA 3GMOA 3EO9H 4S1SH 5AWNH 4EOWH 4GS7B 3OKLB 2Q8BH 1L0YA 2V6HA 2YR3A 4MD4B 3KPOA 4AMKL 3VFGH 1JFMA 5I17A 5A3IC 3DHMA 3S7GA 1UEMA 1FVCB 2V9TA 2YMXL 2W38A 1JV5B 4RA0C 5F88A 3U9PL 4L4VB 2YZ1A 1EO7A 1I7RB 4UT6L 1IGYA 3MYZA 2VZ1A 4LAQL 4PB0H 4M4PA 4HUXB 2AEQH 4BSWA 1I1AB 3EFFB 3TJEL 1J0IA 1K3IA 5EG6C 4HWBH 2F54A 4KJPC 4WNQA 4N0CA 3ARWA 1TZGH 5DEZA 5TF1L 1HSBB 1EHXA 4S0TD 3O9WC 2VDRL 1S5IH 4JFOB 5IB5A 3BHBB 2H45A 1YN6B 2PKDA 2FRGP 5DJZB 5HDBF 1CICD 4OZFH 4JQIL 4X6DB 1ZLUH 4NCC2 3QDGA 2J8UE 3GIVB 1VGKA 3U7YL 1KXTB 2CUMA 2R4SH 4M6AA 4KC3B 2HP4A 2WMPA 5EOCL 1WZ1H 4YDJB 5C09D 3GRWL 3HRZA 3GI9H 4ZOEA 4ZD3L 2WBWB 4N5EC 4Z78A 4KROD 3BAEH 1BBJA 3TN0B 4NQCA 3HI5L 1FO0B 3G6JB 4XP9H 4BQCA 2QLVB 1YN6A 3EYSH 1HE7A 3VD7A 1VGKB 4UUJB 1AO7A 4ZUWB 4NQVA 3HLAB 4QO1A 3GHEH 4X6DA 1CLZL 1KCGC 5F93C 1V3KA 5TH2A 5C09E 3MC0A 5GHWL 2A83B 2YD9A 1DQJA 2OP4H 3IU3B 3MRIA 4XAWH 2YUWA 3HNTH 3DTXB 2NXZC 2DI9A 2DBLL 1NLDH 5DJDA 5MI0B 3FHQA 1JF6A 2FJGA 1AXSB 1NMBH 4JKPH 1Q9KA 3VWKB 5HGAB 4YXHH 2GITA 1YPZA 1T0MA 4AEHL 4W6YB 3SJVB 3ULVE 2VDPL 3FHAA 4XPTH 1XR8B 1T0PB 3IXTA 4WI7A 3AB0B 3GGWA 2MQ0A 2Y07L 4KMQA 2LQRA 4HV8A 4XNUH 2Z31B 3OKNB 2DQDL 1DFBH 3D18A 5C0DA 1WWCA 3MV8D 2FX9H 3SE9L 4Y7MA 4X7SL 2FJGB 2IH1A 1WVZA 4UU9B 1TITA 4OM1H 5EUOE 5I8CA 1WC7B 3ZT6A 3KWWB 3K8KA 5D1QD 4OD3L 2CRZA 4OLVL 1GGBL 1B2WL 3QEQD 3SCMA 1G7QB 3VJ6B 1I8IB 4Q58C 4N90D 3FAWA 5F1NA 2K7QA 1MPAL 3HNSH 5SX4H 2W0LA 3MOAL 3P4LA 1RZ7L 4JFHD 4N9GB 4P99A 3RWFA 3T2NH 1KGCD 2BHZA 1RFDH 5DFVD 2QTEA 3CFBB 3UTZB 1DBKH 4KHXL 3QQ9D 1H3PH 3WIIH 4HIXH 5T3XD 5HYSG 5T3ZE 3QH3A 4NO0B 2HRLA 3T0ED 4NRXB 2OI9B 5ESAA 4BM7A 4UDUA 2C1OB 3FQUA 3DSNA 3RZCC 4I18A 4P4RB 5E8NB 2XZCL 3FO2A 5HVFB 3C08H 3E6FB 4KXZH 3WXWH 5JLZB 4AT6B 2WUCL 1GAFH 2EE9A 2OTUB 4R7NB 3WHE1 5J0BA 2FO4A 3MOQA 2AK4E 1UZ8A 3ULVH 3GI9L 4D0DB 4GRLD 5F3HB 1MHCB 3B6SA 4U05A 1M4KA 1NGZA 4QRPD 2VDMH 1PLGH 2OI9A 3BHBA 5BVPH 4O9HH 2CJUH 4HV8B 1BBDH 2H1PH 3CX5K 2I9LA 3VWJA 1RZ8A 2F54D 1QRNE 1SEQL 2VLJB 2P44B 4WO4B 4LSSH 3IDXH 3FZUC 3EDJA 1SJXA 2Y5TA 2P5ED 5A3ID 1DN0B 5KVDL 2GFBB 1KLUA 3W2DH 4W70A 2XQBL 4MWFB 3TT1L 2EDKA 3SHSA 5D1QB 3O45B 4R4BA 4QOKA 1XGTB 3QAZC 2R2EB 3UBXB 5EBGA 3SGEH 2WWKO 3CVHH 3EO9L 5JPNB 2QR0A 2NY2B 2VR4A 4KKNA 5IBUG 5J89A 2EE2A 2EIBA 2MKLC 3O9WB 1SVZA 4WI3A 3QWOB 4JKMA 2JELH 3BP5B 1HK6A 3GSVB 5D6CA 1UXSB 2DTSA 3OR7A 2HT3D 4Q9BA 5FA4A 2A6DA 2DLIA 2G60L 4MLIA 4Z77B 1E4XI 2EXYC 4F80A 1X5LA 1JFQL 4S0SD 1C5BH 2BK8A 4MNHB 4TULH 5E2VL 2P5WD 2X05A 3ISWA 4Z7VB 5CSBA 4WWID 3R8QA 3QI9D 4WFHD 1QA9A 2J8UB 3A6BL 4J3UA 1UM6L 2KPNA 1EEQA 1B6DA 4GJTB 2DQFA 4P9HC 2X41A 4ODSH 5EBMB 5JDSA 5DJAB 4ZNEA 3QDJA 1IGTB 5J6GA 1EHLL 2VLKD 1KCUL 2FO1A 4KMLB 2HFEA 4OZFA 2P5WE 5GRZA 5DC0A 4ODWA 1WFOA 1D5MB 3W9EB 1PZ5B 4CW1A 1GIGH 4R4NC 3SGKA 3N9GL 4MA7H 1CT8B 1P7KA 1CXLA 3D3VD 3TIEA 1BD2D 3KPSB 3G04B 5HHPB 2BHUA 3WNLA 4ZFGL 3MRBA 4LLQB 5FYJE 1CZ8H 1TQCC 4YO0B 3T0BA 2OL3B 4JQVC 3TBTA 1NFKA 3O4LE 4TPRL 1VB9A 1WFUA 3PV6B 3D39E 5ID1B 1YEIL 3A6OA 4U1MB 1UC6A 4Y2DA 2HFEB 4OZFB 1NC2B 5JMRA 3MV9B 5I6XB 4NJ9H 2EYSB 4K8RH 5J12B 3NN8B 4ELKB 1CGXA 1HH9B 4PRHD 3LZFH 4DCQA 4NC1E 1HZHL 4NO2B 1I9RH 4W6XB 3TJHC 5D7SL 4LOUD 5EOCJ 3SGKC 3HHRB 1CFNA 5HY9A 1LDSA 3VW3H 4I3RL 5AD0B 4YXLL 5EUOF 4U6TA 3OKOB 3QO0B 4MNHA 1NDMA 4OZHE 5EWIH 2HFFB 3IDGA 4AL8L 1KULA 1MREL 1GJIA 1CLOL 1G7HA 1NUGA 1JPGA 4JFZH 3W82A 1H3XA 4LKXB 3GJFA 5T3XE 4R26H 2QADB 3VDCA 4G5ZH 3KXFA 3PWPE 1MUJB 4NDMB 1EMTL 3HC4H 4U1IB 5DFVC 1T5XA 2CO7B 4P2YA 4JFEE 4PJCA 3FFCE 1PGRB 2F53A 5EULV 1H3UA 3EOAB 4QYOA 4LLMB 4XMPL 1BLNB 3P77A 3L5XL 4Y1AE 1S7SB 4P5MA 4HC1L 4P5TD 4JY5L 3BAEL 2VITB 3BKCL 4KRPD 1U91B 1CL7L 1F4XH 5IF0A 3LSOA 3HG1D 1Z0MA 4RMUA 4TSAL 2IC2A 3O6FC 5D9SB 5ICZA 3GRWH 3CFEB 1RIHH 4WCYH 1TZIB 3QCTH 2R39A 5B39G 2FBOJ 3U9UA 3BEVB 3DX9B 3WHXA 5DURB 3KJ6L 1T5WB 4HK0A 5J57B 4F7CB 4WENB 3U4EB 4U7SA 2XNAB 2ADJB 2FBJL 4FFVC 1U3HA 3F58H 5HYQB 5ALCH 1RURL 1MJUL 2BSTA 5EIIB 2NY3C 1PYWA 4GSDH 1UM4L 1A6TB 3LEYH 2KZWA 1VEMA 4MNQD 3KPNA 2Q20A 3E8UL 3WLWC 5HYJE 1S9WB 1MCSA 3N1FC 2CUIA 2N7BA 3SQOH 1HDMB 1EAJA 1NL0L 2NXYC 1OAUL 3FFDA 3VXRA 4XNZB 1DANT 4KRNA 3TIDB 1FVEB 4MS8D 1EFQA 4UT6H 4MVBC 4FZ8L 2ADFL 1Z9SA 2OJEB 3O0RL 5GRUH 4X4MA 3LS4H 4GW4A 4JFFA 5L2JB 4RIRB 3D25B 1RK1A 2R0KL 1RZKL 3MR9A 4KY1L 2X4RB 4EJ1C 4JM4L 4Z7VF 3CU7A 5A2JH 4XB8A 3QCVL 2WNGA 5DMGD 5KOMC 5EO0B 1RMFL 1V3MA 4P23B 1T1YA 1T1XA 2VIRB 1X44A 5TF0A 5LXGL 3KR3L 1XGYL 1C16A 1F4XL 3GSNH 5DHYA 4ISVB 3RVUD 4L4VA 1BJMA 3GKZA 2BZDA 2JJVA 1Y18B 1I9EA 3OB0K 2HT3C 3GO1H 4RIRA 5DUBA 5FYKU 2HMID 1ACZA 4XTRC 4NWUL 3T2NL 3HUJB 3MV8A 2VLKB 3T77A 2VLLA 3VXUE 3WDJA 1PEZA 2ATPB 3FQWA 4AY0A 3FCTB 2BSRB 3ZKNC 3D0LA 2BMKA 3F5WA 3DI3B 4I3RH 1JWSB 5HGDB 3BQUC 1NC2A 1ETZB 1P4BL 1CU4L 1X6LA 5KN5A 1NBVH 2MWCA 5ESQB 4K2UL 5DUBB 3NN8A 2P45B 2RAMA 1IC4H 3RWCB 3GIZL 2OS7A 5HPOA 4NZUL 5IVXE 1UB6A 2VZVA 2IAMD 1VDGA 4OCYH 2W91A 2AJXL 4FQIL 4Y2DD 4GRLC 5E56A 4P46C 5E24E 5DA4A 1UYWL 4EI5A 2VH5L 4LMQI 4YE4L 5F9AC 1M05A 1CT8A 4JDVB 2HFFA 4DGVL 3U0WH 1QG3A 3KLSA 1CLCA 4HK3N 2Z4QB 4KHTH 4YDKL 3QCUH 5T33H 5EZIH 4UAOC 5FK9B 3PWNB 1Y0LA 4H1LB 1TCRA 4YC2C 1B9ZA 4LRNL 1NEZG 3UXFA 5L9DL 4JHAL 4Z7QE 2H2PD 1O5DT 4OI9A 4R2GC 2X1OA 3V6ZB 3T2QA 1ZMYA 1A7RH 7FABH 3OGOE 4F7MA 4ZUVB 2ITCA 5DJ6A 1A47A 4CGTA 2IMMA 3KLAA 1ZGLB 1HXMA 2BY3A 2YSSB 3DX8A 2G9HB 5KSBA 3RJQB 4MDJA 4Z0XB 4LSUL 4G6KL 3I6KA 2YD1A 1MFAL 1WGOA 5LCVL 4ESKA 3BRGC 2AK1H 1PKQA 5BXFA 4IRZL 1DQML 1IBGH 4U1LB 1OF2B 2EC8A 1A64A 4JVPA 4M62H 1FC1A 3AXLB 3Q2CA 1HYSD 4N5ED 1G1CA 2B39A 4KJYA 1WJ3A 3WKML 1AQKH 5LVEA 3AAZB 3E1F1 4J6RH 4NKOB 5HYFA 3KPLA 1ND0B 1AJ7H 4WHYH 4W6WB 4JHWH 4P2QB 3WIFA 3C6LA 3OPZH 2XY1A 3DVGA 2QV2A 4MQ7B 5F7NC 1HHIB 5HGGS 3UTSA 4JGMA 4UIKL 1R6VA 2F5AL 4FNLL 1RIVL 4LLMA 1XGYH 1TJIH 4GRWE 1JF1B 4D9RD 4U1MA 3MA7A 5IEKA 3T0DA 5T1LB 1T5XB 5FM4A 4KK5C 4KQ3H 1MELA 4OZGB 1AGEA 4X7CC 1S78D 4IMLB 4LCYB 1SMOA 3ULUF 2R56H 3PWUB 1IC7L 4V1DB 4NWTL 4XWGL 3VXMB 5HDOA 1P53A 4JFEB 5GSVB 2DOCA 3W2DL 4YJZL 5L2JA 4M93B 4WHYG 2P5EA 4YHKL 4PGEB 2ZCLL 5IVNA 4DTGH 3Q6GL 5E6IB 5D70H 2YRZA 2VDRH 2X4NA 3C8HA 4JFQA 5IFJB 3C5ZD 1R3HA 2FBJH 4XWOC 4DWHA 3HMWL 1A6VL 5C0FA 4P4KC 2HVJB 5EPMB 3TPUB 3P30H 4NUGL 4NHCL 5DVLA 1RIHL 3EIFA 4LASH 2C1OA 3FQUB 3CUPA 2VZUA 1KC5L 5KG9A 1IAIL 3TBYA 1OP9A 4GMSL 2PW1A 4H1LG 5AYQA 2BNQD 3BH8B 4NQUA 5F1IB 3VI4E 1C08B 4AMKH 4I2XA 1LP9F 3TN0D 1AO7D 1PEWA 1AGFB 2KUTA 3FB6A 1M71B 4XP1L 3UTTD 5IG7A 3BGMA 3AS3A 4Y5VC 3VGAC 5I71B 5EZOH 5KSVB 4HX1A 1DQTA 3D0VA 2XZZA 5IHZB 3MRPB 4JHWL 3H9SE 3HI1B 2W07A 3T0EC 1CLOH 3OJDB 3VXNA 4PRBB 2HKHL 5MEPB 3GSNB 3HC0A 3CC5A 3W0WE 5CZXC 4XP5H 2NY4B 1TJGH 3NPSB 1UADC 3PQYB 3H7BA 4M1CC 3TVMD 3O45A 1FH5H 2YHGA 5IIEA 2VLLB 1IQWL 5C71A 3PDGA 4Y5XC 5FKAB 3ZO0A 1MAKA 1SJHA 1ZHKB 3BYTA 4GRMA 4WU7A 5MHSE 3ELAT 2EKJA 1DQDH 1VPOL 5C08A 2NTFA 3DJ9A 5IR1B 3EYVA 1C5DA 1XH3A 3TCXA 5HYJD 2D9CA 4JPIB 1T20A 5IT2H 3HUJE 4KVCL 4Z9KB 3BP5A 1EDQA 2MOVA 3FOLB 2Y36L 4G80B 4AM0B 4GRMB 3RX8A 1JYXA 3DMMA 3OR6A 3L5JA 3QJHA 4GBXB 4Z76B 5JHDD 1CWVA 2ENSA 1YY8B 3X12A 2BVYA 4GUPA 3SDDA 1E0OB 3SDAD 3UZQA 4V1DD 1CFSB 4YQXL 3GSOB 4OQTA 1DQJB 2Y07H 2WINA 4L4VE 4ORGB 4E41D 4QGTA 1K3ZA 1ZWIA 1NCDH 1CFVL 1VFBA 1T22A 1VKXA 2F74B 2XKSA 3PNWB 4FRWA 2XTLA 2UWEE 5BJTA 4AEIL 2JK5A 3DVGB 4MQ7A 5D7LD 1LK2A 4OCYL 4YLQT 4Z7UF 4K8RD 5J12C 3D6GA 2FL5B 2B4CH 1NMBL 4JKPL 3BX7C 1D5ZA 4CN1A 5JXAH 2A6JB 4RGNC 3T09A 3INUH 1ZT4B 1OWRM 1WIPA 3QRFM 4MDJB 4MCZB 3RGVB 1HXMB 4ODSL 5F1OB 1KCVH 3P9LB 5FGBA 5I2IB 2PW2B 2LVEA 4AH2A 4M6MH 2PTTA 1EHNA 2ED7A 5JA9A 3DIFB 3TCLA 3PHSA 4Y5VA 2GAZA 3FMGH 4JKWA 1OTSD 5D7JB 1QPXA 1IL1A 1JZ5A 4TRPH 4LLYA 2QBWA 2HLAB 1HSBA 3NMEA 2ZPKH 4OKVB 2BVUA 2NY2D 1QTYT 25C8L 3BKMH 4JQXA 4XCFL 1MCCA 2YN3A 1E4KC 3L9RB 1X4YA 5DA0B 1UG9A 5E9DE 4NO3B 1MSPA 1D5XA 3GMRB 2XTJB 3C5JB 3BP7A 3VG0L 4TUKH 3ARUA 5TE7H 5E7FA 2NMSA 4BQ9A 4X9FA 1HIML 3RWFB 1IM9A 1P6AB 1WAAA 3WNNA 3MCLH 3QO0A 5CHNB 2XACC 4OZGA 4L9LB 5LAXB 3DNKA 1UJ3A 4WTWA 2DQHL 3I3EA 5CCKH 1L9NA 3RY4A 2DDQH 4B53A 2J7LA 3KPPA 3MRQA 1VESA 1YEFH 2DL9A 4P3CH 1IAIM 3IT8D 3O2WH 3B9VA 1Z3GH 3OF6D 2Z91B 3LPGA 1FCCA 5DWUH 4M7JL 3JTSA 2WWMC 3MMEB 4KKBD 4G59A 2XKUA 1N2RA 2QJDA 3U0PA 1HYRC 4OCSH 1KN4L 3REWB 5DI8B 3MUZ1 3ULVF 1R3HB 4XX1E 5TE7L 4P4KB 1RZFL 1EJ6A 4OGYH 2C4XA 4MJ6B 1FAIL 5D1ZD 5T1KD 1SYSB 3WIFB 3TNNB 4AEFA 3RVXD 4FXGB 5HHNB 4P2RA 5DD1L 5I66B 4P57B 5FYLL 3RQ3A 1AXTH 1AXSA 2JCCB 1ZHBA 1BOGB 5MHSD 5IMOB 1P2CA 2Q76B 1T0MB 1A9EB 2W92A 3B5HA 1FNFA 3EYQD 3HPLB 1EO5A 2NTFB 3T4YB 4TNVK 1GGUA 1YEDB 3O6ML 2AI0L 1R5WB 2B7DT 1H3PL 1FYTE 5DJ0A 1IEAA 3D3VA 3RKDC 1QLFB 3QDMD 3STZA 3G9VA 1A9BB 1R3IL 4K94L 2C3HA 4I0KA 5HJ3A 4QTHA 1OGAE 5C0CD 1XZ0B 1BAFH 1MPAH 3O11B 2IWGA 2W0FB 2FWOB 4JO4L 2DS4A 3QISA 2VLRE 2V7HB 4QRSA 3UMTA 2YWZA 4KHXH 4YXKH 5AYUH 3BT2L 2YWYA 3IDMB 3C2AH 1MREH 1NCDL 5DJ0B 2PCPA 4HBQA 2R0LH 3CZFA 4HC1A 3O2VH 5DO2C 1MCKA 3RY6C 4XVUC 3QG7H 1U8HB 1C5CL 3DMMD 4NKDB 1HSAB 3ZDYE 1NGXB 4H25A 1Q0YL 4BSVB 3BPOC 4XC1L 5DJCA 1DSFH 2IEPA 1MLBB 4JFFD 4ELMF 2Y36H 3U2SB 5E8EA 1BEYL 2A74B 4GQ9L 2GI7A 2PYEE 3UTZA 1CDIA 3GEWB 3CZFB 1UACH 1KTLA 3NAAL 4OI8A 1FORH 1JNJA 3EYFA 3T3MF 4ZO8A 4XBPA 2NXYD 2VLJE 3VD3A 1D7FA 4LU5L 3ZTNH 3RZWA 2MMXA 4WVRA 5DF0A 3GIZH 1DLFL 1EZVX 4DGVH 4J3SA 4L3EB 3ARRA 3SE8H 4AJ0A 4F33B 3V79C 2BMKB 2P24A 3EO0B 2X4PB 1NMCC 2EKSA 2OZ4A 1CE6B 1X5KA 3SDDB 1FVCA 1YC8A 4JGJA 4YC2B 3TO4B 1I85A 1GRWA 1TJHL 1WBYB 1MFBL 3DPBA 3OKEB 1KIPA 3OKDB 4Q97A 2APFA 2Z31C 1U2HA 1RZ8B 4JM2C 4JN2B 3HI5H 4GAGH 5BO1L 4OZ4A 4YHML 1SBBA 4LSPH 5DQ9B 2AJSL 3QDJD 5KOVC 3O4OC 2ZG1A 1YY9C 4RGNB 5F6HI 4I0CC 4HWNA 3REVB 1MWAA 2UY7A 4F2MA 1U3ZA 2RFXA 2ZSWA 1ND0A 4H88H 5CEXB 4D0CA 5GRYA 1WZMA 4FQLL 4L9LA 2ZUUA 3JXAA 4XI5C 1FSKC 5F7KC 4WWKD 1TCRB 2CIIA 5DT1H 1DE4B 4P46A 2NXZB 1WWWX 1ZA3A 2DM4A 3LKSB 2IGFH 3VFSB 1FPTL 4GBXC 4PREA 3OGCB 1RZFH 3AU1A 4PRNB 4WJ5A 3GKWH 5T3XL 4NZTL 2XRAL 4MA8H 1ZLWK 1CQYA 1JPFB 5D96C 3UYRL 1P84J 4XNQB 4JGUA 5I1JL 3NCCB 3MLRL 3UJTL 4YIQA 4YEFA 3PGFH 4RNRB 1G9NL 4M6OH 4QRRA 3HI6H 3IAQA 1WBXA 5AUMB 3TESA 4JFDA 3O3EB 5TF1H 4NWTH 3B9DA 3SQOL 1JYNA 4MB5A 1AGBB 4NQED 1AH1A 2IH1B 2GJZA 5SWSE 2C4FU 2ZCKH 4LCIL 4PTUA 2VC2L 5KVMC 4XCFH 1FJ1B 4RISH 5JW5A 2PETA 1TTFA 5IF0B 1CXHA 5JPMA 3VXUD 5AUMA 5ITBH 4QHNB 1INEH 2CRMA 1Q94B 1J8HB 4PJAA 4KZEL 3WS3B 4D9LH 4YBQC 4BFGA 5C0AA 1F11B 25C8H 4M43H 2QQKH 3P3YA 1XT5A 4CN6A 3HZYA 2HTLC 3EHBC 3MRKB 2B0SH 1UXWB 1JPGB 2RB8A 4R0LB 3VXMA 1G9MH 1DE4A 2J4WL 1K4DB 3U0TA 3QPXL 3X14B 2Y4SA 3RY5A 3C2SA 3OWEA 4M6NH 3TNMB 5CD3B 3L1OL 1CD9B 3EOAA 2OXHA 3LQZB 1B2WH 4JDZA 4M7LL 4TVPL 3QUYD 4B7IA 1IC5H 4OM1L 3L3IB 1CBVL 3TYFA 4X98B 1J5OH 4QOKE 1QQDB 5C0RH 2W65B 4HJ0C 4BZYA 2DMCA 4RAUA 5L6YH 2F53E 3SPVB 2FNBA 2DB8A 3WEXA 4L8CB 2RJMA 1EUTA 1NLBH 2AXGA 4L4JA 4Z8FL 2EO9A 5GPRA 5DO2D 2A2QT 4NYLA 1HZHH 5C0BA 4I18C 3B9KB 1R24B 4XBEL 4YQXH 5T1KB 1S7TB 4Z18A 5EU7C 5T5FH 5C9JB 3E2HB 3C5ZC 2X70B 3IDNB 4Q9QH 1X5IA 4XP4L 3QEGH 4JPKH 3BZEB 5TGBB 1H0DA 3WJLA 3GMNA 3BJLA 4O2FB 4XAKE 4QYOB 5DVNA 4YGVA 4P2OD 4JQXC 1UEYA 1WITA 1QLFA 3STZB 4HG4K 2MQ3A 1KTLB 4PJ9D 4PJBF 3QEQE 4GW1B 2NY6D 2L0DA 4S1DC 1U8PB 1U2CA 4HCRA 4ETQB 1KNOB 1KFAL 2Z92A 3HAEA 1XZ0A 4XAWL 3EYQC 5DK3A 4OD1L 3NH7L 4I5BA 4LLQA 5F88B 3KPQB 3WFDL 3ULSA 4IM8A 1G84A 1NAMA 3QDGE 2NPLX 1TQCB 1K8DB 2ICEB 1U8KA 2HTLD 3EHBD 5CJXC 4CJ1A 3HNVH 1UWEH 4TULL 1JJUA 2HJKA 4FN0A 4NQDE 5F6HJ 4XP5L 1IQDA 4Y89A 5CILL 5FO7B 4JAMA 5INDB 3ARGD 3GM0A 5IQ7H 1VACB 1CLYH 3ME0A 1AXTL 3WO3B 1QVOA 1IEBA 4G6JH 3EGSB 3H9SD 3KYNA 4NRYB 1I7TB 2FD6L 3OR6B 4JM4H 3AY4C 2UZIL 4G7VL 5FM8A 4K23L 4HKBB 1FHGA 1BQLH 5CZXD 2EDDA 2Z8VC 2PR4H 3VXQA 3L95A 1JZ2A 4PV9A 4PLKD 3QQ3B 1A02N 1DQQB 2QSVA 4PJXF 1CR9H 3KPRE 3KLHC 4OLWH 3WE6B 2DM3A 1G7HB 3THMH 2X1PA 2YPLD 3M1BA 3EJZD 4FMFA 4WIQA 1E27B 2BNQB 3ARFC 1C7TA 3NCJL 1S9YA 3C5ZA 1NANI 4O58H 2DQHH 3EO1A 3D5OF 5CCKL 3MTRA 3KHQA 4OCSL 4E41E 3OR7B 3V52H 3KPRD 5JO5A 4O51B 1J1OL 2VLJD 2XFXA 4HIHB 3UYRH 3WUWG 3OKKA 1HH9A 5C0AD 1F4WH 1XGRB 2P48B 5CEYB 2GUOB 5F7FA 3DROA 4XZUB 1DQQA 2JIXB 3C9NA 1W8NA 4KK9D 1X5GA 1GXEA 3HI6L 2ZSVB 1F6AA 3WJJA 3WLWD 3VFGL 3V6ZA 1GH7A 3WNOA 3R1GH 3SDAC 3U7WL 1F4YH 3O41B 4LPUA 3CFJB 4NOBA 3NACH 2E9IA 4AENA 3M8OL 1JWMB 3VFUA 1YMMA 4FTVA 5FYKL 4CW1B 3G04A 4NRXA 3ZZ1A 5HHPA 2W59A 1FGVH 5J6HB 4DZBA 5EIQA 2VQUA 4BA8A 2Y6SC 1S7WB 3G5YB 2G2RA 1A3RH 2P1YA 4PJ7A 5C09A 2FHBA 4OBRA 1Q1JH 3IJSA 4U1SB 3MLSL 1RUAL 1DVFD 2C1PA 4HMCA 1TMCA 4NPYA 1TJHH 4F37F 5F3HA 4X6EB 3HE7B 3NH7H 1XGUA 1RSFA 3VRIA 3L5WB 3RVWD 1QSVA 5I0DA 1S7TA 3EOBA 1OTSC 5BO1H 1TTGA 4PLKC 3AVEA 5D2LE 5FGSA 2EDYA 1DBKL 1KCLA 3DVFA 3L3KB 5T5NF 1MCOH 3SJVE 3E3QC 3V0WH 1LD9A 4D94A 4DUXA 5DUPH 2J6EL 5IHUL 2CIKB 1EHAA 2F53D 3IXTB 3QNXB 5KSAA 3C8DA 5EOQL 3EYUH 3TNNA 4OF7A 3CDCA 2X4OB 4E42A 3GMLB 4OLVH 2YBRB 1U8IA 4PJXA 2BVEA 3ZL4H 4N68A 1BIHA 4PP2A 3QQ4B 3DGGB 3MRRB 1BQHA 3L3IA 3MXVL 3RWEB 3W11C 3UBXA 5KAQF 1Q9OA 1RUPH 1Q0XL 1KJ2B 1JNLH 4ODXB 4UNTA 1JN6B 1ZKAA 5ICYA 1JPTH 3D39D 4FABH 1YQ2A 1KN2H 4OZIB 3MLYH 1I8KB 2DYPB 1ONQB 4NJAL 5K9KA 4JN1H 3KPLB 5F8RC 3G6DL 1OW0C 3WFZA 4MMZC 3C8KB 1ZAGA 4WWKA 1U95B 3L3HA 5E2UH 2YC1A 4KKBC 1IQWH 3EYUL 4Q6IC 4DOHB 4NHUB 2CRYA 1DN0A 3U48A 4PP2B 3S5LG 3RVUC 3UTTE 2DRUA 4YPGA 4IBLT 2HJFB 4PP8C 3MGTA 1XCQA 3FQTA 4NWUH 4LLAA 5H2BA 5DGQA 2GCYB 2D31B 3TT3H 1SQ2N 4B7LA 5IFAH 1C08A 4IOSD 4JRXB 5L2KE 5J9PB 4HMDA 1DVFC 3FB6B 5K59F 5C3LD 4ENEC 4G42A 4JPWL 4LRIA 1ZEAL 4HCRH 2Q87A 3L3KA 4I5BB 5IGXH 3VXRB 4RFEA 3GJEA 1HCVA 1A0QL 5DRZA 2APXA 3T65B 3QEUB 3QUYC 1PX3A 4ZQKA 5HI5D 3SE4A 1INEL 5C0GB 3JV5A 1JI2A 4N0CC 4OGYL 3S88H 1D9KA 1R24A 2IQ9L 4PLNC 4XTRD 5GJTH 2JIXA 3C9NB 5AAWA 5MEPA 3BIBX 3O0RH 1Z5LA 4POZD 3SGEI 3UPRB 2JJSC 5FYLH 4ZDHA 4FA8A 4I0PC 1PFCA 5EOCH 2UVFA 4J23A 1TPXC 3G6JA 3UPAA 2OSLB 2YA0A 3OQ3B 1VA9A 4WNQB 3QO1A 2FL5A 4S0UC 2RIKA 3G5VB 4JDTL 4KV5E 3GSUB 5GRUL 3ARQA 1AD0B 3N1MC 2YD4A 4EI6B 4NN6C 3ESVF 3DUUB 4JFPA 3GJFH 1ZLSL 4I2XB 2BSSA 5CBEB 1IGCL 1H3TA 3C8KA 1J05A 3IXAA 3NZ8B 4HFUL 2R1YA 4P2RD 4X6CA 4L8DA 1NL0H 4KUZH 1YY8A 3X12B 5DJZA 4WFGE 3REVA 1CD1A 1VGEH 2GJ6B 3E8UH 2DAVA 1Y6MR 3CVHB 4LK4A 4ZOBA 1WUNT 2NTSP 3LMJL 1I8MA 2D0FA 5CD5D 2R0ZL 2E7CA 1BQHG 2EYTA 3OAUH 1H3VA 3LKPB 2EDRA 4O00A 3U36A 4P2OC 4RX4A 5C07E 1NFDB 2Q8BL 4QHNA 1CDCA 3ARDA 4GG6E 3DVNB 4ODUA 3O8XB 1FZOB 2X4PA 2Y72A 5BV7C 5D8JH 4NO5B 1YEEH 2X4TB 5DSCA 1SY6L 2PXYD 2YZ8A 5ADOL 3T0AA 4Y4HC 4H88L 4OGAC 1JIBA 1W0VB 3T3PE 1A6WH 1JYWA 3SDXB 3DYOA 1K4CB 1EEZA 2FYYB 5I1EL 3H6JA 4PY8I 4M6ML 4BFBD 2MQCA 1N64H 3QIBB 4NBXB 4M8QB 5B8CC 4U6VL 2AV1B 1H15B 2EIEA 2YA1A 1HOCA 3IJSB 1K8IA 2NCMA 4G5ZL 5FIEA 4U6HA 3QG6A 2QKIA 3SDCC 2NY2C 1ZGLA 4HAFA 3IGAB 1T04B 2P8LA 1YEGH 5TE4H 4F7MB 4Q0XL 4NO0D 4D2NA 1IM9D 1FV1B 3H0TB 3GUTB 4M1CD 3WFCL 2ESVA 4X6EA 4GRWF 3D9AH 1FLRL 1JK8A 3F7VA 1DBMH 3RTQA 3VXSE 2E7LE 5IMOA 2IFFL 1A5FH 2DJ4A 4U1LA 3RDTB 5EO1A 4OQTH 3VFNB 4P57A 2OCFD 1QSZA 5EO9A 3MLZH 5I16B 1FNSL 3DV4B 4OKDA 2B8OT 1IZKA 1W0WB 2HVJA 4WJ5B 5EPMA 2GSGB 3MUHL 3JWOC 1YMMB 4YHIA 1M7DA 5F9JB 1MCIA 2P7TA 3UAJC 4RGOL 2QQQA 1DQDL 5HDQH 3MREB 3VJ6A 4BSWB 3VXOB 5D1XA 3SBWC 3L3GB 4L8SB 3RTQC 1P4BH 4QY8A 4HS6A 2RGSA 1X4ZA 5AZ2H 4PGBB 3F7YA 4EDXA 2V5TA 5DHYB 5DS8B 4EEEA 5H37G 3DV6A 3PL6C 4XHJD 5C0JB 4GKNB 2OI9C 3BZFB 3ZT7A 1KSRA 1A2YA 4M1GL 4G80A 4AM0A 4I13B 4R4FH 3MFFA 2VABB 3BP7B 1A7BA 1WWAX 3LV3B 4I4WA 4MAYC 2A0LC 5EZOL 1MQKH 5IKCB 4N8VB 4OGXH 2G5BB 4JZJB 1HNGA 2AVGA 4IRJB 1UCTA 4QHKI 5IB3A 4Y1AA 1LQSR 3IDYB 4Q9RH 1OGAD 1MJ8H 1NGZB 5C0CE 5ID0B 4XMKH 3WN5A 4XBPB 1FNLA 1NGYB 3KPTA 4I8DA 1RUAH 3LQMA 1AKJB 1VFBB 3F8UB 4HS8L 3EDKA 3NZ8A 3LRSA 2BCKB 3EO0A 2P24B 1R0AH 1D5BA 1CICA 4ZD3H 4HBCL 3SY0A 5GGRA 1K4DA 3VE0A 2G75A 5L0QB 1YECH 1SMAA 1K2DB 1KPVB 2A83A 4YNYA 1ZXQA 3HZKB 1E4WH 1OAZL 3ARED 5F6IC 1JWUB 2I60H 5AAMA 1RV6X 4AK1A 4Y2DC 3ALXA 4I0PD 1KIQA 1KJ3H 3BKJH 4QWWC 2B1AH 4G6AC 1QFWL 3U2SA 4ZS7H 4DTGL 3BGMB 2FECI 1JF5A 2VZOA 1IL1B 1N7ML 2NZ9C 5GGSY 3UAJD 3C6LD 1G9NC 4RX4D 5GGRB 3MBEA 1VKXB 4D0DA 5C08D 4DZ8B 1WCBB 4QHUA 1N0XH 5MI0C 3D3VB 3GSOA 5IVZA 2Z35A 1RI8A 1MY7A 3TVMB 4JFFE 4DKAA 4QXTA 3D48R 4EN3D 4U1JB 4S2SA 4R96A 4RDQG 5DD0H 1MLCB 1UB5A 2RQ8A 2F9BT 5J11B 5L88L 5GZNC 4OIAA 4GKSB 5BV7L 1HOCB 4MB4A 4ALAH 3HZMA 4XHJC 1V7NH 1KCRL 3O4LA 5ESVB 4LFHG 2YKLL 4BUGA 4WHDA 1HHGB 1PLGL 5KTEL 1AJ7L 5DFWH 5MEND 5E08H 2AEIT 5EU6A 2NY7L 4YHYB 2WM0A 2R2BB 5D72L 1AGCA 3G6AB 1FL5B 1M7IA 3VFMB 4UT9H 4PY7B 3MBEC 4I9WE 3V0VA 1I3GH 2XWTB 5DK0B 1T03H 4G7VH 4N9OB 1DQLL 3L5XH 2JE8A 2OYPA 3FCTA 5HY9B 2FSEA 3I02A 1CLYL 4Y5XA 2V17L 3IVKB 2OR9H 2XXMB 2HFTA 3T0EB 4XRCA 4ORGA 5E4EC 3SEPA 1JCKA 3TWCH 1S7XB 2YRPA 4G8GE 4BUHA 4GAGL 3QFJA 2N4IA 3IS1X 1QO3B 2DMBA 3KYOA 4BK5A 3EYFB 2DQUL 3QI9C 1G7LA 1NFDE 1GPOH 4ZTOL 4F2MB 1DQMH 5I71C 2QADD 3J7HA 2NY4D 5DJXB 4XVSL 4CJ0A 3GMMA 5HI3C 3OKNA 1A1MB 4NJAH 3C5JA 3LN5A 4QRQB 3HB3D 3MRBB 3DSFL 3GHBH 5KSUB 4BYHA 3O6KH 3ARFD 4RZCB 4AEIH 4PRDB 4R3SB 2VLRA 1AC6A 1NBZB 4QWWD 4PGBA 5J3HC 1BJ8A 1X3DA 2VJXA 3H2WA 4MYWB 5T5FL 1KTDA 5MEOA 3GBLA 3HTLX 4R4ND 2WWKT 2DI7A 1DLFH 4HGWB 2BOCB 5C0ND 3WJJC 3VI3F 5LGJB 4OSUL 1I9IL 4XP4H 4ACPA 2O61A 1T89C 1KF9B 5GGSB 5IT2L 4H20L 2V5MA 3OXSA 4Z7UB 5JUEH 1CFBA 3G08B 4UTBL 2V7HA 4QRSB 3DSFH 3BW9A 3ZMRA 2A9NH 3WBDA 4PJ9B 3TC9A 3RWDA 3DX8B 3BSZH 2G2RB 4RWHA 1AY1L 4ZAKD 3QXTA 2P7TB 3K4ZA 5SX5K 2VE6A 3R0MA 5FECA 4XZUA 3QXAB 1DBJL 1HEZA 4NPYB 3CK0L 1DUZA 2GJZB 3O6KL 1PQZB 4IS6A 4XH2A 5ITFB 1EBPA 2ORBL 2IPKA 3H8NA 3HPLA 3MCG1 1IGMH 2XPGB 3FQNA 4KMTH 2VZSA 2KL6A 1L7TL 1ZA3B 3DRTB 4LCWA 3WEXB 4L8CA 2KZ1B 2PXYA 3TLRA 2ZCHL 3RWJA 2P42B 4Y5YA 3JWDH 1LO2L 2AI0H 15C8H 4RMRA 3KLDA 3MROA 3NIDE 4EDWH 4RMTA 4JCLA 4BFEA 3GMQA 1U58B 2VAJA 4CVUA 1R3IH 4K94H 4TQEH 3SDAA 2IF7A 4YHLH 4YGAB 2UWEB 4LP5A 4JO1L 4CBPA 4Y4HD 5DEGA 1QUNA 4RQQB 5C0AE 3QHZL 2ZKHL 2QQKL 2PUQT 4LIQE 1F3JA 4HQQL 2ZUSA 3RNKA 3OX8B 3LRSB 4NFBA 2EEDA 5J1SC 3QRGH 5JTWA 4QOKB 4CNIB 1WBYA 2DYPA 3MRLA 4KPHH 4IRSB 3H3KA 2BOCA 1AKJA 3JTTA 5ILTH 3FRUB 1G7IA 2O26U 3LVEA 1QR1A 5D7IF 2LTQB 2ICEA 4OFYA 4OIIH 4PJGE 4MD4A 3MNZB 4G8IB 1MOEA 5DQ9A 4K3DL 3KS0J 4NCC1 3O4LB 1KB5H 3WJLC 2WIIA 3AREC 1KBGL 4EN3A 1JNNH 3NCYS 1MCWM 3C09C 1MJUH 5FKPB 2X4OA 1WT5C 3FN9A 1C1EH 4WUKL 4E42B 1NEUA 4PJDB 3CC5B 3T1FB 1MFEL 3H7LA 5DMIL 3F12B 3LKOB 4HWBL 4TUOA 1R5IA 3ETBF 2ZUWA 1FPTH 4L4TB 2BNUA 5E1AA 5FA3B 5MP6L 4GW4B 5E8OB 3TBTB 1BPVA 4P2OA 4LSSL 4DVRL 1BFTA 4MA8L 2DM7A 5FB8B 2E7HA 4M1DL 5I1HL 2V2WB 3O3DB 2Z31D 1DEDA 2DLHA 3CXDH 4NKDA 1PYWB 2NYYD 3OJ2C 1XF1A 4EBQH 4XNQA 3THML 5DGRA 4X7DC 4XMPH 3CSYB 5BVPL 3WFEH 2D03L 2Z0BA 4RNRA 2EDOA 4ODHL 1MIMH 1HYSC 1KB9K 2Q6WA 4EDWL 3ARPA 1QQDA 1N4XH 4GRLA 1AXIB 1EIBA 2NZIA 2OSLA 1EV2E 2EXYD 3QEQB 3B2UD 4CVWA 2OJZH 2R29L 5JOFB 5EZLB 4GXVH 4WUUE 1Z9MA 3PNWA 1MHCA 4OKVA 1B6UA 4J6RL 1PX4A 2VKXA 4WFED 2O61B 2R23A 3S6CA 5GGVY 2JJTC 2X70A 3IDNA 3IJHB 1LP9E 4K9EL 1M05B 4PJCB 3QG6B 2VUOA 4GH7B 2Y06H 4P5MB 4JPVH 2WIIB 4G6AD 1PZUB 4XI5D 5B8CA 1OT1A 3DX6A 4XVJL 4PJDA 4G9DA 1KIPB 4X4YA 2FH6A 5D7LA 3ZE2E 1GZQB 1AC0A 5GRJL 2GITB 4HZLB 1I9RL 2DI8A 4CRPA 4H0HB 1F2XK 4FG6D 4OLZL 4NO5A 4DN3H 4FMKA 4OZIF 4YHNB 4QLRA 4Z7WB 5JORA 2UVEA 2AV7A 3QEHB 2VSDA 3VXRD 1ETZA 1NMAH 4X6FA 3N50A 2AJXH 1FCGA 4FQIH 2YEZA 4MZ3A 3BGFB 5T33L 5FYJD 3WFCH 3VRIB 4QEGA 5ERWA 2XWTA 2E7MA 5TDPA 2MCPH 4PJFA 4EVNA 3VRJA 1NLBL 4Z8FH 3BT2H 1HDMA 1MFDH 2VDOL 1TENA 4ZUWA 4NQXA 1TCMA 5TDOB 4P5TA 1F11A 5DHVB 3HPJA 4NQEA 4JO4H 4PRHE 3PHOA 1LEKB 4JFHE 2Z9TA 4M5YH 1U41A 1A3LH 4NC2B 1LO3H 1Q72L 1QLEL 3WN5C 3K8MA 4JY4A 4WDIA 3PP4H 4HGKC 1L0QA 4XPGL 4F8TA 5L0QC 4Z95L 3BEVA 2CLVA 2K1MA 3FL7A 2X4RA 2VTFA 1Q9KB 5GIRA 4HH9A 4H5SA 2EDNA 1TZIA 1CG9A 1JZ3A 4KK6C 1K9TA 4LSVL 5LXGH 1N3NA 3A6BH 3JSSA 5D7JA 2C5DC 2HFGH 5HHMB 4UMGA 1I1RA 2K9UA 1YN7B 4EUPB 4JFDB 3GO1L 5K9OB 1FL3A 4FQXB 3ILPB 5C0EA 4RGMC 3EFDL 1P4IH 2DICA 1WTGT 2F8VA 4JZJC 1LDPH 3NCBB 5HD8C 5EU5A 1F02I 1H15A 1S9WA 2O93L 4LEOA 3MGTB 3BW9B 2OL3A 3VGFA 3CFCL 5HBBA 1TIUA 2I26N 3ARBB 2P5EB 3EOTL 3TO2B 2IJ0C 1OAUH 5K59E 1I4FA 4YNYB 4JO3H 5T1KA 2V2WA 1KN4H 3E6HB 4HFUH 4UQ2A 4FG6C 5CP7B 4JY6A 1QR1B 4B5EA 5GS2H 4GKZB 3M17B 1MVUB 4ZS6C 3RTQB 1KT2A 4OD2B 4R8WL 3DO7B 1UQSA 1VENA 1J88A 4QXWA 3GSWB 5CMAB 1WZLA 3L3OA 5FF6B 4PTTA 1SEQH 5D9SA 3LEVH 1BVKB 1NGYA 1SBSH 3Q48A 3MLTB 5HTSA 2DWDA 1OVZA 1Q9OB 1FLTX 3FO0H 1DN2A 4JFYA 1X5JA 4IRJA 3N1GC 4ZS7L 5I1DA 3EJYD 1J0YA 1U95A 1RURH 3L3HB 4G6FD 4PP1C 3LRHA 1ZSDB 5D1ZC 4YHPB 1IAKA 2QSQA 4K7PY 4QT5B 4UIKH 3NCJH 1XF2A 3KXFB 1L7IL 3F7PC 5F7UA 4WTZA 4E9LA 3VMPA 5D1XC 3SBWA 4X0KA 3I85A 2HRPL 3KNBA 5KS9B 1MH5B 3ROLB 5C7XH 1MI5D 2CUHA 3HG1E 2C3GA 1P4IL 5F1KC 1XF3A 2FJHB 2BFVL 2XYCA 1LO2H 2R2BA 4LARH 3HE6D 3QWOA 1D9KD 2A77L 2W60A 5DLML 2UUDK 1IBGL 2BNRA 3S35L 5GGQH 1L7TH 3P73A 1IEBB 4I48A 1PY9A 1BREA 5FHBH 5LWYL 1ZEAH 1L9MA 2NX5D 4U1GC 4I77L 5IOPB 3D25A 4MA3A 1N26A 2YXFA 4HKJA 5JOFA 1JNHB 4EIZC 3R0NA 1CD1B 4QHUB 1BFSA 2IANE 3GI8L 3VMNA 3VW3L 3ARXA 1SM3H 4Z7VA 1MRCH 4G8GA 2X7LB 4IHOA 4BSVA 1OD7A 4LU5H 1BGXL 3OJMB 2OX5A 3KPMB 2IPUK 5DVKA 1RUMH 3CLFL 3I84A 3RFZC 3HAEB 1WBXB 1D5MA 1QLRB 3WD5H 1AD0A 3I6LE 2CDFB 2ADGB 3L3DB 4OV5B 1A7PL 4CMHC 4RAVA 5JNYA 1KIUA 4X6DF 3X3GL 4ONFL 3UYOD 3HUJF 1JGUH 2GYSA 3RWHA 1YPZF 4MJID 4XNMB 1BJ1J 5BRZD 5TQ2L 2GJ6E 4ONHB 3P4MA 3CLFH 1EEZB 2FYYA 3TPUE 3BFOA 3LKSA 4K7PL 2X7LA 3EFFA 3H3BC 3WKNA 4LOUC 5CJQH 3VFPB 1MCOL 5LKNA 1MFNA 2JB5H 5KS9F 3MBEB 2ARJQ 1DSFL 3L5HA 2DBLH 2NY5H 4ERSL 4P0DA 5DRXB 3DURA 3AFLA 4NBYB 2DQEH 1Q9WB 4ISVA 4LSDA 5CAYB 1BECA 5KBNC 4POYA 1ZHLB 3LKPA 1TZHB 3VXUB 1LILA 2J4WH 1KYOJ 1T1ZA 2MFNA 3IFNH 4XXDB 4I0PB 4LIQL 3VWKA 4XPFH 3RGVC 4OCNC 1N4XL 3C60D 1WQVT 1YEEL 5DHVA 4NQDD 4UV7L 5D71H 4RMVA 3TVMC 3FT4A 4U1HB 1YMMD 2HT2C 5IMMB 5HHOD 1RMFH 2CGRL 1ORQA 4L1HA 4LHQB 3BD3A 2F74A 3ES6B 5DD5L 1RHFA 4AIZA 4YFDB 5AEAA 4KZEH 2VAAB 4PRIA 4U0QB 4ALAL 1SY6H 5FOJA 2IG2L 5LG1A 4KFZC 5A2LH 5GS1C 2J88L 5C0DB 3DUSB 3ESUF 4FZ8H 5F9WC 5B38B 2CDGA 5JIPA 3MRGB 5FYKE 3NGBB 2QL1A 2R1XB 1MHHB 4UT7L 3ARBC 4RAVB 5C1MB 5IROA 5JNYB 3MPCA 1FBIH 3FT3A 2YRLA 5DJ8A 1LEGA 1RZKH 4KY1H 4Y16D 1NJ9A 4KUZL 4PS4L 1QBBA 2FX7H 1SJEB 4OJFH 5BZDB 3RDTA 3RWGB 1QBMH 4O5LH 4DVRH 1E6JH 1OAKL 5CGTA 4HK0B 1BZ9B 2FEEI 3P4OA 3ZTJG 4FQHB 3I6LD 4AG4L 4RGMB 3V6OE 4FQXC 4ZUVA 4HWBA 1H0DB 1N0XL 3VFNA 4LLYB 1KENL 2WP3O 1A6VH 1AGFA 3MOBL 4ZFOB 5JOPE 5F1IA 4LBEB 3ZHKA 1AHWB 1KLFA 3NCMA 1VFMA 2HTKC 1J1OH 3TEUA 3EYOA 3IDYC 1CXKA 1A1OB 3LEYL 3QJFB 4P3DB 3V4VL 5JHDB 3RU8L 3HE7A 1MCDA 3U46A 3WUZA 3GKWL 3NPSC 3ULVL 4DUVA 4YAQA 1NCWL 3MV01 4JFQB 3QFDA 1B0WA 4HKJB 4LPYA 1P9MC 1SYVA 4TSBH 4KTDL 5E2TH 3SPVA 4ETYA 3IS0X 4GXUN 5ETUA 3MGOB 3JWDC 2H32B 4ZPTA 5D7JD 4CVZA 3K2MC 4M61B 3T08A 1TDQA 3HE6B 1L6XA 5IGXL 1IVLA 1LDPL 4NQCD 5BJTB 1EPFA 3FQXB 3LIZL 1NDGB 3ABZA 15C8L 5FCUH 4CADA 2M26A 5I76A 4Z77A 3QFJD 5GS1A 1LO5B 3MCKB 4N1CA 4OGZA 2CLRA 3DBXA 5EBWA 1JPST 3HE7C 3SDDD 1YUHB 4MQXC 4Y19A 1MJ8L 5EUKB 4FQ2H 3U1SH 5T1LD 1J1PH 1CDHA 2VERN 4ONGL 4P59L 4TUOB 4Z7VE 5E99L 3RIAK 4ERSH 4Z76A 5FF6A 3B43A 4HPOH 5IQ9B 1JE6A 2JTDA 5F7EL 5JXAL 2R8SL 4WEBH 5E6IA 1HQ4B 4Y4FA 3AREA 2X4TA 5DSCB 1QSFD 1K8DA 4HIEA 1RD6A 4PRPA 4YDJA 3CXHK 1YEIH 5DK0A 5EU6E 4ONFH 2BSSB 3OHXA 5IROC 3SQBA 1AP2B 1DP0A 4PJGF 1OB1B 4M93C 4HW6A 4DKFH 5E0QA 1GSMA 5EC2A 2H26A 4NJ9L 1IAMA 3LKRB 5FXCH 3QUMA 3CUPB 4L3AA 1C5CH 12E8H 1RZKC 2WZPD 3D9AL 2OBGA 1CGWA 3RWHB 5FUOL 3PDDA 3QEQA 4JKLA 1VFAB 1I1AC 2AJZA 4JHBA 3MV9A 1CQKA 5I1IL 5E00A 4UBDC 4S2SB 2HJLA 3IFPB 5FEBA 1N5AA 1D9KB 3BIKB 2BVPB 5J6HA 4KTEL 2R0WL 5HGHA 1RUML 3TGXA 1T21A 4FS0A 4QTIH 1A7QH 1AP2A 3V4UH 5E8EB 1LO4L 1IC5L 5HHOA 1HI6B 3ARFB 1YYMH 1VCAA 2HA1A 5GGTH 1LO0L 1XR9A 3QIUB 3TIEB 1FE8H 1U9KA 3BI9X 4K94C 5EZJA 3ZKMD 4Z7WF 1TQBB 1Q8MA 4UNUA 3I50L 1F00I 3A67H 3MNVB 4PYHA 5DMYA 4UTAL 4LHUG 4ZNCD 1UM5L 3TYGL 3IFPA 3QUXC 3QCVH 2BERA 5GGQL 4XNYH 4APQA 2A9ML 4U1HA 5T1DH 2X4NB 1KCSL 5D7IA 1CFQA 3X11B 4JM2A 4F3FA 4EUPA 5MEQB 3OTTA 2VITA 5E6ZA 5CEZH 5BCAA 5D5MB 4NN6B 2EDQA 3MRKA 1D5IH 1FC2D 4FTVD 2E9WA 3AUVA 4IRSC 5AZEL 5FOBB 5INCB 3O3AB 1ZVSA 2FHCA 3OKOA 3RL1B 1QD0A 3T0EE 3CCHB 3ULUC 4V3EB 2VLRB 3MRMB 2YOCA 1WFTA 3NFSL 4WUKH 3ALPA 4MA1C 3O3UN 4DKDC 3DOSA 1S8DB 3BN3B 4GBXD 2W9EL 3GJFB 4GG8A 4GSDL 1CFQB 3X17A 2NNAA 1HINL 3D87B 4J3WA 4MHHG 5GSRB 3I75A 1DJSA 4E0RA 4KKAC 3G5ZA 3WUWB 1J8HA 5AZEH 1KENH 1J0ZA 3MJ8A 5DYOB 3L3OB 2NR6C 2RR3A 3RWIB 5BQ7B 5IVOA 2H3NA 1CICC 2ZCLH 1MVFA 4NT6A 5ANMA 3W9DB 4L8SA 5IB2B 1YUHA 4Y19B 1XCTB 1VHPA 3QZWB 4WV1B 5C2UB 2EO1A 5IW1A 1I1FA 2BVQB 4D9RE 5I74B 1OSPL 4N0FA 3VG0H 3WXWL 3X3FH 3BIAX 3SDXF 5J9PA 5CHNA 1KXVC 4MVBD 3U6RB 3BH9A 3MNVA 2X1WL 5A40E 1S7WA 2OK0L 3I50H 4ZO7A 3ZKSD 3IDIB 2WLYA 1MHHA 4O2FA 3MLVH 2WIMA 3O6FA 4LDOB 5GRWA 1SYVB 1M71A 2ZCHH 1I1FB 4N0UE 2P8MB 1W2KT 1D6EA 1XCTA 3SY0B 3RKDD 3MO1B 1MCNA 4U1JA 3WL9A 2ZP0T 3S37L 1F6LL 2AJSH 1NBYB 3E6FA 4L4TA 3RIFK 3TIDA 3Q5OA 1PG7W 2AJUH 2D4DA 3FJTA 1KTKE 4PB9H 4NGHL 4TTGA 1KELH 5D7SH 1LO3L 3KPSD 5ADPL 4X83A 5HD8D 1V5JA 4JANA 2ZSWB 2AKRB 7CGTA 4NCDA 3HNSL 1TVBA 5ENWB 5HJ3B 3S98A 4PRPE 8FABB 5E9DB 5JUEL 1JYVA 3KJ4B 3L6FA 3MLXH 3W81A 4QHKJ 5HHXL 4FZEL 2MKWA 1G7IB 1T2JA 4XNUL 4ODBD 3G6DH 1SHMA 3VFSA 4MS8C 2AW2A 1UWXK 5H8DA 1KPRA 4G8FB 4KKAD 2ZG2A 4WV1A 1MWAH 1XGPB 2IBBA 3QG7L 2B2XH 1JGVH 1RU9H 3WLBA 1UWXH 1LNUB 3S37X 1UQSB 1U36A 4QXGH 3VFWB 3F12A 3LKOA 3AS1A