3VXPA

Hla-a24 in complex with hiv-1 nef134-10(6l)
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
274
structure length
274
Chain Sequence
GSHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 74
structure length 274
sequence length 274
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxpA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 3vxpA01
1BWWA 2F15A 3BD3A 2ZOLB 1YNKH 5C86A 3NZHH 4KRMB 4X6CA 1J9CT 1E4JA 5EDXA 4FQQB 3RX7A 2Z92A 2RJMA 3OQ3B 3RVWC 4M62H 2XIDA 5I30H 5B8CA 2EDTA 3LN5A 2CDFA 4XC1L 5F7LB 3O81A 4MGXA 4UV7L 2PW2A 3MV7D 3PABB 4ERSH 4DKFH 4HIIB 5E9DD 3RX8A 4H20L 5I71C 5GRYA 4JCLA 4PJ5B 4ZAKB 4S0UC 1EUUA 2JK5B 4OT1L 2EDXA 5JO5B 4C55A 4PJFE 5KVMC 2UUDK 3HLAB 1A6ZB 2AEPL 3ROLA 4ZFFA 3KPRB 2X89A 1P69B 4FQIL 3RUGB 3BN3B 4LNRA 4Y4KC 5ITBH 3IXTB 1WCBA 4NCC2 4ZUVB 3ZT7A 4GW1B 4P23D 3BN9D 2CRZA 4OQTL 1YPZF 2KKQA 4G59A 4BELD 2J7LA 1SEQH 3WNKA 4U7KA 4Z0XB 2MKLC 4MJ5B 1ZHNB 5IBUG 1EH9A 5F9OH 4LVHC 1FPTL 1QQDA 3EZJB 1MHHB 5IF0B 4JFHE 1QSEA 1JRHI 4RIRA 4PRPE 4HK3J 2QHRH 5CLWA 2Z4QA 1WK0A 3BP7B 4RMUA 1NFKA 3PL6D 3NA4A 1FL5A 2Z31D 3K81A 3JWOH 3AREC 4OZGB 2VLJA 1IZKA 2OJEA 4GW5B 5A2FA 4D0BA 2EIEA 1OPGL 4JHAH 3UBXA 4XXDB 4NM4H 5C2BL 3B2VH 4F57H 1I1RA 1RURL 4XPFL 5KN5A 5HYSA 4MCYB 3RTQD 5H2BB 3W11C 5JW5A 1XGYL 4G6FD 1KIRB 3W5MA 4U1GB 3KPNA 1GAFL 1Q9WA 3L1OH 5HYJA 3IF1A 3OKKB 1RUMH 4Z7NE 2HA1A 4Y4FB 4ORGA 5DUPH 1C1EL 4QXGH 2OL3B 4ZTPL 4NRZB 4M7KL 2EO1A 1FNEB 4UMGA 5GRWA 3WXVL 1S7XA 3UTSD 2FX8L 25C8L 3QIWA 4K2UH 1NCUA 2L4OA 3I75A 4FZ8H 5I8EA 2I9TB 4G3YL 3BJ91 4QWWD 3UROR 4J1UB 1P9MC 4JDTL 4MNQB 5IM7A 2IBBA 3RWDB 3IFOA 4L1DA 2ADIB 4XPBL 3DXAD 1FVEB 4XNYL 2ZJSL 4LHUB 1MELA 3MRBB 1Q72L 1R3JA 2HJFB 4H8WL 4PJ7F 2A6JA 3GMQA 3CDGA 5D2NA 4BUHA 1U3HA 4JKKA 4OM1L 1T2QH 2XXCB 1OQXA 2HLAB 4XBEH 3OBAA 3MRMA 4HUKB 1JRHH 5FIEA 1I1FB 1ZHLA 1DBKH 4Z5RA 1KN4H 4ZQKB 2BHYA 2IPKB 5D2LF 3S36L 5GRZA 3BP4B 2VLRA 5KW9L 3QIBD 3MV9A 4AIZA 5JDSA 1FFPA 4YXKH 1XGUB 4NKOB 3BPLC 4OUUB 4Z7UA 3IAQA 5J9PA 3LHPL 5DLMH 4KXZH 1YEEL 4KZDH 2CRYA 1N6UA 4GAGL 2OS7A 1BBJA 3QDMD 3I6GB 3FRPA 2WBKA 3U6RB 4GKSB 4B0MM 1HHHB 3U0TB 3WIHH 3ARVA 1V8HA 4NQDE 4GBXB 5BZDB 2Y07L 1HQRB 1P7KB 2P24A 1U36A 5E7BA 1PG7H 4AENA 3DMMA 2VNCA 1DBML 5K93A 3TJEH 3BIAX 4LIQH 4HFWA 5ICXA 1Q1JH 2AK4A 1KXTB 3KJ6L 3CSPA 1LP9F 1TQCB 3L5WB 1EX0A 1IC4H 4OF3A 1OP3H 4OKVB 2YK1H 2DL9A 1JUFA 5I8KL 5HHVH 4P2QE 2XN9D 3WS6C 1LEGA 1QO3B 3BGMB 3RA7L 4XPTH 1NGQH 2Y36L 4YDIL 4DQOL 5C3LD 1MAMH 1M05B 5JHLH 2ITCB 4R97C 1E4WH 1HSAA 3HE6B 3V6OA 5EZIL 1EIBA 4G6ML 4LASL 5D8JH 4OCMC 2I07A 3L7EA 5C6WH 3BRDA 1CYGA 1NFIB 5HHXL 4TNVF 5IBTH 2C4XA 2BRRL 4JRYE 3LRSB 3VGHA 1GZPA 4KI5C 2WINA 3QPXL 1UG9A 3X14A 5JQ6L 1NUDA 5CWSB 4OJFL 1JGUH 3UC0H 2OYPA 5C07D 2J5LC 2IAND 1P5VA 2Z8VC 4LCWA 5DHYB 1YJDL 1DANU 4RGNC 1RUAH 1E28A 3G5YA 4QRRE 1J05B 1TCRB 1QFUH 3DHJA 4XRCA 4K94H 4I1NB 2QQKL 4Y5VA 1VFAA 3BH9B 3TJHD 5HD8C 4U6XB 2CKNA 5JLZB 2ZSVA 1CF8L 3LRHA 2DD8L 3GBML 1T22B 4XNQB 2ZWLT 5C0IB 2P48B 5DGQA 3BZFB 3F7VA 3ME0A 3RY6A 1WFOA 5H8DA 4Q9CA 4DAGL 1QLEL 2XRAL 2ATPB 4G9FD 5D71H 4NFCA 4LF3B 1RJZA 3IXAB 5GGUB 3N1QC 3MNVB 3QEGL 1KJ2L 4PP2B 2H8PB 4FZEH 5ELIA 3RL2B 3QEQB 4I0PB 1BQSA 3Q48A 3M8OH 4P48A 4PY7B 4Z78B 3LIZL 3U7YH 1RJYA 1FAIH 3ULVE 3BX7C 4LPWA 3OMZA 1BIHA 3RVTC 1KCVL 3IVKB 4XBGA 3N9GH 1U8IA 4YBQC 2HVJB 3TV3L 1JP5A 3GI9H 3HG1E 5L2JB 2CLZA 4AEEA 3MLSH 5I1CL 1R3LA 2BVOB 3WHXB 1J0JA 5A16A 1CQYA 3MV8B 4MS8C 5HTSA 3V79C 3T09A 3QH3B 5HYQB 2W60A 3JV0A 3MGOB 3VG0H 1DQDH 1WAAE 4FMFA 4HHAA 3SDDB 1HN1A 43C9A 1ITCA 3ZDYF 2C7UB 5JPMA 5ICZB 4PJ5D 4ZAKD 1IKNC 1I75A 4PJ8A 5BQ7B 1SHMA 4U1MA 4FP8L 1HHJA 4JO4L 5DFVD 3MX0A 1MLBB 4O02H 3S8WA 5BZWA 5HGDB 1BM3L 3TNNB 3VWJB 2EDOA 4QHUA 3RVWD 3WCYA 2X4UB 1EXUA 4O51A 3WHE1 1T0MA 3SJVB 2OMNA 4MB3A 2QQLL 1UWEH 5CINL 2VDNL 1UVQB 4NBXB 4LLVA 1MJUL 1PVHA 4HZAA 5IHBA 1OM3L 2UWEF 4MJIB 4FQPA 3W39B 1TJHH 5KZCB 2OSLB 2VAAB 2DOCA 4OCSH 2UVFA 1DTUA 4XHJD 3QSKB 4C54A 1T66C 4YDJB 1VADA 4MXQD 3NCYP 2W0FB 5E5MB 5D7LE 3C6SA 4YXLH 5GGVH 3HC3H 3FO9B 1NCBL 2QQQA 4P4RB 4X0KB 5EO9A 4DFHA 4R4FH 4N9OB 2HYMA 1F4WL 5T3XD 5LBSH 1TPXB 5C0AB 4Y16B 4LOUD 5DD0H 3OX8A 4UU9A 5HI3C 1CDBA 3A6CH 4GG8A 5DJ8A 1AQKL 2HKHL 3MFGB 5T3ZL 4NO3B 2EYTB 4IRJA 4HUVA 4BZ1H 3EYQC 4ONFH 1X4ZA 4FFWD 4NPYA 4GG6F 2XWJB 3IFNL 1QYGH 3MV01 4NDMB 3QUZD 2PF6A 2G60H 4Y4FD 2XQBL 4Y7MA 1P7QB 4NN6B 2A83B 3L3DA 5SWZB 1KEML 3VI3E 4PGDA 1VFBA 1W2KT 2R2BB 3DECA 3LPWA 4P9HC 4K8RL 5IWLC 4LSUH 3TZVC 4KDTA 2VZSA 5HGAA 3TH4T 3UPCA 1VGEH 4MNQD 3R1GL 3V7MA 4JM4L 4NQEE 5L2KA 3MYZA 1C5DA 3HMXH 3H3KA 1VHPA 1FG9C 4LHUD 2OTUA 2BNQA 3FB8A 1FJ1B 5K9QI 3LV3A 1BJ1H 2NX5A 4HF5L 2JJUA 4CADA 2E7LC 1NKRA 1TNNA 2ED9A 1C1EH 3T3MF 4G42A 1MHEB 2BC4A 5FYLH 3NFPA 2AEQL 4ZO6A 3UBXI 2LAAA 3DIFB 3RUGF 1MIMH 4QXUH 2X4OA 1PX3A 5TE6H 2ADJB 1I7UA 2O5ZH 3UDWC 5EULV 3GSXB 4WY7L 5E8NA 4G3YH 3BUTA 2E5EA 4E42B 2CO6B 1W8OA 2DI9A 4UIKH 3TBVB 1IAIM 1OSPH 4ACPA 2CK0H 1YECL 3MODH 5FYKL 5IFJB 3UJTH 2QBWA 4G7YH 1HINL 4X5XB 4YHKL 4CMHB 2V7NB 4JPKL 3BRGC 4YFLF 3LDBB 1TVBB 1FHGA 4K7FB 4UOW1 1YMHA 4WW2A 3QWRD 1EAJA 5F1KC 3MCLH 4GBXD 4OLWH 2FJHB 1X5HA 5DEFB 2GJZB 1GIGL 2NY5L 1CFSA 1T0NA 3D2UB 4Q7DA 1I9JL 3KR3L 1D5ZB 3GSNA 4Y1AE 4M6MH 1MCPL 1B0RA 1YY9C 1F4XL 2F54B 3H3BC 5TJWK 3WLBA 4LSQL 3BDXA 3P4MB 4PRBB 4WI7A 4PRHB 1UJTA 1Q9KA 3QCUL 1XGPB 2RFXA 4HIEA 1K85A 2LFGA 4BH7A 4MQXD 1FIGH 1RMFL 4LVEA 1GYAA 2F53B 2DLFL 2J4WH 1XIWC 2XV6B 2C3XA 2LAGB 1DBBL 3I84A 4P2RA 3P9MB 3PNWA 4WEBH 1CI5A 3FQNB 3GSVB 2HLFC 1GXEA 5F70A 3O45B 1BFTA 4HS3B 5ERWB 2YWZA 4ODUB 3G6DL 3GMPA 3QUMB 4MVBA 3QA3A 3IETA 3ZE1E 2BMKB 4ODXA 3MOBH 3SO3B 1JFMA 4APQC 3ZL4L 4MDJA 35C8H 1F4HA 2Q8BH 2A9NL 3G5XA 4YDIH 1U8PA 3DUSB 4L3EB 4S0SD 4PTUA 4YBLC 4HJ0D 5ISZE 5F1OB 2GSGB 3D39E 1A2YA 2VZOA 3FQRA 4OZHE 4GW4B 3EYUH 4L5FL 5IW6A 3VXQB 4GH7B 1DQQB 4N8VG 3BKML 3I6KB 1MCFA 4R26L 4G7VL 1MCOH 2CRIA 3AMKA 5DMGC 4RA3A 3VXRA 1EUTA 3MLUH 1FN4A 4OKDA 1FLRL 2HTLD 1HNFA 4C4KO 4OCRH 4RMTA 1N5AA 3EDEA 4UTBL 3IFPA 3QEQD 3BHBB 4YO0A 3JSSA 5HGHB 1G1YA 1WTLA 3K7UA 3SDAC 1LQSR 5GS0D 4I4WA 3K80A 3MLTB 1KYOK 4N8CH 3UPRA 1QNZH 1XT5A 3ARFB 5B39B 3GMNA 4JANB 1JYWA 2YKLL 1CXFA 5CJXC 1RZJH 2VIRA 2FR4B 1B0WA 3BEWA 5JNYA 5JORA 1D5MA 4ISVB 5JW4Q 2X4SA 3ZKMD 3GSNL 3P11H 3OSKA 4ZPVA 3R0NA 3GMRB 4PJ9A 4FABL 1YUHA 2R56H 3SKMA 2XWTA 4MXWH 3NN8A 2R69H 4R7DA 3MV8D 1BD2A 2XNAA 1PY9A 4KPHH 4QEGA 1NLDH 3UJJH 3G08B 5EOTA 1V3KA 2LTQB 3VW3H 4X7SL 3FTGB 2F9BT 5HGGS 3SDDD 3K2UL 3WFDL 2X4PB 2OR8A 2PO6C 3HAEH 3L5XH 2NY2C 2ZKHH 1KCUL 1LHZA 5EO0A 2YPVL 4YZFF 4BQBA 2XFXA 3HMWL 4JHZA 4YHOH 2Y6SD 3SKOB 4NC2B 3U9PH 2JJSA 1IGCH 3LKSA 5I16A 4IMKC 5C6TL 3E1F1 3MLYL 1Z9MA 1GZQA 3SJVD 2I5YH 2FEDD 1CU4L 4PJFB 3DVIA 3MJ8A 5J6GA 2AJVL 4PR5A 3NCMA 1EK3A 2P42B 1T1ZB 4KK5C 2P8PB 5TE4L 4NZJA 2VKXA 1CDYA 4O58H 4LMQI 1D6VL 4MJID 4FTVA 2E6QA 2WWKT 4MNGE 5KZCD 2R0KH 4U6VL 5D7IF 4EBQL 5J12B 4D8PB 1A4KA 4JZJA 1NMCB 3MRRB 1FGNL 4LPCA 5J3HC 5D1ZC 4J3VA 5I1DA 4MQ7A 4WV1B 4WHDA 3ET9F 5IB4A 4ZFOB 1R5IA 2WBJC 3IRPX 5GSVB 4M7LT 4O2CB 3MLWH 4PRPB 5I8OH 3OR7B 4PB0L 5C0AD 4Y16D 7FABL 1P4BH 2IFFH 3BQUB 1SVCP 4WI3A 3EDJA 4FQLH 3QPQD 4N1HB 2DQFA 4Z7VF 5JW4R 1MJUH 3MRLB 4V1DE 3PL6A 1KT2B 1KF9B 2Y06H 5ILTL 2ZOKB 1BGXH 2D4DA 3LKOB 2WNGA 4KI5E 4UBDC 2J88H 3E3QC 4XCNA 4J4PC 5SWZD 2WQRA 4PS4L 4UT9L 3QJFA 3SKNB 3VXNB 4OCXH 3S4SB 1Q94B 4R96B 5AG8A 3HRZA 2XTJC 3B9EA 1FYTA 5KJRH 5BW7A 1B3JA 1F58L 1QBAA 2HG5A 1XGQB 3LOWA 5T3ZH 3QCTH 2GAZA 1PEZA 3TPKA 1HQ4A 4QF1A 2EDQA 5FM8A 3TBWB 1LE5B 1OAZL 3GI8L 4XVUD 3C8HA 4LLDA 1UB5B 1ONQA 3VD9A 1CLYH 4HS6A 3DTXB 5FYKU 2DI8A 1LK3L 4S1SH 5DF0A 4NYLB 4LU5H 5FDYA 4WCYL 1CZ8H 3ZTNL 3SDCA 4X98B 1FVCA 2CMRL 3INUH 2B5IC 3OL2A 3FONB 3DXAA 4UB0L 2NTFA 5MEPB 3LS5L 1F2QA 3ECBB 1I8MB 4ONGH 1EO7A 3RJQB 2B1HL 3FQXA 3K46A 4H88L 3WUWB 3LPFA 1EFXA 1CGXA 3DURB 1IGTB 2WMPA 3IDGA 5DVOA 3V0AC 3VFNB 1OF2B 1QKZL 2DQEH 1KPUB 2V17H 3D2UD 1BFSA 2XA8L 4PTTB 2ZSWB 3S34H 4MJ4A 2R4SH 2Y23A 3CFEA 4Z18A 1NGWB 1BVKA 1BFVL 2OZ4H 4NQDB 2F54D 1CBVH 1DFBH 2IADB 2VQUA 3MUY1 3QDMA 1DQLL 3OAYK 1N7ML 4J3UA 4U2YA 3KAAA 1CLOL 4ZXBB 4PRHD 1CFTB 2J12B 2YRLA 1KUMA 2AI0L 2VXTL 2HVKA 3O9WD 3PGCA 5H94B 2F53D 4M00A 1NGXB 1RZJC 4GAJH 5FUOH 2NXZB 2AGJH 3G04A 4WO4C 4P2QB 4RISH 5INDA 4LLYA 5IFHH 3CSYB 3MA7B 5MERA 5MEOA 3CFKB 2IH3B 1JF6A 2GW5A 1K8IA 2UUDH 4HX1A 2BP3A 3VFUA 1FE8L 1KCSH 3QIUA 2CGRH 4WU7A 4MQTB 2VABB 3UTPE 2D0GA 4HLZG 1IMHC 2IQAB 4I77L 1RJLA 3V0VA 5MENE 3CDCA 1XCTA 2XKUA 1VKXB 4JRYB 4L3CA 3LN4A 2PYFA 3CFBA 3DRQA 1RMFH 4L3ED 1CG9A 5GGTA 1QVOB 4ZD3L 4C58B 5HVHC 3MMEA 5E4EB 5DD5H 3MRHB 3QUYC 2FATL 2B4CL 1GGCH 2Z93A 4LEXL 2H1PH 3TFKD 4K3GA 4QRRB 3O41A 2EKSB 4K9EH 4R8WH 1OAXL 5HDBF 4GRLC 1AJ7L 1OGTA 2X4TA 1BIIB 4YDLC 1IQWH 5DD3L 5EU3A 1YYLL 1ZS8B 3Q0HA 2DQUL 1O0VA 3CUPA 5FDWA 4D0CB 1NCDL 3ELAT 1CGYA 2VDLL 3HZMB 2L0DA 1U41A 2MHAA 1FDLH 1QP1A 1A7BA 1MPAL 4ONOA 5E7FA 3U0PB 4LIQE 5IROC 4XNZC 3M45A 5D6DA 3QFJE 3QO0B 5B38B 5EU5A 3ARFD 4M6NL 2P5WE 4Y2DC 3RNQA 3W0WA 4CMMA 1RZKH 3EYFA 2DWDA 4EEEA 3PF2A 4LVNC 1VPOL 2EYRB 3HC4L 2IGFL 2BX5A 1FV1A 4X7EC 3TEUA 1HZHH 4L8SC 1A02N 4OI7A 5B4MD 4Q2ZB 1HNGA 3A0OA 4F8TA 2E7HA 2YD8A 4JO1L 4CL7A 5DVNA 5F9WB 3U46B 1EZVY 2EC9T 4HPYH 4D9RD 3HPLA 4H1LG 4M5YL 3WNNA 3RZWA 2YPLE 5KSVA 5GZOD 5CP3A 4FFVC 2P8MA 3VGAB 4U1IA 5CJQH 1JPFB 4PJAA 5MHSE 4ZYKA 3HG1B 4HJGB 3CC5B 3H7BB 1ES0A 3K4AA 5CGYD 2NY4B 4CVXB 1WT5C 1NAMB 1BLNB 2X9WA 5FGBA 4PJIE 2VXQH 4FNLL 3BO8A 4MA1C 1AQDA 3I2CL 4X80L 4BQ6A 2RHEA 4N0YL 3QBTB 4KK6C 1OGAE 1QACA 3BMVA 4DGYL 3V8OA 4NSKB 4R3SB 3DX9A 4L29B 5KSUB 2XG4A 3PABA 3ARWA 5IUSA 2FHBA 4JB9H 4HIIA 4OD2A 3AS0A 4M5ZH 4PJ5A 4ZAKA 2JK5A 3G5ZB 3QWOB 5GGSA 3LD8C 5JO5A 2QADC 5I1EL 5F7YC 3ZDZF 1DJSA 2P4AB 3HLAA 5B3NA 3KPRA 5F3HA 5DR5L 1KCUH 1UCTA 3IXTA 1CD0A 4ZUVA 4LHQB 2FLBT 3DV6B 5CMAB 1ZE3C 1RZ7H 4JFHD 5EBWB 3D3VA 1N64L 5EOQL 1ZVSB 1ZKAA 4GOSA 4YNYB 5DJDB 4Z0XA 2V9RA 1ZHNA 1RIHL 5I75C 1RULH 3GJFB 1HWGB 5BV7L 4GMSH 3TIEB 4BQCA 1MHHA 1GGUA 1WZ1L 3BQUD 2WV3A 5IT2L 4HS8H 5D7LB 1CFVL 3ULSA 1C08B 4HMCA 4MD5A 5FGSA 4PB9H 1YMME 1ZT4B 3SDXE 3B9DA 4XVTL 8CGTA 4MXQA 4S2SB 4FQ1H 3BKJH 1BQLL 5EFIB 4OZGA 1A0QH 4L3AA 1HH6B 3GMLB 1DUYB 2IH1A 3V0WL 1GOGA 3RVUC 4HBCL 5L7XH 3O2DA 5D1QB 5CILH 4TOYL 5DRXB 5FOBB 5JXEC 4PJCE 1LO2L 2W91A 1KIRA 1QG3A 2PCPB 5FA4B 3QRGH 5ENWB 4LRIA 4QHKI 1WGOA 5FYJD 3LS4L 1MFDL 3LSOA 4K7PY 4HG4J 2JCCE 2HH0L 5TQ0L 12E8L 5ICYA 1JZ6A 4G8EA 1VEMA 1LO4H 3IJYA 4I48A 5EWIL 3E2HB 2OL3A 4M3JA 1FNEA 4RBPK 2YEZA 4RRPA 2HT3D 3VG9B 1L0QA 2GY7B 1DUZB 1MFBH 3EO9L 3S96B 4NQEB 5D7JB 3GHBL 1AIFA 1FNLA 3PIQB 4J1UA 2VZUA 1I9IL 2EYSB 4MNQA 3RWDA 5F7DB 1A14H 3TA3B 3RKPA 4LHUA 1UADC 4P46D 1MI5D 2HJFA 2G5RA 4TRPL 2H3NB 3GDBA 2G2RB 3EHBD 2R0WH 2Q20A 3FFCD 1SYVB 1AR1D 1I1FA 2ID5A 4TUOA 1T4KB 2Z9TA 2IPKA 3WIIH 1AGBB 2L7JA 4U31A 1H3VA 5DWUH 5TGBB 3BP4A 3HFMH 4HWBA 1L8JA 4OFDA 4XMKH 3VCLA 1D5IL 1ORQA 4PRNB 5DMIL 2ATKB 4UUJB 2NY6C 4AQOA 4YXHL 2DQTH 4NQDD 1KJVB 1ZA6B 2SEBA 5FB8A 3JTTA 4PIRF 5EU7E 4WFFE 2AKRB 3I6GA 4HUUB 3GEWB 3WNOA 3U6RA 2AP2A 4OFYD 3UJIL 5K9OB 3QWRA 1LNUA 4KKCC 5EU4B 4I9WE 4ZXBD 1HQRA 1V5JA 2FIKB 4KHXL 4J7RA 3O8XD 4Y1AB 5HDQH 4GKNB 3AS3A 1DN2A 5J7CC 1EEUA 1OARH 4P2QD 3ILQC 2BFVL 4GXUN 2HN7B 5L88H 1MQ8A 4XWOC 4EDWL 5CD5D 5CEXA 3F62A 3QNYA 5EBMB 3IDMB 1RUQL 2DLEA 4OKVA 2V9TA 2XA8H 1TTGA 4BK5A 2NXYC 5T3XL 2F5BH 5T1KA 1LDSA 2A6KB 3TYFB 9CGTA 4PV8B 2NY0C 1ITBB 5KVDH 5CJ5A 4Z95L 2WIIB 3RPKA 2MKWA 3NA9H 3ORJA 1CDIA 2WLYA 1JGLL 2FGZA 3BP6A 5B38G 5HI5D 5EC2A 5KG9A 2NY7L 2MPAH 3SGJC 4NZRL 1M05A 2ITCA 4Z76A 3IAGC 1EV2E 3HE6A 4JRYD 3V5DB 1FSKC 5FYLE 4JQVA 1NFIA 1MF2L 2OL3L 3LRSA 4OLYL 5GZNC 5F88A 3EGSA 3OKNB 3NZ8B 4I3GA 5C0RH 5CWSA 1YEFL 5JIIA 3ESVF 2R1WB 3D0LA 5ISZB 1J05A 2R1YB 4YC2C 3AREB 3D39B 4XP5L 3DX6B 1JGDB 4OZHB 5KSAC 3BH9A 1IEBB 1JVKA 5AYQA 4U6XA 1I9RL 3Q6GL 1DL7H 2IAMC 3IU4H 1GC1C 5FUCE 4RGMB 3GUTB 1T22A 4OTXH 4XNQA 1HILB 2VC2L 5C0IA 3WBDA 2YD6A 3BZFA 1WJ3A 5F7MC 2PW1A 3QUYD 3CX5J 5HHQB 2YOCA 3VFWB 2MFNA 1L4IA 1OAYL 4CDHA 2O5XH 2ATPA 5T5FH 5KVEL 3G9VA 1KNOA 4HWBL 5DD6A 4IOSD 4JM2B 3IXAA 4F8QA 4XZUB 3MNVA 3ULVD 2IEPA 4HPOL 3U7AA 3MOAL 3RPIA 3CZFA 2H8PA 3JV6B 1YNTA 3L3IB 4I0PA 3O3DA 4PY7A 4GRWH 3KLHD 4Z78A 2VERN 1QSEE 3NIDE 1HKLL 2A1WH 4YPGA 4YHML 2PUQT 3U30C 5T33H 5HVWA 4P4KA 2OR9H 3V4PL 3IVKA 5ALCL 3HG1D 4X7CC 4RAHA 3QQ9C 3GBNL 2VLJE 3AVEA 2NY4D 1W0WA 4M7JH 2BVQA 2BY3A 2RAMA 1VPOH 3MPCA 4PV9B 2IGFH 4Y4HD 1W72H 1INQA 1U2HA 3WYRA 4PJHF 1J1XH 2BVOA 3CK0H 3ZT5A 4KTYA 3MV8A 1KGCD 5F7WC 4GT7A 3UYRH 3WDJA 1A6AB 4TTGA 8FABA 3GSRB 4ZOCA 2W9EL 2FBOJ 2I25N 4G8FB 3RGVA 1PQZA 5HYJE 3TVMB 2C7UA 2FEEL 1UACL 2OQJB 3EO0B 4P2OA 5ICZA 1T7YA 2HRLA 5TDNB 3U7WL 3X11A 4D9LH 5HHOD 5BQ7A 2FHFA 3BPLB 2D7OA 2OK0L 3FQUB 1E6OL 1MLBA 1AHWC 5HGDA 4PLJD 5BVPH 3TNNA 4CVWA 3VWJA 4CRPA 5JW3L 2X4UA 4OGAD 5DQ9B 3SJVA 3P4OA 2BVEA 4M9PA 3HCVB 3ARBB 3RX5A 2N7BA 4MNGB 1NKOA 3S7GA 4ODHL 1KELH 3L7FA 2C1PB 3IGAB 2E27H 4MJIA 3U36B 5D2NE 5D7LD 5F9DC 3OKMB 3DSFH 5F9JA 2OSLA 2VAAA 5BS0A 1UA6L 2UZYB 1MREH 4OD3H 2ITDA 1TIUA 1FVDA 2X7LB 5ACLA 1MRDL 5GGTH 1UT9A 5C1MB 1ZEAL 1DDHA 3O2WH 5DJYA 5L8LB 2ZZUT 1JFQH 4C83A 2D3VA 4X0KA 1QLFB 3E6HB 1NC4B 3MV9E 5MI0C 5I1GL 1QA9A 1RHFA 1VA9A 5C0AA 5D1QD 4W4OC 3S5LG 4V1DB 1EO8H 3DWTA 5IG7A 4LLUB 2APVA 2A2QT 1DR9A 1IT9L 4PJGE 4OGXH 3LB6C 3BW9A 3B43A 1HYSC 1CFVH 1IKFH 3VWKB 3IFLH 1MCDA 4NO0B 1FORL 5GS0L 1JWUA 2BSTB 1JZ7A 4GXVL 2VLKD 1HI6B 2J5LB 1D9KB 1P7QA 3NFSH 3NFNB 4XNUL 1BQHG 3CXDL 2CUIA 1PG7W 2A83A 1AFVH 2AK4E 3V4UL 2IG2H 3P0GB 4WFHE 3IKCB 5IVXE 3V0WH 4DOHE 4NQED 1I8IB 3OR6B 2R2BA 4HBCH 5D7JD 1NAKH 1T1WB 4F9LA 2GQHA 4L4VE 3QDAA 1X7QB 2F5AL 3V52L 2J8UF 2JB5H 4IRZL 4OLZL 1CE6B 4TPRL 3TA3D 4BKLB 4OV5A 2XXMB 1E4KA 2YD5A 4HWNA 1FJ1A 4QRSB 4QHNB 1E0OB 5CP3H 3QQ4B 4O4YH 5DJCB 1U8QA 1UZ6E 3C60B 5CZKA 4M1GL 2R0LH 1NFDF 1NCCH 4JN1L 3VRJA 1QRKA 3LMJH 2X44D 3JV4B 2NY3B 1XAUA 1CLCA 3V4VL 2ADJA 5JQHC 1RUPH 2VXVL 3GSXA 1K4CB 5I9QC 1NGPH 3ULUC 1I9IH 4LCWE 3TBVA 4PJEE 1QFWL 2DYPB 2ICEA 4X4ME 4LRNH 1EPFA 2J8HA 4KJPC 2GTZB 2V5SA 4GKZA 2V7NA 3QXDB 1CIDA 3BUYA 4EUPA 1ZT7A 4RQQB 4QY8B 1OW0A 1G7HB 3N1PC 5EOCL 1I7TB 3RQ3A 3PHSA 2FJHA 1MJ8H 2F74B 3RVXD 2GJZA 2H41A 3WXWH 4Y1AD 3MRJB 4PJXE 1JNNL 2WM0A 1M1SA 3FQWB 4BFGA 3D2UA 1D5ZA 4YUEH 4D94A 4IIQA 2M8XA 1N0XH 3CIQA 3CSBA 4YR6B 1KTDA 4ELKA 1G9NL 4XWGH 2NY6D 4YE4L 2Q86A 3MSPA 4MHHI 3P4MA 1MJJA 2HTKC 4F33B 2GITB 2MCPL 2QR0B 4IRSA 2VITB 3W9EA 1O5DT 5C08D 4LMQE 3ALWA 2ZCLL 3VI3F 1C16B 2EEAA 4OM0L 3FQNA 3IDXH 4XI5C 5FECA 4ZDHB 4HKZB 3O45A 4HS3A 4LSVH 3ARDB 4U1HB 1DSFH 4FHBD 3RGHA 5C0JB 5MENB 2BMKA 4EI5A 4IDJL 3O2DH 3PHQB 3MRIB 2FO4A 3IDNB 4TSCL 2FGWH 5LWYL 4Z8FL 2FX7L 1F4YH 1A6TB 2W0KA 1JGEB 3K4ZA 4UIMB 2NLJB 1JPTL 1XCQB 3DUSA 3T2QA 1R24A 4XVSL 4N0FA 1HIML 2QJDA 2GSGA 1G9MH 1IVLA 3L5IA 1OTUD 3U82B 4GW4A 3UAJD 4IM8A 3X3FH 4BFEA 4U4BA 2XZQL 2J6EA 4JR9H 3P3YA 4IOFC 2HRPL 4ALAH 3I6KA 3SGKC 3VFOA 2DQIL 3MLZH 4JFEA 1IGYB 4K3JH 1RJCA 1WV7T 3AY4A 4F2MA 1J0YA 4NOFA 4KRPB 2Q76B 4I3RH 2A6IB 2JIXB 4KRLB 2DQHH 4CGTA 4FQXC 3MJ9A 3QFJB 2FEEI 1NANI 4RFNC 4EI6A 2ICWJ 2P5WB 4KKLD 1TTUA 3MRPA 4LGRB 2B2XL 3EO1B 3L3KA 4Y19E 3MBED 3QZWB 3ARPA 1ZGLB 1UH3A 3ARFA 2A0LD 5B39A 3VFGL 4JANA 1S9VA 4PRDB 3CPLB 1A7OL 4PUBL 3MA9H 1I3GL 2QTEA 3ZYZA 2M1KA 1JHTA 1RVFL 3QCVL 1CR9L 2D9CA 4ISVA 4KKBC 2YPLB 4E0RB 5TQ2H 3MYJB 1JMXA 3GMRA 1T83A 2XY1A 4M61B 3FO0H 4LARH 5CUSL 1ZLWK 3UYOD 1DQML 3L6FB 5EPMB 2GYSA 3G08A 2GK0B 4R2GB 3HB3C 3RWEB 4PDCE 5K9JL 4DFIA 2X4PA 1A9EA 4PJIB 3TH3T 3SCMB 1J5OH 1CL7I 3SGEI 3ZE1F 1OGAB 4XGZB 5ANME 3KLSA 2ZUVA 2BK8A 5IMLB 4JPVL 3L95B 2Z8SA 2R1XB 3MRFA 1SBSL 4HK0A 1J12A 3O6KL 4QO1A 1TNMA 3VDBA 3QUML 2PTVA 2GKIA 3OKEB 4AJ0A 2HKFL 3ARBD 4LSPL 5FOJA 3L3GA 2Q3AA 1T1ZA 4OZHF 2P8PA 2RGSA 1P84K 5FKAA 3QI9A 1LMKA 3ARTA 1S5HB 1NANH 3OAYH 5F93C 1RY7B 1XR8A 2ZUUA 1IGML 3BIBX 2E9IA 1OB1B 3MRRA 1E6OH 2J6EL 4EN3C 1C5BL 1HDMA 3FJTA 1SJEB 5GSVA 3GKWH 4O5LH 4PRPA 5HY9B 3DRTB 4KVCL 3ZDXE 1I3VA 4V1DD 4MAUL 4TULL 1YMMB 3ILPA 3SDXB 2G75B 3HN3A 1YY8B 4OIIH 4ODTL 5C09A 3MJ9L 1Y18B 3MRLA 3RZCB 4N0CC 3C5JA 1BOGA 2GCYB 4MA3B 2EXWD 3VWKD 2R0ZL 2ZOKA 1PZ5A 4NO0D 3OXSB 4YHLL 1KCKA 1L7TL 4GRMA 4PJCB 3GB7A 1D9KD 1RHHB 1KC5H 4AEHH 4YJZL 1CL7H 1TVHB 2C5DC 1I1AC 3SGEH 1QFWI 1JK8B 1Q94A 4K7PL 5L6YL 3FO2B 5C70A 1ED3B 3RDTC 4DGVL 1KFAH 2JCCB 3DNKA 2AJSH 4AK1A 1Z6JT 1MCEA 1HK6A 1BVZA 1V3LA 3VGGA 3TCLB 2V2TB 3TBWA 2HWZL 5DJ2B 1RIVL 4FFEX 3P73B 4OZFH 2DQGH 2X9XA 4JHWL 4U3CA 1N4XH 5T1LB 1SVZA 3NTCL 1UB5A 3C60D 1T03H 1QFHA 4Z0BL 4ZNCD 3DTXA 1EAPA 3WD5H 1KJ3H 3MCG1 1JJUA 2OP4L 2MNUA 4NYLA 2NY3D 3MACH 3V4UH 3ARGC 3TT3L 2IJ0C 2WSKA 5E24E 5CGTA 1MJ7L 3EYVB 1CD8A 2ED8A 3G5VB 4FMKA 2EDYA 2X4QB 2ZCHH 5J0BA 5MEPA 1TMCB 3LEVL 3ECBA 1LO5B 3SGDI 4JO3L 2EDLA 4GQ9H 4O9HH 1PD6A 1AGEB 1DLFH 4M8VA 1F90L 1JNLL 4LLMA 1H3PL 4JKPH 3F7YA 2NR6C 3Q1SH 1BPVA 3MUGA 5D70H 4Y8DC 2ZUSA 2ADGB 2ZSWA 3KLAB 2O26U 1A1NB 4ZUUB 1NGWA 4DVRH 2NW3A 3VXRE 4ZFOL 1NBZA 4J6RH 1QFWH 4YDVB 1XH3B 4P5TD 4AM0B 4KVNH 4IS6B 5I6XC 1AD9A 4ZUWB 1CFTA 3QWQB 2NZ9D 3D25A 3EUUA 1YZZA 5H94A 3NCJH 3MRCA 5KTEH 2CKBH 4GS7B 4FXLA 2R2HA 1NGXA 3PGFH 1NDGA 3OGCB 1CE1H 3VXSA 2ZCKH 1IEAB 3CSYA 3MO1B 4ZOEA 2DQDL 3CFKA 1HEZB 1T7VA 2NYYC 1FZOA 3N0PB 5F97E 5E2UL 3UTPD 1B90A 4H8WC 3ARDD 1T3FA 1IGJB 4OD1H 4AT6A 4QOKD 3Q6FB 3IDYB 1EGJH 5LGHL 2VOTA 2D7TL 3ARQA 4J3SA 1BD2E 3ZE0E 3OGOE 5C9JB 4X7FC 4M03A 3QQNA 4NT6A 4JRYA 3OZ9L 2YMXH 5D1ZB 1QVOA 1JHKL 2B39A 4EVNB 4U1JA 3LQAH 5B8CB 5E94A 3LN5B 3PDOA 2GTWB 5H35B 4XAWL 3C5ZD 3MUHL 4YBHA 4QRRA 2EKSA 3RI5K 2JJWA 1BIIA 2PW2B 3QXWA 4XPAH 3VH8B 1IARB 4YGAB 1G0DA 4LPXA 1SJHB 4BSVA 4EQ2A 1P6FA 4KRPD 4XVJL 3OAUH 2AXFA 3S88L 2JIXD 4NJ9H 2HT4C 3HZMA 1HCFX 3ROLB 4ZFFB 4LNRB 3T0VA 3THMH 2OX5A 3PV7A 3QO0A 3FHQA 5KSBF 4L4TD 1EA9C 2FBJH 4EJ1C 1MCCA 2XZQH 1OAKL 5I15L 1QOKA 1QQDB 1NMAH 1QSEB 4RBPH 3RAJL 2YPLD 5ACZB 4RWYH 4NWTH 4BZYA 1BHGA 4NJAL 3U46A 1Z0MA 1TFHA 1IQDB 4O2FA 5HBBA 4P2CG 4V3EB 1I1CA 2EZ0C 4Y5XC 1KEGL 2VLJB 2OJEB 4R2GD 1JPFA 1PW3A 4D0BB 3UBXB 4EUPH 5SWQB 1XGTA 3HG1A 4HJGA 2R2EA 2EDFA 4H25A 5E2VH 4GAYB 3SCMD 2B5IB 5GJSL 1NAMA 1BLNA 3DHMA 4WRLA 5DT1H 5JW5B 1OGAD 3P0YH 5D96B 4F7TA 3ZKND 1LEKB 3C6LC 3KPNB 1WAAA 2P8LB 1Q9WB 3ULUE 2HT2C 1RQ5A 5HYJB 5SX4I 1U3HC 3AB0C 4NSKA 1BJ8A 4YHNB 4DUVA 2MTPA 5F71A 3HTLX 4JRXE 3MGAA 4ORGB 4U0RB 5IV2A 5DA0B 3CNKA 1S7XB 2DQJH 2YD1A 4NC1C 5HSFA 3C09B 3S37X 1JZ5A 1MQKL 3CLFL 4R0LB 2C26A 5I8EB 1RFDL 1R5VA 3PGDA 4JG0H 1HYRC 2MOVA 3G6JF 4HSQA 5IM7B 1AE6L 3UO1H 4X6FB 5C7XH 3O6ML 5CMAA 5LG1A 3O4OC 3PHOA 3WSQH 4HXBL 2PYEE 2A6JB 5D2NB 3CDGB 3S3JA 4GRWE 3TIEA 1JCKA 3DMMC 2FB4H 3SE3C 1YMMD 1DP0A 5EN2B 2ARWA 4HAGA 3PQYA 1U9KA 2PXYC 3BT2L 4QT5B 4Z5RB 3O6FB 3LH2L 1C08A 4ODBD 3RZCD 2LVCA 1QUNA 5I66A 1ZT4A 1WQVT 4L1HA 3B9KA 3QG7H 1UC6A 1A6WL 3MV9B 5JDSB 4EKXA 5EFIA 2DKMA 1Z5LB 2KDGA 1TZIA 3RNKB 1G7LB 1DUYA 3Q3GB 1MCBA 3I3DA 3UTTE 3JWDL 1U93A 5D1QA 5A2KH 4PJGB 4JFFE 4UAOC 3SQOH 3HAEB 3ULVL 3V6OC 1MWAA 1JPSL 1U92B 1ZT1A 1INDL 2PCPA 4AENB 1AXTH 3TO4C 4L9LA 1MEXH 4HFWB 3BGFB 2AJUH 5ESQA 2Y7QB 2AK4B 3VFRB 5IVXB 3E2HA 4IJ3C 4DOHB 1JUFB 1RU9H 2XKSA 4L4VB 5F3BA 5IQ7H 2V7HA 3NPSB 3CXHJ 3S96A 4OCYH 3T3PE 1NAML 4NQEA 2KZWA 2EYSA 4F3FA 4OZIF 3RDTD 3TA3A 3WMSA 4OFPA 1CGVA 1UQSA 1ZLSH 3IDJA 4Y2DB 1QLRB 4LVNB 2H3NA 3RY6C 3LQAC 3S98A 4L8SB 4XC3L 3X14B 5GS1C 1J1PL 1V7ML 2D03H 3EDDA 4J3OC 1YQVL 1R3IH 4X7TA 4JEGB 4LCWB 3WJLA 1S7TB 5BMFL 1AGBA 4PJEB 1ZANH 2EIZA 3ES6B 5TGBA 5I73B 4OAWA 5ADPL 2EDJA 5GIRB 4WFFD 4Y5VB 3VFMB 4PRNA 3DVNA 1Q0YH 2ATKA 3HE7A 4G6JL 1CICA 5FKPB 2VDOH 2F58H 1KJVA 1VACB 4I9WD 4R90H 5AYUL 3SDXF 4HUUA 4PJXB 3TGXA 5K9OA 3F7VB 5EU4A 1I1YB 4FN0A 5EA0L 4YHPB 2EH8L 4JRWA 4K8RC 1J8KA 5JZ7D 2Q87A 5BVJA 3W0WE 2HFGL 4WGVB 2HN7A 2RR3A 3BKYH 3GM0A 1CXIA 2H26A 2NR6D 4M6OL 3IDMA 1FNGB 3V2AR 2H6PA 4LCCC 2A6KA 1RJYB 5F89A 1QPXA 4PV8A 3TYFA 3DSNA 5FO7B 4JCMA 5IBLC 1KLUB 2QLVB 4S1RH 2WIIA 2JCCF 4I13B 4PLOB 4HXAH 3C87A 5FYLD 3WS3A 4KQ3L 4JG1L 4XBGB 1U8IB 1XF5A 2Z35A 2XYCA 4PJAE 4BM7A 2VAJA 3DI2B 4FXKA 4MWFB 2AXGB 4KTDL 2QL1A 1WICA 3VXOA 5I19H 2JELL 3RP1A 4JFZH 3OKNA 2AK1H 1KENL 2ZUQB 3GMMA 4G6KH 1S7SA 2IQ9L 1AXIB 1MFEL 3R4DA 2W60B 4HUWB 1NBVH 5JHDA 4HZLB 1LGVA 5E2JA 2R1WA 43C9B 1O7VA 5IMKB 4YK4B 4HWEH 3O3UN 5ISZA 3SE4C 5JPMB 2OJZL 2R1YA 3CMOL 2CD0A 2NY5C 4U6TA 3AREA 3D39A 3AMLA 3DX6A 2XI9A 5HYSG 3H8NA 1IEBA 2GUOB 3OG6B 4U1MB 5F7EL 3MLXH 1HHJB 3I3BA 5IB2A 2X89D 1MFCL 1PZUB 1KIPA 5BZWB 1TZHA 4OB5H 4MA7L 5IMMB 1HILA 3EJZC 3BISA 1NDMA 1CGSL 1EXUB 4O51B 3MREA 4XP4L 5GGVY 3VFWA 4NN7C 4IRJC 5IVZB 4JM2A 4LAQH 4LLVB 4MAYC 4QXTA 4F7EB 3TBTA 3D3VE 4XZUA 1QSED 5TE7L 4Y19B 5KS9E 3ZHKA 3JV6A 3A67H 5D93B 4KUZL 4PJBA 2E8YA 1DLHA 1VADB 1AO7A 4Z7OE 2HT4D 5EIQA 5IQ9B 1HHGB 1KN2H 2VLJD 1Z3GH 5IJKA 5B3JF 5EO9B 1QR1A 4OLXL 1GPOL 4W6XB 5E2WL 4RMRA 1ZLVK 3RWHB 1P9MA 4S1QH 2VXSH 3OX8B 1LE9A 4CN1A 4UU9B 3HR5B 4GG8B 5HPOA 3T8XA 3NCEB 1I3RA 4NPYB 2GJ6A 5HYJD 4YHIA 3QG6B 6FABL 1A6AA 3MRGB 5DGRA 1J1OL 3OAZK 3WV0A 4ELMA 2AJ3A 4WUKH 4LBEB 1MRFH 3BEVB 4LCIH 1A7QL 3TVMA 2OQJA 1R5WB 3EO0A 4X6CF 1J0ZA 3L3DB 5IGXH 5TDNA 5I17A 4OCWH 3FRPG 1P53A 3QIWD 3FQUA 4JZNA 5KANG 2GFBA 4WI9A 4HUXA 1DVFC 2I60L 4PLKD 2Q8AL 1XF2B 1C5DB 5DQ9A 1FRGL 3HCVA 4UI2A 2CIIA 1K4DA 5AUMA 3U4BH 5D4QA 4MNGA 1PEWA 1PSKH 3DYMA 4UINH 2D4FA 2AQ2A 3IGAA 1NLBL 3OKMA 4NM8H 1OAUH 1KG0A 1I7UB 2X7LA 4TUKL 1GGBH 5E1AB 5TPWH 2VLRD 3FOMB 3WS6A 4DZBB 4CUCA 3MV9D 1LO0H 3LZFH 4FG6C 4XH2B 3VRIB 3ZKXC 4JFDE 1PLGH 2WUCH 5CKGA 3E6HA 4O2EA 1NC4A 4WW1B 3KLDA 4ENEC 3VMNA 5EU6E 5IW1A 4C59B 3FT2A 4JAMA 5EB9A 4EOWH 3P9WB 4WW2B 1FSKB 2UZIL 2QHLA 5SWSA 5I18L 2CUHA 1J87A 4XX1E 4MXVE 2QSVA 5LGKA 5JXAH 3WFEL 1GSMA 3IS0X 3NPZB 4XPGH 3EBAA 1YEJH 1K6QH 1L0YA 2AK4D 4WFHD 4IMLB 1KULA 2A38A 1INEL 5EZJA 4LSTL 3WLBB 2J2ZA 2K7PA 4FFYH 2ARJQ 3L3OA 3B6SA 3IKCA 3KPMA 1VB9A 3OR6A 4HMEA 4QGTA 5DQDH 4ZS6D 1X7QA 4KMTH 2P45B 5TDOB 3KYKL 2DI7A 4Z7QE 4I18C 4BKLA 1JPSH 4DUXA 4LFHD 2ORBL 1B6UA 3MLRH 4QRUB 3B8SA 3H9HB 1IBGH 3QT2A 4QRSA 3EFDL 4QHNA 3VD5A 2VISA 5BXFB 2AEIT 4YDKL 3GMPB 4WUUE 2YBRA 3PWLA 2VDRH 3QA3B 4ODXB 4S0TD 3JV4A 1CD1B 4LCWD 4MDJB 4N8VA 4NP4H 3MCKB 1U91B 1UCBH 3SE9L 5C3TA 5EZOL 1MVUA 4OV6F 5D1XC 1K4CA 3HNTH 1FLTX 3ARZA 1U8PB 4PTUB 2DYPA 3RIFF 2N7AA 4HCRA 2GTZA 4NNPH 3W2DL 1A2YB 1FFNB 4S1DC 4P5MB 3FQRB 5CJOH 4PY8J 2DDQL 3HI6L 3I50H 4RQQA 4S11A 1A3LL 2BNRA 2Z8RA 5HYIA 5IW6B 2YA1A 1ZLWH 1T5XB 5GISH 3CFCH 5DJ0A 5C0BA 4B50A 4KJQC 3LEYH 5GRXG 1J1PH 3KJ4C 3FQWA 4PJ9C 3PWJA 1R0AH 3VXRB 2HAZA 1CXKA 4KTEL 1FN4B 4Z7UF 4E5XA 4MS8A 1EJOH 1A3RL 2R4RH 3TT1H 5T3ZD 3X3GH 4B7LA 1KBGH 3R06B 3C8DA 3IFPB 2FYYB 4PFEA 4YO0B 4TSAL 1NL0H 5TH2B 1MFAL 1IKNA 4LSRH 4WHYG 4FXGA 4X5LA 4F9PC 2QV2A 5IB5A 2XZCH 2KZ1B 4NRYB 4WVRA 3T04D 1YNKL 3NZHL 4RMWA 4AYFA 1A7NH 2VIRB 4NC1E 2VITA 4M62L 5I30L 5GQBA 3LPGA 32C2B 3BEWB 4F37K 5JORB 2PR4H 2JJSC 3GSOB 1C16A 3HR6A 1A64A 4ZPVB 1RZ8A 1DBAH 1YUHB 3SKMB 1WWCA 2XWTB 3EYSH 3O3AB 3C08H 3NN8B 3ARDA 4R7DB 3CJJA 3Q2CA 4ERSL 1BD2B 4DKFL 5C0JA 2EE9A 5MENA 4UT7H 3NACH 4G80B 3PHQA 3MRIA 4KV5E 3JVGC 4Z7WA 1BF2A 1Q9OB 1A6TA 1JWMB 1JGEA 2K1MA 1AR2A 1KB5A 2NLJA 4UIMA 1MWAH 4PJ8D 2OMBA 5HI4D 4AZ8A 3CFDA 5ITBL 5L0QB 4JZJC 4MMZC 2IBZX 4P23C 1NBYB 3BN9C 5MI0B 4PRIE 1UJ3C 1SEQL 4DN4H 4POZC 2JELH 5LJYH 4G9DA 5F9OL 2EDBA 5FYKD 1GZQB 3QHFH 4YFLI 3MJ8B 4HIXH 3WIHA 4PR5B 1IGYA 5D7SH 2IQ9H 1MFEH 2YN5A 3T0EE 4ZPTA 2QHRL 1U8MB 3LY6A 3PL6C 4NWUH 4UTAH 2EECA 3QAZB 2Z31C 4YWGH 4YQXH 5JA8B 3JWOL 3QFJA 1NSNH 2P5WA 5F7NC 4JHAL 5E99H 1A4KB 4NM4L 3QZWA 3B2VL 4F57L 5BS0E 3CSGA 3ESUF 1ZGLA 4UNTA 4MQ7B 3RTQC 4NZUH 3CPLA 5IWLA 3TZVA 4H0HB 2GEEA 2VTFA 4XP4H 3GIVA 4NKMA 1OTTD 4E41E 3ZLQC 4E0RA 3L1OL 3WHE0 1E6JH 3MYJA 1BAFH 1RUML 2BY2A 2E7LA 5DUPL 3L5HA 3OKYA 2R2CA 4QXGL 1H0DB 3WN5B 5CP7A 1N6QH 2B4CC 5EPMA 1T7WA 3ARSA 4TQEH 4W6WB 4Z77A 2JJTC 4NN5B 4K2UL 4PJIA 3GRWH 4FZ8L 4QWWC 3UDWA 5I1JH 1G7MA 1S7UA 3QJFB 5I9QB 3BPCA 4HW6A 4XMPH 5ESVB 1OGAA 3O3EB 1A5FH 3HRZB 5FO9A 3SY0B 1QBLH 4NGHH 5I1LA 5IMLA 4ODWA 4JRXB 5DRNA 2HG5B 1NEUA 2GAZB 4F7MB 3EZ8A 1T2QL 3OKEA 3RHWF 4XBEL 2BNQD 4MJ6B 2NX5D 1JRHL 1HSBB 1ZGLP 4B53A 1ONQB 1DBKL 4X6DE 3TF7C 4HS6B 1KN4L 4XP6H 4Q6IC 1FH5H 3QIBC 5DQJB 3DVFA 2A73A 4XP9H 1IGFH 3GIZH 3U4EB 1A1MA 2OTWA 4K55A 4YXKL 3NAAH 5E8PA 1P4IL 4XNXL 3CFIC 1W0VB 5DLML 2PYEB 3SDCB 4HC1H 4KZDL 4M7ZC 4GRWB 5CBEA 4FQJH 1QHOA 1MRCH 3RL1A 5FV1L 5FV2A 3NH7H 1HXMB 5K59F 3AUVA 3WIHL 3S35X 3T2NH 5EH1A 1PG7L 1XIWA 5J11C 3LN9A 4RNRB 3ZE2E 5F6IC 3TJEL 2BZDA 2G75A 4LIQL 5DD1H 1YY8A 1CFNA 1ZHBB 3HZVA 1FC1A 3IDGB 1R3HB 1Y18A 3BOVA 4H26B 1Q1JL 1RUKH 4Y5YB 2YWYA 2X1QA 1W72B 1IC4L 3UTTB 4MA3A 2YK1L 1AGCA 5HHVL 5IHLB 3OXSA 4JFFB 4XPTL 2P44B 4APQA 1BVKB 2VO5A 4LEOB 2X70B 4PJCA 3MUZ1 1RHHA 1NGQL 3WE6B 1E4XI 4R4NC 4DKEH 1TVHA 1MAML 2I27N 2B0SH 1JK8A 5D7KE 5JHLL 1E4WL 3JTSA 5ABDE 1SEBA 5I8CB 4P3DB 1OP9A 5D8JL 3PGCB 4N0UA 1SM3H 1LO3H 3P0VH 5BCAA 4P3CH 2QQNH 2P43B 3TCLA 3OXRB 5IBTL 1F45A 5INDB 5DJ2A 4WIQA 3QXTA 3P73A 4M3KB 2OBGA 1U2CA 5FCUH 5T1LA 1JGUL 1K8IB 3UC0L 4JY5H 2RCSH 2NCMA 4ORZC 5BV7C 3QIUB 5C71A 1RUAL 3OJDA 4JFPB 2FNBA 4MVBD 1QFUL 5TF1H 3GK8H 3DVGB 3KS0J 3TJHC 2FZ3A 3V0VB 2WY3A 3G5VA 4BFIB 4N5ED 5I1IH 3MTRA 1GVIA 3SDAA 1NCTA 2DF3A 1X5JA 1Z0NA 2PYFB 3CFBB 3DRQB 3LN4B 1CG9B 2GSIB 4JPWH 2BSSA 3MMEB 1O7SA 5GS2D 5CJXA 1LO5A 2OXGA 2W9DL 3KPSE 4LDOB 2P46B 2Z93B 1AGEA 1XR9B 3DUUB 3O41B 5HDOA 2OI9C 1OGTB 2X4TB 3VRLE 4S10A 4KUCD 1ZHKA 4FZEL 2LU3A 3VXRD 3CUPB 4LKXB 3M8OL 3U7YL 2W65B 1A1NA 1FAIL 4ZUUA 5KOMC 4BK4A 2IALB 1E4XH 1X4XA 2MHAB 3A6BH 4WW2F 2XZAH 2PO6A 1XH3A 4YDVA 1N8ZB 1QPPA 3NCBB 4G6AC 4YX2H 3N9GL 4AM0A 4IS6A 3WJJA 1FYHB 3W0WB 4S1DD 3CCHA 5GHWH 1X44A 3GI9L 4JGJA 3LKRB 3PJSB 2FSEA 1A4JA 1FV1B 4PPTA 3MLSL 3OGCA 4ONHA 4IMKA 1IEAA 1TZGH 1KCRH 3CLEH 1KTLA 3O3BA 3IJHA 1HEZA 3HMXA 1KACB 3PE9A 4TVPH 3VG0L 3T0BA 1DQDL 1T7XA 4PBVC 1BD2D 3TO2B 2P8MB 1ZV5A 3Q6FA 4ZAKC 1TETH 4WI6A 4PJAB 2WP3T 4M02A 3STLA 1KIUA 3TLRA 1ES0B 1IAKB 5DFVC 4P9MH 3NCFB 4PJDF 3SPVB 4O02L 4QRPE 1OD7A 5D1ZA 1Q0XH 4EVNA 1KV3A 2BERA 2WBJA 2GTWA 5H35A 3BO8B 1ZWIA 1AQDB 1A8JH 3GNMH 5IB3B 1UWEL 3BSZL 5IK3A 3MXWH 3EOYG 1OD9A 4A6YA 3DX9B 2P5EA 3VH8A 2ZG2A 4OD2B 3OJVC 1SJHA 4LCYA 1TJHL 15C8H 4NQCE 4OCSL 5GGSB 4XHJC 5AZ2H 2X2YA 4MXQC 4FTVD 1QFPA 5F1NB 4YXLL 5F3HB 1OCWH 5GGVL 3KGRA 3HC3L 2CLVA 3E3QA 1P1ZB 2DIBA 3CVIH 5JA9A 5J13B 3V6ZA 1F3RB 1KB9J 4R4FL 5HHMA 2X41A 5LBSL 1UYWH 5A3ID 5IVOA 2FH8A 4LOUC 1V7NH 4NKIH 4FS0A 4RGOH 5DD0L 3D3VB 5GRVK 5KS9B 4X9GA 5CCKH 3A6CL 1CK0H 4PP1C 4POZD 3O6LH 4BZ1L 3CVHA 4LRIC 1XZ0A 1G6VK 4ONFL 4FFWC 5ACZA 2DTMH 3VXUE 1G6RH 3KYOB 1Z9OA 1QYGL 3ULSB 4AG4H 2VXUH 1JI2A 3QUZC 3B9VA 1IC5H 4Y4FC 4X6EB 4MD5B 2G60L 4PGZA 1G0XA 1IQDA 2CDEB 3NVQA 5TDPB 5FO8B 3SHSA 3I9GH 4BJLA 4HCRH 5C09E 1G7PA 3CDFA 5DMKB 3WKMH 4RZCB 2IH1B 5SWQA 4NQXA 4J23A 4U1KA 4KXZI 3BWUC 1ZOXA 1MHPH 1YPZE 1EHLH 4GAYA 5DK0A 4QTIH 4LSUL 1IAIH 3RRQA 1BBDH 1VGEL 1RD6A 2BSRB 1S7QA 3SE8H 4WEMB 5DC4B 1FYTD 1LEKA 3HMXL 3ZE0F 3QR2A 2P8LA 4TSBH 5FXCH 5EIIA 1U6AH 3LSOB 4YHNA 5ICYB 5GSRB 4G8EB 3IJYB 4I48B 1QBBA 3VXME 2J8OA 5FYLL 3TESA 1XF1A 2YEZB 1T20A 1MIML 1BF8A 4QXUL 5TE6L 1MCRA 5CZXC 2O5ZL 3ARYA 4R0LA 4PJHA 3SN6N 1AIFB 2DRUA 3JUZA 4UIKL 5J06A 1OSPL 1ETZA 2UZXB 2CK0L 3MODL 3SDCD 1MHCA 1GH7A 3UJTL 3VD3A 1EEZA 1F02I 4G7YL 4X6FA 4Q0XH 1Z9SA 4ZTOH 4ZFZA 5IMOA 2AVGA 2IBGA 5EORH 4GBXC 3MCLL 4GQPH 4K71B 4LVOB 4OLWL 5F6HJ 2BCKB 4GAFB 1N0LA 5EN2A 4RFEB 4WO4A 2MSPA 1NUGA 4LHJB 2F8OA 1EFXD 4QT5A 1KLFA 1OL0A 4JFDB 3O6FA 4TUOB 2AJYH 1KB5H 1TQCC 4M6ML 3OKLA 5FEBA 2HFEA 3BE1H 5EU6B 3U0WH 3VCLB 3GSUA 1ORQB 1Z5LA 1P4IH 3EJJX 4KQ4H 4JFFD 2CIKA 1G7LA 4XNXH 3RNKA 4UQ3B 3Q3GA 1ZLUK 3MV7E 2SEBB 5FB8B 1ZVYA 3JTTB 3E8UH 2BXYA 4PJGA 1AD0B 5LAXA 4MQXC 1FIGL 3ERYA 3NIFF 3HAEA 1LNUB 4C56A 2WW8A 2J4WL 1U92A 3FZUD 2XOTA 2BVPB 4WEBL 1P2CA 4XPHH 1PJ9A 2RB8A 3BAEH 5D2LE 1KB9K 5B22A 1FIEA 1F5WA 2Y7QA 3VFRA 2DS4A 5CEXB 3QNYB 5IVXA 3T65A 5L9DH 3VXSE 5AWNH 3MOBL 3IJSB 4PG2C 5T1KB 4L4VA 5T1MB 3QIUD 1CGTA 4P9HH 35C8L 2Q8BL 1EERB 4G8IB 4R4ND 3BP6B 1IC7H 5EC2B 2X40A 5KG9B 4HJ0C 4Z76B 5IROA 1U8OA 3PV6A 4UT6H 4WUUB 3EYUL 4Y2DA 1NEZB 1QLRA 1GGIH 3AFLA 3ABZA 1JTPA 3Q5TA 1W0YT 2GIYA 5F88B 3EGSB 3SKJH 1HWHB 4L8SA 1MCOL 3ARXA 1OP5K 3MLUL 2ZG3A 2HTLC 5BO1H 4OFVA 1EMTH 1S7TA 4PJEA 3ES6A 4GRWF 4I8DA 4OCRL 3D0LB 4X4MA 3TN0B 3ZZ1A 4Q9RH 5GIRA 3KWWA 5CEYB 1ZLVH 3VFMA 2ZG1A 5FKPA 5GS0C 1WZMA 3S37H 4HAFA 1VACA 2BNUA 4N8CL 1QNZL 3KPTA 1PBYA 3GM8A 4PJXA 2X1WL 1WT5A 1RZJL 5LQBH 2PW1B 1IFHH 1I1YA 3W0WD 2W9DH 2XTLA 3VJ6B 4YHPA 2ZUTA 3ZKMC 3MFFA 3OAZH 2ESVE 2VDKH 3P11L 1KNOB 5DD6B 2R56L 4MXWL 3AB0B 2R69L 3BWAA 3F6IA 3HZYB 1ZMYA 1S7WB 3RPIB 3CZFB 3T2PA 3G6AA 5AAMA 1YNTB 2KPNA 4KPHL 3O3DB 1NLDL 3UJJL 1FNGA 4L8DB 4YH6A 3VW3L 1YC8A 3SDDC 3GSQA 2Y25A 4OZFB 5FO7A 3P9LA 2CJUH 1KLUA 4YPGB 3MV11 3L5XL 4P4KB 4X4YB 2ZKHL 2RBLA 4TYUA 4G6AD 3E6FB 5HDLA 1VFOA 1W0WB 2BVQB 4MDIB 2Y6SC 4Y2OA 4YHOL 4XCCH 5TFSH 4JY6B 5I76B 4HKJB 4QNPF 3U9PL 2E7MA 3AU1B 1IGCL 1QSFA 4MWFA 2AXGA 1INQB 3X13A 2R9HD 5BRZA 5FUZH 2FEDC 3MRKA 2I5YL 2EH7H 2DICA 3KHOA 3HI1A 2AW2A 3BD4A 8FABB 4HUWA 4HZLA 4YHZH 2PXYB 1WFNA 4DK3A 4HGWA 4O58L 3RGVB 1DBJH 1PQZB 5IMKA 5EZLB 5GRJH 4LPYA 4P2OB 2R0KL 3WO4B 4PRIB 3X11B 4CN6A 3QUXB 1OAQH 5CS7A 2GUOA 4HLZH 4M48H 2LQRA 4OGYH 2XG5A 3KPRD 3MZTA 4JVWA 2X1XR 4X99B 3O11A 1YN6A 5FGRA 3DV4A 5IMMA 4DUWA 2OZ4A 3RIAF 3QXVA 1YEKH 1TPXC 3T0EB 3MLWL 1KCLA 4Y16C 5I8OL 5JXEA 3P4OB 1P4BL 3D3VD 4OGZA 1WBZA 2IFFL 1YNLH 4I5BB 3QPQC 4FQLL 3BSZH 5I0ZA 3Q5YA 4UDUB 1RZFH 2DJSA 5IVZA 4F7EA 3D9AH 3L7FB 2VLLA 4RRPG 5IB1A 2YD7A 2CKBB 2Y06L 4Y19A 2F8XC 2QKIB 3HI5H 5F9JB 4NO5B 4X4XA 5BS0B 2FL5A 1BGXL 2MCG1 2ITDB 1FVDB 2XACC 4WFEE 3PQYE 3D48R 1DDHB 3F7PC 4OF6A 5IQ9A 5DJYB 1HHGA 2J88L 2EC8A 4NN6C 4C83B 1Y6NR 4LHUG 4E41B 5C07E 4OCXL 2WBWB 5LVEA 1QA9B 3RWHA 3V6FB 1S3KH 2C1OB 1KPVA 1W8NA 3P4NA 2DLTA 5IG7B 5KJRL 3HR5A 1JZ4A 1GGYA 4P49A 4G5ZH 4PP1D 4UDTA 3QCTL 2O61B 5ITFA 2HJLA 1E4KC 3BW9B 3KPLA 2FECI 3RFZC 4XVUC 4OSUH 1X9QA 4PJAF 3QG6A 3HUJA 1KSRA 3MRGA 3QEUB 1CLYL 5SX5K 5I74C 1JWUB 4LBEA 4JDVA 1PFCA 3BEVA 4H1LH 2P1YA 5ANMA 1R5WA 3P40A 4S1SL 4G9FE 4LU5L 1CZ8L 3QDJA 4NO2A 3BZEB 4KJWD 1S8DA 3INUL 4UOJA 5MP6H 2PTTB 2W59A 1T0PB 3C9NB 5BOPA 1XF2A 2A6DA 2AS5M 4HJJH 1ZAGA 2AV1A 4EXKA 1FAKT 4X6DB 4OV5B 4FQCL 4LSDA 3LDBC 4GUPA 4ONGL 5T1DH 3W82A 5LCVH 2FCBA 1U8QB 2JE8A 3T4YA 3VRJB 2DQEL 3HNVH 5FM4A 2V17L 1U95B 3QO1A 2D31B 3S34L 1JV5B 2R4SL 5CZXD 5E1AA 3FOMA 4DZBA 5GGSY 4XH2A 3VRIA 2BVYA 3VU2A 5C0FA 2B8OT 2OZ4L 1FL6B 1SY6A 1B2WH 1CBVL 3QJHA 1DFBL 3ROOB 2ICEB 1DQTA 1QFWM 4WW1A 3SGJA 4GKZB 2ZUWA 3WFBL 4A6YH 3BUYB 4EUPB 1ZT7B 5FYJH 1UH4A 3O9WC 1RK0A 3OHXA 5DVLA 2AABH 1K9TA 3DROA 5FUOL 4GAJL 1JTTA 3T3ME 2AGJL 3MR9A 4RISL 3UTQB 5IFHL 1JYNA 2M2DA 2BDNH 4KKAD 4OZGF 2MQCA 5JMOC 4IIQB 2IWGA 1KCSL 4IMLA 5HHPB 2CGRL 1KTDB 1FO0H 4ELKB 3SO3C 5T1KD 2Q86B 5KSAA 1MJJB 4HLJA 4OI9A 3R8BB 1H8NA 2DIAA 3CVHH 5TDOA 3CU7A 3LKPA 4IRSB 3W9EB 5DD5L 3QQ3B 2ZNXA 3HE6D 2NY1B 2VDMH 1Z2KA 1C12B 1GGCL 4QRUA 3H9HA 3TFKC 4AMKH 2H1PL 5FECB 4K9EL 4R8WL 1X6NA 1IQWL 5BXFA 1X4YA 3X12A 4EI5B 1ROWA 5IHUH 1OVZA 3NCCB 1CD1A 1L9NA 3GJEB 2FO4B 3MCKA 3TN0D 1U91A 3U83A 1BP3B 4N5EA 1H8OA 3BVNB 5JHDE 4HQQH 1FDLL 3KPSB 4M1DH 1R24B 1F3DH 4N0FB 1JBJA 1OTSD 4AEIH 3V95A 3ARFC 4JFQB 1FFNA 4P5MA 4D9QE 1CN4A 3WFHB 1RZKL 3KYNB 5F7FA 1T5XA 2VDPH 3V8CA 5B4MC 1HZHL 4RMVA 4XTRD 5ID0A 4MZ2A 1B0GB 3VFOB 3B2UD 1EBAA 4JFEB 2IMNA 3RVVD 1T83C 4G8GE 4TNWK 5DZNA 4F2MB 5JOPD 3SO5A 1VGKA 4HPYL 3FB7A 3C2AH 2R8SH 5GZOC 3R06A 2C4FT 4I0PD 2FYYA 4MB4A 4EI6B 5CJQL 5HGBA 5TH2A 1H3UA 3MRPB 3L3KB 3DUHA 3FMGH 1YQ2A 4UQ2A 5CGYC 4PJBE 4P4KD 4NRYA 4LKCB 3REWB 1S9VB 1AO7E 4LGSB 3VFSA 1AHWA 5CSZA 5DO2D 3VDCA 2CXGA 1JHTB 3WLWD 3D85A 3O4LE 1DVFB 2VXQL 32C2A 1F6AA 2R15A 3MQIA 1FP5A 3GSOA 1T21B 3OJ2C 1M6OA 1U8NB 2P49B 3O3AA 4DJMA 2WK2A 3V5HB 4JB9L 1UWGH 3QEHA 4P59H 1FNHA 4J3TA 4PG9B 1UWXK 4M5ZL 4QRPB 4G80A 3MBXH 3RGVD 2GJ6E 1A9EB 4EDXB 1D3CA 1BZ7B 4P2OD 5IOPB 3PWPE 1Q9OA 4WTZA 1JWMA 4ELME 5J12C 4PRID 5E08H 3HC0B 1NMCC 2IC2A 1CFQB 1NBYA 3FB6A 2XA3A 4WV1C 1RZ7L 3MRFB 3X3FL 4HK0B 3VWJD 2DBLH 1RULL 1WC7A 3T0ED 4XCFH 5E6IB 4NQCB 1YYMH 3BQUC 4GMSL 4OCNC 3MLPA 4LLWB 1N3NB 1NMBH 3L3GB 4ODVH 4HS8L 4KRNA 4MCZA 1U8MA 2KQNA 4P5KB 4JQXC 4HWZA 4PB9L 5FKAB 3QI9B 4HGKC 1BX2B 5E4IA 4FQ1L 5BS0D 5DUMH 4ZODA 3BKJL 3TIDB 1XR8B 1A0QL 1NJ9B 3AM8A 3GGWA 4UNVA 5I1KH 4PD4J 2XZZA 2AJZB 1B6DA 4L4JA 5L7XL 5CILL 1YEHH 1HDMB 3F12A 1A6PA 1H15B 1DE4B 4CVZB 3VXUB 3N85L 4TVPE 3LQZB 5A40E 3BDYH 1J0HA 3ARRA 3QRGL 3ILPB 1UM6H 5CIPA 2R29H 4GSDH 4A2MA 4M4PA 5C09B 2LE9A 3C5JB 1LO4L 4EZMA 1BOGB 2QSQA 1H0DA 3WN5A 5D7IE 2Y4SA 1YPZB 1PZ5B 5F96H 5SWSE 2HT3C 5CSGA 2EIBA 4GRMB 1SJXA 1U8LB 1MFBL 3GB7B 1P7QD 5AEAA 1DEEB 1NCAH 1IGIH 4KROB 2CDGA 1BMGA 2XQYG 5AAWA 3K8LA 1WIUA 5ESVA 4RGNE 3O3EA 3CGTA 2EDEA 2I26N 2OLDA 1A14L 3OKDA 3SY0A 4KV5F 5DMYA 4JRXA 4P46C 4XHQA 3VXMB 4Z7VE 4F7MA 4HIHA 1M71B 1M7XA 3EHBC 2R0WL 2EDHA 3AAZB 1UH2A 4MJ6A 2DQCH 1QBMH 1AR1C 1HSBA 3KJ4B 3K8MA 4F58H 5I1HH 5F7KC 4AIOA 3WIIL 1EAPB 1AKJB 1TJGH 4Y88A 2YUZA 5DWUL 5DQJA 4ZFGH 3HFML 5CD3B 4L8BA 4XMKL 3U4EA 4JREB 4HD9A 1UM4L 1W0VA 4X6BB 2PYEA 5J1AB 2DQTL 4DW2H 4NIKB 4UILH 1T89C 2NZIA 5IESH 1HXMA 3KDMA 1C7SA 1FCGA 2DBJA 2VDQH 4ZXBC 3BYYA 4FQCH 3O8XC 2EKJA 1AY1H 1IRAY 4RNRA 3DO3A 1F42A 3SDYL 5HDQL 1ZHBA 4LLMB 1OARL 3F7YB 3K1DA 1R3HA 4N0RA 4H26A 4K3EH 2F19H 5L88L 2BNRE 5CD5C 3QFDB 3MNWB 4Y5YA 5EC1A 1W72A 3MV7B 4HT1H 3MUGB 1I4FB 3UTTA 4DEPB 5C0BE 2YR3A 3QDHA 4N5UA 4I3SH 2F5BL 3KPQB 4JFFA 5KVDL 4PRAA 5CEZH 2NW3B 4LEOA 2X70A 1JN6B 4HBQA 1NBZB 3WE6A 3NA9L 3WDHA 5HI5C 2C3VB 1TTFA 3PDDA 2MPAL 1AD9B 3G9AB 3WFBH 5MEQA 5I8CA 4MSWB 4OZ4B 3D25B 3BMWA 4P3DA 5FM5O 3RKDD 3ZMRA 1JGVH 3MRCB 5E4EC 3ZT6A 4IRSD 2XPGB 2R2HB 3OXRA 3EFFA 1NDGB 3VXSB 2NY1D 4JFXA 4YHYC 1T1XA 4XNMA 5C8JB 2NMSA 1FZOB 4KK9D 5C0RL 1OOAA 3O0RH 4N68A 1T3FB 5F8QC 4CU7A 1NC2A 4OLVL 4EIZC 2QSCH 4JFPA 4AT6B 1T7ZA 1D5XB 3GSWB 3ULUL 1CXHA 4EI5D 5DFWH 2B20A 3U48A 2KH2B 3FCTA 4PGEB 3DVGA 3NGBB 5B39G 1HHIB 5DZOA 1QD0A 4U6YA 1DANT 3M07A 4U33A 1DL7L 4BFIA 3IU4L 1YEDA 3HZKA 4NT6B 3U2SB 5GJTH 3QNZA 1I9EA 1DN0B 4OTXL 2GSIA 4Z7WE 3IRZA 4U1JB 3TH2T 2H2PD 3BKCH 5E94B 3PDOB 5DJ6B 2ERJB 4X8XA 1A7RH 4HDIB 5E2TH 4XBPA 3JWDC 1XR9A 2W1NA 2O5XL 3DUUA 1U8KB 5T5FL 4WJ5A 3ULVC 2AXHA 4JFED 5CFHA 4DKDC 1S78D 5IBUB 4BSVB 4LKXA 5F9WC 3KLHC 2AXFB 3TWCH 2W65A 2A1WL 2IALA 1LDPH 3DYOA 5T33L 3FQTB 2OR9L 4E9LA 2A74A 1N8ZA 4QGYA 5IR1B 2ESVB 2ENYA 4CN4A 3MZGB 2NY4C 1BEYH 4M7JL 3LKRA 5HDBE 2YHGA 4GMTH 4Y4HC 1FNSH 2DKUA 1MIEH 3PJSA 1W72L 1MNUH 4Z6AT 1J1XL 3S35H 4LQFH 3CK0L 1UEMA 1EEYB 4KHTH 4WFGE 3UYRL 2FJFA 3QNXA 2CSPA 4FRWA 1U8JA 1U3YA 1SY6H 3P30H 4NCC1 4O2FB 4LPUA 4J2XA 3M1BA 3TO2A 2YSSB 3OTTA 2E7LE 1XGTB 4D9LL 4JO2H 2R2EB 4H25B 1IAKA 5CBAB 5GXBB 3SPVA 2JKXA 1WWAX 2WWMD 4M7ZB 5FHBH 1PKQA 4PLJC 5BVPL 4OGAC 4QYOA 4D3CH 4F7TB 2ED7A 1L7IH 3RWIB 3W9DA 1CS6A 3NMEA 4KAQH 4RX4A 5IB3A 4IOIB 1OLZA 3CFJB 5E6ID 4NQCD 1CWVA 1KELL 3BPNB 5IV2B 2E27L 3BPOB 1KTKE 4N0CA 1MCQA 1VCAA 4K23H 3DSFL 1ZLUH 4OI8A 1MREL 1CDUA 4OD3L 4F7PA 1JYXA 1S7VB 4BSJA 3QI9D 3W81A 4M1CD 1GC1H 5GGTL 3S4SG 5F1NA 3O2WL 1M7DB 1JFQL 1R5VB 3PXHA 3PGDB 1P1ZA 2RQ8A 3H9YA 4CNIB 5C0CE 5D1QC 4OFIA 3DYPA 3WNLA 3PHOB 1EO8L 2IPUK 5KS9A 3VXUD 4ODSH 3MROA 4PRPD 1C5CH 2VJXA 4WHCA 4OGXL 3LKNA 3PQYB 3WIFA 3KYOA 5DSCB 1IKFL 3IFLL 5C09D 3QUKA 5C0ND 4X6EA 4GO6B 5I66B 3E2HC 5C07B 3B9KB 2CDEA 1WBYA 5TDPA 5GRUH 5FO8A 3NFSL 4OBSA 3BP5B 1FL3A 2O5YH 3VG9C 1TZIB 4RWHA 4YEEA 5I2IB 1AFVL 1BFOB 2IG2L 4RZCA 5DMKA 1LEIB 5DHVH 4Z9KB 3ARGA 5D7JC 4D0DA 2VLME 4OLUH 3PP4H 1NAKL 1KJMA 1U93B 4KROD 2BOCA 1FBIH 4F7CB 1I8LC 3N85H 2BSRA 5ESAA 3TA3C 2JB5L 1MWAB 2Q6WB 3WUWG 1ZT1B 4DZ8B 3RU8L 3QHZH 4JFOB 1OP5H 2FD6H 5IHZA 4L9LB 2A77H 5JPNA 2NNAA 5JUEH 2YD4A 4WI2A 4O4YL 4G9FB 3EOTL 5ESQB 5GSRA 2OI9B 2KQMA 2R0LL 4N0UE 1NCCL 2UV3A 3U9UB 2C4FU 2ZUXA 3LMJL 4R9HA 1B4JH 5F3BB 2V7HB 1LD9B 3EJYD 5CZVH 1RUPL 3WFCH 5K33A 1NGPL 4UV4H 4F3FB 4HFUH 4LGPB 4D9RE 4LRNL 1N5YH 3D5OF 2WAHA 4RFOH 4PJFF 4BFBD 5JR1H 1UQSB 5D9SB 4K3DH 3IDJB 4RAUB 2YZ1A 2ICWB 5LGJB 5FF6B 3RVXC 1MJ8L 2BCKA 1IL1B 3WXWL 4X9FA 1OY3B 2ICES 4WWKB 4RFEA 2WANA 2WUBH 4JFDA 4X7TB 5DDHA 3EOBA 4YUEL 2EIZB 3MLVH 4OAWB 1N0XL 1FNFA 5EU6A 4JY4A 4XWGL 4NHCH 1S9KC 3DVNB 5LXGH 3HE7B 1UM4H 4UQ3A 1CICB 5E8DH 5E00A 2K7QA 3TBYB 4KKNA 1EO5A 1AD0A 3CMGA 3STZA 3DX7B 1A1OA 1D6EB 5GPRA 4FQ2H 5KVFH 5KVGH 3S3PA 2BVPA 3SDYH 3ZHDA 5C0EB 5BVJB 3IDXL 4LSSH 2NXZD 3VXSD 3F58H 1OSZA 3U1SH 4LSVL 1IAOA 2YC1B 1IZJA 2HMID 1DSFL 1LK2A 2H26B 4KJYB 1WIOA 2JJVA 3VA6A 2O93L 4MA8H 4X9BA 2H6PB 3IJSA 1EBPA 5F89B 5I71B 3O2DL 5T1MA 2PTUA 3NBNA 1RV6X 2UY7A 2FGWL 3H42L 4Z7NF 1H5BC 4G8IA 2FLRT 1F4YL 5D72H 1S7RA 1KOAA 5F1IB 1P4LA 1I7RA 4M43H 3WS3B 1XF5B 4CKVX 2Z35B 4Y4KB 3CX2A 3KPOB 3FN0H 5CIPH 1G9ML 1WSST 2KL6A 1OTUC 4RGMC 3UAJC 4LQ1A 2DAVA 4WUUA 4OIBA 4FXKB 1NEZA 3VXOB 3UZEA 3OPZH 4JR9L 4ALAL 3EDFA 4LVHB 3MLZL 2VH5H 2VWEC 4QRRD 3GMMB 4K3JL 4QCIB 1S7SB 4PREA 3TCXA 4JM2C 5JHDB 1FFOA 3FRUA 4CW1A 4BZ2H 2AJXH 3QUZB 4I3RL 4OLVH 3RJDA 3DLQR 4NKDA 3TN0A 2DQHL 2V2WB 5C9KA 3ULUH 5FYJE 2P5EE 4KKLC 3D18B 3VDAA 5CEYA 5IIEA 4Y5XA 3MBEC 2IPTH 4HG4K 5EO1B 1YEIH 4QTHA 5IB2B 5IJKC 1KIPB 2A0LC 1TZHB 1FZKB 4U49A 1J18A 3NOIA 3OKOB 2ESVD 3MA9L 4WNQB 3UMTA 4G8GB 1NDMB 4ZOBA 3MREB 3VJ6A 3LEXA 3E3QE 4N90E 4ZOAA 3H0TB 5HHME 3PP3K 3C6LA 4M7LH 4MZ3A 5SX5H 5TQ2L 2E9BA 5ADOH 3JWNC 4QXTB 3T77B 3TBTB 5J4MA 4BH8B 1JWSA 3FO0L 4LARL 2G9HB 5IW3A 2XTJE 3HZYA 1S7WA 2XWBB 3VGFA 4JQIH 2MQ0A 1MI5E 1QRNA 4DCQA 3GMOA 1HH9B 4L8DA 4PJBB 3H3PH 5EUOA 1S9XB 1DLHB 1AO7B 4JDZB 4OZFA 4YEFA 5D6CA 4KMQA 5GGRB 3ZTJG 1A21A 4TTDD 3TVMC 3FHAA 4HMDA 3FFCE 1EVTC 3FT3B 3O4LB 4X4YA 1Y0LA 2Y5TB 3HNSH 4YIQB 5ALBH 5A2JH 1QR1B 1GGTA 1VEPA 1J5OL 4JKWA 4KU1A 1KJ2A 3E6FA 1H3GA 4GLRI 1A9BA 4Q9BA 1NGZB 1LE9B 4MDIA 5I76A 4JY6A 4HKJA 2A9MH 1T5WA 3AU1A 4QHKJ 1K5NA 4KK8D 3T8XB 3UXFA 3ARBC 1I3RB 3E0GA 2GJ6B 4YHIB 3SE3A 1JHLH 1FGVH 3PWPB 4ELMB 1GHFH 2AJ3B 3B5HA 2PXYA 4FFZH 5A2IH 5EZLA 4JGMA 2EDWA 3WO3B 3PWVA 4NFDA 5I17B 4PRIA 4JJ5A 5INCB 3QUXA 4RDQG 4POYA 4FOMA 3B3IA 1JZ8A 1X5YA 4JZNB 2H32A 4XAKE 4X99A 2GFBB 1PYWB 2B1AH 4HUXB 3CH8A 4PJHE 3UZQA 3T0EA 1QTYT 3GKWL 4O5LL 1AGDB 5DJAA 1KPRB 4KGLA 4WGWB 2CIIB 4I5BA 1K4DB 3SOBH 5AUMB 5D5MA 3TO4A 4UDUA 4OIIL 4XMLH 3Q5OA 2CKBA 4WFED 3KVQA 2QKIA 5J6HA 3PQYD 2EXWC 3VWKC 3C8KA 4NO5A 5DRWA 4HV8A 1UKTA 1KG0B 3MJ7B 3B9KD 5I1AB 1N59A 1D9KC 2DJ4A 1T6VN 3HS0B 4H5SB 1KC5L 1ZTXH 4AEHL 1CL7L 4O2EB 4E41A 4N1CA 2BOBA 4GLRH 3DI3B 3DO7A 1EGJA 3V6FA 5IW1B 2C1OA 4R97B 1UM5L 1JPGB 3ULVF 1KFAL 3FT2B 4JAMB 2AJSL 4DN3H 4U05A 1H3TA 1H9VA 2W0LA 5D7IB 3H9SA 4NZDA 4ZS7H 5SWSB 5E1HB 2O61A 2AERT 5DC9B 2BSED 2BJMH 3SBWA 1K3ZA 4IEFB 5J8OA 2DQGL 1YEGH 5IVNA 2VQ1A 1N4XL 4C56E 2YN3A 3C60C 2BHZA 3QEUA 3T4AA 5GS1A 3QRFM 1T03L 1F8TH 1CLZH 5IFAH 3QULA 3WD5L 1KJ3L 5EZJB 3CX5K 1X5LA 4RGNB 5JOFA 1GJIA 4L8CA 1ZVHA 5DA4A 1A7PH 2NY3C 2FRGP 2LU7A 3MACL 3L3OB 3B6SB 2YRZA 3KPMB 5A1AA 1VERA 3BZEA 1CT8A 5EBLB 4Z7VB 3MRQA 1WAAF 3GO1H 2ZCHL 5M94B 3JWOC 2PTTA 3LAFA 4PBWD 1MCLA 3C9NA 3RBSA 4HEME 4NUGH 4X6DA 4WWID 3RU8H 4GQ9L 4O9HL 5FHAH 3MNZA 1ADQH 1DLFL 4XP1H 4JFYA 4P2YA 2Q1EA 3EOTH 2VISB 2EC9U 1NGYA 1ACYL 4IBLT 1BQUA 2VL5B 4JKPL 3VFTA 4WWKD 2VL4A 2YBRB 3PWLB 5GGQH 3Q1SL 5D70L 4I2XA 3T0WA 1U95A 2VSDA 2AV7B 4JZOA 4N8VB 2D31A 1NCWH 1G6RB 4NZTH 1JV5A 1MVUB 4LCCA 3TYGH 2KUTA 3IKKA 4DVRL 1KGCE 1NH6A 1FL6A 4J6RL 2J8UE 2K3TA 3ROOA 3HE7D 3KXFA 4XT1C 4P5TC 1CICD 4EXPX 2J1KA 4KVNL 1T1YA 2NZ9C 4W70A 5HHNB 2BNRB 4GXUM 3NCJL 5KTEL 2CKBL 4MD4B 3D0VB 5DJ0B 5C0BB 5HHOE 1NFDE 4Q9QL 3PGFL 4G43A 1CE1L 2ZCKL 3UTQA 1MCWW 1UWXH 3FAXA 4JPIB 4XC1H 1Y6KR 3PWJB 1EVUA 4E5XB 4DVBA 3N1FC 3UP1A 3ARDC 4U1SA 1VSCA 2YA2A 4UV7H 4X8JB 5DZLA 4OD1L 5HHPA 1JTOA 1EGJL 2HFFB 2YPKA 4H20H 3SE4A 4OT1H 4RDQF 5AD0A 4OQ1A 3FT4A 4FXGB 4NBYB 3VXTB 4M93C 2EICA 5IB5B 3REVB 2AEPH 3TNMB 2YMXL 2Y9RT 4FQIH 4HIJB 4Y4KD 2FWOB 3LQAL 3QQ3A 2FJGB 3L3JA 3C5ZC 4OQTH 1C12A 2RIKA 2G5BB 4XCYA 2D7PA 1RZ8B 1U8HA 3H9ZA 1FPTH 1WEJL 3I6LE 4XPAL 4MAYA 1QSFE 1J8HA 5BJTB 2V2XB 5BRZE 2GHWB 4PYHA 3VA2C 5JHDD 2VZTA 4KRPC 3OAUL 3HRPA 4TNVK 5DRZB 3GJEA 1J11A 4Z7WB 4NJ9L 5ISZD 3H42H 1L0XA 1I85C 3BVNA 1PAMA 3ARED 3D39D 1KB5B 4D9QD 3KPSA 2H9GB 2I9LA 3THML 3IB4A 3CFDB 1OPGH 2VLKE 3OF6A 5C2BH 5E5RB 2EE6A 1RURH 4JFQA 4XPFH 5FGCE 4TVSa 3WFHA 2Q7YA 3KYNA 2FBJL 4G8GD 4BYHA 4G9DB 1FZMA 1XGYH 3W11D 2DM7A 1B0GA 1NMAL 5CEZE 5TF0A 4ZSOA 1J88A 1GAFH 3TPUA 2COQA 4NWTL 4ZPTB 4RWYL 4JM2D 4LNVA 2MQ3A 2DWEA 1KYOJ 5I74B 3K4DA 4ZTPH 4R2GC 4M7KH 5CLTA 3PWUA 1AO7D 3WXVH 4QLRA 2FX8H 5C0DA 25C8H