3VXQB

H27-14 tcr specific for hla-a24-nef134-10
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
242
structure length
242
Chain Sequence
TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSSWDTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H27-14 TCR alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 242
sequence length 242
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqB02
2VC2H 2DB8A 2DICA 4ELME 2G5BA 1CVRA 4G3YL 4YBLB 5DGRA 5EDXA 1CFNA 4PJHB 3BRDA 5IB4A 2M1KA 2N1KA 1NCUA 3LKRB 3ORJA 4LSTH 4HDIA 5T1LB 4ZO7A 4LCCB 2HJLA 1B88A 1ES0B 4ZDHB 1WBYB 4M48L 1Q0XL 2GJ6D 5FKPA 4C57C 1NMAH 1AKJA 1QSFA 2WZPD 3WN5C 3LZFL 4NO3B 5DK2A 2UWEA 5DMGD 3ZDZE 2QSQA 2VLJE 4I5BB 1GYAA 4NC0B 4NZJA 1NSNH 5EOCJ 3QDJE 4JKPL 5DJCA 3BZFB 2HG5B 4MAYC 2X4OA 3DMMD 4OBSA 1IGFH 4QF1B 4WFED 3IF1B 1Q94A 1V3MA 2IMNA 3ZTNH 5C0IA 1LP9B 4S1DC 4I48A 4TUJA 2H8PA 1N6QH 1ZLSL 2HA1A 2DQUL 4EI5B 4QOKB 2OR9L 3HMXL 3VXQA 3NGBB 4YR6A 1WBZB 2AW2A 5JHLH 1QRNB 4WHCA 1KN2H 4LFHG 4QKXB 1PKQB 4NT6B 5IQ9B 4PRPE 5EZJA 2CIIB 5KVDL 5DJAB 1OSZA 5C08D 3RGVD 2FB4H 3C5SA 4Q2ZB 4Y4KD 3V8OA 4HQQH 4WW2B 5DEFA 4UQ2A 3ULUH 1HZHL 5CINH 4HJJH 4U6YB 3TBVB 1YEEL 2WBKA 1MCLA 3ME0A 4F3FA 1LEIB 4OKVA 5AZ2H 1A9BB 5EZIH 4Q6IA 1YEIL 3VWJD 3NPSC 4UDUA 2FEEL 1X5LA 4OSUH 4HAFA 3FHQA 4ZPVB 2IFGA 1WZMA 1UEYA 4IDJL 4F8TA 3RWHB 3ARPA 4NZDA 1DLHA 4H88L 2X4QA 2DLTA 4YHOH 3QHZL 1FZJB 1QKZL 1QSED 2CDGA 3CVHA 4FZEL 4AH2B 2BHUA 4CGTA 1WBXB 2VTFA 1CE1L 2FJGB 2XFXB 4WFFD 1EO8L 4DQOH 3FT4B 2Q3ZA 1I8KA 3WIHL 2CRYA 4QT5B 3PP3K 4NUGL 3TM6A 4P4RA 2XWBB 1GOGA 1NGQL 3IFNL 3SDAB 1NBVL 4UBDC 2R15A 4FTVB 4XMPL 1JF6A 3DX7B 4R90L 2IAMD 4Z7WE 2JF1A 1FNLA 2A83A 3KPSE 4PRDA 4TN9A 5I1KH 4PRBB 1CIUA 3KXFD 3KR3H 1PZ5B 5EOTB 3PWJA 5I1DB 3OKDA 5ANME 4NCC2 3KLDA 1SEQH 5LQBH 4AT6B 4CL7A 3X14B 1V8HA 2C3GA 3GSXB 3T3PF 3UTQB 1AO7A 4PGBB 4WO4B 1WFOA 3L3JB 3NFPA 4X6CE 3V4UH 4TNWF 5IP4A 3W39B 5JIIA 4GRMA 1L9MA 3ROOA 1LK2A 5I8EA 3WO4C 4A6YB 1MFDH 5FV2A 4OM0H 3EYQD 5C0AA 2NNAB 1T83C 1IGML 2D4DA 4HIIA 2NW3A 1TZIA 3JWDC 4WY7H 3RNKA 3C5ZA 2P47B 4EN3A 2QLVB 1BZ9B 3ALWA 2NY7H 1NGWA 5ITBL 5KJRL 2H1PH 4XCCL 4UIMB 4YDIL 4YUEL 2NYYC 1OF2A 3GSWB 4U1KA 1OGAB 1JNHA 1F6FB 3DARA 5L9DL 5J6GB 3M07A 2IQ9L 2QKIB 3GHEH 4PLJD 4FQHA 3TO4B 5HTSA 5JQ6H 3C6SB 1AGFB 1F8TL 4YPGA 1PW3A 4OZIA 1LO4H 2V2XA 3HG1E 3HUJE 2XI9A 3RTQD 4PP1D 4U1GC 1MFBL 5JXAH 2A6DA 5IVXE 1PYWA 1U8MA 4NM4L 3I3BA 4GBXD 1JJUA 3WNMA 1GSMA 2HT4C 3P11L 5CJQH 4JKKA 3S36X 2IGFL 2G9HA 4PGEB 1UXWA 2NXYD 3SKJL 2FJFA 1J8HA 5MENE 1BWMA 4NJ9H 2MCPL 2MKLC 5LCVL 3U0WL 5KSVA 1I1FB 1MJ7L 2W0FB 1INEH 4WTXA 4HFWA 5H35A 1ZGLM 2VERN 2CKBH 3CFCH 5C0DB 3DRQB 1CG9B 1UZ6F 1FZKB 3QFJD 3WE6B 3ELAT 3ES6A 1U3HD 3FZUC 3RI5F 3F6IA 2DWDB 3DHJA 4F7TA 4RA3A 3CPLB 4YXHH 3IDUA 1ZS8B 2A9ML 5E8EB 3TBSB 5BJTA 5FCUL 3KPLB 1H15B 2X6MA 3IDMA 5BS0D 3P40A 3ZT7A 4MXVF 4JJHA 3OKOA 3Q6FA 1JZ3A 4YQXL 2ESVA 5ESAB 3ARBC 4EDXB 4EVNB 4X7TB 3WIFB 3MV7A 3T0ED 2EC9U 3FOLA 5ERWA 4OQ1A 1ZT1A 3SCMD 4RFEA 4Y5VB 3TZVC 1X5GA 1OD9A 1QD0A 1N64L 4MDJB 5GGQH 1TDQA 4PJ9C 3IXTA 1YC7A 3O2WH 5TE4H 1BGXL 5IJVA 2ADGB 4PJ8C 2Y36H 3GMQB 5EPMA 1EHXA 1DUZB 3AREC 2ICWJ 3P4LA 1CL7H 4UUJA 1S7TB 2A9NH 1F4YH 5IF0A 1XF3A 4K7PY 1N2RA 5C1MB 5IROC 1UENA 3O4LE 1FG2A 3PL6C 4FFWC 4LIQH 4RISL 1M05B 2WSKA 3ILQC 1IGTB 4GUPB 3RVXC 2DQFA 2OXHA 2JKXA 1RZKC 3FO2B 1A6WL 1CK0L 1TVBB 1ZANH 2W38A 5KS9E 1MCIA 3AC0A 1P4IH 2AEIT 3QNYA 1I9JH 3BP4B 1DQLL 1NCAL 3MRJB 4NOFA 3ZL4L 1BQHA 5HHNA 1JHKH 1T1ZA 4IRSA 5AD0A 1IE5A 5E94A 2O5YL 1S7QB 1EHNA 4KK8D 2DLFH 2N56A 2YHGA 3OZ9L 1KOAA 1MJJA 3WO3B 3M8OH 3VA2C 3QQ3A 1BQLL 3BN9D 3U4EB 4M4PA 3WDIA 3LSOA 4JZJA 2OQJA 1LO5B 1WICA 1YPZE 3CLEH 4MNHB 1HSAB 3BPLC 3TT3L 5CJOL 1RIVL 4RFOL 3FN3A 3TIEB 2X44D 2VXVL 1BD2E 3EOBA 3O4OC 4MX7A 5TDNB 1N5AA 4OLWH 2Z0BA 4AEEA 2Z8VC 5DFTA 3LRSA 1MCDA 3QUML 5MEQB 1DBML 1MF2L 1FNFA 4IRJB 4YO0B 3LQMA 4ZXBC 4IHOB 4YHLH 4J6RL 5H2BA 3MRMB 3O6KH 5FDWB 5HGBB 2I60L 4NRZA 1MIMH 3JXAA 4L29B 2AK1H 5JXED 1BX2A 5GS1A 1MFEH 1CGUA 3W9EB 2EXYC 5FCSH 1IAOB 4I2XB 3WJLA 4M61A 2DQTL 4ZTPH 4QTHA 5DD0H 3HZYB 4XCYA 4YC2C 4PJ7F 3SJVE 1QHPA 4HD9A 1ZLWH 3KPQA 5IBLD 1NMCC 2YK1H 4V1DE 2CUHA 1OAYH 1W0YT 2HKFH 4R0LB 1ORSA 2VDOH 2X4UA 4Y4FC 1FZMB 3FRPG 3LS5H 5DJ8A 1JZ2A 1B4RA 3JV0A 2NY5H 4GW1B 3CSPA 4Q0XL 4G9FE 3GSNL 2BJML 1KELL 4WWKB 4HH9A 1SY6L 2O5ZH 5GRVK 1BAFH 4YHPA 1NAMB 3BP7A 4Y16B 4N8PA 4Z7VF 3O0RL 5LBSL 1RK0B 1T1XB 3AB0C 4RMTA 4TUOA 5I1LA 2NTSP 3T1FA 3DVNA 5LG1A 1QFWH 1AFVH 5L0QC 1M6OA 3QNXB 5HHPA 4MNQE 3HC3L 4ZAKC 2QQLH 1MHHB 1RMFL 1OAZH 2RCSL 4NN6C 4NM8L 3RHWK 3V79C 4TQEH 1F3DJ 5FO7B 4JDVB 1F11B 3X3FH 3UDWA 1HCFX 2YZ8A 3U9UB 4KJQC 5ALCH 5GGSB 1WTGT 2PTTA 1WWWX 1BIHA 1RUPL 4FQIH 5HGHA 5JHDA 2WUBL 1MRCL 3QXDB 3VA6A 1MCWW 1YEFH 4LNRA 5ESVB 3GMNA 1G9ML 3MRGA 5GXBB 5J1TC 3LN4A 3VGEA 4J12A 2PKDA 3VI4E 3B8SA 4GAFB 1CXIA 5DHVB 3KLAA 1PFCA 3UTZB 4Z0XA 5HI5C 3BIKA 2ZUYA 5DHYA 1QEWB 5MEOB 1PSKH 2YD2A 3UXFA 5KAQF 4GLRI 3QDMB 2AGJL 2HFGH 3IS1X 5CZXD 4QYOA 3RWJA 6FABH 4PJBA 5DD3H 2Q76B 3TJEL 2Q8BL 3U30C 3VXTB 4F7CB 1D5XB 4Z78B 3QIBC 2Y7QB 2UWEE 4XNZC 3GJFA 2WP3T 3ULVE 3N1MC 3OKKA 4GKZB 4HC1H 3G6JE 4NNXB 3IJYB 3UTPE 1IAKA 4DGVH 3HZKB 5DSCA 3HC0A 3H7BA 5IKCA 1P84K 1ETZB 5E24E 4BSWA 1U8QB 3BN3B 4E9LA 3IVKA 3BUYB 4ZG1A 4Z95L 5I1JH 3FQWB 2UZXB 4N90D 5I1CH 1VESA 3CK0H 1OGTA 1P1ZA 3PXJA 4AIZA 1BVKB 3L95B 5J13B 5GGRA 5IW6A 1I1AD 2COQA 2EDDA 3ARFB 1KIQB 1A21A 2F19L 2R0ZL 3RA7H 1D9KB 2FZ3A 1WV7T 2V17H 2IMMA 4WI6A 2DI8A 4M6ML 1NGXB 3UTTD 3L7EB 4D0BA 2X1XR 1UB6B 5AWNH 4JFDD 1G9NH 3EYOB 4OTXL 1MCCA 2ITDB 1X5KA 4MNGB 3S34H 5C2UB 3EFDL 1S5HA 3HNSH 4YBQC 2ERJB 1I3RA 1AI1H 2C3VB 5JDSA 4OT1L 3HE6D 5KANG 4LSPL 2APVA 1HIMH 2FX8H 5C0GB 4UNVA 2R9HC 3NTCL 2WLYA 5KVEH 4MD4B 1MLCA 4JRXB 2FO4A 1OAXH 2W0PA 2OXGA 1JNLL 2KPNA 4KMQA 5IMKA 3FB6B 2HJFA 1HXYB 4G8IA 2NY4C 1QPPA 4WGVB 3IAQA 4N0YL 1HQRA 4XP5H 3G9VA 2IQAB 4MJ6A 4UTBH 1I3UA 3DX8A 5LGJA 3MLRL 4HUXB 1RJLA 4O2CB 5DRNA 3OXRA 1JGDB 1ORQB 2D7MA 2E9BA 7FABH 1DQMH 5I30L 3QB7C 1A0QH 1YC8A 3RY4A 5E99H 3N1QC 4O9HL 1R3HB 3VRIB 4LCIH 1WFUA 25C8H 4EI5D 4P5MB 4QOKD 4K3DL 4I77H 5MERB 2VAJA 5D7SH 5C7XH 3PWLB 1CE6A 1H3TA 3IB4A 1A4KB 3N50A 2DD8H 3Q5OA 4QTIL 3F6LA 3T0WA 3JWOH 1JRHI 1O7VA 1ULVA 2EYSA 5CWSB 3QWOA 1K3ZA 3PNWB 1BMGA 5F9OL 1S7UB 1FL3A 5E70A 3R0MA 3C87A 5GJTL 1QYGL 4LVHC 2OJEA 1FH5L 2VDKH 3U83A 5KVGH 4ONFL 2XACC 1BFTA 1R0AH 3T3ME 2J6EL 1HWGB 1AO7E 4BH7A 4KAQH 5FGCB 2AXFA 3ZDXF 2GK0A 1IM3A 1MI5A 1W0VB 2XA3A 5J6HB 1BEYH 4GXVH 4DCQA 2CKBA 4DGIH 4IMKA 3MA9L 3HNTH 5C0AE 4L3EA 1VGKB 1XH3A 3L3OB 4HWZB 5GHWH 1FNGA 3RWDB 5MEPB 4P59L 3UJTL 1AC6A 4R4NC 3HAEB 4ETQA 5D7JA 1U6AH 3EO9L 4XAWH 3VXUB 2BOBA 5A2KH 1NCWH 4XCEB 4XC1H 2X70B 4KV5E 4NZUL 5I19L 1FVEB 3MBEC 3FQNB 1U8HA 2BY1A 1QP1A 1W0WA 5KSUA 3ZDYE 3RNQA 4O2FA 1CU4L 3MCG1 1MWAB 2J2ZA 4OZIE 4TVPE 1FDLH 1KBGH 2AJYL 3LHPL 2VAAB 3MRNA 4MS8D 5CFHA 1NGYB 3QUYC 4KHTH 3HE7C 1JPTH 3DXAB 5H37G 3RVUD 2GJ6A 3CDGB 3PDOB 1JI1A 1A2YA 4L8DB 4XBPB 1ZK9A 3OKEA 1J8HE 5IHZA 4NKQB 5JW4R 1MRFL 4HT1H 3ZKMD 1QFUL 3AY4C 2R69H 3ZE0F 3QH3B 1JPSH 3HB3D 3NAAL 4LLYA 3EOYG 4JFPB 3MO1B 5T5FH 5GJSH 5I8KH 2GCYB 3EFFA 3I2CL 4NUJA 3FOMA 4PJIA 3QUZD 4WO4D 4LSUL 5L2KB 1HILB 1U8IB 1P4LA 4NZTL 3V4VL 1PEWA 4JPIA 4Z0BH 1QVOB 3PQYE 1NH6A 5I71B 4XP6L 1JUFB 2FWOB 4RQQB 1YEDB 3CMOH 2CO7B 4BKLB 4NRXA 4YHKL 2C4FU 3PHOB 2AKRA 1CIDA 4Y2DC 2MCG1 2V5SA 2ESVE 2OR8A 3QFDA 1FLRH 5C08A 1KTDB 2MFNA 3RGVA 1E4XI 2CUMA 2R2CA 2PF6A 3MV7E 4G5ZL 4Y4KA 3TO4D 4M7LH 5C9JA 3K1KC 1HHIA 3EZ8A 4S1QH 3UC0L 3WLWC 2AJXL 4O5LH 3BAEH 1JBJA 4HKZA 1CTNA 3VWJA 3S88L 3W11C 2VN4A 3T2NH 4UINL 1P7KB 3U7WH 2QTEA 3QO0A 1FPTH 3MRDB 4YHZH 1EHLL 4WFGD 5D1QB 5GRVL 1X5AA 3MA7B 3KVQA 3WS3A 2DQHL 3HLAB 5C0FB 3H42H 1KC5H 4DEPC 3ALXA 3C2SA 1A7QL 5FKAB 5LWYL 1NCCH 2JJSA 1W8NA 3EYVA 2Q7YB 1E6OH 2QEJA 3GBNH 1QSEA 4N1CA 5D7IA 2J5LB 3BEWB 3H3BC 3BKJL 1EBPA 4JQVA 1X4YA 5CEZE 1NAKL 1EO7A 4KTEH 4QCIB 4G6KH 4N8VB 2BSTA 3LB6D 5CMAB 1C16A 5HY9A 4WEUD 3BRFA 1FCGA 2EDYA 3SDXF 3AS0A 3UO1H 3QNZB 3D2UB 3SGKC 5ICYA 3EYUH 5C6PB 4YDJB 5ACZA 3E6HA 3NZ8B 3CLFH 3IDXH 1AGEA 1U95B 2XG5A 1G84A 3S4SG 5TDPA 4CU6A 1SYSA 4ONGH 1IARB 1UYWH 3FFCB 2FL5B 1A1NA 4LDLB 1EDQA 3KYMB 4WUKH 3KXFA 1I4FB 1S8DA 4OQTH 5FECB 3NOIA 5IFJB 4RZCB 1QOKA 5C0JB 2DWEB 4FFYL 5F88A 1T20A 3UTSD 1CFSB 2BSSB 4I0PD 3VXOA 3O11A 2D03H 1LILA 1IT9L 3FO1A 3L6FB 4HLJA 2JJWA 3BO8A 4ZUUB 3RWEA 2R1YA 2IPUG 3BHBB 2A6IA 1U91A 4LARL 2J8HA 4KJWC 3PHQA 3F5WB 4NRYB 1JNJA 4U1IB 4QHMB 4G80B 3KYKH 5JIPA 5KVFH 4HWNA 2AJVL 1QLFB 2EYTB 1ADQH 5IG7B 4ZMAT 4P5TB 4RIRA 4N0CD 4DN4H 1K6QL 3FQXB 5E03A 1H3WM 1SBSH 5JW4M 1DSFH 3DBXA 3RTQA 1IRAY 3U2SA 3VD3A 4GBXA 1KLUB 3SGDH 1D5ZB 1HQ4B 4BZ1H 5IVNA 1J1XH 5F3HB 5JR1H 4XXCC 4I18C 1ZXQA 4HC1A 4MAUH 3X13A 3MLTB 2VSCA 3ISWA 1AHWC 3FTGB 1CDBA 2NZ9D 3EZJB 1T5XB 2N7AA 4X9HA 2HRPH 4ZUSA 5DTFB 4Q9CA 4GKSB 4L8BA 1S9XB 1HINH 1B9ZA 3MRBB 4WDIA 2QSVA 1FAIH 1K3IA 2O5XH 2YD3A 5K9OA 1JWUA 3QFJA 1DTUA 1D5BA 3Q3GB 4DUWA 5IFHL 1U3HA 3WUWA 3VGDA 2NY3C 4IRJD 4KC3B 2EH7H 4IRZL 4M7KL 4AEIH 2EDLA 5EU5B 1VKXB 5B39B 4P57A 5JHDE 1L7TL 3ULVL 1N59A 4TPRH 5BS0A 3JTSB 5F3BA 3U7YL 4FQXB 1H9VA 4J3SA 1M7IB 1KG0B 4NZRH 4LLUA 4MAYD 2DLIA 3EO0A 3T0EA 4X6EA 3ULUE 2CMRL 1FCCA 2XIDA 1MCOL 3SCMA 3F7YB 3O6LL 2F5BH 1MAJA 4JY6B 2VDLL 2Z35B 4PJBE 2UZIL 4S1DD 5TE6H 4C59B 1E28B 2HT3C 4KKLD 4QWWD 5F7NC 4K7FA 4M4RA 3SQOH 1YY9D 4PY8I 4P3CL 3S3JA 2BC4A 4PJ7B 4PRNA 3P4MA 4O51A 4GAJL 4F7EA 2H41A 4ZFZB 1C5DA 4WWKD 4CVUA 1C5BL 5FM8A 4M7ZB 1NGZA 2J7LA 1AXTL 2AXGB 3GM0A 2VE6B 5CGYC 4OZFB 3BWAA 2E8ZA 5D1XC 5ECJE 1XF4B 5DUML 1JHTB 5F7DA 4DKFL 1UB5A 5F21B 1IFHL 3BEVA 3QQ9C 3EYFB 2Y9RT 2E7LC 1B0RB 3CSYB 3MRCA 3OPZL 4Z7VB 5DRWB 1KCVL 1KCUL 3MOQA 1HYSD 1CZ8L 1RZGA 1EEQA 4XXDB 1XGRA 4PJFF 1TZGH 2X4NA 1CFVH 5EOCL 5HHVH 2EDWA 3ULSB 3VFOB 2YOCA 3KYNA 5DI8A 2BY0A 4G6JL 4K23L 1T7WA 5C8JA 3VD9A 3OX8B 1KIPB 1YMHB 2LTQB 1FO0L 1ZMYA 4KJYB 3VFUA 2F5AL 4XBEH 5E8OA 4ELKA 4X5WB 2PO6C 4GW4B 5T1MA 2H2PD 3Q6GL 3R06A 1K8IA 1BLNB 2C1PA 5HD8C 4ZOAA 4MHHG 1LE5A 1Q1JH 3QDMD 4KQ4L 4I0CC 3O41A 3RY6A 1SJHB 4CBPA 4DW2L 1F58L 1LO3H 1NBYA 4I3SH 5HYQB 3DV6A 2W9EH 3VFNA 2P1YA 3LEVH 5HHXL 1YYMH 3CX5J 3Q1SH 3IAGC 3T08A 2AV7A 3NACL 1MIEH 2FYYB 3P9WB 1AD0A 1TJIL 5DC0A 2OJZH 3DX9A 2HYMA 4YZFF 4KZEH 2B2XH 5E2JA 5DD5L 4E41D 4K94C 2RQ8A 4IJ3B 5JOPD 3VI3E 5JXEA 1D5MA 4F9LA 2JTDA 4NBYB 1YJDC 1A6ZA 1J86A 3CNKA 3V9FA 2HLFD 1ERNA 2BMKA 5C3TA 1BJ8A 5FGRA 5CEYA 3IAPA 1LE9A 2VXTH 2NX5E 2V5RA 1OAUL 4FNLL 1GOFA 4HPYL 1OAKH 3RIFF 1KF9B 3ARFD 3W5NA 4FN0A 1D9KD 2NXZD 3MBXL 4RGNE 4XWOD 3L3HB 3V7AE 4MDIB 4B41A 3T0BA 3MV8E 1CFBA 3WL9A 2FSEB 2VITB 3QXTA 1NJ9B 1P6FA 5C70A 2FH6A 1I8MB 3QG7H 3ZTJG 3SKMB 2IG2L 2NY1B 4UT7H 1DVFB 1TCRA 2EIDA 4Z7QF 5DT1L 5BCAA 3UTOA 4CADA 1MCFA 3TCLB 2KL6A 4TVPL 4RAUA 5SWSD 2BOCA 1U8KA 4KUCF 1VFAA 2NY0C 5DF0A 1LGVA 5I0ZA 1GZPB 3BPOC 4L3EE 1U8JB 4OGYL 4YFDB 5HVHB 3PABB 1T66C 2BNUA 1EERB 4Q6IC 1JGEA 2F74A 3U82B 1E27B 5AYQA 4HFUL 2BVOA 4AYFA 1S7SB 3NBNA 3QRGH 5F7FA 1T2JA 1U58A 2CXGA 3G08A 5E2VH 2V7HB 4AL8H 2EKSA 3JV4B 4EDWH 4ZOBA 2JB5H 2SEBB 4L8SA 3OTTA 4G8GB 3H3PL 4AG4H 1DN2A 1F90H 2KKQA 5IT2H 1II4E 2UVFA 4UDTB 3QEGL 3OXSA 1LK3L 5D70L 2GITB 3L3IA 1LEKA 3V52L 4XNQB 4J8RA 3TIDA 3I50H 1DBKL 4F58L 2GJ6E 3KS0J 2XTJB 2Y06L 3M1BA 1NEZB 1R3IL 1N0LA 3ARZA 2IBZX 2UUDH 1EK3A 4F33A 5MI0C 4UTAL 2CO6B 3MR9A 3DV4B 1TZHB 1DQJB 5IWLA 3B3IA 1DUYA 4BQCA 3QA3B 3OKLA 4AM0A 4WFEE 2GUOB 1JTOA 3CFJA 4JANA 4CMHC 1NPUA 4MD0A 2GY5A 1JV5B 3DO7B 4IMLB 3MYZA 5ADPL 3ARBD 4LIQE 2DJSA 5D5MF 5D9SA 3GSQA 1IGIL 3HPLB 1L0YA 4G6AC 4LOUC 3Q2CA 1MFCL 4PTTB 4OFDA 4TTDD 1XR9B 1GIGH 1CLYH 3W9DB 4ODSL 5T5NG 1A9EA 4HIXH 3UTTA 2V9QA 4UB0H 4K9EH 4JFDA 5F93C 4KKCD 3DSNA 3K7UA 3VXMB 4GSDH 3A6CL 3L5XL 1QFHA 4NWTL 1KB5L 1QNZH 1JCKA 2DIJA 3C5ZC 5L7XL 2ED9A 4EN3C 2YPVL 4FQ1H 2WUCH 1MLBA 5IB3B 2Y07H 4YHIA 3BPCB 3V0VB 4PJHA 3HE6A 4MYWB 4NNYB 4Y1AD 1P69B 5E8NB 4OQTA 4NN7C 4HXBH 4FQ2H 3PL6D 2V5MA 5T1LA 5DVOA 4R3SA 2D7TH 4LCCA 3REWB 3DXAD 1CS6A 1ES0A 3IDJB 1FORH 1WBYA 2E6PA 3RWFB 1DJSA 5JW3L 4UV4L 4NO3A 1BQHG 2R0KL 4Z5RB 8CGTA 4P5KB 4PRIB 2DBLH 3EDJA 3VH8G 5T1DL 4FXKB 1A3RL 5BV7C 5F7WC 2R56H 4BZYA 4FQCL 3BZFA 2HG5A 4CJ1A 2FH8A 2JIXB 2IPKB 1QSEE 5D7IE 4QF1A 3FKUS 4OD1L 3TO2B 3U9PH 2BXZA 2BX5A 3ET9F 1MCEA 2VH5L 4ENED 5FEBA 2K7PA 3MJGX 4G9DA 3RVVC 1LP9A 5C6TH 4WFFE 1T0NB 2GJZB 1OTSC 4MSWB 4PJ5B 4EI5A 4QOKA 4GW5B 3C8HA 2FX9L 2QSCH 5K33A 2KUTA 4G43B 2OTWB 1UVQB 1F97A 4HGKC 1ADQA 1PVHA 4XHJD 3PWVA 4LKCB 1PKQA 4NT6A 3G6AB 4L9LB 1IKFL 5IQ9A 4R7NB 3WIIH 2VXSL 43CAA 1ZT7B 1AQKH 2CIIA 2XQBL 4OZ4B 3ROLA 4DTGL 4JGJA 5I1IL 3RL2B 4JREB 1JPGB 1KJ2L 3QUXB 4U0RB 5DJAA 4UV7H 3KXFE 5HPMB 4Q2ZA 1KTLA 2FRGP 2GQHA 4WW2A 1B0WA 1REIA 5TH2B 3TPUB 3OG4B 1AY1L 1KENL 1U92B 3SO5A 1A7NH 4U1MB 3CJJA 4YDKL 1QLEL 3RIAF 1EX0A 2EXYD 1QBMH 5FOJA 5D7KD 1LEIA 3MLXL 2VISB 3FCTB 1A9BA 1IC4H 4LSTL 2WANA 2W9DL 1NGPH 5DQJB 4ZPVA 4XH2B 5D1QD 2VO5A 2XXMB 1TJHH 1GGBH 3RWHA 1NMAL 5D72H 4Y4FD 2XN9D 3L9RB 1VSCA 5FK9B 1A14H 2OL3H 1B0GB 3NIDE 2VLKB 5E2UH 2Y5EA 4P9HC 2WQRA 1NSNL 4GRWF 4U6HA 4U49A 4AH2A 3BYYA 5I1HL 3BZEB 4KROC 3H0TA 2FJGA 3VGGA 1AXIB 3ARTA 4MVBC 1SBBA 3FT4A 3P9MB 5KG9B 5E2WH 3S5LB 2IANB 4ODHH 5I75C 4QT5A 1N6QL 2AJSL 5ID1B 4L4TB 3D2UD 5SV3A 1T3FB 4NO5B 5JHLL 3LDBC 2XWBA 1KN2L 3FFDA 3QBTB 4ZAKD 3MLVH 4WEBL 3DX7A 3JWDH 1RZJH 2R23A 3FFCD 2ZG3A 4KJQD 1ZLUH 4PRBA 4IRSC 1V7NH 1PZ5A 5EOTA 5ESQA 5DRZB 1JTTA 5I1DA 2NR6D 1K2DA 2Q87A 4AT6A 2W59A 3X14A 4HQQL 2YSSB 3GSXA 3ULUL 3BKYL 4PGBA 4WO4A 5EU7E 3L3JA 1T89A 3I75A 2EO9A 4LEOB 3W39A 1DQQB 4W4OA 3THMH 4JO3H 3TEUA 4KMTH 4UT6H 2F58H 5AZ2L 5EZIL 1CVSC 4A6YA 4ELMF 4R7DB 4ZYKB 4JHBA 1QBLL 5CIPB 4NQVA 4AK1A 2A38A 4OSUL 2M2DA 4R2GC 3SO3C 4JFED 5T33H 5HGDB 4UIMA 5EZLA 4LQFH 5GGTH 4YPJA 1PJ9A 3U7AA 3STLB 5IMOB 5D1ZD 2ZKHH 5L2JB 1YEKL 2R2BA 3G5VB 3T0EE 4M93C 5DZNA 4EZMA 1UJ3A 4U1LA 2QKIA 5E8DL 5FYLD 5GS1C 3TO4A 4M5YL 3VXSE 3GMOB 3W0WB 2Q3AA 1OCWH 3MJ7B 3WJLC 5DO2C 3HCVB 5EU6B 3EHBD 3WHE0 5M94B 3P30H 1T0MB 3MJ6A 3E2HB 4MXQC 2CDFA 3P4OB 2J4WL 2XKUA 2LU4A 1LMKA 3IKCA 3V5HB 5F1IB 3Q5YA 3P3YA 4HK3J 1NUGA 1A4JB 5E6ZA 5F9WB 3MNVA 4HG4J 1I1FA 1MHPH 5I1KL 4EUPG 4RMUA 1OY3B 2W0FA 4F15B 4R97C 3CZFB 5GZND 5C0DA 3F7VB 1KYOK 4GLRH 4ACPA 3DRQA 1CG9A 3U36B 2FEEI 3TBTB 1SEQL 5DR5H 1YQVL 3I02B 5E95B 5KTEH 3FO0H 5GSVB 3WE6A 1KXQE 3D3VD 1P5UA 3V4UL 5C0CD 3NCJH 4UNUA 3QYCA 1RI8A 3CPLA 2KZ1B 3HAEH 4M7JH 4PP2B 1ZS8A 5E8EA 4XCFH 3TBSA 1U8NA 1KLGB 3FO9B 1QLRB 1A6UL 5JLZA 3LEXB 3KPLA 1H15A 1MFDL 4OM0L 3SKOB 4X4MA 3BD3A 5FUOH 4MLIA 4FQXD 4EXKA 1MUJA 2DI7A 4KRPC 2OR7A 1KPVB 5FYKU 2ZUXA 3NPSB 5F70A 4L3CB 3KDMA 1QQDB 2CQVA 4X7TA 3WIFA 4EVNA 1BIIB 3P0VH 4RFNC 4LHJB 3WXWL 3MRHB 3BDXA 1ZHNB 4Y5VA 5GS3A 1R6VA 3P77B 5EH1A 1G7IB 1MJ8L 3GHEL 3UTSA 4CN6A 1KN4H 3WMSA 4I0PA 1RZKH 4OUOA 1S7WB 4WCYH 4Q74A 3KWWB 2ADGA 4U0QB 1SQ2N 5E9DD 3BOVA 3VXRB 1RUAH 3GMQA 3VFGL 4G7YL 3OQ3B 1DUZA 1NAML 3V7AG 3BXNB 4PY7A 2OX5A 5CJQL 1A64A 5GSRA 4XNXL 1S7TA 1KXTB 3NA4A 4FQQB 2FGWL 4PG9B 3L3KB 2GYSA 3FMGH 4NJ9L 4JKWA 1M05A 1Y18B 4GUPA 1IGTA 1TVHB 2CH8A 4Z7WF 1QZ1A 1UH3A 2HFFB 1T5WB 3FO2A 3GNML 4LLQB 4CVXB 1TVBA 1UH2A 4LBEA 5JW4N 3BP4A 3PG2A 3MRJA 5LGHH 4N5ED 4FZ8H 1A8JH 4YXHL 4MZ3A 4F37F 3WNOA 1PLGH 4X6CF 4PB9L 3REVB 1S7QA 4AENB 4EXPX 3FB5A 5CBAA 2H3NB 4XMKL 3T0AA 4Z8FL 4JHWH 4NN5B 4MJ5A 4TUKH 3IDIA 4PBVC 5A2JH 1VDGA 4LASL 4R4ND 4WTZG 4PJEF 1RUKH 3U4EA 2ZJSH 2ZCHL 3EJZC 4PJFB 4AQ1B 2P44B 4P99A 5EU3B 4NQDB 3IU4H 4MNHA 1HSAA 5DD6B 1C08A 1HHJB 1F6AB 2OSLB 3D69B 3TIEA 3V4PH 5IEKB 4FHBD 2BFVH 4XNMB 4YLQT 3RZWA 4JG0L 5TDNA 1I1RA 3I6KB 3AS3A 2CSPA 5I66B 2IFFH 1KIUA 1JRHH 1ND0A 4YNYB 2RFXB 2PYFA 3LD8C 4IRJA 4YO0A 5L6YL 1UKTA 4IHOA 2Y6SC 3MRMA 5FDWA 1S9YB 2Y36L 5HGBA 1WISA 3ILPB 1QFPA 1H0DA 3HUJF 4JAMB 1RIUL 1KJ3H 2ATKA 2QJDA 5CJBA 1CL7L 1GOHA 1Y6MR 3UYRL 5IVXF 3W9EA 4HS8H 1QSZA 2A9NL 3S8WA 4GAYB 1IAOA 1MQ8A 2H32B 4F7PA 3D1MC 3HZYA 4MAYA 2ZUQB 3SOBH 4QRRB 1CR9H 2DS4A 4LIQL 2NY2B 3PIQA 4F7MB 2E5EA 4BUGA 3L5WA 4R0LA 1WFTA 1G1CA 4JHZA 1C1EH 5TJWK 3P0YH 4R8WH 3RWIA 5C09E 2K3TA 4JFHD 5A2IH 3VDAA 1CLZH 4EOWL 1NKOA 4W6XB 4WWKA 4RGNC 4XPHH 3RAJL 2DLFL 4KTDH 1OT2A 3M8OL 3CUPA 1RK0A 1T1XA 2NY1D 2RHEA 2X4RA 4N90E 1ZKAA 5TF0A 3ZYIA 1W2KT 1GL4B 3CLEL 3QNXA 2J12B 4XTRC 3DJ9A 3MOAH 4ZS6D 4OCXH 3MV11 3U6RA 3HI5H 1MHHA 3QZWB 4BA8A 4LVNB 4WHDA 3VFSB 5BVPL 4OLWL 3HKFA 1KCRH 4BFGA 5FO7A 4JDVA 1F11A 3CX5K 2LAGB 3U9UA 4ODXB 3UTTE 5HPOA 5GGSA 4P4KB 4IMKC 3QXAB 3TZVB 2MNUA 5F7EH 3A6BL 1HKLL 2HJKB 4YHLL 4E0RB 3O6KL 1KB9J 4U3CA 3GB7B 4HKBB 5ESVA 1NANI 1ZHKB 4PRHB 2E27L 3BISA 4EBQH 3I9GH 3H2WA 1DLFH 2IBBA 3FQUA 1R5VB 2F53B 2AK1L 5D7JC 5FYLH 1GGCH 4PJ8B 4PJHE 2DQEL 3BQUD 4M8QA 1MFEL 3AS2A 4G8GD 5B4MD 1QEWA 1HI6A 3J7HA 4ZTPL 1Q0YL 3QDMA 5DD0L 1QFOA 4P9MH 3HNVL 4U6TA 1ZHLB 2XTJD 4K3EH 3VXTA 3VFVB 4M03A 1D5XA 4Z78A 1CQYA 1OAYL 1EH9A 3RDTB 2VDOL 1UXSA 4GKZA 4JB9L 2F54B 2NY5L 3MMEB 4E41A 3HZKA 3JBG7 4YXLL 3KJ4B 1E4XH 5KS9F 2YMXL 1U8QA 2GSIB 4G6ML 3BUYA 1D7FA 1UWXH 4NQCB 5DMGC 4ZSOB 2OL3A 2W1NA 4JFYB 2O5ZL 1OAQH 3FQWA 1J05B 5JQHC 1OPGH 4X4XB 3VGAC 5A3IC 4BFIA 4YK4C 3QIWB 1BVKA 1XFPA 3L95A 5E7BA 3WYRA 3MCKA 4KKBD 1JTPA 4M1DH 2EDXA 4OLYH 1AJ7L 1AFVL 2FX7L 3ARFA 1KIQA 2QQNL 2RBLA 1PKQE 1D9KA 1YPZF 1CD1A 2VUOA 1OAZL 5EZOH 4UAOC 4TQEL 3L7EA 5D5MB 2MPAH 4WU7B 3HI1B 3EYOA 2D7QA 1WSST 3VXMD 4MNGA 2F8OA 2YUWA 4MXWH 2EH8H 3GHBL 4KJWD 1YEFL 4L8CB 4K8RD 2C3VA 3LKOA 4ZXBB 1XF2A 1EGJH 5ETUB 2FIRT 3VXNB 1NFDF 5B22A 4KZDH 1CFQB 3EDEA 3RGVC 1K4CB 3MFFB 4JFFD 4MA1C 4X8JA 3QDHA 1Q72L 4Y4KC 5I2IA 3HHRB 4MD4A 1PSKL 4AMKL 5SWSA 3AROA 1MPAL 4X7SH 2HFGL 2RIKA 2EIEA 3FB6A 6FABL 3O9WD 5EU4B 1Q9KB 5DD3L 4PRID 3GBLA 4WVRA 3CVIL 3DX6B 2YPLB 5HDQH 3VWJC 2IQAA 3OB0K 2CK2A 5TPWL 4HUXA 4O2CA 2JIXD 1R3KB 1S78D 4HC1L 1JGDA 1NBZB 1JHLL 1BZ7B 1ORQA 4LPUA 1C8PA 2EDFA 5BZDA 4GG6A 3BVNA 1R3HA 3KJ6L 4L4JA 3VRIA 1RFDL 5GGTA 2JJSC 4FXGB 4PJ5D 5IHUH 1BFVH 1J10A 4RA0C 3CK0L 4IOIB 1WEJH 3O6FB 3DIFB 3MGOB 3PWLA 4JQVC 1WQVT 2B5IB 4RMRA 4NQED 3OR7A 1A4KA 5A16B 2ZCLL 3AB0B 3QPXH 4JDTH 3W5MA 1FNEB 5CWSA 3RA7L 3PNWA 1C7SA 2GKIA 4ODVL 1S7UA 5CSBA 2V17L 1T21B 2NY3D 5F6HI 2XZCL 3QUXD 4E42B 3WXVH 4YDLB 2XNAB 5AWNL 5FXCH 3KPNA 3B9AA 4KQ3L 3IDGB 1MFNA 2HAZA 4K3JL 2A77H 3S34L 2AEQH 1X5XA 2D31A 3HNSL 3U0PA 4ZFFA 5C86A 1ZOXA 4FG6D 3C08H 1AI1L 4DOHE 1LD9B 2IBZY 5FV1L 4U1SB 5F6IB 1W0VA 3ARBA 1JYWA 2ICES 1HIML 2AEPH 4DFHA 2FX8L 5GRYA 3VI4F 1MVUB 5KVEL 3U79A 1VGKA 3L3OA 4HWZA 4Y2OA 1OAXL 3OF6D 3ZKXB 3RWDA 5MEPA 4WNQB 3ZKQD 3GBML 4LHUB 3L5IA 2PR4H 1R24B 3HAEA 4PB0H 2Y5TB 5I6XB 1NUNB 2VLKD 5SX5H 2VSDA 2CJUL 3DURB 5BOPA 4KK6D 4XP5L 3EOAB 3EUUA 4WHTB 2A0LC 1ONQB 2UWEF 2X70A 3V5KB 3QIBB 1FVEA 1F45A 3ULVF 4LU5H 1E4WH 4M3JA 3G6JF 4ODBD 1D6EB 1MWAA 2EXWD 4OB5L 4ONOA 4C54A 2P49B 3L3GB 2IAND 5E99L 4NPYB 4I13B 2VAAA 4Y1AA 4HGWA 5EG6C 3QUMB 4LCIL 4GRWB 3JV6B 5IROA 3MV01 4YFLF 1NLBL 1NGYA 4I77L 3ABZA 4M1CC 4JN1H 3MRQB 4PLJC 3DXAA 5C7XL 1JNNL 3QQ9D 2AQ3A 3DUSB 3CDGA 3PDOA 3BGMB 1DBAH 2WBWB 4HKXB 1LNUB 4WFGE 2C4FT 5BZWB 3O3AB 5E5MB 2GIYA 5CKGA 3RTQC 4PP1C 2DKMA 5C0BB 5GRJH 5TDOA 1RUQL 2E8YA 2L4OA 4Y19B 1GXEA 3QH3A 4TRPH 2VDKL 4DGYL 4JFPA 2PXYB 2NXYC 3MO1A 5DUBB 5KVGL 2GCYA 5DD1L 4N0FB 4M9OA 2AI0L 5L2KA 1HILA 1U8IA 5EA0H 3MREA 4HV8A 5AUMB 4XI5D 4KAQL 5EBWB 5CD3B 3TN0D 4AJ0A 2ZOKB 4XBGB 1RZ7H 4LSQH 5D96C 1JUFA 4PG2A 2FWOA 4RQQA 4XC3H 1YEDA 5CSZA 5EU7C 4BKLA 4NHCH 1S5IH 3GSNB 3HNTL 4X4ME 3SKNB 3GKWH 1U3HC 1XZ0B 2VDPL 2R0LL 1X6NA 4O4YL 2C1OB 1PG7H 1A7OL 1KTDA 1GVIA 3GSOB 3O2VH 4ELMB 4ZUTB 5J06A 1OW0C 1NCWL 1QSFD 5TE7L 2NY4B 4JVWA 4XC1L 2CK0L 5CBEB 3EYSH 1G9NC 1FVCB 4JRYD 3UTSE 1V05A 3O2DA 1AXSA 5EU6D 5CSGA 1FGVH 4M5ZL 1FDLL 1KBGL 1A7PL 3T0EC 1DBBH 1SEBB 2GY7B 1CDYA 4S1SH 3SCMC 1F4HA 1P7KA 2CPCA 4LHQB 5EOQH 3RPKA 3VFRB 4KHTL 2XWTB 5D1QA 1JN6A 4JQIH 4Q7DA 3TWCH 4NC1E 3MA7A 4Y4FA 2XN9A 2CDEA 4NNPH 5IW1B 2HKHH 4KUZH 5BXFB 5FKAA 2AK4B 1E4JA 3G5YA 3VW3H 1FFPB 1EFXB 3BEWA 2R69L 5I15H 2CXKA 5F97E 4B7LA 5JNYB 4QHNB 5T5FL 1XGUA 2GT9B 5CMAA 4YIQB 4DN3L 2AJZB 2BRQA 1U8OB 3T3MF 1DFBH 2Y1VA 3QNZA 3D2UA 3C8KB 2MKWA 1NCNA 3SGJA 4YDJA 4OGZA 3CMOL 4ZAKA 1MQKH 1AH1A 4ETYA 5CP7B 4QNPE 5TQ2H 4KVNH 1T66D 4OF5A 3FFCA 4X83A 1ACYH 3GO1H 4PGCB 4JHAL 4K8RH 3T0XA 1WC7A 3HMWH 2FL5A 3KYMA 2ID5A 4OV6F 2BDNH 1A5FH 4XPAL 1EEUA 3HPJB 5C0EB 3JWOC 1I4FA 3H9YA 4KK8C 5IFJA 5EUOE 5C0JA 4N68A 2DWEA 2YEZA 3OMZA 4YX2H 3GGWB 1CFSA 4M7LL 3MJ9L 3RL1A 2MOVA 4CMMA 3TA3B 5C92A 3MFGB 4C56D 2BY3A 4KV5F 1JWMA 3L6FA 4KI5D 3DECA 3H9HB 3RY6C 3QHFH 4ZUUA 4O5LL 3VXRD 3ZDYF 3B43A 1KIRB 2VABA 1S7RA 4OIIH 1IC1A 1N0XH 1YMMB 2R39A 5JMOC 3PGCB 3T2NL 4OZIF 2I9TB 3U7WL 3VE0A 1YNKL 2EDRA 1G6RH 4JFEA 5HHME 3CCHA 4PJDF 2MHAA 4YWGH 1CFTB 1WZKA 3F5WA 3FL7A 3DYPA 1KC5L 3HE7B 1JVKA 1XT5A 3MLZH 5FFLA 2FD6H 1CGSL 4HG4K 4QHMA 5D1ZA 2XA8H 4G80A 2EEDA 4G8FB 1E6OL 5LXGL 5I9QB 5JXEC 5I1GH 4F9LC 1TMCB 3S37H 3MLWH 4G8EA 5IG7A 1XF5A 3FQXA 4M6AA 4G6KL 2ATPB 1EEYB 2CLVB 4PLKD 3TH3T 2V5TA 3DPBA 5IBLC 4Z7WB 3UO1L 4JQXA 3B5TA 1D5ZA 3EYUL 1HQ4A 5L8JB 5KW9H 3QAZC 3IDXL 4JVUA 2XPGA 3MLTA 1UYWL 2WWMD 3TNNA 1T5XA 3FRPA 4X6CB 3FQTB 3KPOB 4QXWA 5GIRA 1Q9LA 4GKSA 5CUSH 1I9IH 3V95A 3MRBA 4ZTOL 4WRLA 1JPFA 5EBLB 5B8CC 3LIZL 3LMJH 2GAZA 4PJEB 3Q3GA 5FOBB 4NWUH 3D3VA 1C12B 3W81A 5C0CA 4DAGL 2D03L 3NABL 2OZ4A 2DL2A 2D3VA 2W60B 1M71B 2X9XA 1OP9A 4ERSL 3ECBB 4NJAH 4J4PC 3JTSA 5DMIH 2DTML 2IH3B 1A7RH 1G0DA 4QHLB 4OZGA 5ALBL 4FQXA 4XNUH 4MA7H 1M7IA 5C0RH 3CDCA 1KG0A 1F4XH 4W81A 4HWEH 3QDME 4QRRD 1TXKA 3HG1B 3HUJB 1PKOA 3F7YA 1RY7B 2NY2D 3BDYL 2Z35A 1EGJA 4TSAH 3RVVD 4L8SC 2FR4B 3T2PA 1E28A 2PW1B 3U0TB 3N85L 4DN4L 1SBSL 15C8H 1RIHL 5E9DA 1FSKB 5CZXC 1DSFL 5ICXA 3T4YB 4E41E 2DBJA 3QEUB 5JOPE 5IB1B 3RJDA 4BZ1L 1KSRA 4B53A 5FDYA 1J1XL 4JVPA 5JR1L 1PY4A 2VE6A 3MRPB 5IWLC 3UPRB 4CVWA 3TESA 5DJXA 5K9JL 4RGOH 1P53A 5IM7B 2HRPL 2ZNWA 2BXYA 1NDMB 3CSYA 2G60L 4Z7VA 4ODWB 2O5XL 3D0LA 1FZOB 4F80A 2Z31B 4LLMB 1JWSB 4XXDA 3CSGA 5CKAA 1XCTB 4P4KD 1ZTXH 2ICEB 3ULSA 4AEIL 1Q9OB 4GMTH 4MNGE 1IC5L 1KIPA 1YMHA 3OX8A 4KJYA 4PRHD 4K94H 4TPRL 3MXVH 2JB6B 2F53D 5ACLA 1R3LB 5ILTH 4MA8H 2YPKA 4GW4A 1U2HA 3GI9H 2VXQH 1QO3B 1BBDH 1G7LB 2XWJB 1ZWIA 1BLNA 3MNZA 4NZRL 1SJHA 3AU1A 3BT2H 5SWSE 1EHAA 3FB8A 1KJVB 1QR4A 3IKKA 4NKMB 5F71A 5HYQA 1OP3K 4KROD 2JJVA 4FABH 1CTOA 1U36A 3SE9H 2DMKA 4O02H 5CJ5A 4B5EA 5GISH 35C8H 2FYYA 3RDTD 1G7MA 4X7EC 1JF1A 4JFOB 4LCCC 3SQOL 4CDGC 2F54D 4QHKI 1HEZB 1GGIL 1ZHBB 3TBWA 4JM4L 5KSAB 3MLPA 3B2UD 4OAWA 3T77A 4KKNA 1FL5B 1KPUB 3L1OL 2XKNA 4OGXL 2IALA 1EXUB 4GG6E 2DQCL 4WI7A 4TOYH 4PV8A 3QIWD 4LRIA 4ODTH 3UZQA 2Z92B 5BOZG 3G5ZB 5KS9B 2V7NB 3O6MH 4PYGA 4JPWH 3T4AB 2FEDD 4M02A 4U6XB 4WENB 1T4KB 5E8PA 4ZQKB 3L3HA 5D4QA 1RAMA 4EI5C 1P2CB 5FHBH 3NGBC 3NCCB 4NYLB 3MXWL 2XZAH 3GMRB 4G6FB 4OUUB 4YHMH 1CFVL 32C2B 4R26H 2JELH 2BVQA 5HHVL 4XCNB 1SJVA 2VITA 1DANT 1TJGL 3MYJA 1TNNA 3EDDA 3LQAL 1YPZB 1I8MA 3WFBH 4UOJA 3UPAA 3SKMA 5FGCE 3WFCH 3VJ6A 2IH1B 3TCLA 1ZLUK 4WW2C 3TVMB 1CT8A 2HVKB 4BM7A 1IMHC 1GC1C 2BVPB 3CVHH 1DL7H 1Q1JL 2IJ0C 2YRLA 4LCWB 1GZPA 2OMBA 3E0GA 1U8JA 4JEGB 2W9EL 2I07A 3PABA 4JN2A 1NFDB 4PUBH 3K8KA 5DO2D 4KGJA 3ULUF 1I7UA 2LU7A 2YPLD 3O45B 3Q1SL 1E27A 1MIEL 3WLBB 4G3YH 1S7SA 4PJBF 1AR1C 4KZEL 3PWPE 1FYTB 1UACL 2B2XL 1FYHB 1ZVSB 5IJKA 4K2UH 1NEUA 4GKNB 3JV4A 1FN4B 3SJVB 3BW9A 4MJ2A 4OCMC 1Q0XH 3BQUA 3LH2H 3OJDB 2ZSVA 5TGBA 4Y1AE 4G8GA 2X40A 2A6JB 3O6FD 3VG0L 4CUCA 4UDTA 1IILE 2CLZB 1YUHB 2GITA 5T3ZL 3DXAE 3Q48A 4JPKH 5DS8A 1NEZA 5GS0L 3BD4A 4G9FB 5D1XB 3JUZA 4HS6A 3SBWC 4OD2A 3RIFK 1MCKA 4FQPA 1A6AA 4CU8A 2DYPB 3SGKA 3RVUC 2G75B 3SDAC 2GUOA 2OR9H 3HMXH 4KPHH 1YEGL 4YHYB 3MRRB 1JV5A 3IDNB 5EIIB 1Z2KA 3ZKMC 3NH7H 3UJIL 2OTUB 4UT7L 2VDRL 3FN9A 3IT8D 4E5XB 3HPLA 1HNFA 3K80A 3UZEA 3ZTJH 4WO4C 4XP1H 1T89C 3IS0X 3T3PE 2X1PA 1OT1A 3A67L 4R6UA 4CAGA 4HUWB 1IQWH 4W4OC 3IJSB 2EDEA 3W9DA 1NCDH 5BO1L 1IEBA 3GM8A 1YEEH 3HRPA 3IGAB 1Z5LA 3VXMA 5JUEH 1CFNB 5ID0A 3UP1A 1A1OB 4HDIB 1HH9B 1VFMA 3V0VA 2JB5L 2YC1B 5D7KE 4NNYA 5FKPB 4IDJH 3MRIB 4GS7B 2HVJB 4JKLA 4AG4L 3QPQD 1F90L 2DQDH 3IDJA 4RDQG 3TO4C 3RWFA 2E7HA 2HMID 4OZHA 1IGJA 1UFUA 3I50L 3G6JB 5I1EH 3O9WA 4RAVA 4FZEH 2H9GB 1N5YH 4Z5RA 4PRIA 3RZCB 2X4OB 4OF6A 5I16B 1GH7A 5D7LD 4L5FH 2XN9E 1CE1H 4FXKA 5FUCC 1Q94B 4GH7B 2V9RA 4X98B 5C0BD 4U1NA 2X9WA 2Z8RA 5ICZB 4Y19D 5C0IB 3HRZA 2JIXA 2IPKA 5F1NB 3WIHH 4TUJB 3C2AL 3TO2A 2PXYD 2H8PB 1ZLVH 5D6DA 5MHSD 2IBGA 4NUGH 43C9B 3VXQB 1I3GL 2YD7A 2GJZA 3IFNH 4KK5D 1TPXB 3EJZD 1FAKT 4MSWA 4PJ5A 4LEXL 2AEWA 4GW5A 1UGNA 4R90H 4S11A 1T03H 4GFTB 3PXHA 1CI5A 4G43A 1AGBB 2OTWA 1UVQA 4LLAA 3CD4A 4NQEA 3QCUL 1D5IL 4LPVA 3LB6C 1OSZB 4LKCA 1U42A 2R29L 1CICB 3G6AA 4L9LA 1WLHA 4R7NA 4BQ9A 5CHNB 3FFCE 2P46B 4OZ4A 3OHXA 5DEFB 1GIGL 1CLYL 1I1YB 3RL2A 1JPGA 2VUYA 3QUXA 3BRGC 5F1OB 4HIXL 4RMQA 4UB0L 5T3XL 1HK6A 4LCUB 5HPMA 4HX1A 2ZSWA 4P9HH 5J1SC 1L4IA 2ORBH 5TH2A 1HHGB 1CD9B 1U92A 4WI4A 4HLZH 4U1MA 1VFBA 3WDHA 1SVZA 4X80H 1IGMH 2WUCL 4K7PH 5IMMB 2VISA 2Y07L 4C55A 3S4SA 3FCTA 1F42A 4W4NA 4WWID 5ITBH 4OIAA 4HXBL 4Y5VC 1Y6KR 4XCCH 1RZIB 4YDIH 1K4DB 5DQJA 1DLHB 4JY4A 4S2SA 1TFHA 4HAGA 5CEZH 3V5DB 1FORL 3OF6A 1FO0B 4I0PC 1CXHA 4JFEE 3N06B 5L9DH 1I1CA 4O2EA 3L9RA 3GMPB 3OB8A 3R8QA 5FK9A 1B0GA 2VLKA 3MROA 2AK4D 3ZYJA 2DBLL 1FFRA 2DM2A 5JTWA 1EFXD 5IB5B 5F1SA 5CEXB 4KU1A 1TQCB 3IDYB 5CCKH 5ENWB 3BZEA 2DDQL 4NC1C 5A43C 5FYLE 3TC9A 4BZ2H 2XQYK 4LSSH 5C6TL 2GJJA 3P9MA 3D6GA 5KG9A 2BHYA 2IANA 2IGFH 5D2NB 1SYVB 3TYGL 3V0WL 3W2DL 2C26A 5J12B 4MCZA 4F2MB 3ARSA 1T3FA 4NO5A 2O61A 5LCVH 3U0WH 2A83B 2Q7NA 4J2XA 4PRDB 3L7FB 1MJ7H 5SWQA 4N0CC 2X9YA 2QQKH 4N8CL 3AXLB 1IAIH 3VRJA 1SJXA 3PWJB 4D9QD 1J1PH 1KFAH 1AQKL 4JR9L 1MAKA 5E08L 3S96A 1AO7B 1OP5H 3NFPB 5DRZA 2KZWA 3GMMB 4GRMB 2A9MH 1J5OL 1IVLA 5DK3A 1XCQA 3ROOB 2YSSA 1LK2B 4UT9L 5I8EB 4HK0A 3TA3D 3BD5A 3D3VE 1DQQA 1RV6X 1CGWA 1BHGA 5C0CE 2NZ9C 1IGCH 4B7IA 1TZIB 3K8LA 5GQBA 1IC4L 3TN0A 4YQXH 2AABH 3C5ZB 4NO0B 1WVZA 1N4XH 5DRXB 1YMMD 1FNHA 4KDVA 3WFDL 4Z18A 2Q8AH 1OF2B 4L3AA 3ARWA 4U1KB 3MGTB 1JNHB 4KI1A 3CU1A 4OZGE 3BGFC 1GGBL 4IRJC 5EBMA 2B0SL 5D72L 5HGDA 1BM3H 2CIKB 1A14L 2OL3L 4TYUA 5DDHB 4NBZB 3RWCB 4Q58C 5IMOA 3STLA 1R5WB 3G5VA 1BGXH 3T2OA 4OZIB 1LVEA 3GMOA 3E8UH 4K9EC 5FYJL 2I9LB 4PJDB 1L7IL 4JRYA 1U8PA 4APQD 2V5YA 3MJ7A 4POUB 1CWVA 1WIPA 3HCVA 3N1GC 3I6LD 5EU6A 5A3ID 4PTUA 5E2WL 3D85B 5F7KC 4EJ1C 4ODHL 2G9HB 1UXWB 5E9DE 3P4OA 2FJFB 4LDOB 3M17B 4G7VL 4JGUA 2VLLA 4Y5YB 5D2LB 1C7TA 4RISH 4R0LC 5KSVB 4QRPE 4GMSL 5JDJA 4X99B 1NANH 3OAZH 4KKLC 4QWWC 1UA6H 3MLVL 1YY9C 1YNTB 1FIGL 2AQ2A 3UBXI 3JWDL 3TYFA 2XG4A 4H8WC 1CK0H 4LLVB 4AEHH 4R9HA 4RRPA 4ZFOA 1RQ5A 1V7NL 4WWKC 1DQLH 1NCAH 3CZFA 3F7VA 4F7TB 3PQYB 4F8QA 3TBTA 5AG8A 3I02A 4L4VD 5E4IA 5GSVA 4Z7VE 3MJ8B 2O5YH 5BJTB 4H20L 1SVCP 3OZ9H 4W6WB 4DKEH 5D93B 4KFZC 3THML 1IBGL 1QLRA 3VCLB 1BQLH 2P8PB 4KMTL 3LEXA 1EBAA 4POZD 5BMFL 2CD0A 4CJ0A 3SKOA 4O58L 2H6PA 4J1UB 4JGMA 3LS4H 3TT3H 1HYSC 4OCYH 5CJOH 1RIVH 3MV7B 2BVUA 3GIZH 1J18A 5T33L 3G6DH 2VXVH 1KPVA 3GJFH 5J1AB 4XVJL 1B6UA 1RUMH 1QQDA 1BIIA 4LQFL 1X5JA 1DBMH 1MF2H 3IXTB 3MRHA 3HG1D 4PJCF 1ZHNA 2ZKHL 4RGMB 1GRWA 1DEDA 3P77A 3DRTA 2OK0H 2ENYA 5IJVB 1G7IA 4HCRL 4LVOB 2F15A 2H2PC 4GRLB 4JM2B 5EPMB 2NMSA 5J3HD 2BCKB 3RRQA 3W82A 1S7WA 1MCWM 4C56A 3KWWA 4JLRB 3VXRA 5H94B 4X5XB 4H1LB 3MUZ1 5IF0B 1G0YR 3EJYC 1XF3B 4PJGA 2DQTH 3BXNA 1G7PA 1KB5B 4BK4A 3PJSB 1WWAX 2P8LB 4R96A 4PG9A 1PEZA 1OM3L 4FFZL 5EULV 5BQ7B 3RJQB 2A74B 1Z9MA 4A2LA 5SWZB 3VDBA 3DTXB 2NCMA 1FFOA 2HFFA 3B9KB 3BP6B 1NL0H 1P7HL 1PGRB 1T5WA 1DBJH 4LLQA 4EUPH 4P2RE 3GSNH 2HLFC 5KTEL 3FO0L 2Z31D 5E94B 2BVTA 2HH0L 1KELH 1N6VA 2R0WH 5J13C 3V6BR 4HIEA 5HYFA 3BI9X 1FL6B 4M7JL 4I3RH 4JFHE 3EAKA 2MQCA 3HAEG 3REVA 3ARFC 2V2WA 1WJ3A 3GK8H 2H3NA 1K8DB 1KCSL 1D9KC 2NXZC 3UJJH 4XWOC 3LSOB 4JZJB 4WTWA 3BH8A 3O3BA 2P5ED 4JY5H 5FUOL 4ZFGH 4PJFA 3HC3H 2VR9A 4NM8H 2RCSH 3EGSB 1RVFH 4MX7B 3K2MC 1N5AB 2DQIL 2A0LD 3DYMA 5FHAL 3HMXA 3P0VL 2AV1A 4P2YA 5DD6A 3SO3B 3LRSB 1RZJC 1HHJA 2ERJC 2IC2A 2OSLA 2A6KA 3D69A 4JJ5B 4M62H 4LF3B 4XNMA 5C07D 4URTB 3I6KA 2ICWB 1CGYA 2WUBH 5CZVH 1KNOB 1TQBB 2N4IA 2Z93B 5I66A 2EE9A 5JMRA 1OWRM 2RFXA 1G9MH 2YA1A 1RZKL 1FV1B 3VGBA 5BRZD 1MHEA 1H8NA 1KJ2B 4WI9A 4M1CD 2VXUH 1S9YA 3ZT5A 3ILPA 2EDJA 2ZWLT 5KSAD 4NDMA 1O5DT 4KDTA 5DURB 4JAMA 4M61B 2AVGA 4QTHB 5CZKA 1LHZA 1FJ1A 3GFUA 3CXHK 5HI4C 1FVDA 3UBXB 4B0MM 2H32A 4G8GE 4F57L 3S37X 1I7ZB 3X11B 2X4UB 4QRRA 3EBAA 4X9GA 1CF8L 1BFSA 5DJ8B 1OLLA 4LPXA 3IRPX 1DCLA 2X05A 4F7MA 2XTJE 3IU3B 1S9VA 3FN0L 3QWQB 3G04B 2GK2A 2IPTL 5E4EB 3GMLA 1BJ1J 1IZKA 3ESVF 4Z95H 4YHPB 4G6FD 3BP7B 4KXZI 3H9SD 2K7QA 2OTPA 3OGCB 4TUOB 1PLGL 3MLUH 4R4FL 3QP3A 4XRCA 4PJAA 4PGDA 2HTKC 3T1FB 5I1LB 3DVNB 5FYJU 4ZUWB 4F37K 4TUKL 2C7UB 1FG9C 3C9NA 5JIKA 1XAUA 2F19H 2R0ZH 1L0QA 2ZJSL 1MELA 3WIHA 2EYRB 1CXEA 4WI8A 5F9AC 4M6MH 1MH5A 5IFAL 1B4JL 1IZJA 4FQJH 4LCWD 3IU4L 1Q9WB 2APFA 3MZTA 1N26A 4KRPB 2BFVL 5HVWA 4HJ0C 3QZWA 3EFDH 3BE1L 3VFSA 1M7DB 3ZDXE 4Z7UE 4KRMB 3FT3A 4N1EA 2IFFL 1DE4A 4LNRB 4ODXA 4HUMB 5CGTA 4P4KA 1AC0A 3MRGB 4OT1H 2QBWA 3VXME 1FYTD 4LSPH 2HJKA 2M26A 4E0RA 3KLAB 3GB7A 4HKBA 1Q38A 4I9WD 4Z0XB 1JGVL 1ZHKA 4PRHA 3NTCH 4TTDC 5AZEH 1R5VA 2F53A 2ARJQ 2BERA 1KJ3L 3SJVD 3RWJB 3IFLH 5JPNA 4KKCC 4Z77A 2DJUA 4PJBB 4JFFE 1H3PL 4N8VG 5HBBA 4N0YH 3CX2A 1CR9L 3V6ZB 1ZHLA 1CXKA 3LOWA 3L3DB 4OZHE 3GKZA 3OKKB 3VFVA 4QLRA 4G9FD 1YQ2A 3F12A 4PRIE 1ED3B 1K5NA 3RDTA 3H7BB 1C1EL 4HUUB 4G42B 4R8WL 4H26B 2DYPD 2F54A 4O9HH 1SJEB 3DGGB 2I26N 4K3DH 5IGXL 1BVLA 2GSIA 5HYSB 3D39E 1P1ZB 2EE2A 4ZSOA 4AIZB 4XPBH 5A2FA 4KTDL 4D0DB 4QTIH 3K74B 4C83A 4X4XA 4X6DF 4PJ5E 4EIGB 1X3DA 3VH8A 3QIWA 2FZ3B 4ENEC 4DZ8B 2D0GA 4DWHA 3QDGB 4NQEE 3S9DB 3NZHH 5CILH 1I9RH 1DR9A 5ISZE 3LEYH 3MOAL 4CN4A 4K71B 5I71C 3GZKA 4XAKD 4WU7A 3HI1A 4PG2C 3PGDA 4XHJC 3IXAB 5F7EL 1CDJA 3BMWA 5EC1B 2QHRL 5LAXB 4P2OB 4L8CA 4EBQL 3I9GL 1DLFL 4QY8B 5ETUA 1J0IA 1AGDA 1CFQA 3CFDA 3DO3A 1GGCL 1K4CA 5IMKB 2B1AL 3K8MA 2FDBP 2CRZA 3EO9H 1MNUL 3OG6B 1YDPB 3F65A 4P9ML 4TULH 1BF8A 3BZDA 1V3LA 1BQSA 1Q9KA 5DRNB 3RZCD 4XB8A 1YEHH 4NZUH 5D6CB 2YPLA 3PP4L 2VLKE 1CD8A 2RR3A 3FT2B 1R3KA 2AJYH 3LHPH 4DVRH 1NBZA 5DQDL 5D1QC 1BZ7A 3QEQD 1TTGA 3RQ3A 5HHOB 2JK5B 2NX5B 2R2EB 4J23A 3X12B 3KLHD 1OAQL 2IANE 1EVTC 1QRKA 5FUZH 3QQ4B 4IOIA 3O6FA 3DIFA 3MGOA 4RGNB 1UZ8B 1MRFH 3NFSH 5F89A 3VXPB 5A16A 4M1DL 4OLYL 3MV8B 1CICD 1FNEA 5B39G 5TQ0L 3NAAH 3ARXA 4XPTH 4BUHA 3FB7A 1B90A 4E42A 2BRRL 5EZOL 4ZUVA 4LSUH 2LABA 1MCHA 2MPAL 4LCYB 3SGJC 1WCBB 3V4VH 2P5WB 3JTTB 1MY7A 4J4PD 2BP3A 1IM3B 1T7XA 4MXWL 4XP6H 5F44A 1Z9OA 4MA3B 1WFNA 4J3XA 5FF6A 1EGJL 4L3EB 4U1SA 3O8XB 4YHKH 1V7MH 1FNGB 2X4TB 2NR6C 3KPPB 4FA8A 1MVUA 4ETQB 1A6TA 4AZ8A 4LKXB 3HR5B 4X7SL 4WNQA 5E00A 4LHUA 5DJ0A 2D0HA 1YNLL 2Y5TA 2ZZUT 1W72L 1EA9C 2J1KA 1ROWA 1U8HB 3EOAA 1NC4D 4WHTA 2WBJB 1ONQA 2DKUA 3UC0H 3WFHB 4OCWH 2AJXH 4MJID 4DVBA 3V5KA 1QSFE 1Z9SA 1NMBL 4OZFG 4HIJA 3ZKND 4OCRL 4NBXB 5EBGA 1D6EA 4JRYE 4H25B 4NP4H 3L3GA 2IPUK 4NPYA 4WUUD 5EU6E 1OOAA 3ZYZA 3QUMA 2GJ6B 3JV6A 4NKDB 5D1ZC 3UPCA 2X09A 1A2YB 1BFVL 3OKEB 1A7QH 1WEJL 5LWYH 2BNQD 3S36H 1T1WB 3DUSA 3BGMA 4HKXA 1LNUA 3VGAB 2BSED 3QPXL 5KN5A 3O3AA 3EHBC 3DMMB 5D7LA 4LLYB 1NAKH 2C5DC 2HT2D 5DVMA 4JRWA 5C0BA 4UOW0 4NUJB 2PN5A 4Y19A 5GRUL 3WXVL 4JQXC 5TF1L 2VZ3A 1ZEAL 1P4LB 3U4BL 2PXYA 2VDQL 4JPIB 3X17A 5FO8A 2Z91B 3L5JA 3QI9B 2JJTA 3C08L 5AUMA 1RZ8B 4WI3A 4YGAB 4X7CC 5CD3A 4KY1L 1JGLL 1JFQL 1Z0NA 4NRXB 3WEXA 2ZOKA 5GZNC 4NO0D 2YN3A 4P2QB 2AKRB 4XBGA 3OSKA 2AEPL 1G7QB 1N3NA 3LKQA 4EUPA 3GSNA 3OL2A 4HBCH 1WITA 5KAQG 1XZ0A 4NQUA 2C1OA 2YD1A 3QG6B 4PB0L 5T1LD 5IQ7L 3O3DB 5DVNA 3GSOA 1T04B 4ZUTA 1HHIB 1IGYB 5J7CC 3QCVL 5CBEA 4FQXC 1MCSA 4W70A 4I8DA 3TV3H 2PYEB 5F8QC 2VWEE 5I76B 1JP5A 2EEBA 5K59F 3QO0B 4C56E 1S7XB 3D85D 4KI5E 2OS7A 1FFQA 5IUSA 1SEBA 4WIQA 1SM3H 4FRWA 5DK0B 3VFRA 4PJGE 4YJZL 3MODL 3EYVB 1DBAL 4NO2A 2VMFA 5IW1A 4WJ5B 4XX1E 5BXFA 2AK4A 2IWGA 1QRND 1K6QH 1LDPH 1EFXA 1EJ6A 2BSTB 1L9NA 3QSKB 4MMZC 3SY0B 4U31A 4M7ZC 4TRPL 1OTUC 4QHNA 3MUGA 4WI5A 1U41A 2GT9A 4Q9RL 5F7MC 1UM4H 1RU9H 1EPFA 5EA0L 2DQGL 4CDHA 5ACZB 2AJZA 3ARDB 3A0OA 4KWUA 4HS3B 1AGEB 2ILLA 1YEJL 5KZCB 5EWIH 3C8KA 1SYSB 1J0JA 2IAMB 3QULA 3D5OF 4LSQL 5J4MA 4XC3L 3MLSL 1RJZA 5CP7A 2EC8A 1J9CT 3GKWL 2NY6B 4XNYH 4N5EC 1MCNA 9CGTA 1T22B 1VADB 3HPJA 1T20B 1AR1D 2ADIB 5C0EA 5IFHH 2MTPA 4OV5A 4UIKH 4LGRB 1G7HA 4M7KH 4OLXL 2APWA 3FO1B 3HI6H 1VA9A 3RWEB 3EYSL 1MSPA 4GRLD 2DN7A 4JM2D 4ALAL 3TA3A 1EUTA 2IADB 2ZPKL 1QA9B 4WTZA 1NEZG 1OHQA 4H0IA 4PJCB 1KIRA 2I9TA 1YMMA 1HHKB 2FHCA 2P7TA 5EOQL 1H5BB 4ZNEA 3WSQH 1MCOH 3O6LH 3VMOA 4YDVB 4JQIL 3TFKD 3TWCL 2EDNA 4KUZL 3KGRA 1J8KA 5AG9A 1WIUA 4RIRB 2HWZH 5SWZD 4G8FA 4QRRE 3SDAD 4Z76B 1S3KH 4FTVD 2DI9A 1ZGLP 3DBXB 4ZPTB 3RTQB 4GG8B 2Y25A 4APQA 4RBPH 5SX4H 2ATPA 4GBXB 4LRIC 5F8RC 3TLRA 5K9KB 1EEYA 1UWEH 1UM5L 1AXTH 2WV3A 1DFBL 2OP4L 1J88A 4HH8A 2YRZA 4PJAE 5DUMH 4DKFH 4RWHA 4YGVA 2JCCF 5IBTH 1KULA 4ZUSB 2H26B 4KVNL 4DK6A 4HGMA 3PGFH 3QHTC 3GO1L 5D96B 4AIOA 5IESL 3OPZH 3QIUB 4FQLH 4WDIB 4X7FC 5FYKD 4DFIA 4DZBB 3HMWL 4RMWA 1U93B 4XVUD 5K9OB 5C3LD 1D5BB 3FQTA 1GAFL 3KPOA 1A5FL 2PCPB 3DVFA 1OB1A 2DIAA 2YWYA 2Q6WB 3WUWB 5EOCH 4HXAH 5GGUA 2KH2B 4L4VA 4PJEA 2NY1C 3BKMH 5FOBA 3DGCR 1C12A 3DSFL 1FO0H 1N59B 1OGAD 2FBJH 4PBXA 3OAUH 2ADJB 1KPRA 1M71A 1T0PB 2V6HA 4ZS6C 3ECBA 1BVZA 3Q6GH 5DURD 5HVHC 4PRHE 5EO0B 4KQ4H 2IH3A 4JPVH 2F53E 2ZUWA 4IIQB 4WV1A 4DW2H 1G6RL 1P4BH 2DKSA 4KVCL 4K3HA 4MD5B 3VXSB 2Q20A 3VGFA 5IJKC 4Y4HB 3MLZL 1JMXA 1QUNA 2FD6L 5EN2B 3HG1A 4MQ7A 2R1XB 5I1GL 2BC4B 3S37L 3BQUC 4PYHA 5AEAA 5JW4Q 2NPLX 4P46B 5B4MC 4NC2B 1OQOA 1XIWB 2BSRB 1NGZB 2F54E 3T4YA 2XTJC 3GSUA 4HEME 4MB5A 5IB1A 1JPST 3I6GB 4S0TD 5IIEB 1IEHA 3BWAB 4FNLH 5KW9L 2ZUVA 2RJMA 4ZSOE 5HDBE 4HPYH 5F7DB 4UNTA 1A3QA 2UV3A 3MRPA 3BEVB 4KH2A 3UPRA 3MRCB 5J9PA 4BQ8A 3VFMB 5BVJB 2WIIA 5IM7A 1YYLH 4QXUL 4QGYA 4KJPD 5CUSL 1LEGB 1NDMA 2X4NB 3QT2A 4ODWA 1FZOA 3LMJL 3B4NA 2Z31A 5DI8B 4LLMA 1JWSA 4NWUL 1TENA 1ZAGA 3U1SH 5EUOF 4OFVA 1KYOJ 2E9WA 4KKBC 4ELKB 5DLML 1F00I 2ICEA 1X7QA 1MCPH 1Q9OA 5T1MB 1BOYA 4R4BB 5DT1H 4HF5H 4Y88A 4WW1A 4TSBL 1UKSA 1R3LA 5DMIL 4M7LT 4EQ3A 4PS4H 1A7RL 2P5EA 3U46A 1QO3A 1LO0H 4XNUL 4OCSH 1G7LA 4MA7L 1T80A 1R3JB 1R5IA 1AE6H 4RAHA 1INQB 3DUUA 3H3KA 4ZOCA 4NKMA 5EFIB 4HWEL 3S5LG 4HFUH 4K8RC 2C3HA 5C07A 3MCLH 3DX9B 5K93A 1VFOA 3RKDD 3GUTB 4RMSA 1DEEA 4D2NA 4JO2H 3DUHA 4JFOA 5BRZA 1D5MB 5I18L 1HEZA 3GI8H 1A6ZB 1ZHBA 3AAZA 3O9WC 3ZZ1A 5KSAA 4MQSB 2BMKB 1A3LL 4KRLB 3QEGH 5D70H 1LE9B 1DN0A 3HTLX 1FL5A 4HW6A 1LQSR 3V6OA 1HYRC 3RUGF 3MSPA 5IEHA 1S78C 4D9RD 3G5ZA 5DQ9B 5D6DC 5IV2A 2V7NA 1S9WB 3QDGD 1WWBX 1U8LB 1GC1H 3EDKA 4RX4D 3K0WA 3T4AA 1FNSH 4U6XA 1T4KA 4C4KO 3WCYA 4ZQKA 3C60B 3WL9B 3VDCA 5DMKB 1N6UA 3F58H 4X6DB 3O3EB 3MOBH 1X5HA 4OM1H 4Y8DC 2EECA 32C2A 3H9SA 5ADPH 2HRLA 4KK9D 1TCMA 4GMTL 4L9LC 4P2OD 1TCRB 3S98A 4CNIA 4K94L 3MXVL 3LKPB 4LP5A 4JREC 2BOCB 1U8KB 3QUXC 4U0RC 5ILTL 3ARUA 3T65B 5JPMA 3GI9L 2OYPA 2IH1A 1MRDL 1YJDL 2HVKA 1OW0A 3CU7A 2BVPA 4LCWA 4KTYA 1JYXA 3BT2L 1EVUA 3QUKB 4FG6C 4LLDA 2BVOB 3A6CH 5JA9A 1NFDA 3D0VB 4NWTH 4FABL 1KB5H 4I4WB 1U58B 3BDBA 2A73B 2XT1B 3O45A 5GISL 1VHPA 2YPVH 2B4CC 3NIFF 1IJ9A 2EKSB 4Z7OF 4XPGL 1FYTA 3TNMB 2LU3A 1BOGA 5HYJB 4GKNA 4PFEA 1MEXL 5HHOD 1FN4A 2NX5D 4ZFOL 1EEZB 3SJVA 4RRPG 1OQXA 1UWGH 4D9LL 4KK6C 5JW3H 4J8RB 1BFOB 2BY2A 5D71H 4GRWE 2UYLB 2A6JA 2EE6A 5T1DH 3OKNB 2Q86B 1WTLA 4Y16D 2D9CA 3MV8D 5C09B 2EXWC 2DQJL 3TGXA 4JPWL 2Y4SA 4G9FA 4OD1H 1DUYB 3CXDH 3OKLB 5D7LE 3AS1A 1OARL 3CFKB 5FHBL 4NQTA 5C0BE 1H8OA 3BFOA 4OLUH 3LRGA 2DYPA 3OR6B 4Y19E 4A6YH 5FYKH 2P5WD 2XZAL 1IEAB 3GIVB 2G75A 4YHML 1E4KA 4R26L 2JELL 5B38B 3WJJC 4GXUM 5MHSE 2FX9H 2G2RA 4RCAA 2BNRB 5D9SB 3MRRA 4YAQB 3IDNA 3OAZK 4N0UB 4CW1B 5EIIA 3CH1A 1I1AB 3O8XD 4ONHB 2OTUA 1WAAA 4E5XA 2ZP0T 2YD5A 1JE6A 2DTSA 1KJ2H 3SE8H 1ZT4A 1CDHA 3CVHL 2FLBT 1DL7L 3UTTB 4X6FB 4D8PA 5JZ7D 1RURL 4HUWA 1CN4A 1MCJA 1EAPA 4WFHD 4XI5C 2OBGA 1IQDA 1KENH 4PUBL 3TN0C 4YDKH 1QLEH 5AAMA 3STZB 1OTTD 1MLBB 1Z9LA 2WBJD 3DI2B 1P7QB 3MLXH 4YHIB 3EJYD 3HE6B 2F9BT 4XX1G 1A1OA 1HH9A 4K2UL 1FP5A 2W9DH 3KG5A 3NCEB 1I85A 1UKQA 2E7MA 5MP6L 4R3SB 4OI7A 3VFTA 5INDB 4LSRL 4IOSD 2YC1A 3HC4L 4FP8L 5DJ2B 1EMTH 3LH2L 3GJFK 3MRIA 5DJZB 2HVJA 5IBUB 2R4RL 4X4YA 4LP4A 3PV6B 4GG6F 4ZD3H 3CFBA 1X5ZA 3G6JA 1GGUA 4JPKL 2H9GA 1E6JH 4YBHA 5I16A 3RZCA 2WINA 5I1HH 1BJMA 1G9EA 3E2HC 4QHUB 4TNVK 4X98A 2AK4E 1VCAA 5ICZA 2R4SH 4G9DB 5FA4B 5F1NA 4TVSa 2AXHA 3PWUB 2AJSH 2NLJB 3QEQA 3QJHB 43C9A 4GT7A 5F9WC 2E9IA 3GRWH 3QI9D 4KPHL 4XVTH 3SDCB 3G9AB 1F4WL 3PWVB 4WEBH 5CLWA 1HXMA 3NH7L 4F15C 1FC1A 2QADB 4HZLB 2GSGB 4P2QD 4YXKH 43CAB 4DJMA 1AGBA 2GTZB 1G1YA 3ROLB 3DNKA 4M1GH 4FS0A 5B8CA 1CICA 4XP1L 5CHNA 1MI5E 5EO1B 4D9QE 1KTLB 1IQWL 1I1YA 2OCFD 1ZA3B 1CD0A 3N1FC 1A47A 2Z4QB 3BKYH 4JRXD 1NCDL 4LCUA 5I74B 1CQKA 3KHQA 1T1YB 3ARGB 5BV7L 5JUEL 4J4PA 1HHGA 3QO1A 5ELIA 5IVZA 5CJXA 2PYED 1QBLH 5HI4D 5IMMA 2XKSA 1AQDB 3T09A 3HFML 1CLOL 1RZIA 3DYOA 1K4DA 1DANU 2DQDL 1YMME 3PF2A 2AQ1A 3V5DA 4OKDA 1FO0A 2VWEC 5EO9B 1YEKH 1MREH 3P9LB 4ZNEE 5I1EL 4KI5C 3GMPA 4U6HB 1N5YL 3BPNB 5E8DH 1NLDL 4HZAA 4M5YH 1RHHB 4L5FL 4MGXA 1PDKA 3BP5B 1DDHB 3H0TB 3BZ4A 3S6CA 5IB5A 1NC4A 4TSCL 5CEXA 4MJIA 1F3DH 1J0KA 5ENWA 5DUPL 3S35H 2VQUA 3B9EA 3DVIA 2HTKD 4WI2A 2FIKB 2J4WH 3SDDB 2V9TA 5DYOB 1KUMA 4Q6YA 3P4NB 3ARRA 3LN5A 3K3QA 3FFDB 4WUUA 5D2NA 3I6LE 3KYOB 3ARDD 1SYVA 1QR1B 4F2MA 4JZNB 5KZCD 4Y5XB 4LK4A 3QZWG 3WFEL 1T03L 2R23B 4S0SD 3WKML 1UJTA 2BNQA 3UZVB 1N7ML 4MWFA 2XZQL 3L7FA 4PJIE 4LPCA 4H0GA 3NIGE 4HJ0D 4XT1C 3LCYA 3AXLA 4LSVL 3ZT6A 3MLYH 2NY6D 3VWKB 2FHFA 5ESQB 3X3GL 2I5YL 3MRKA 1K2DB 4PLKC 1YQVH 1VACB 4NFBA 3NA9H 5DEGA 2VKWA 1RJYA 3RKPA 3T0VA 1XGPA 3QUZB 4PV9A 3I75B 3V6FA 2Y23A 3GMMA 4M43H 4NN5C 4DOHB 4P9HL 1YECL 1A6UH 2ORBL 4ISVB 5EIQA 1WZ1H 4L4VE 4PJEE 3VXUD 3D9AH 3QEHB 4M6OL 2WWMC 4H0HB 4X80L 4HLZG 5C08E 4KDWA 4K7PL 4NQVB 3OJ2C 3C8DA 4V2CB 2F8XC 1I7RB 1GCFA 3MACL 4NO0A 2EIBA 5DRXA 4OFPA 4KXZH 5EZLB 1AIFB 2X4PB 3WXWH 5CEZL 3MGTA 3LKRA 4OFIA 4JFZL 1JZ5A 2R2BB 2KBGA 3TJHD 1UJ3B 2CIKA 4U1LB 1MJ8H 3BJLA 5KSBF 5DDHA 3RWCA 1R5WA 4ZDHA 1TETH 4ZO8A 4X4ZA 4H8WH 4KDTC 1KEMH 2GFBB 4M6NH 2P24B 4BYHA 3VFGH 4G7YH 5CCKL 4W68A 2I9LA 4PJDA 4I5BA 4Y0GA 2CDFB 1NAMH 4BZ2L 1I7TB 2OI9B 4LSSL 4XNXH 5DC4B 2ZUQC 3IKCB 3D85A 4POYA 2FGWH 4PRAB 4C58B 3IF1A 2HN7B 4OF3A 2NY2C 4RWYH 4U3XA 3M17A 4LMQI 3ESUF 4Y5YA 3MNVB 4RSVA 5D2LA 5L2KD 3KPMB 1BPVA 1GZQB 1YY8B 5GGVL 4X99A 2J88H 2QQKL 4GAGH 1IAIL 1EO5A 1YNTA 3NFNB 1KCLA 1WBZA 3QIUD 3GNMH 1QRNA 1INDL 5IW3A 1J1PL 1KFAL 4LLVA 4JO4H 3VRLF 2VZSA 1MVFA 3PQYA 5E6IB 1NBQA 1TTUA 2JCCB 4XMLH 4ZO6A 5I73B 1U8NB 3BWUC 1IC7H 3MJ8A 4PB9H 3B6SB 1J87A 5JLZB 4BQBA 4XMKH 5DHVH 2J8UF 4Z8FH 5L8KB 4LASH 1IGCL 4Q97A 1JYNA 3VCLA 3O3UN 2P8PA 1LWRA 2ZCHH 5DMYA 2AABL 1MUJB 4HPOL 4U6YA 3TBVA 1D6VH 8FABB 1N4XL 4J1UA 4LVNC 4QEGA 3KDMB 2VC2L 2Q8AL 1WUNT 2P5EE 4P4KC 12E8H 4JG0H 2N7BA 5J1AA 5KBNC 3VXSD 3HZMB 1BM3L 4Y4HD 3UTSB 3ZE1F 2E7CA 4XGZB 3RX7A 2DLGA 5J11B 2R1WB 4I0PB 3QWRD 5I17B 5L6YH 1KCKA 2XQYG 3H6JA 5C07E 4KGLA 4K07A 3E8UL 4GRLA 4JM2A 4P23B 2AXJA 2BCKA 4P46D 1RIUH 1CYGA 4PY7B 1XIWD 1FZJA 3DETD 2DM4A 4CU7A 4JLRA 5GSRB 3UYRH 1JK8B 5BRZE 5H94A 3K81A 3C6LB 4X5XA 4H1LA 1WBXA 1IGFL 2BVEA 2DRUA 4MCYB 2AJUH 2XFXA 4OCLC 3ZTNL 4PJXF 1KB5A 4HBQA 3PJSA 5DJDB 3EKCA 3RDTC 2P8LA 3SBWA 1CCZA 1UA6L 5BQ7A 2A74A 3V6OE 3OKMB 3KJ4C 4BK5A 5SWZA 3SEPA 3DTXA 1EUUA 3B2UC 4AEHL 4LBEB 1ZLWK 3SDAA 3SPVB 2L0DA 4FTVA 3B9KA 3BP6A 4LPTA 4X5LA 4QRQB 2X89D 4EOWH 4ZS7H 3SDXB 1UADC 2CRIA 4XWGH 2EDOA 3FB5B 3RP1A 3RAJH 3QIWC 5CBAB 4MJ5B 4DKEL 1VGEH 3IDIB 4KKAD 2QR0B 1FL6A 2FB4L 3K4ZA 4LHUG 5DEZA 3H9SE 3UTQA 2FEDC 1K8DA 5CINL 4HJJL 3QFJE 2CLRB 3ZYOA 3LS4L 4OCYL 5EUOB 1C08B 3GIZL 3G6DL 2H45A 3MUY1 5GGVY 3EGSA 5BVPH 2NNAA 1RUML 4B50A 5BS0E 4JJ5A 1ND0B 4OZGF 4LCWE 4LF3A 2PYFB 5JO5B 2YD9A 3BGFB 1BZ9A 5GZOC 3A6BH 2OK0L 1HKLH 2ICWA 3RBSA 1RSFA 5FIEA 1KNOA 2Z93A 1NFDE 1ZGLB 3GSWA 2E27H 1H0DB 1OGAA 1FV1A 4YHOL 2WLZA 2WWKT 1KJ2A 2ATKB 2NTFB 3WN5B 5HHMB 5J6GA 3ZDZF 4OGAD 4LRNH 2DQEH 3EIFA 3CH8A 1FYTE 3J8F7 4U1JB 4P5TD 3C6SA 4F7PB 1AGFA 4I9WE 5CD5C 3KNBB 1Q0YH 1XGQB 4DQOL 4MAYB 5A1AA 2DAVA 3HNVH 1G7JB 3UBXA 1A6VH 2VR4A 3PHSA 4HUVB 3PIQB 3UX9B 5LGKA 1BECA 4UU9B 3L5WB 1I7ZA 3X11A 3R4DA 1Y0LB 4IOFD 4PGEA 3VG9C 3WS6A 4JB9H 4LGSB 2W91A 3WV0A 3RWIB 1NL0L 1J1OH 3IU3A 3E6FB 1DBJL 4YXLH 3C60D 2YMXH 3G04A 2ZG1A 5J89A 5L88H 3RUGB 4G6MH 1XR8B 3O6FC 2PW2B 2B5IC 3KR3L 2R0WL 1UCBH 4J3VA 2GTWB 1FZKA 4I3RL 3CUPB 5LQBL 2YD8A 3OGCA 2X4RB 5F9JB 3GK8L 4GO6B 4ZUWA 3UJJL 2DWDA 3QCTH 2O93L 2C7UA 2DJ4A 5IK3B 1AJ7H 4YDLC 2FX7H 1X5YA 4JY5L 2QQNH 2DIBA 4ZFGL 3U6RB 1YN7B