3VXQB

H27-14 tcr specific for hla-a24-nef134-10
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
242
structure length
242
Chain Sequence
b'TGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSSWDTGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H27-14 TCR alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 51
structure length 242
sequence length 242
chains with identical sequence E
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqB01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxqB02
5ID1A 3FRUA 3RGVA 1FAIL 1AO7B 1U0QA 3H3BC 2OMNA 5KSBB 5IVXF 5D2LA 4LLYB 2YWYA 4Y5XC 4AMKL 3OX8B 2Z4QA 4XXCA 4KK8D 3PHQB 5CINH 1OGAD 4M1GL 1WZKA 4R97B 3ZTJG 1A6WH 1LP9F 1CQYA 3QI9D 3WL9B 4BA8A 4PRHD 3NA9L 3TN0C 1C08B 4U3HA 3HR5B 4OLZL 5GJSH 5HJ3B 1ZV5A 1A02N 2BVOA 2BVUA 1GGCL 3VFSB 4E41B 5F7MC 3F8UB 2DM7A 3DECA 4Z7WF 4QRRA 4V1DE 1I9JL 5E2WH 4JHWH 4FP8H 5BOZG 1UWGH 3ARBA 2ZG2A 1SJHA 2XIDA 4QYOB 6FABH 2DJUA 2VJXA 4H1LB 3VA2C 1XGRB 3BQUB 5HD8D 1QBAA 1CFVL 3VFOB 3S36X 2DQTL 3RRQA 1NBYB 5GS2H 4ZXBD 4D0BA 1MHPL 3O41B 1CF8H 1CD0A 3JVGA 4C56E 3D0LA 3GNMH 2VQ1B 4J4PA 4FTVB 3U30B 3ZZ1A 3MODL 3UTPE 5GGUB 3WN5B 3FB5A 4JFZH 4RZCA 4XVUD 1T66D 4Y2DD 3UC0H 4FOMA 3O4LA 3TH4T 3UCRA 1LEIA 3NBNA 1YQ2A 4B41A 5KSUB 3MJ8A 3VG0L 3EFDH 3LS5L 4PBXA 3BRGC 5FUCE 4IOFC 4X5WA 1JF1B 5CUSH 3VXTA 4XPTL 5JR1H 1ZHLB 1EH9A 5I73C 4DCQB 5SV3A 3H9HB 4R2GC 5F89B 3B2UD 4PYGA 4FRWA 3QIUC 4MLIA 4OZGB 2NZ9C 3IS1X 3QNZB 3UPRB 1HHIA 1N8ZA 2H2SC 1DN2A 3HG1E 3HTLX 5IGXH 2H26B 3B83A 5I1JL 3S88L 3UTTE 2PXYC 4RCAA 3T1WA 2G5BA 1I9IH 2ZCHH 1BX2A 4X7TB 3MCKA 3OKNB 5FUZL 4I1NB 1N59A 2FRGP 4LGSB 4LSPL 1RZ8A 3ZDZE 4RMVA 2JJSC 3FONB 3MUZ1 2MWCA 4P3DB 4XCYB 5FKPA 3MC0A 3U6RA 2VXUL 1CDHA 1SYVA 3SEPA 5L2JA 4U3CA 3TFKD 3CLEH 2BMKB 5DD6A 5AWNL 4AZ8A 4CUCA 1UKQA 1CLOH 3ECBB 4TVPL 1I3VA 4IRJC 5F7EL 2YUWA 2MKWA 3DETC 5DJAA 3ULVE 2A83B 5SWSB 3M8OL 4J8RA 1A7BA 1FYTA 4ZO9A 4Y4HD 5D7KE 5CJOH 2XWJA 2JF1A 5DQ9A 3L3OA 2AJVL 2XPGB 4E5XB 3EOBB 2DQEH 1FO0H 2GTWB 1HYRC 4OQ1A 3C8HA 4F7MB 3JV4B 1UG9A 2WBJB 2DTSA 5IVXE 4QCIB 3ME0A 1U8MB 2QSQA 1JTPA 1R5WB 1T6VN 5J56B 3ZKND 3PABA 1C7SA 3MROB 4KY1L 1ZA3A 5IWLA 1JWUB 4U1LB 3D2UA 1LP9E 2GI7A 3TF7C 5MEPA 1PJ9A 3TYFB 1VPOL 1J0IA 3D69A 3RGVC 2XV6B 5HGHB 1VGEH 1I3RB 2Q3ZA 1RJLB 4U6HA 2LTQB 4Z7WE 4XXCC 2DI7A 5TF0A 1DBAH 3BD3A 3TNMB 4X8XA 3VDBA 5C0AB 1KB9K 4B53A 1CDCA 4TQEL 4JG0L 3T8XB 3WDHA 4U1IB 4JM4L 5BS0B 5FECA 3EUUA 2DQGH 1FYHB 3PL6A 3HKFA 4NQVB 1ES0A 5BMFH 5AD0A 3G6JF 3EDKA 4JEGB 1YNKH 3ARBC 5K9JH 4BZYA 3C08L 4L4VA 4QXUH 1A6TB 1MIML 1DFBH 1PLGH 4HG4J 4Q74A 3BO8A 4FQQB 2EYRA 3FN0L 1RMFH 3JVGC 4C57C 5BO1L 4QF1B 2F58L 3QDJA 3GI9H 5IB5B 1U42A 3NZHH 4J4PC 5ETUA 2X4SB 3O9WA 1JPTL 3HMWH 4XP4L 3WE6B 1A6ZB 3Q6GH 3NPZB 3LN4A 1BOGA 1SHMA 1BZ9A 4LLVB 1NCWH 2YHGA 4N9GB 1JRHI 1OCWL 5INCB 1SJXA 2ZKHL 3LPWA 5EC1A 1OGAE 4PJIB 3F7VA 1ZVHA 2X1XR 1R5IB 3QDGB 3IJSA 2BRQA 15C8L 1PX4A 1IGFL 1OAQH 25C8L 2ID5A 4OF6A 3NAAL 1S7QA 3MLSH 2VB5A 3HC0B 3TGXA 5C0JB 2W60A 3OQ3B 4JKMA 2EDNA 3C5SA 1DSFH 5EU6A 4ESKA 3MUGA 3OGCB 4FZEL 5LXGH 4PJ8B 4JHAL 1NC2A 1X7QA 1U2HA 1X9QA 4O02L 4O5LL 3QUMH 4GMTL 1IEBA 2DB8A 2PCPA 4KK5D 2A0LD 4UILL 5ALCH 2CDFA 1Z9LA 1VGKA 3TVMA 2BSRA 3P73A 3CFIC 4NJ9L 4WEMB 2F54A 2R4SL 3VFRB 4NZJA 2VERN 5CZXC 5FDWB 1QRNB 2MHAA 1RZKL 3MJ7A 4Z5RB 1NSNH 4UIMB 3O4OB 4H1LH 4RWYL 1G7JB 4JFQB 5I1KH 5GGVY 2YZ8A 5CHNA 3BHBB 3D5OF 3LD8C 4HT1L 3E8UL 3FT3A 4MA3A 1E6OL 1AGDA 2BSED 3U36A 3MLWL 3C60B 5IK3A 4M8VA 3MV11 5IWLC 5MI0C 1F3RB 4JHBA 2DOCA 3IDUA 3JWNC 4X4ME 5D6CB 3X3GH 4LCUB 1FL6B 2EKSA 3KGRA 4DQOH 3EYFB 1ZLVH 3QUZA 5MENE 3X11B 2ATKA 5JNYA 5JW4Q 2BVPA 2FWOA 3G6JE 1AHWB 1WCBA 2W9EL 5DRXA 4G6AD 4XVJH 3UJTL 3PHOA 2J88H 3CFJB 4LPXA 5F9WB 2CDEB 4UOJA 3MRHA 3BGAA 1RUKL 1GZPA 2QR0B 2VIRA 3VFMB 3FFCB 3U4EA 4NNXA 4KRPB 3P0YH 2LVCA 1E6JL 5HI4C 4QGTA 1DQML 1OTTD 4OQTH 4ALAH 1TJIL 3HC3H 4EUPG 3KPSE 5I75C 3RTQD 4OSUL 2ZJSL 3SGEI 3MREA 5IOPB 1D6VH 2D03H 2AAVA 2DIJA 4YDIH 4WUKH 5EORL 4DN4L 2VLKD 3DSFH 5HHNA 2IAND 1P7QD 1IC4L 1NFIA 1AFVH 1FV1A 4G8IB 4GAFB 4LLDA 1ZLWK 2DLFH 3W0WD 3PP4L 3QPXH 4EXPX 5F9JA 5J89A 2XZAL 1AR1D 1PYWA 3O9WC 1HQRB 5FHAH 1U58B 3SDXB 5JOFA 4JM2B 1K6QL 1FQ9C 4BZ2L 5FM5O 4EBQH 5CBAA 2P43B 1NLBH 1MREH 4J6RL 4LIQL 4O9HL 5DJCA 3BRFA 4BFIB 3WS3B 5HVHC 1CQKA 5D5MF 2VAAA 5DSCB 2YD4A 4M9OA 3ARGD 1LNUB 4O2EB 4RGMC 5F8QC 1T22B 3MV8B 1G7PB 2OL3B 3DX8B 4NFCA 5DJ0B 2HFFA 2Y06L 3MNVB 4AIOA 3CXHK 3IRZA 1P2CB 3FHQA 3KXFD 4F3FA 3P9MA 5TE6H 1U93B 3MNWB 2FEDC 4OBRA 1FN4A 4U1HB 5JA9A 1EFXA 3A67H 4K8RC 1F8TL 2BFVL 3TNNA 4XPBL 1FH5H 3FTGA 4M1DH 4PY7B 4WU5A 5I1CL 1RZGB 2R29L 4YXKH 3RWEA 1H5BB 3RPIA 3CFEB 1J5OH 5DT1H 3EGSB 5EZIH 4KI5D 4P5MB 3TVMC 3KLHD 4XNZC 3VWJB 2NY5L 5DMIH 4XCFH 2YD3A 1MWAL 3BEWA 3QCUH 1VSCA 4N9OB 3OKMA 3ROLB 5K9KB 2HKHL 4EQ2A 4LHUD 5DS8A 1BWWA 2EXWC 4JRYE 2F53B 3MLZH 1KC5L 1OB1B 2O5ZH 2HAZA 3T4YB 3WFEH 3QDHA 4NQEA 1OAXL 3T0EB 3T2QA 1D9KD 3MACH 3U2SB 5CLTA 5LWYH 4LSRH 3NACL 4H88L 3U82B 4HZLA 1G9NH 1GH7A 3U7WH 4HS3A 2VR5A 1LQSR 1QO3B 1XGQB 3QUZC 4X80L 4EN3B 3RZCA 4LHQB 4D9RD 3U0PB 1IC7L 1MLBA 1MCSA 4PTUB 1PY4A 4JZOA 1G0DA 3BP7A 2F15A 4JN1H 1GGIL 3IDJB 5IVZB 4QKXB 4GH7B 1U8LB 5ILTL 4MAUH 3QT2A 5KOVC 4PGEA 1IGYA 5MENB 4PRIE 4ZTOH 5ANMA 2MCG1 3ZKXB 4RNRB 3MRKB 4V2BA 1J88A 5D1QA 3GM8A 5A16A 3G5XA 2Q76B 2HWZL 4DKEH 2OP4L 3QG6B 3FCTB 1P6FA 5D71H 5DJ8B 2DBLL 5GSRB 1A3QA 2WP3T 5E5RB 1NMBL 3J8F7 5K59F 3DO3A 1FNFA 1SY6A 2Y23A 3H7BB 4LLMB 1FRGH 5CILL 4APQB 2CO7B 4C55A 4L1HA 5D5ME 1J7VR 4XX1E 2YD9A 3RUGB 1KYOJ 4LDLB 4M61A 3CJJA 4YUEL 3SJVB 3C9NA 1AJ7L 1JWSA 2XICA 3BPLB 1FE8H 1LVEA 3OXSB 4HXBL 1PEWA 4J3XA 5A2KH 4F9PA 2CDGB 3LKPA 1BQLH 3VXPB 2OI9B 3CU1A 5DR5H 1CT8A 4XP1L 1ZEAL 4OTXH 3FQXA 4XNXH 2DYPD 4KJYB 5HHPB 3MJ6A 2Y6SD 2AXJA 3AC0A 3OB0K 4OT1L 4K2UL 3GBML 3B2VH 2YUVA 2CIIB 3BVNA 4BQCA 2WM0A 4R4FH 4JO3L 1XR9A 3ZYOA 4BH8B 1OARH 4CADB 3P2TA 2P46B 1T1ZB 1QFPA 3GJFA 4KXZI 3RKPA 2VSCA 1ZGLP 1EFQA 2B39A 3M1BB 5ESAA 5KW9H 1HNFA 4HV8B 3HZKB 4LBEB 2XXMB 1KTKE 3D6GA 1FPTH 4GW1B 1MAJA 5J13C 4X6DB 1CLYH 2WINA 5F3BB 4UT6L 4M7ZC 1H3UA 1HHKA 4JG1H 2DWDA 2E7BA 3S37L 4IEFB 2Y7QB 4JREB 5C70A 3CFDB 2R1WB 1D5MA 3ULUL 3DUUB 1CLCA 3RP1A 2P8MB 5FGCE 1XGTB 3FT4B 2Z31A 1BD2A 1TQCB 3KDMB 3WNMA 2V5SA 3H9SD 4XZUA 4P2RD 1BJ1J 1N5AA 3O3DB 4YDLB 5HYQA 4PLJD 4NQCE 1BQHA 4WU7A 5IBUG 4PS4H 2I07B 1YUHB 3HC4H 3NH7H 3SDAD 2ESVA 4YHNB 4MDIA 1MVFA 1QUNA 4NP4H 1A7RH 4P46D 5CINL 3TYGH 1JNNH 2V17L 1ZT7B 1CICD 2CH8A 5EBWB 4R3SB 4PJGB 3TCXA 4R96A 3RZCC 4PJ5D 1ZA6A 1BEYH 3L3DA 2BVTA 1BF2A 3HLAA 1PKQE 3LZFH 3RHWF 5DLML 5K59E 4RQQA 3MGOB 2C5DC 2JIXA 2JCCA 1RU9L 3UPAA 4AH2B 5HYJA 2Z8RA 4FP8L 1UWGL 2AEQL 3G04A 6FABL 2RCSH 3HPJB 2ZCLL 5IMMB 4GSDH 5CEYA 4Y16B 5I8EA 5C8JB 1X5GA 4L9LA 1P4BH 5D1QC 1CF8L 3KPRD 1P1ZB 5ESQB 1XMWA 1MI5A 2CKNA 2L7UA 2DMCA 3PWUA 1KB9J 4GKZA 3SDDB 4JFZL 3GRWL 2E9JA 3WSQL 3FO2B 3UC0L 5D2NE 4MQTB 3H9ZA 5GSVA 3T65B 2VMFA 3P4OB 5JORB 5C07B 2A74A 3GGWA 2ZUQB 2NX5B 1XF2B 3CC5B 1S8DB 5CUSL 2OTPA 3O8XB 1TCMA 5JR1L 3BWAA 2VABA 4TSAH 2VOTA 4G9DA 3K8MA 5FYJD 4JQIL 3GHBL 1ND0B 2J1KA 3ARFA 3WIFB 5DD3L 4JKPH 3ARVA 2FIKB 5E8OA 3ULUF 3DURB 5IGXL 4D9RE 4F9PC 1TIUA 5E8NA 3B5TA 3RL2A 2V9QA 5L6YH 1JPFA 4YDKH 3VH8G 5JOPE 2FATH 3VGFA 1EHNA 3UTSE 3O11B 1KTDB 1CFQA 3MRCA 3MRBB 3UTQA 2QADB 3HNTL 1FZKA 1NMAH 2UZIL 2ZCHL 2HVJA 3DGGB 3WXWH 2NY3B 4PJ7A 4AIXA 1WT5A 2X9WA 3F6LA 2EE2A 2E5EA 3JWDL 4FQLH 2X4QA 1BVZA 1S5IH 3OAZH 1AXSB 2O93L 4OFYD 4WHDA 4I3RH 1EEYB 1TJHH 1DUYA 1EGJH 1D5ZB 4TPRL 4YEEA 1RQ5A 3CLEL 3D3VB 3MOBH 4MHHG 4MXVF 5ICZA 3RGHA 4MD0B 2OK0L 1CLOL 1J05A 1BIIA 1OQOA 1NANH 4X6FA 2BX5A 4JFEB 4R7DB 1LO3H 5TPWH 5F72S 3GMLA 3S97C 2BOBA 5H2BB 1IAIH 4N5UA 1XF3B 4LCIL 3UMTA 5CEZH 1WF5A 4YBLC 3MA7B 3IFPB 1OT2A 5JMOC 5DRWB 5KSBA 4LLYA 3OX8A 3BGFB 2YPLB 2P5WB 5I2IB 2EC8A 4KC3B 3PHQA 1AC0A 2Z31C 3A0OA 1IZJA 2F5AL 3I75A 4R4ND 1M6OB 1TXKA 1S9VB 3WL9A 4QRUB 3FFDB 2KDGA 2Y5TA 3HMXH 4TTDC 3C2SA 3HR5A 3BEVB 5HJ3A 4UNTA 3T0AA 4ZSOB 4J23A 3P40A 3VFSA 1JVKA 1VGEL 3K2MC 1SVCP 2QQKH 3AU1A 3RPKA 4DAGH 3EYVB 2BVYA 1QSVA 1OD7A 4K3HA 4QYOA 1BZQK 1DBAL 3A6CH 3CXDH 4OZFH 4I48A 4MGXA 1YN7A 5CD5D 4KZDH 1MOEA 4ZNEA 3O41A 1UWXH 3TO4D 1CDIA 3D85A 3IB4A 4A6YH 3UP1A 2DQGL 1AQDA 3QCVL 4NUGL 1OM3H 2VQ1A 5BMFL 4HIJB 3GDBA 3VJ6B 5C08A 2VLRD 4UBDC 1RVFL 1Y6MR 2VUOA 3QHTC 4FQPA 2X7LB 1YYMH 4PRPE 4RA0C 5KSUA 3FT2B 5I66B 1TZGL 5CP3H 5DVNA 4L9LC 1DFBL 1PLGL 5DVLA 5L7XH 4WY7H 5L2KA 1QHPA 1RMFL 2FX7H 5EU4A 1J1XL 3GI9L 5E9DB 3BPNC 3QJHB 1IEHA 3GJEB 3ULUE 3H9SE 1AIFB 1GSMA 4RDQG 4RGNB 3Q6GL 3NIFF 3MV7B 4G7VH 4FXKA 3NIDF 1UZ6F 4PGBB 2PR4H 1TFHA 5ADPH 2VXQH 3OKNA 5ELIA 5CZVL 3FONA 4OGYL 1KGCD 3ARFC 1L9NA 4PJEB 5C7XH 1CDGA 2HT2D 4MXVE 4QTIL 3IKKA 3MOAH 4O51B 4G8EB 3WV0A 1LO0H 5JIHA 3V6ZB 4HLJA 3IDYB 3JZ7A 2A83A 5SWSA 4HC1A 1DSFL 1WIOA 1WT5C 2OTWB 4J3OC 5LXGL 5LBSL 4K3EH 4OF0A 3EOBA 1TQBB 3QUML 3KPRE 3ESUF 5KN5B 1M7DB 1XF4B 5A3IC 3T09A 4G42B 3GUTA 1VEOA 4OAWA 4JANA 4PJXF 5L8JB 2ITDB 1CGSH 1E4XH 3MROA 3C5JB 4ENED 3HPLB 2Y9RT 4LCWD 4U1LA 2YRPA 4ODUB 5FCSH 4CMHB 1NSNL 2Q3AA 3O6ML 5FO7B 4ZS6C 1GIGH 4ODBD 3TYFA 2MQCA 4AY0A 4HMDA 1NJ9A 2X6MA 4XC1H 4FQ2L 2EE3A 5HGHA 4Y1AE 1RJLA 3RWDA 3QXAB 4JZNB 1EZVY 3UDWA 2VRAA 2GAZB 2YOCA 4XAKE 3VH8B 2DMBA 1SYSA 4OCMC 1WSST 3SKJH 1YYLL 5CGTA 2JELH 1GPOH 3X3GL 3D39B 1K4CA 3VMNA 4DZ8B 1YMHB 2CXKA 4U1IA 5C0CD 3VMPA 3I9GH 5B39G 4NQVA 3THML 4KKBC 5I74B 2F8XC 1EDQA 1UVQB 4XVJL 5T3XH 1XFPA 2J88L 2HLAA 4WUUE 3W5MA 4HIIB 3C6LD 1CXFA 3WDJA 1J8HD 5HTSA 4ZPVA 3ALXA 3KPLB 4FQQA 3BH8B 3OPZL 5I30H 2HT3D 4WFED 1D5IH 4F15C 4I2XB 4Y2OA 5IB5A 3QWOB 4WGWB 4JFFB 3U30C 4ALAL 1EJOL 3EHBD 2X4SA 4F7TB 5MEQB 1LE5B 4HSQA 5GS1B 3G9VA 2Q8BH 1KJ2B 2P24B 3RWCA 4U1JB 3PG2A 1A6ZA 4U1NB 4Z76B 1KSRA 2D03L 1B9ZA 1UZ6E 2R39A 4WTWA 3DSFL 2AP2A 4ODVH 4LLVA 1AFVL 1CLZL 4M5ZH 3ZT6A 1Z5LB 1IGTA 1H0DB 2YD5A 5DI8B 2DLFL 3QPXL 1QSFE 3U0TA 4YE4L 3HB3C 3PV6B 5H94A 1W0VA 4IM8A 3I2CH 3VRIA 5FHAL 1F4HA 4BSWA 3KPOB 2AV7B 1T0NB 3QDGA 5LG1A 5GISL 1EBPA 4EBQL 2X4RB 3DMMB 5DUBB 4WO4B 3EOYG 1NLBL 1MREL 2QSTA 3ILPA 1EVUA 3H3KA 1B6UA 3K1DA 5C0JA 2LABA 3X3FH 3TCLB 1AGEA 4LU5L 1DP0A 4KROD 5DQJA 3OGCA 4HWBA 4JO4H 2VWEE 4WHCA 4IRSA 2DN7A 4GQ9L 1UM4H 4PGCB 4N0UA 2DQDH 1T2QH 5TE6L 1ZWIA 3WEXB 5TQ2H 1EAJA 4WDIB 5C0BB 4PJXE 2FJFB 1ZANL 2AERT 3HRZA 4TUJB 1SEQL 3X13A 3WFDH 1WBXA 3A67L 3MV9A 5E8EB 5I9QB 1FH5L 3FO9B 3MRDA 4M1DL 4Q9QH 1P6AB 4JFQA 2R56H 4YXKL 3BHBA 3GO1L 1DQJB 3BGMB 1I7TA 2ZUTA 3R8BB 4TUKL 3L7EB 4L5FH 3NVQA 4OFDA 2OR9H 5DRZB 1EHLH 5EZIL 1H15A 4JFDD 2E7LA 1QLFB 3RWJA 1KPRB 5J6HA 2ZUXA 5F44A 3C60A 4XP6H 3I50H 3KS0J 4Y88A 2YPKA 3GJFK 2IPUG 2IH1A 3QNXB 1Q9OB 3QCUL 1SMOA 3NFNB 1OAKH 5D6CA 3W9DB 3MXWL 4X7CC 1ULVA 4PPTA 1FL6A 4WI2A 5AZEH 2AXFA 3MLZL 4JDZB 3VRLF 5EBGA 4CN1A 1M05B 3X11A 4L9DA 2O5ZL 2FBOJ 1INDH 3MUJA 5IMKB 4K9EH 4P9HH 3PIQB 4F7CA 4YR6A 1AHWA 2LTQC 3WFEL 3MLRH 5D8JL 1C5CH 3BZ4B 3CFJA 4UI2A 4HF5L 4ZFFB 2WZPD 2NY7H 2CDEA 5F21B 1FBIH 1G9NL 3G6AB 3FFCA 3DHMA 1KB5B 3U7WL 4JFHD 3PNWA 4PJBB 5KJRH 5ADOH 3LB6C 2Q8AL 3QEQE 4IOFD 3RJDA 1MFCL 2R0LL 1IAII 3MO1A 5E00A 2EIDA 3TWCH 2DIAA 4QXGH 5IOPA 5EUKB 1GAFH 4L3EA 2WLZA 5FYJU 3V5KA 4KU1A 4UIKH 2BXZA 3QSKB 3WO4C 3DXAE 4Z95H 4G8IA 4MJIB 2EXYC 5ISZA 2NY1C 3CSYA 3TBVB 4B7IA 3T0VA 4HK3N 4XBPA 5IHUH 3OSKA 3PWPD 3RX7A 4ZTPH 4H25A 4M7LT 3B9KB 3VGGA 1IGIL 1FRGL 4HUUA 1A3LH 4ZFOL 2XQBL 1N64H 4OF3A 1IGMH 5DSCA 2BNQA 2APBA 4OV5B 4IRJD 3DRQB 1ZT4B 5E2UH 3DETD 4O2EA 1T22A 1G7PA 2OL3A 2A1WH 3MQIA 3MNVA 1P2CA 3ULSB 4G8GB 4J2XA 2BSTB 2L0DA 5B39B 1U93A 3SKMB 1JWMB 3KJ4C 3CK0L 5M95B 1RJZB 1RULL 4NBYB 4U1HA 4NQUA 4OCXH 4YHYB 1BQLL 3HA0A 4LRNH 4DUVA 3J7HA 4GG6B 4OTXL 4XNXL 4GAJH 1T2XA 4IRSC 3QFJE 5EPMB 2X09A 5IHZB 3QCTL 1RZGA 2C4XA 2Z91B 3F7QA 2AK4E 3O6FB 2FHFA 3IDXL 1C1EH 4WFEE 2D9CA 3EGSA 2UZYB 4K94C 2P8PA 3EYQC 1JNLH 1FFNB 3RGVD 3PQYA 2NW2B 3AREB 1CTNA 2LU3A 3AB0B 1I1AC 3IAQA 2DICA 3QRGH 5DUML 1S5HB 1KCKA 3BE1L 4OZIF 1J0KA 4KTEH 5CZKA 1CGTA 3O4OC 3RA7L 3ZSTA 3VRLE 3CH8A 5TE4H 1I8MA 1FPTL 5LGHH 1CXIA 4LL9A 5BVJB 4XXDB 3GZKA 3PDOA 1CLYL 3K2UH 5FAAA 5J06A 1N3NA 1S7SB 4HGKC 3T4YA 2UWEA 5JQ6L 2E7LC 4P3CL 2CIKA 1IM3B 1MCWW 4WWKB 3C60C 4CN6A 1A4JB 1KJ2H 1DL7L 1JGLH 4GFTB 4EDWH 4QRRD 4X7SH 3AVEA 2P48B 3ARBD 2IMNA 3GSWB 1KN2L 4NUJB 5GRVL 3X17A 4POZC 5I1EH 4X4YB 5DEZA 1T1XB 1XGQA 5E2JA 3DO7B 3MRJA 4EN3A 3LS4H 4JKLA 1HI6A 3V2AR 1NBZA 1UH4A 3BD5A 1AHWC 4IHOA 5BZWB 4NN7C 5DD5H 4J4PD 5SWZE 1GC1H 1YC8A 1ZGLA 1I1CA 1KXQE 3AM8A 2F5BH 3QUYA 5INDB 3O2DL 3MRLB 3RWFA 3O4LD 3NH7L 3HC4L 4JFXB 5EA0H 1A7RL 4RNRA 4GKOA 3VRJB 3F12B 3UYRH 3MRKA 4XNYH 4G6JH 4D9LH 1JGVL 5C86A 1UACL 1BEYL 2Q76A 3QG6A 3LZFL 5GSRA 2QBWA 5FIEA 4Q9RL 1EERB 1IRAY 4KKLC 4ZOCA 3FQTB 4HDIB 3DUSB 2V7NB 3H7BA 4LLMA 5CGYC 4MB5A 4GLRH 1XCQB 2RCSL 3FRPG 3MLTB 4JFDE 4UUJA 1RFDH 2ORBH 4QOKE 2DI9A 5D2LF 3VXME 4LLAA 4WFHD 5JW4N 4K7PY 2YKLL 3IU4H 4WW2A 3IF1A 3OXSA 3LIZH 4ONFH 2X4OB 1LO2H 5H35A 2VITB 2J6EA 1N0LA 3MRMB 1INEH 2CDGA 1AD9B 3S8WA 1CD9B 4K23H 4D8PB 5JIIA 1F6FB 2VXVH 1ZLVK 4F7EB 2P42B 4KJYA 2PW2B 5HHPA 3JWOH 5CZXD 4TSAL 1N0XL 1A7NL 2VYRE 2X70B 1RK1B 1ZT1A 2H9GB 4GUPB 2CIIA 1F3DH 4EUPA 1FFRA 2G75B 1DJSA 2RIKA 5FGRA 4DEPB 1KT2A 2HRLA 4BH8A 1L0QA 5L6YL 2YBRB 4CADA 2AK1H 4YDKL 3BW9A 1NAML 4ZAKB 1T1ZA 2FATL 2FJGA 1MFEL 2EEBA 1MHEB 4OZIE 3C87A 1CFTB 2SEBB 3DYOA 5FF6A 1NFDE 3CH1B 5TGBB 2VXTH 4Y5VB 4MNQA 3W2DH 3D2UD 3QO1B 3D0VB 2GCYA 4ODWA 1PKOA 1KB5H 5JOEA 3ARZA 5F3BA 1U8PB 4LSQH 4X9BA 1DE4B 1EGJL 3V5DA 4QRSB 5C6PB 1JE6A 5DO2C 2ZWLT 4XWOD 1INQB 2R1WA 3CFDA 1A1MB 1YNLL 3PWPE 3DUUA 4GW4B 3D48R 3MBEB 2DKUA 5CWSB 5HI5C 2FH6A 2P5EA 1IAOB 2CUHA 5TPWL 1G9MH 2VUYA 5DZLA 2CKBB 3GSOA 4ODHH 1IAIL 1LILA 3KDMA 3PDGA 2XI9A 3LEYL 1ZLSH 2VDKH 4QRTA 3KPNB 5HI4D 3PL6D 3MLUH 4GAYA 4RGOH 1Z9SA 2H6PB 2IFGA 1N5YL 1MJ8H 5E2VH 2I07A 4M02A 1YEDB 1G7QB 2VDLH 1WQVT 2XFXB 3QAZC 5ID0A 4L4VD 1RZ7L 3M07A 4X98B 1U8JB 4PJGA 4EN3C 2W0PA 1UZ8B 3ZE2F 3QDJD 4O4YH 4PD4K 3SKNB 1YEKH 4M9PA 3O9WD 1QPPA 2HYMA 4K71B 2QHLA 3TLRA 5E2TH 1BQSA 3AM8C 4DAGL 3QUYC 4I0PB 4NKIL 5KOMC 4S1QH 4LEXH 2AQ3A 3H0TA 3A6CL 3CXDL 1Z9OA 3T0DA 4OUOA 4AK1A 4XMLH 3ZKXC 5J6GB 5IMLB 4PGZA 4QHNB 5IKCA 5D2LE 2ZOKB 3RY5A 3RX5A 5HHOA 1P1ZA 1AXIB 1GVIA 4A6YL 4ODSH 4OGXH 5DC4B 3QA3A 4QLRA 3SDDA 1TMCB 4KKAD 3FO2A 3RKDC 5BRZE 5FGBA 4LASH 3P4OA 5JORA 5C07A 2FEDD 1YYML 4KI1A 4RWHA 1IM9B 2PO6B 3L5HA 3CC5A 1S8DA 2DMKA 4WY7L 3VFVB 2FGWL 3O8XA 2IADB 3ARSA 1ZS8A 3UO1H 4K8RD 5FFLA 2G2RB 5EU6D 5T1MA 5DJYB 3FO1B 1ND0A 4WW2C 3BPLC 1NC2D 3WIFA 5DHYA 2OXGA 5E99H 1NAKL 4HD9A 1G1YA 2FD6L 1MRFL 2OI9C 3TVMD 3D18B 3K0WA 4HGWA 5FHBL 2PR4L 1A21A 2F54D 1HWHB 2WBWB 5ADPL 1F4XH 2VXQL 1D5BB 2BCKB 4YXLH 5F8RC 4LSTL 1S7RB 1AXSA 4BSVB 2EXWD 3BIBX 4HLZH 3IVKB 4LLUB 1D5ZA 3BP6A 4L3CB 4S1DC 2X2YA 3MOAL 3PV7A 3S7GA 5F1KC 1LO0L 5C2BH 4N8VG 2ZUYA 4CU8A 1I7RB 3GB7B 1IGJB 4XVTH 4R7DA 5MP6L 1SBSH 4M6NH 3CCHA 4Z7UA 3LEXB 4HWNA 1FAKT 5IR1B 2VZ3A 3QUZD 4XRCB 2V2XB 4M6OL 3FB8A 3MA7A 3IFPA 4JREC 2XTJB 1LO4L 4QXTB 2P5WA 3N1PC 1B0RB 2GSIB 4KTDH 1NCDH 1IKFL 2ADIB 4Z6AT 1RIUH 4UNUA 1TQCC 1E27A 2L7JA 4P2QB 2PYFA 4BK4A 3QDMB 3FFDA 3L3IA 4H26B 3PP3H 1HK6A 3ZE2E 5DMKB 1GIGL 4ZYKA 3TBWA 3L7FB 1RZFH 4XC1L 2JB6B 5ENWB 4NZDA 1FYTE 4HS6B 2E3VA 4FFYH 3VE0B 2EYSB 5KSVB 3HI6L 3K80A 3EYVA 2JE8A 1KIPB 2YRZA 1NMCB 5C9KA 3K3QA 2X40A 4OFPA 3SKJL 4UDTA 2O61B 3VMOA 2ZG3A 4W6YB 2JELL 1GPOL 2XA3A 5DZNA 3OZ9H 4O2CB 1A9BB 4UU9B 2C7UB 2C9AA 3QEUB 5IV2A 4TSBH 1JGUH 4NQSB 4HJ0D 3RZWA 4HIJA 4OCRL 3VJ6A 1YPZA 2V6HA 4OZ4B 2WUBL 1T2JA 5DK0B 5F1IB 2CJUH 5B4MC 2XY1A 3ESVF 4GKSB 3BH9B 2R1YB 4FS0A 5EC2A 3CFBA 3C8KB 1T89A 3QXDB 1CD1A 1DBJH 2NPLX 5IMOB 4G9FB 1QA9B 1MELA 2IPKB 3O0RH 5F6IC 2VDRH 3CFKB 4NM4H 2FECI 5HYSG 1K2DB 5J1AA 5I30L 1I3UA 4PIRF 1D5IL 2XXCB 1IZKA 5E9DA 3GJEA 3NFPB 1AIFA 3LKNB 1H3XA 4GAGH 3PWNB 2YZ1A 1FZOB 4PB9H 5ALBH 5CEXA 1IAKB 2XKSA 3C5ZA 1EFXD 1OAUH 2B4CH 2VSDA 2WSKA 3O8XC 5MERA 5FYKL 1L0XA 1TVDA 2C3WA 5KG9B 4L4VE 1KELH 3Q1SH 4QHKI 1MF2H 4FXLA 5E0QA 5C1MB 4PJEA 2CKBH 1SM3H 3ZL4H 5E1AB 2B0SL 5FYKD 3O3AA 3VI4F 1EV2E 2C3GA 1MCNA 4O51A 4G8EA 2CLVA 2I60L 4NM8H 2ZUSA 2EYTB 5FUOH 3QH3B 4V1DB 4CU7A 1Z6JT 3V6ZA 2AXHA 4P2OB 1KPVB 4LLWB 4RMWA 1TTFA 4OD3L 2A9NH 3MMEA 1MJJB 4GLRI 3RVTC 1BREA 4JO4L 4DJMA 4MAYA 4HWZA 1BZ7B 4C56B 5BJTB 1YJDC 2HFGL 4LARH 5T33H 4NO2B 1JUFB 1WCQA 1CXKA 1E4JA 3ALPA 3PXHA 4NQED 2J8UA 5E6YA 4KK9C 5TQ2L 5FK9B 4OFVA 2ITDA 1YECH 3C5JA 3HPLA 4ODUA 4RFEB 3RWGB 3ZKQD 3WLWC 1J12A 4B7LA 4EEEA 2HRPH 1ORQA 5GIRB 2XNAB 3RZCD 4L5FL 2OR9L 1V7NH 2OR7A 5EU6E 4LSSH 3WUZA 4YXHH 2Z35B 2OZ4H 2Y1VA 1JCKA 2OM5A 3BGFC 3H7LA 3HG1B 1OPGH 7CGTA 3VH8A 3DARA 5T1KA 3BAEL 2IG2H 5FV1L 4QHKJ 3UTTB 1LK3H 3N9GH 5GGTH 3V6OA 1RUQH 3QISA 1U3HB 1OAKL 4O2FB 3INUL 1YMHA 3FAWA 1ADQH 4LCYB 5D1QD 1SY6L 1V05A 3WNOA 3T3PE 1INDL 2VR4A 4P5TA 4K9EL 3D1MC 2B8OT 1UVQA 1BGXH 2BC4B 1JPST 3ARPA 4H0IA 1OF2A 4OCSL 1NCBH 1FBIL 3SN6N 5DZOA 2CR6A 1R3IL 3VG9B 3BH8A 3V6FB 4P49A 1FL3B 1GHFL 3QWOA 3TBYA 1ZLUH 4JFFA 2DKSA 1NEZG 1MCFA 1LE5A 3TWCL 4U1NA 3RDTB 5DVKA 5EO0A 5IVXB 3FOLB 4OD2B 4MZ3A 4DW2H 3KVQA 4D3CL 4Z95L 1IQDB 3Q5OA 2R23B 1EUUA 2GKIA 4ZUWA 3CU7A 3LH2H 5EU7C 5KS9A 2VKXA 1NGPH 1LP9B 4G8FB 1TITA 1JTOA 4D9QD 1EXUB 4XWGH 3UX9B 4S2SA 2KQMA 4JAMA 3L3KA 1DQDL 2AV7A 3VI4E 4RGNC 4ZTPL 3BT2H 5C0RH 2BOCA 1DEEA 3VGEA 2X4RA 2F8OA 4Y89A 2VDMH 5MEOA 4Z7WB 3S5LG 4FQCL 1A3LL 4BJLA 3C5ZC 12E8L 3SOBH 4XBGB 1IGML 2D31B 5E2UL 2NW3B 2ARJA 2A1WL 2QEJA 4PGCA 2IJ0C 1H3WM 3L3HA 4U49A 4NJAH 3I6LD 4M43L 3WEXA 4HCRA 4N68A 1IEAA 3KAAA 4WDIA 1KEML 4PJDE 1T0PB 4BZ1L 3K1KC 3IDYC 4OCXL 2NCMA 1UWXK 1CG9B 1HIML 4LRNL 1QZ1A 5E8EA 4MA7L 4Y4KD 3V4VH 1WWAX 4MAYC 3FO9A 2Z31D 4P59L 1NUFA 5HYSB 1BD2D 1DQJA 3S96B 4R8WH 1H3VA 5T3ZH 3P4NB 5AUMA 5DRZA 1NDMA 4YBHA 3O2VH 2UY6A 3MR9A 4TTDD 3VDCA 5HPOA 5IJKA 1QLFA 4NCC1 2D3VA 4Z78B 1NPUA 5DURD 3VD9A 2DJ4A 3R06B 3PWLA 1EO8H 2ESVD 2PKDA 3NFNA 1C5DA 4KTEL 2AEPH 4X4XB 5HHVH 2AJXH 3U0WH 2I9LA 5TE4L 1JYWA 3KLDA 1WTLA 3K2UL 1OGAB 2GITB 1ZAGA 4NHCL 3QI9B 4D0DA 4AL8H 3O2WH 3KJ6L 2JIXD 3OAUL 4RBPK 4YHZH 3VXUA 1KJ2L 1HINH 1QSEA 4PP2B 5FYKE 1T7YA 2FECL 4X7SL 4GMSL 4LF3A 4K7FB 4DKAA 3V6OC 4UBDD 3ARDD 2IQAA 5GRJL 5IT2H 3AAZB 4NBZB 1EMTH 2A6JB 4IS6B 5EIIA 4PJBA 4Z18A 1YMMD 3QUXD 3GSXA 3LS4L 4P5TC 3M17A 3OF6D 4KKCC 5DD5L 2EO9A 4YDJA 1MI5D 1GC1L 1N6QL 3VD7A 1W0WB 3KYOB 5EUKA 3VFGH 1DQLH 2F5BL 3QFDB 4HUWA 4KDWA 4KZEH 3OKKB 4NQEE 3BUYA 1FJ1B 5E94A 1ONQA 4LNRB 3TBVA 3UYRL 2G9HB 4XNYL 5KTEH 4LHJB 4G6JL 4D9LL 3CSBA 5IQ9B 3VFWA 1I7UB 4BSJA 3Q2CA 1UC6A 2YEZB 2AVGA 4WV1B 2ILLA 3ARFD 1G6RL 1DBMH 1C12B 5J11C 5GRXG 1YY8B 3I6GB 3B9KA 3IRPX 1N4XL 2AJZB 4NSKB 5TFSH 1RFDL 4OV5A 4XX1G 3DRQA 2J3SA 3JTSA 3S3SA 2LQRA 2ARWA 3OB8A 1B4JL 4PTTB 3JV6A 5AG9A 2BJML 3U79A 3ULSA 5ANME 2BSTA 3MYJA 1AP2B 5B39A 3IU4L 3KPTA 2W92A 4NKOB 3SKMA 4FFZL 4ONFL 3G6JB 2IPTL 3MCLH 4KMQA 5AYQA 1QVOB 3U7AA 3LKSA 1INEL 2R2EA 4WI4A 3TIDB 3ZO0A 2FJHA 5A3ID 1IARB 3QIWB 1G6VK 2ADGB 1T80A 4GG6A 2VXVL 2JCCF 4Q7DA 3L95A 1MFDH 5EPMA 4LPVA 5FM5M 5FO8B 2Z91A 1UH3A 1N26A 2JK5A 2DQHH 4PJFA 4XPHH 5GGRB 4ZS6D 2DQUH 1IAMA 3KPSB 1NEZB 4Y4HB 1FFNA 3AREA 3RIFF 1FCCA 1S7VA 3SQBA 3OKLA 4YHLH 4HULB 1HHGB 3RNQA 3NPSC 2XQYG 3CX5J 1VFMA 1DLHA 2IBZY 4LCCB 2VXTL 4W81A 2W65B 4DVRH 2QQNH 4XPAH 1VFBB 4KVNH 3SPVA 4WFFD 3NCFB 3EYSL 4XXDA 3W81A 3ULVH 1S9XB 4PJAB 1J1PH 4LSQL 1FCGA 4H5SB 5IJKC 1UB6B 4RIRB 1FZJA 4F33A 1IM3A 3FO0H 1DVFA 4KKBD 1L7IH 4E41D 1D9KA 5JPNB 3S5LB 4NUJA 1HXMB 4JRXE 1QLEH 1G9ML 4ZO6A 3LRHA 3H3PL 3KHOA 4ODHL 4X4YA 4KUZH 3DO7A 1ZLSL 3LEVL 1QBLH 2VDKL 2XT1B 3OV6A 3KHQA 3D85D 3OXRB 1A0QH 1QEWA 1UGNA 3GIZH 2EDBA 4Y0GA 4G6AC 1BLNB 4RGOL 1B0GB 4PJ7F 5C08D 1MJ8L 5E2VL 2X41A 2VL4A 3MRLA 4NFBA 2Z93A 4NN5B 2VDLL 2OSLA 3QDAA 5DHXB 3FZUC 2EDHA 3GMNB 2A9ML 3F12A 1FNGA 3VD5A 3GHEH 4HH9B 1VFUA 1Q9LB 3VXRB 3X14B 1XAUA 5DVOA 1YEKL 3HB3D 5I1DB 3TT1H 1WFUA 2CGRH 2EDEA 1KCUL 3FQTA 4HIHB 5E2TL 3K46A 4HDIA 2MOVA 4HQQH 4Y19B 2V7NA 4S1QL 4LEXL 5HDLA 5KVEH 3MLTA 3KG5A 1IMHC 4XMLL 5FYKU 3EAKA 4EJ1C 4QHLB 2IALB 1KCLA 2YXMA 2JB5L 4FQ1L 4JRYB 4NFDA 4ODSL 3VD4A 5B38G 2EECA 5DJDB 5DEFB 4ELKA 1BJMA 5FA3A 1KFAH 4H8WC 4DK3A 4PJHA 4HHAB 3B9KC 3DV6A 3MJ9A 1X5KA 2VITA 1O0VA 2P49B 5JIKA 4HC1L 2CLZA 3MRMA 2CRZA 1NGZB 4LASL 4W4NA 4M3KB 3FQWA 3RY6A 1DR9A 2ATPB 2YA0A 4MXQC 3ARGC 3EFFB 3BZFB 3IKCB 2JCCE 2DYPA 2YUXA 5GS0H 1S7TA 3HAEB 3O6KH 5SWSD 5HYJE 4LSVL 3F6IA 3G08B 2X70A 4P5KA 3ROOA 2R69L 1E28B 4GUPA 5DHVA 2GJJA 5AEAA 5B8CB 4KAQL 3GK8H 4PRBA 2B7DT 2GK0B 1FAIH 2YBRA 4HWEL 4YHYC 4AMKH 3B5GA 4MJ5B 5HVFB 1P4IL 4PRIB 4HIEA 2MPAH 1K8IB 1F4XL 2ADJB 2X4PB 4NRYA 1MRCH 4YXLL 3HNSL 4UMGA 5SV4A 2X4NB 3WKNA 2ZOLB 3NA9H 4JR9L 4KI5C 5GRUL 4LAJH 3L5WA 1GGCH 4YIQA 1CL7I 4LK4A 2XKNA 1DUZA 3HE7B 5C2BL 4GW4A 5I17B 3MBEA 1IAOA 4XVTL 4JJ5B 3I6KB 5HGGS 5D5MB 1CFVH 5C0AD 4FMFA 2CKBA 5KANI 1F3JB 4LVEA 1MHPH 4P2RA 3CVIL 4XCEB 3Q5YA 2V5YA 4BELD 4XNMA 1KCVH 5E4EB 3LB6D 3KPNA 5BV7B 1PEZA 1DVFC 1D9KC 4PJ7E 5FOBA 2YSSB 2I9TB 3QULA 1FL5B 1YEDA 1G7QA 3JSSA 1M7IB 1NCDL 3ARWA 4P46A 2GY7B 4E9LA 1RIUL 1E4WL 3LS5H 3KNBA 3V52L 4XPTH 1X6NA 4XHJD 2R8SH 2EXYD 1ZHBA 4XPGL 1MNUH 5DDHB 5C6WH 5I71B 4FFYL 3K4DA 4OUUA 3RNKB 1U8QB 4OI7A 5IROA 1Q1JH 3S88H 3RTQB 4NZUL 4ZUVA 1ZXQA 2BDNL 4GBXA 5IMLA 3L9RA 5DK2B 4GJTB 3ISWA 2D0GA 4PREB 5FUZH 1BVKB 2NR6D 3MLYH 4TSBL 1JGUL 4C59B 2J7LA 1PQZB 1AGFB 4WW1A 3V6BR 2CJUL 1QFHA 3QDGD 1RY7B 5L88L 2FX9L 4AEHH 2EH7H 5DEGB 5EH1A 3WNLA 1IM9A 1BQUA 2PO6A 4M6ML 1OTUD 5FGCB 3O0RL 2VDRL 5ACZB 2IADA 4ONOA 3M8OH 1M71B 2Y4SA 4YAQB 5DJYA 4QHUB 3QNYB 2GIYA 4K94L 2BHYA 4YH6A 4MD5B 4ZNEE 5IBLC 3JV0A 4NQCB 1Y0LB 1K8DA 4GAGL 4CJ0A 5F7FA 5HBBA 1T7XA 3VCLB 3RY6C 3EYQD 5C0EB 3D18A 1X5LA 1HDMB 1OAUL 3AY4A 4WIQA 2B4CL 1JFQH 1MCJA 5C08E 2Y6SC 3MV9D 4AM0B 4F58H 1D5BA 1QRND 1YN6A 5T1LA 5KAQF 3Q1SL 2I24N 3NGBB 3LQZB 5HGBA 1VPOH 1PKQB 4L3CA 4LLUA 5L2KE 3LKQB 2X44D 3NN8B 3BISA 4MS8D 5IB3A 4U1GC 1T04B 4DUXA 4NM8L 3CIQA 3C60D 4X5LA 2H3NB 3LEXA 3PGDB 4TQEH 4JG0H 5IR1A 1VKXB 4X0KB 4JM4H 1EJ6A 2FYYB 3F7PC 1AI1L 4YC2C 5B38B 4KVCH 4FG6C 4GQPH 1F4WL 4YDVA 4UTBH 1O5DT 1HSAA 3MBEC 4J1UB 4GXUN 5D2NB 4ELMA 2GSIA 2NLJA 5CJBA 3SDYL 1S7XB 1YECL 5E5MB 2HTLC 3T2OA 2Q6WA 3WHXA 5LVEA 1MIMH 4P2QA 3KLAA 3FFCD 1IL1B 4X5XB 7FABH 4NQXA 2MTPA 1T83A 4H26A 3FN0H 3V4UH 5DMKA 3MV01 4KRPD 1JYXA 2F58H 2HRPL 5M94B 4R7NB 5ENWA 1HSBB 3RWHB 1V7NL 5F1NB 4HS6A 4LSSL 1X4XA 2OZ4L 5KSVA 5HHQB 1FDLL 4HKBB 5IVOA 1OPGL 1EHXA 4P57A 4K3JH 4P46C 3WFZA 2VZSA 1KUMA 1LK3L 3N9GL 5CJ5A 3UTSB 5E08L 2O61A 1YC7A 5CGYD 1RUQL 4NRXA 4O2CA 1A9BA 4UU9A 1OCWH 1UKTA 2C7UA 5ISZD 3QEUA 1ADQL 3DSNA 2ZKHH 2P1YA 1YEGH 2DI8A 3HAEH 4HZAA 4OIIH 1D7FA 3D25B 4OZ4A 3OJ2C 3DIFA 5DK0A 1G0XA 3VXSA 2VLRA 2X89A 5IROC 3QEGL 4UINH 15C8H 1UXSB 3BH9A 1L9MA 4MWFB 2GT9B 5IEHB 4PJCA 4U0RC 1FIEA 2QQQA 3R0NA 4GBXC 5E1HB 1U92B 2XWTB 1C16B 4Y5YB 4D0CB 3GMPB 5IMOA 1QA9A 2IF7A 2IPKA 1Z9MA 1K2DA 1KIQB 4E0RA 3SE4A 3WKMH 4CVZB 2X4UA 4FZEH 4JHAH 2D4DA 4O02H 3NFPA 5GZND 2H32B 3DGCR 1UYWL 3PWNA 1SJVA 4UILH 3GSRB 4L8BB 4FQXB 3BWUC 1RK0A 2OR8A 4DW2L 4X83A 4EVNB 1MJUL 1QR4A 1ZHNB 1AGCB 3VWKA 3OG4B 3MNZB 1L6ZA 4XWGL 4RWYH 4P4RB 1HOCA 2FGZA 3UYOD 5HYIA 5E1AA 3QPQD 4JN2A 1NUNB 3BT2L 5C0RL 2GW5A 1ED3B 1HH9B 3RIAK 1HHJB 2VDML 4P9ML 5BV7H 3PQYD 3QH3A 1OQXA 5E56A 2F19H 3MSPA 5HHME 1A6AB 5ICXA 3GIVB 2Z92B 1OGTB 5HI5D 3L5JA 5FKAA 1MHCB 1T1YB 2F53D 4C56A 3T4AB 5BJTA 4ZPTB 4E42A 4NO2A 4MJ6A 4XCNB 3MCG1 4NJAL 2OJEB 5EFIA 1FIGL 3T0ED 5FK9A 3UJTH 4KJQD 4G7YH 2EIZB 1R24B 1KCSH 2E6PA 1BF8A 3STZB 4PRPB 2VZ1A 3RWGA 5F7LB 2G60H 3T1FA 1S3KH 3DRTA 2OQJB 1PBYA 1RZIB 1E6JH 4R8WL 2EDKA 3EO9L 2D7OA 4EN3D 1DQMH 1TJIH 2EZ0D 4K3DH 5T3ZL 4RISH 2R15A 3P3YA 4BK5A 2VTFA 1YNTB 43C9B 4N0UE 1MAML 5EORH 2AQ2A 5F3HA 1WICA 5JTWA 5MEND 1EO8L 3QUYD 4OKVB 4A2MA 1RHHB 1IC4H 2V7HA 1AE6L 3VXQB 3BDXA 2AEPL 4O2FA 4HBQA 3IFNL 5HHVL 4MCZA 1OL0A 3CUPB 1S9KC 5CEZD 3SDAB 3HUJB 2YC1B 4LPWA 1WLHA 1BFOB 3V7AG 3MV9E 3WIHH 2XZAH 1DZBA 2WK2A 2QQLL 3OJMB 3O2WL 2EE6A 3RY4A 4BZ2H 3QQ3A 1HINL 4DGIH 4J6RH 4KGJA 1VDGA 2VZVA 4N8VA 5D1ZB 3BP5B 3BSZL 5IT2L 3PGCB 3T3ME 1EMTL 5HGAB 3VGAC 1FL3A 4HW6A 4EI5B 2IBBA 4AT6A 4LVHC 5E03A 4JCLA 4G6KH 2FHBA 3IAPA 4H20H 3NZ8B 1HHHB 4ISVA 4NQDA 3KPRB 3IJHB 2GTZA 4P23B 3OR6B 3VFGL 4IBLT 4KZEL 1T0MB 2UWEF 1IQDA 1U8KB 4UDUB 2C1OB 3SE4C 1F8TH 3NCJL 1JYVA 1IFHL 5E8PB 1EXUA 4QXWA 5I1CH 3HS0A 3OWEA 1QRKA 3PWVA 4HBCH 3MRNB 4WFGE 4Y1AB 4F8QA 4YNYB 4QTHB 4PGJA 4S1DD 3VFNA 1R5VB 4YFDB 1K3ZA 3C2AH 5D96B 1A1NB 2IPUK 1AXTL 3PP3K 1DDHB 3VWKC 5BZDA 1WTGT 4L3AA 1R3KB 3SY0A 1IKNA 2HKHH 4L3EE 5DJ2B 2NW3A 3DROB 1I8IA 2FSEB 4UAOC 4WWID 2GSGB 4MNQD 1KJMA 4HPYH 1A1OB 2HT2C 2WAHA 4R4BA 2HJFA 5D9SB 2D7TH 5ISZE 5K9OB 3GSNH 5D72H 3MCLL 3OJDA 4NO3B 3BI9X 1L4IA 4WUUB 3BPOB 1CG9A 1OHQA 4TSCH 2P5ED 4OCLC 2ITCB 4OF8A 5HYSA 4S1RH 4I4WB 4ZODA 3FHAA 2I26N 3REWA 2VLJE 2VLLA 4XPHL 2BNQE 4KHTL 4QRQB 4TULH 2W0FB 5I18L 3EDEA 5D6DC 3S37X 1EBAA 1MQ8A 3NCYS 3AXLB 4FQJL 1GGIH 1JZ3A 4ENEC 2VQTA 2IBGA 4YFLI 1JRHH 1OAYL 4WW2F 1Q9WA 3RAJL 1QTYT 4DVRL 4OLWH 4OKDA 4KPHL 4XPAL 5IG7B 4KVNL 4LAQH 4M7LH 1QSFB 2JJUA 2WWMD 3ULVL 5IEKA 2GITA 1J1PL 2OP4H 2P4AB 4GRWF 2DKMA 4Y8DC 1W72A 1PY9A 2DBLH 5KZCB 1KLGA 1NMBH 2COQA 1WITA 1L7IL 3X12A 3GKZA 1BFSA 2H32H 5CILH 5I76A 1XF5B 4OZHF 2A6JA 5CP7B 3PQYE 4HKJA 1WBYB 3O45B 4Y16D 4NO0B 3Q6FB 4EI6A 4KUZL 4KKNA 4WVRA 2C3VA 1QBLL 5CD3B 3N85H 3CD4A 4NHUB 1A0QL 3GIZL 2B1AL 4HUNB 3DV4B 1T1WB 1MHHA 2YPVL 1FNSL 1AJ7H 2GUOA 4G43B 2P8LB 3CNKA 1F6AB 4KTYA 4MHHI 1FFOB 3KYOA 3SDDD 3LV3B 4MB4A 1JL8A 4I18B 3QFDA 3PHSA 2EKJA 1JZ8A 3MUHL 4PJXB 4U7KA 2UWEE 1P7KB 1PSKH 5C07D 4XP1H 4LNRA 4ZOAA 2NX5D 5I19L 2NYYC 3MRFB 3QWQB 5IQ9A 1QFWM 3EHBC 1QFUH 3GHEL 3O8XD 1HQ4B 4UB0L 4OT1H 4K2UH 1I8KA 3S3JA 3GBMH 4ETQA 2BNRA 4PR5B 4WV1A 4QY8A 1NEUA 4ONGL 1C12A 1YY8A 3I6GA 3DX7B 1HILA 1KTLB 2A73B 1TZIA 3GI8H 4NSKA 2Q7YB 3RVUC 4L8SA 5D7JA 4PTTA 1CN4A 4NKQB 1H3PH 2EE9A 3RVTD 1MCOH 2Q1EA 3R0MA 4JB9H 1KFAL 2N7AA 4NKOA 4UT6H 1T7WA 3GMRB 4DK6A 3G6JA 4PJGF 3D3VD 3S37H 1QVOA 2PTVA 3F5WB 2ZPKH 3TC9A 4HJGB 3RWIB 3TIDA 3ULUH 3MRQB 1LHZA 4JPIA 5EU3A 4O58H 1IKNC 3KWWB 2Z9TA 4HWUA 4JFED 5GS0L 5IB1B 1EAPA 4J3UA 4N1EA 2X05A 2NY6C 3QXVA 2VC2H 3D87B 5KVMC 5E8DH 5ACLA 2NXYB 3QEQB 3RU8L 5GGRA 4Q9BA 1A9EB 1NEZA 1T5WB 3WLWD 5JHLH 3GK8L 32C2B 2IC2A 4KGLA 3H42H 1RIVH 1HHGA 1Q0YL 4XTRD 2P5WD 2MPAL 3HI5L 3AS0A 4BH7B 3TH3T 3EO1B 3DXAB 4LCCA 4LVNB 3ES6B 4CMMA 1MRCL 2V17H 3KR3L 3AROA 3QUMB 4NBXB 3DX9A 4PJAA 3V0WH 4GRWE 4LQ1A 4M03A 2N1KA 1UB6A 2WMPA 4NO5A 5DLMH 1DBBL 3TZVB 5FYLD 4XB8A 2P7TB 1L6XA 1U8OA 4LPUA 2KL6A 4TVSa 1RU9H 1A6VL 3TP4A 3S5LA 2AEQH 4OZHE 1HXMA 5C0GB 2K1MA 1UENA 1I4FB 1CVSC 2ZCLH 1S7WB 4IDJH 4NYLB 4W6WB 3BIAX 5EOTA 5ABDE 4HJJH 3BYTA 2R1XB 1KIRA 4N5ED 3OXRA 2PN5A 1KCVL 1RIHL 5J3HC 3FAXA 4MNQE 4C54A 2FB4H 4H0HB 3GRWH 4YGAB 2OTUB 3E3QC 4XH2A 3WSQH 4UQ2B 3L5XH 2GK2A 3QHZH 3DVNA 4LKXB 1U6AL 3DVGB 5BQ7A 3ZYZA 1AC6A 5DUPH 4AQ1B 3I3EA 1PZUB 2V5MA 2R8SL 3QFJB 1Q9LA 3VXRA 3S35H 2P5EE 3BMWA 1MNUL 3OKDB 3GMMA 1CTOA 4JQIH 3G5VB 1P5VA 2AK4B 3GHBH 5E9DD 5IM7A 1UQSA 2VDNL 5DD3H 4Z7UF 4HIHA 4Y19A 4RGND 5JHDE 3MV7D 4NC0B 4NRZA 1Q1JL 2R4RL 5F88A 2P45B 2GJ6B 3TBTA 5E6IA 4Y7MA 3QQ4A 3C5ZD 3HNTH 3K8LA 2AKRB 3VU2A 2UZIH 1U8IB 3OKOB 2ZNWA 4JRYA 4F7PB 1OWWA 3JWDH 3MLYL 5GXBB 4Y8AA 4WV1C 5DJDA 5BXFB 4I3SL 1PZ5B 3JTTB 4ZUSB 4TPRH 4DVBB 2NMSA 3DBXB 2OK0H 4J12A 1BBDL 1K5NB 4AEHL 2EH7L 2ATPA 1EA9C 1MCWM 3BPCB 1JPGB 4L8SC 1CGYA 5D7JC 1NGWB 1C5BH 4HIXL 1II4E 3G08A 4MAYD 4LCIH 1J1OH 1KPUB 5HHOE 2GK0A 4KK6D 5SWZB 2AGJH 5IIEA 3KYNB 2C3HA 3GBNH 3ZYJA 2KZWA 5C0FA 1D3CA 2IFFL 4PRIA 2F74B 1U9KA 1K8IA 1CGWA 3IXTB 1JFQL 5KSAB 2FEEI 1YPZF 2YA2A 2ADJA 2X4PA 1OP9A 4F58L 5HHXL 2F5AH 5FCUL 4PG9B 2X4NA 4Y5XB 2ZUVA 2A6IB 4OLYH 2IAMA 4Z0XB 3STBA 1V7ML 1CZ8H 4EIGB 1BFVL 5I17A 5F71A 3TN0B 5FO9B 4U1MA 4LCCC 5T1KD 2A6DB 3I6KA 3ZDXF 1UXWB 4JFDB 5D5MA 5SWQB 4UOW1 5AAMA 2DLEA 4QOKB 3SDCB 1FNEB 3TPUA 1D6EB 2AV1B 5EU5B 4M93C 4G3YH 1TJGL 3VXMB 3QCVH 4NUGH 3H2WA 2KPNA 4KVCL 1NC4B 1BJ1H 5C09A 3WXVL 1ZGLM 4P5TD 5F7DB 3IDNB 4KKCD 4RX4D 2LU4A 2I9TA 3KLSA 4UTBL 3OG6B 1RVFH 5F1OB 1UCBH 2LAGB 2W07A 2D2OA 2OXHA 1HZHH 1TZGH 3WFBL 4PRAA 7FABL 1X4YA 1X4ZA 3WNNA 3V4UL 4CVUA 2E7MA 1J1XH 1NGXB 1QHOA 3PJSB 4JFFD 1OD9A 5DDHA 4Z7UE 3L6FB 1LO5B 1JNHA 5CKGA 3HE6A 5I16B 1U8QA 4KXZH 1RJYB 5GHWH 2J5LB 5I73B 3QHFL 4NZTL 4K3JL 3R4DA 1JHLH 1XF1A 3LDBB 4R2GB 4X9FA 2NY0B 5DK2A 2X42A 1MLCB 3QIUB 2X9XA 5JO5B 3SHSA 1NFDB 2J8UF 1DEDA 3HZYA 3FOMB 1BVKA 3NMEA 5CZVH 1YEGL 4OGYH 4YFLF 1EK3A 2PXYB 1PQZA 5IW6B 4OIIL 4IMLB 3A6BH 3DVFA 1TVBB 3GKWH 1S9YB 5AG8A 4PRHE 5LCVH 4QTIH 4CU6A 1KLFA 4UINL 1URLA 2APVA 4XGZA 5E6IC 4CVXB 3WIIH 5FYLE 3PWPB 4PGDA 5HI3C 5T5NG 3WJLA 1G7MA 5CIPB 4QEGA 5ACZA 4DZBB 4Y4FA 1M71A 2XTLA 3WFCL 3WKML 4YAQA 5LBSH 3IETB 1ZVSB 1HN1A 2B5IC 3DYPA 1LEGB 4R0LA 4IRJB 2EDJA 5B3JF 1F11B 2ICWI 4NQCA 1Y0LA 1OP5K 5EZJB 5EZLB 2HG5B 4ZFOB 1KLUB 3AS2A 5C0EA 3VFPA 5C0BD 3NFSH 1HEZB 1YEEH 1YPZE 3KPMB 4L4TA 4AM0A 2APFA 1XR8A 1NCTA 2E9WA 4Q6IA 4NKMB 3O6MH 1S9WA 1A14L 4JLRA 1PVHA 5DMYA 3NN8A 5IFJA 4FQ2H 4JVWA 2XA8L 5EU7E 2GFBA 1LGVA 2UVEA 5BV7L 4G6FB 1QR1B 2DWEB 5EN2B 2F19L 2E6QA 3ZDXE 5I6XC 3LN5B 4RGNE 5DJZB 4WI7A 1YYLH 5L0QC 4X99B 3PGDA 4L29A 5D2LB 3QIBA 1VKXA 1AGBA 2ERJB 2Z4QB 2IAMC 5B38A 3THMH 3MZGB 3U7YL 5KS9F 1QACA 4XWOC 1X5XA 4OZFG 1MWAA 4ZUTB 5ICYA 3JUYA 4G7YL 5BRZB 4J1UA 5D2NA 1RZKC 4GKNA 3VXUD 1S7XA 1KCSL 5EOQH 1KBGH 5E5MA 1QSED 3BJ91 3UTZA 1IBGL 2C1PB 1MCPH 1ZHKB 1KXVC 2G60L 1IL1A 1DTUA 4X5XA 5E5UB 5DFVD 1TTUA 4U1SA 2ICWJ 1S3KL 3MZTA 3FZUD 3OPZH 2R0ZL 3ARBB 4QNPF 1I7ZA 3PL6C 2Y5EA 1HSBA 1EJOH 1WWBX 4K3DL 3RI5F 3RWHA 5F1NA 3S3PA 4RISL 4PRDA 4WEUD 5HHQA 4HKZB 4HKBA 3D0LB 3UTSA 3BZEA 2RJMA 2KZ1B 4ZNCD 1CLZH 5A2FA 2J8UE 5SX5H 3HR6A 4H8WL 1LEIB 4CL7A 4YE4H 3WIHL 5C0DA 3MJ8B 3D25A 3HE6C 2FL5A 2AJYL 3DI3B 3VXTB 4MB3A 1UXSA 4U4BA 5GISH 2GT9A 5IEHA 2Y36L 1U92A 3B9KD 4DGIL 4D0CA 1QBMH 3GMPA 5LQBL 1KN4H 3MFGB 1I85A 2BY1A 2NY4C 4LU5H 4M8QB 4RDQF 1Y18B 4MXQD 4KRNA 4CVZA 2DDQL 2YD7A 4GQ9H 4G6KL 4U05A 5JLZA 2JLLA 5B3JE 4H20L 3GMOA 1BECA 4KKAC 4UQ3A 2H32A 4G8GD 1BX2B 3MXVL 5DRNB 3V0VB 3GSRA 4L8BA 4JPVL 4FQXA 4EKXA 2FEEL 5FKPB 1RAMA 3WJLC 5GGVH 3U6RB 1ZANH 4EVNA 1SEQH 4JPKL 1AGCA 1SYVB 4Y4FC 5L2JB 4PB0L 3I3DA 4LLQB 5DD6B 1WV7T 1MY5A 4P4RA 4R0LC 1X6LA 3GO1H 2Y72A 5DJAB 4TUKH 1KCRH 2A6KB 5GGRY 4FNLL 4HBCL 1U95A 1FYTB 1U41A 1HH9A 1H9VA 1ZLWH 3UBXI 3L3OB 3ARED 4D94A 5CSGA 3C2AL 2M26A 5E95B 1A6AA 2Z92A 1OGTA 3O3BA 4Q6IC 3MXWH 1MHCA 1NDGB 5HY9B 1T1YA 4HPYL 1JPSH 2PTTA 4ZPTA 4CDGC 3PABB 4OF7A 1ZA3B 2D7TL 4YLQT 3MOQA 5KS9E 3GSNL 5D72L 1NAMB 1TTGA 2HJLB 2OJEA 3T2NH 4PYHA 5D8JH 4WWKD 5MEPB 2H45A 5CFHA 1DVFD 1R24A 3GSQA 4HF5H 3BRDA 3STZA 2R9HC 2N4IA 3TO2A 4TSCL 1A5FH 3RIAF 3QIBC 4M48L 1MJ7H 4S1RL 4DFHA 1RZIA 4CNIB 2Q8AH 1BOYA 4OCWL 2NY5C 3C09B 2J4WH 4TULL 1MFCH 2R0LH 2DQJL 2FHCA 2VL5B 1XCTB 5D2NC 43C9A 1ACYL 2VLMD 5ESVB 5FECB 2W91A 1JRHL 3LN9A 2BVQB 1WBZA 3VXQA 5AD0B 5I75B 4LDOB 4LPTA 5C0IA 4OLWL 1FLRH 3CUPA 4LAQL 2X9YA 1ZSDB 3HUJA 4M7LL 5CIPH 2YC1A 3V95A 2XN9B 1BFOA 4ZFGH 1FG9C 4L4VB 3U9PL 1LE9A 4WNQB 5A43C 3IGAA 1IC1A 2H8PB 5DC0A 3F62A 3IFLH 1CS6A 1IGIH 4PJFF 1PD6A 5I8OL 3BP5A 2XQBH 4X6CA 4KI5F 2I5YL 3PGCA 5CSZB 4K3GA 5HGAA 5D93C 2K7PA 3ZT7A 1HXYA 3MJ9L 3N85L 4N0FA 3IDGB 3LN4B 4HJ0C 2KKQA 1BZ9B 5F7KC 1OLZA 3NZ8A 4QRPB 4EOWL 1I3GL 3IJHA 5HVHB 4TRPL 4CAGA 1HH6A 1NFKA 3PF2A 5D7SL 4OZFB 5EC1B 3CK0H 5IBLD 1CDJA 2FX8H 1RULH 1KJVB 2OS7A 2LVEA 1I85C 3BESR 4ONHB 2DL9A 4WHTB 1PSKL 1U8KA 4EIZC 1CIDA 2C1OA 4QWWC 4A6YB 3VXUE 3D9AL 1WFTA 1QSEE 5DQDL 1QFUL 3QCTH 1GGUA 1S7QB 2XY2A 2KH2B 2W60B 5DC9B 3IDXH 1XIWB 3B43A 3PE9A 3C5SB 1CVRA 3MUGB 5D7LA 4NNYB 3Q48A 1X7QB 3EIFA 3GI8L 1A1NA 5DUMH 1IEBB 3BE1H 4XHQA 1MCDA 2PCPB 5DJ2A 2CDFB 2VLKE 3DROA 3RA7H 2FSEA 4YX2H 2WQ8A 2IANE 3P73B 1H3PL 1MCOL 1CWVA 2XOTA 1IQWH 3W0WE 4JB9L 5D9SA 5IFAL 4AYFA 3MRIA 2RBLA 2MHAB 1UFUA 3TJHC 5JQ6H 4P3CH 5J4MA 4U6XA 4FG6D 2ZPKL 4ERSH 3L3GB 4WUUA 5CHNB 1DL7H 3GMQB 1F5WA 4LRIA 4YHPB 4O58L 4MA3B 1REIA 3MBED 4Y4KA 1KN2H 1J8KA 2HTLD 1N2RA 1AD0B 4YZFF 4MQSB 3U36B 2VC2L 5E8DL 2ED9A 4KFZC 3VXNA 1W2KT 1X44A 2C26A 4MSWA 5JHLL 1G7IB 1RZJC 3F7YA 2Z0BA 3AXLA 4WGVB 2EKSB 3KXFE 4ZO7A 4N8PA 4ZDHA 3H42L 3QUZB 1RIVL 4OM1H 3G6DH 2ATKB 3O2DH 5JNYB 2BVPB 3KS0H 2B20A 2FWOB 3OB0H 2YRLA 4PJHF 1MEXL 3P77A 3PHOB 5IG7A 1JGVH 1QSFA 1FO0A 1Q94A 1UACH 2WIIA 3EOAB 3V0WL 4Q9RH 3U4EB 3REVB 3MUY1 4PJFE 2DS4A 5CJXA 2RFXA 3ARDA 5C92A 4KI5E 2BHZA 2DRUA 5CP7A 4GBXD 3TIEB 4IDJL 3O45A 1YZZA 4NO0A 3Q6FA 4OD1L 3UZVB 1G7LA 1YMMA 3QUXA 4HJJL 3BKCL 1CIUA 4NHUA 3OF6A 3VXOB 1FV1B 3CFCH 2YKLH 4G43A 4LLDB 3MJGX 4XP5H 4DGVH 1FFOA 2FB4L 3LV3A 5F9JB 5SX4I 3WS6A 3L5XL 5D1XB 5HYFA 1DANU 1WZLA 4P4KB 3QHZL 1PYWB 1W8OA 2BXYA 2FBJL 4PJDB 5FYJL 2IWGA 1QKZL 1IM9D 5JOFB 2QSVA 5DUPL 2PO6D 3CDGA 5CBAB 1HQ4A 3LKRB 1N0XH 1A7NH 1OLLA 5LGJA 3S35L 4QO1A 2VAAB 4XMKH 2PYEA 3MGTA 4YWGH 1CFNA 1QOKA 5JUEH 4C83A 1NAMH 2NXZC 1MFEH 3ARQA 2Q7YA 3P9MB 1TVHA 2XQYK 2VLME 3DYMA 4X6EA 4ORGB 1PX3A 5F9DC 3MRRA 1XGPA 5T1LD 1T3FB 3BN9C 2Y07H 1IC5H 3CDYA 3GSVA 1UM6L 3GMRA 1T4KB 1GZQA 3SKOB 4LKCB 2K3TA 4MNGE 1Q38A 3GSUA 4HJGA 1YNLH 3MRQA 4YPGB 3RPIB 5J13B 4OLEA 5FB8B 4M7ZB 5IB1A 3WUWG 2V2TB 1C5BL 4YZFE 2WV3A 3UPCA 4A2LA 3IJYB 2P47B 1WFNA 3LEYH 2HJKB 3QEQA 3BEWB 1J1OL 3BOVA 1T5WA 3OKMB 3NA4A 5DS8B 1H8NA 2JTDA 3B9AA 1AO7A 2AGJL 5EZOH 5IF0B 3SE3A 2D0HA 3GBNL 5H37G 1N5YH 4OI9A 4Y4KC 1I1RA 4S10A 4PJHE 4HG4K 3DXAA 1RZ7H 2V9TA 3ES6A 5HGDB 3MX0A 4P2QD 3QUMA 3E1F1 1C08A 4GS7B 4HZLB 3LSOB 4HMCA 4OLYL 4PJ9B 3TZVA 4E41A 4HS3B 4KUCD 1CZ8L 4GRLB 2H1PH 4NKIH 1MLBB 2X1WL 4H1LA 1XGRA 3BQUA 4JZOB 1S7WA 3BP7B 3EZ8A 4NYLA 3VFOA 2K9UA 1NBYA 4PGEB 1IGYB 4G3YL 4NC1C 3DI2B 5TF1L 5ANMB 5F7NC 4FTVA 1NCCH 1QBBA 3BP4B 5GGUA 5GRWA 3WN5A 1WGOA 3LPFA 3VXSD 5CJXC 2X89D 3ARDC 4K8RH 3G5XB 1UCBL 5DMJB 1R0AH 1VESA 4NDMB 4V2CB 1HZHL 3CMOH 1CDYA 4G9FD 3QUXC 3TH2T 1JZ4A 1JF1A 35C8H 3CVHL 2FGWH 2HFEB 4F2MB 1ZHLA 4DCQA 3H9HA 3PDDA 5F89A 4QHMB 4XMPL 1J0JA 4OZGA 4OCYH 3SE8L 2FH8A 3QNZA 3WS6C 3UPRA 5HDQL 1E4KA 4P2RE 4RFNC 1NAKH 1VACB 5D4QA 5GHWL 2H26A 2UUDH 5HYEA 2FD6H 1JHLL 2GJ6A 1MRFH 3C9NB 2VZTA 2PNDA 1JWSB 5IP4A 5FHBH 4RMTA 4WI3A 4R9HA 1LDPH 4N0CC 4OQTA 4X7TA 3VWKD 4Z7VF 4ELMF 4LOUC 3WFHB 4LSTH 1FSKC 4P3DA 4XCYA 5BXFA 3JTTA 3A6BL 4ZUSA 3GKWL 3FQXB 2LE9A 4S11A 4PJ5E 5LCVL 2BMKA 4DVBA 3DBXA 2AI0H 4CDHA 1UJ3B 2CRYA 3WIIL 3ECBA 5C9JB 4XAWH 3BVNB 5J57B 5MP6H 3QUKB 1XR9B 4JRXB 4HXAL 2AABH 3UJJL 3GJFB 1DANT 2XPGA 4E5XA 4IRZH 4RAVB 2EEAA 5ESAB 4C56D 2GTWA 2WLYA 3E2HC 4M6OH 4F7MA 3LRSB 5F9OH 3JV4A 1IVLA 1OOAA 2WBJA 5SWZA 5GZOC 4M7KH 1V3JA 1EIBA 1LO4H 4QCIA 1U8MA 1R5WA 3NFSL 2WINB 1YEEL 3IXTA 3CXHJ 4DKDC 1JYNA 1IKFH 5KSAA 1HHKB 3U4BL 1JWUA 3FQNB 1VEPA 3NCYP 3E6FB 4YBLB 4PJCF 1D5MB 4XB7A 4ZQKB 1MUJB 3RHWK 4DOHE 1RD6A 4LSUL 4Z0XA 2A38A 2Z31B 4LFHG 1I3RA 5EIVA 1EO5A 2EIBA 5FYJE 1J18A 3HI6H 3TA3B 1MFAH 1A3RL 5FA4B 3QXTA 1FC2D 2A6DA 4LVNC 2ICEB 3TNMA 1UXWA 4R97C 3FJTA 3KYAA 5C0AA 1BQHB 2GEEA 4HPOL 1EZVX 4QOKA 4WU7B 3SDCA 3T8XA 1T20B 1K9TA 2AV1A 5BS0A 3VXMA 5GGQH 4MDIB 3TZVC 1NC4A 3UZQA 2YWZA 1RURH 1NGYB 4OCRH 2DQIL 1QD0A 4IOIB 2WUBH 1ZA6B 3L3DB 3P11L 3HLAB 5EOQL 1KBGL 9CGTA 2B1HH 1A6TA 3BQUC 4U7SA 3LQAL 1MCPL 4RQQB 2JCCB 3WUWB 2XRAH 1FP5A 5HYJB 5DWUH 4QF1A 3ZSSA 4OLXH 2B2XH 2NYYD 5J12B 5D7KD 1WVZA 3PJSA 2IGFH 1SQ2N 4MQXC 5CEYB 3L6FA 5I8EB 1LO5A 3WN5C 4GOSA 3WE6A 2AW2A 1MCRA 4NQDD 1F2QA 3NIFE 5L9DL 3NIDE 4MDJB 3RDTD 5GRYA 3BPNB 1CDUA 1MLCA 3QIUA 4WCYL 1G1CA 3PWUB 2XACC 4N9GA 1NFDA 1JK8B 2NTFB 5FYKH 3TJEH 1HWGB 5E7BA 4Z7VE 5H8DA 5INCA 3RVUD 4ELME 3QG7L 4M1CC 4PJIA 2HTKD 2PXYA 4XPFL 4P2QE 1UWEH 4IIQB 2WUCH 4NCDA 1E4KC 1S9YA 2B0SH 2QLVB 1R5IA 1GCFA 3BWAB 2VABB 4G9DB 1MVUB 3A6OA 2I60H 3L3JB 2DTMH 3UROR 2V5TA 1QBML 1TDQA 1KN4L 3ARFB 3HC0A 5CIPA 4DZBA 4OD3H 3RL2B 4HLZG 1JPFB 1P9MA 3IETA 4OLVL 4PJ8A 3ZE1F 1G6RB 2Z8VC 2NY6D 1FZKB 2HFGH 2HVJB 4ZS7H 4Q0XH 4UT9L 4PJ7B 4ZFOA 1OY3B 4G80B 3K81A 5GGVL 1V3KA 3VFRA 1DUYB 3KPMA 1GGBH 3VXSE 2VLRE 5FDWA 4YHIB 1QRNA 5ICZB 1NCAL 1UKSA 4PJCE 4Z5RA 4UIMA 1J05B 1BIIB 1G7JA 1ZVYA 1AQKL 1N6VA 1A6PA 5F70A 2O5YL 4X6FB 1KCRL 1K4DB 2WBJC 3GMLB 4R26L 3AMKA 4KHXL 5EN2A 2N7BA 3ARXA 1N7MH 3BAEH 3LN5A 5DJZA 2YD2A 4X99A 3INUH 1W72L 4LCUA 2E6JA 1YQVH 3EYFA 1JPSL 1Y6KR 1NLDL 4N0YH 1SY6H 3MLVL 3I75B 3T2NL 3E6HB 3UDWC 1KGCE 4ZUTA 2OLDA 3IFOB 5J3HD 2AJ3B 5BRZA 4MJ2A 2Y5TB 4JQVA 1UH2A 1J0YA 4OCSH 2C1PA 1XH3B 1VEMA 1ZHKA 2QR0A 2X5PA 3M45A 4AG4H 5CSBA 1A5FL 3VFMA 4HEPG 1KYOK 1R3IH 3SDCC 3AU1B 4C58B 2OX5A 1MJ7L 2Q20A 1GHFH 1FNAA 5GPRA 4U6VH 4S0TD 4DGYH 4JFOB 4I48B 2J4WL 1YN7B 4YK4B 2XG5A 4N0RA 4HKZA 3D85B 2EDFA 1MCLA 4BQBA 4F15B 1AQDB 1Q9KB 4JO1H 3TESA 4D3CH 2EDYA 4XHJC 5C08B 1XGUB 1FLRL 4ZFGL 2ENSA 5ITFB 5J8OA 4LCWE 5DMGD 5IHLB 1HQRA 2EC9U 1U58A 1DQDH 2ZSVB 3SDXA 2BNRD 5L2KB 3GJFH 4HK0B 4JM2A 2HKFH 2EEDA 2J5LC 3O2DA 5TH2B 1G9NC 5EU4B 3LDBC 1YEJL 3IFLL 4BFBD 3T77B 2NY0C 4FQCH 1BP3B 12E8H 4BFIA 4P99A 3WS3A 4YPJA 5DA0B 4M8QA 4KMLB 1Y18A 2NR6C 1LNUA 4FXKB 5D7JD 3MV8A 3ZE1E 3DX8A 1GJIA 5DJ0A 2EH8H 4JFPB 4KV5F 5C6TH 5C0CE 2V5RA 4NGHH 1OWRM 4P0DA 5DRNA 3MNWA 3UAJD 3V0VA 4M43H 5EUOF 1A6UL 3ETBF 5IUSA 2FX8L 3R8QA 3STLB 1KEMH 4BZ1H 1OTUC 5DF0A 4PP1C 3VGHA 2A77L 3LHPL 4LLQA 1HIMH 1ORSB 3QIWD 3O81A 4MA7H 3P9LB 4ZMAT 1P9MC 3WJJA 4PJ8C 4P59H 1J8HE 4PY7A 5DJXB 2XG4A 5HVGB 1OSZB 1Y6NR 2ZP0T 5FM4A 4Z7QF 1H5BA 3CFEA 2A6KA 1FHGA 3KPSD 3TT3H 5FM8A 4ORZC 4P5MA 4UT7L 4TVPD 3VWJA 4M7JH 4NOFA 4IOSD 4NQDE 4NWUH 3ROLA 5K9KA 3F58H 4FABH 4YX2L 2YUZA 1NDGA 2LV4A 2Q87A 3GUTB 5HY9A 4OAWB 2F53A 4LPCA 4JANB 3B8SA 1IQWL 1OB1A 4MS8C 3U9UB 4C4KT 4NHCH 1CBVH 1NAMA 2HJLA 3CZFB 1MSPA 3T0EA 3S36H 5JDSB 3KYMB 2DF3A 3RVXD 3KJ6H 4ERSL 3OAUH 4WEBH 3U2SA 1UA6H 1NJ9B 5AYUL 4GMSH 4J3SA 4WI6A 3P0GB 5GRJH 3RWDB 2DQFB 5H37H 3SCMB 2ERJC 1QO3A 2HT4C 1EGJA 4CNIA 1FFPB 1SYSB 1VFAB 4P48A 2VL5A 3U0PA 4PTUA 3IXAB 2MFNA 1M1SA 1XCTA 1K4CB 3IDJA 5IVZA 1N6QH 1U8LA 5ESVA 4JQVC 5F9WC 4OM1L 5MENA 3G6DL 2BVQA 4X6BB 1CR9L 5ERWB 5DYOB 3DOSA 5I1HH 4KRPC 2FLRT 1ZSDA 3H6JA 2HLAB 4I8DA 4LGRB 1WEJL 2XN9A 3B6SB 4WNQA 4ZPVB 3FCTA 3VXRD 1JF5A 3WO4B 2H8PA 1HCFX 5DJ8A 1G6RH 2NY1B 4Y19D 1N4XH 4APQA 4KMTH 3EDJA 1HKLH 2WWKO 5E6ID 5CSZA 1I1FB 3RWCB 3L1OL 5HHMB 3HMXA 5HI3D 3RUGA 4U7MA 1NCNA 1B4JH 1UM5H 3IDGA 4RRPG 4KV5E 5J0BA 4JRYD 2BJMH 3SJVA 4QRPA 1CU4L 3CFCL 1IGTB 2QSCH 3G5YB 4FHBD 4JM2C 4XP5L 3NCEB 5KANG 4DGVL 3DNKA 4FFZH 5EUOE 3U0TB 2IPTH 4OZFA 1MFBL 5H94B 1KJVA 5KVDL 4L8CB 1W0VB 4PJAF 1I8LA 3VRIB 4ONHA 4K7PX 4WHTA 4LEOB 4BSWB 3VXPA 5KBNC 4AEIH 5BW7A 4A6YA 4JRWA 3E3QE 1GGYA 4JY5H 3KJ4B 2BP3A 3ILPB 5GZNC 4Z7QE 5F96H 4RFOL 1XIWA 2XWBB 1AGEB 4JFHE 4M3JA 5BVPL 1SEBB 4XMKL 5DQJB 3W9EB 5AZ2L 4YWGL 1LDSA 5BOPA 4OM0L 4IRSB 4NNYA 5CKAA 5CMAB 5CP3A 5JUEL 4N0UB 2CO6B 2M8XA 4FZ8L 1A22B 2VH5H 4PRID 3M1BA 3WJJC 2EC9T 1ZWIB 2BERA 4HV8A 3HZKA 4LBEA 4TN9A 1G84A 3HRZB 1YEHL 3QPQC 2DJSA 4GW1A 1H5BC 3X13B 3EYSH 1WBXB 4X6DA 3MV9B 1I1AB 1IC5L 2Y07L 4XP9H 1KXTB 2IAMD 3VWJC 2QKIB 3MRDB 1X5JA 2Y7QA 3L3GA 2ICCA 2BNRE 4P2YA 3GMQA 1I7TB 3HE7D 1NGQH 4YHPA 5SX5K 2P8MA 2XYCA 1XGTA 5A1AA 2BSSB 1RUML 3FT4A 4MNHB 1H15B 1AD0A 2CUIA 3RWJB 5J6HB 3H3PH 4G5ZH 3IT8D 1WIPA 3LEVH 2YPKB 4LPYA 5D7IB 2IH1B 1I75A 3OTTA 3O3DA 1TLKA 4TNWK 1G7IA 1P53A 3T0EC 4KJQC 5C09D 5HVWA 5IW1B 5GJTH 2AXFB 5EZOL 1TPXB 4JO2H 1YUHA 1S78C 4YHNA 1B90A 4F7CB 3HZMB 4YR6B 4OGAD 3NCMA 3LMJH 4NN7B 1ZT7A 4JY4B 2A9MH 5EBWA 4R3SA 3EOAA 1OVZA 2EZ0C 3C09C 4U2YA 3MGOA 3REVA 3PNWB 2R2BB 1KCUH 2UY7A 1U3ZA 3HE6D 4AH2A 2H1PL 1NBVL 1AKJB 3HPJA 3MO1B 5E00B 3TIEA 5IMMA 4TVPE 4K7PH 4Y16A 4FA8A 5C8JA 1DQQB 5A40E 3P4LA 3S98A 2YK1L 3V5HB 3SO3B 4L3EB 2NY4D 3V5KB 1GGTA 2JB5H 4FQ1H 3VXOA 5ESQA 1F6LL 3GFUA 1NCCL 5ISZB 3CSYB 3HZVB 1FVDB 5D1XA 4KQ4L 4PJAE 1BM3L 4HC1H 4APQC 4P4KA 4K8RL 4PJDA 5B3NA 3T65A 3RX8A 4XBPB 2AXGB 1R0AL 5EBLB 3CMOL 2NX5A 1MCEA 1XF2A 4H25B 35C8L 1EEZB 4Y4FD 4QRRE 3LKRA 4JFYB 4JKKA 4LSVH 2NZIA 4HUUB 5DD0H 4UV4H 2R69H 5CAYB 2VLJB 5DD1H 2BNQB 4KAQH 4OCYL 2FIKA 1FG2B 3DURA 4NQCD 1I8LC 3DX6B 1FGNH 4HWEH 3O11A 3VW3L 1KTDA 3MRBA 4XVSH 5FV2A 4Z7OF 5BW7C 1P4IH 4IJ3B 2IMMA 1LDPL 3DGGA 4ORGA 4L4TD 4AQOA 3O4LE 2YMXH 5I1IL 3HNSH 1T5XB 2E7CA 1JHKH 1XIWC 1T3FA 4JR9H 1EEYA 1T4KA 3SKOA 5GRUH 4OJFL 4LKCA 3D3VA 4MD0A 3VXRE 2BY2A 2AI0L 1ZMYA 3Q3GB 2R2HB 4YPGA 5TQ0H 5IESL 4XAWL 1D5XB 1OAZL 5FB8A 4JFEA 5B22A 2V2TA 2P8PB 4Y19E 3PQYB 1H3TA 3N1QC 4OV6F 4HUVB 2R9HD 3IJYA 5H2BA 5J7CC 2BHUA 2AABL 2HJKA 3DJ9A 1XF3A 4HFWB 3CVIH 3QIBD 4IRZL 4PRNB 1QFOA 3I84A 5F9OL 5A2LH 4MA8H 2UYLB 4MCYB 4M7KL 5DRWA 5GRZA 4HEME 5IF0A 4WFHE 4YQXH 1I8MB 2YPLA 4Q2ZB 4XC3L 2NTSP 3PDOB 5I2IA 1N3NB 3JBG7 2UWEB 2RAMA 4U3XA 3T2PA 2CIKB 5HGDA 1LEKB 1E4WH 4F57H 2DBJA 1M6OA 1S9VA 3V52H 4QRUA 2NY2B 2BY0A 4MQ7B 4XPGH 4YDLC 1CXHA 3BEVA 2D7QA 4JGMA 3LSOA 5EO1B 4KWUA