3VXSD

The complex between h27-14 tcr and hla-a24 bound to hiv-1 nef134-10(6l) peptide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
204
structure length
204
Chain Sequence
KQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLTSLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVRMDSSYKLIFGSGTRLLVRPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, A-24 alpha chain
total genus 44
structure length 204
sequence length 204
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxsD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxsD02
2FJHA 2BSED 4HMCA 3V5KB 2LU7A 2WQRA 4EDWH 5HGBA 1JHKH 3EOBA 1TITA 4LHUD 4YK4B 1DL7L 2IFGA 5JTWA 5T3ZH 1MWAL 4N0UB 4PGEB 2EXWC 3I3BA 4QO1A 2FATL 2B0SL 3A0OA 3C08L 3PWNB 1KEML 5F1NA 3NBNA 3QIUA 2BHUA 1OGAA 1Q1JH 3OPZL 1ND0A 1Q72L 5FYKH 1X5YA 1XF5A 4F8QA 3FQWA 2B7DT 5E99H 3UCRA 3QNXB 4NRXA 5K93A 3MRIA 4WHYG 1MJ8L 3RVUC 1R0AL 4JO1H 1IAII 1W2KT 3D9AL 5D96C 2DAVA 2XKSA 2QSCL 2HVJA 4JG1H 2FL5A 5IB5B 5KVEH 4XPHH 4LRNH 1DBMH 2AGJL 5GS0H 4HGMA 4RFOH 4Y2DC 4RMTA 2VISB 3BPNC 2X4TA 2AJZA 4ZUUA 1Z9OA 1UJ3C 3VE0B 3IKCA 3UTSB 3RZWA 3TBSA 5MEOA 1JHLL 1HQRB 3QUZC 2IGFH 5EZJB 3SBWA 1F42A 5KG9B 3MV8A 4XXCA 1A7RH 5TFSL 5IWLC 4P2RB 2WBJC 3PP4L 4LLYB 4HZLA 1KB5B 5AZEL 5AAMA 3B2UC 2OSLB 3EGSB 4M93B 5TH2A 4JGJA 1E0OB 4DKAA 5I71C 1A8JH 2R9HD 5HYEA 2N4IA 3H3PL 4L4TD 1B0WA 2KUTA 4X4ME 1U3JA 4ENED 4NN5C 1AR1D 1FGVL 2C1OA 4DGIH 5B22A 3PNWB 4HIIB 3W9EB 4AT6B 1BOYA 2VDRL 2GY5A 3D3VD 2W9EL 3SDCA 4LOUC 5D70H 4P57B 1NFKA 4KY1L 4KGLA 3I6LD 3PHSA 1CXIA 3U1SL 1WBXB 3OAYH 1MWAH 1S9YB 1EGJL 4WGVB 2D3VA 4PJ5A 4GAFB 5D96B 3T0AA 1OSZA 5IB2A 1KJ2L 3CU1A 3IU4L 1FNGB 2R23B 4RQQA 5GS1C 1C08B 4HFWB 1HDMA 1JF6A 3OPZH 1VEOA 5IW3A 3MRLA 3FQXB 3QHFH 3P9WB 4YNYB 3D85A 3MXVL 1HNGA 3E2HC 3GFUA 4S1DD 5HYSG 3ZHKA 4WO4D 4DGYH 1NC4A 3RWJB 2QJDA 4MAUL 1T2JA 1KFAH 1YJDC 5CSBA 4OD3H 2ICES 3TYGL 2DQTL 5ANMA 3T65A 4PJAE 3ZE1F 3NAAL 4OZFH 2B4CC 2R69H 3KYKL 2ESVE 3CH1B 3PIQB 4P2RD 5GGTL 2VN7A 4MZ3A 4UILL 5L0QC 4OQTA 3S7GA 1EEYB 3IKCB 1P4LA 1HWGB 4JE4B 4KWUA 5FV1L 5EZJA 3QFJA 4P3CL 2UYLB 4LCWE 2V5RA 2GTZB 5E8EB 1YN6B 1GGTA 4HF5H 2MKWA 3AUVA 3QEHB 4PBVC 5E8NB 3BVNA 4OCNC 5H35B 4IRSD 5EORH 2NY4D 3QUXB 4Z5RA 3W9DB 1TXKA 3DUSA 4GRWH 3L3DB 3DO7B 1MHEB 1J88A 1WISA 1CT8B 4W6YB 3BH8B 3ARRA 2PTVA 1MQKH 3MRHA 3QQ4A 2FDBP 1FYTD 3CDFA 5I16A 4U0QB 1HHJB 4ONHB 4WI2A 2EIEA 3IF1B 5BOZG 5TDOB 4X8JB 5DHYA 1CDUA 4KKLD 3SDYH 3VWJA 4N0CD 1JK8A 1U8IB 1H0DA 4K8RC 2K7QA 1BIIB 5FYKU 1GCFA 5KAQG 1TCRB 4OQTL 5DVKA 3C2AH 1LVEA 4PJEF 4EDXB 4XXCC 4WW1B 3E6FA 4HS3B 4YH6A 3N85L 1T2QH 4G8GD 3V52L 2YPLA 1WTGT 2BSSA 3IDIB 1J12A 2GK0B 2J2ZA 5IFAL 1PQZA 4OLUH 3FB6B 2FJGB 2VXTL 1XZ0A 4YHLH 3PP3H 3JWNC 4XVJH 2ADGA 3UAJC 1GGBH 1QFHA 1HXMB 4M8QA 4XCYA 2XG4A 3IFNL 5J12C 2EH7L 4BH8B 3WXWH 3FT3B 4Q9RH 3ZE2F 3GBMH 5C0IB 2NPLX 3F6LA 3VXNA 4NHUA 1RK1A 1L9NA 4G7YH 4TRPH 2XY2A 3OMZA 5DSCA 5E4IA 5KOVC 1EO8H 2VLMD 2QKIB 2PETA 2ILLA 1NMAH 4MX7A 2HJFB 1SYVA 1O5DT 5GHWL 4M1CC 4U0RB 3C5JA 4UOW0 5DQJB 1E28B 4Z7WB 4AJ0A 5BMFH 4GXUM 2X4UB 2XZAH 2HTLC 1DVFC 2WAHA 4GRLD 4XNMA 2BOCA 5KZCB 3FHAA 2JCCA 1K4CB 1CD1B 3TBTB 1OSPH 4K3DH 1B2WH 2BNQD 3QAZC 4MSWA 3UJJL 2DKMA 4LCYB 4OF8A 4H25A 5D2NC 4F7MB 2QQNL 1MH5A 5D9SA 3WNPA 3BPOC 3N1GC 4LVOB 1UM5L 2PW2A 1FH5H 3M1BB 1JPFA 2XKNB 3IJYA 1LO2L 3MLZH 3A6OA 4MHHG 5FM5M 5BZWB 4AM0A 2XV6B 5FUZH 4UV7H 4MAYD 4HULB 4QHNB 5F7EL 2EKSA 4ISVA 2ICEB 3QDMB 4RMRA 1YYLL 3VH8B 4Z7UB 2GJJA 4F7TA 3CFDB 5KVDH 1DEDA 4QOKA 2G60H 3NCJL 4S1SL 4EIZC 3W82A 3LDBC 2ZPKH 1BM3L 3TGXA 5DFVD 4FFZL 2XQBH 2OI9B 1FZOA 2QADB 3KPOA 3QG7L 3V4PL 3V6FA 5DZNA 3O6LL 5D7LA 3ARFA 4KTDH 4JN1L 4XBEL 4NNYB 2VXSH 2A9ML 1RIHH 5JORA 4PJAA 3JVGC 1UWXH 4FS0A 4GBXB 4KXZI 2FR4B 1FDLH 5FM5O 5K9JL 2X4UA 5TF1L 4JPVH 5SWSE 1I1FA 1AXTH 4B41A 5BVPL 3MRCA 5CGYD 3KPPA 3TN0A 3NABL 1CD1A 1AIFB 3MRRB 2F53E 2Y6SD 1KJMB 2V17H 1CFSB 3OG4B 4QRPB 3OGCA 4NKMB 3DECA 1JV5A 3FFDB 5B8CC 1U3HA 4JRXA 3TT1H 3PV7A 3LRSB 2NY6B 3ZO0A 5IFHL 4Q6IB 3EYOB 1PZ5A 1UM6L 4HJJL 2EICA 3CCHB 4HQQL 5HI3C 2YN3A 2GHWB 4ZPTB 2WINB 5FYKL 4KJQC 5KW9L 3IKKA 4G3YH 1TZGH 1VFBA 1WBYB 5E03A 1CK0L 4PGDA 3GB7A 1NGXA 1F2QA 1HHIB 2EDQA 3MJ9H 1DFBH 4LCIL 2NY0C 4P49A 1RJZA 4PJHB 1S5IL 4B0MM 4LL9A 5IBUB 4HXAH 3LSOA 4V1DD 5EIQA 5EBLA 5DXWA 1Q0XH 4NSKA 4XGZA 1KTDB 4L4VB 3L3JB 4IIQB 4MAYA 1NANH 2IAMC 3RBGA 3PWVA 3VFUB 5F1OB 4OZHA 2Z4QB 3JV6B 1CICA 4S1SH 5DK2A 2CRZA 3D3VE 1XMWA 3UEZA 5ALBL 4OF5A 4BZYA 2OXGA 4NPYA 4Y19E 5CJBA 3KYMA 5CJOH 5HYFA 1EA9C 2ZSVA 3P11L 3QUYD 3A6CH 1OB1A 2CLRB 2VSDA 1QVOA 1UYWH 3ARPA 3ARQA 3V0WL 4WUKL 3WXVL 2C1OB 2CUMA 4XBGA 3RVXC 1I8KB 1ZA3B 4F7PB 3ULUD 1FDLL 2DICA 1A6UH 4NKMA 1I7ZB 2WUCH 3AU1A 4EKXA 1GPOH 4PLKC 1VDGA 2W07A 2DDQL 4PJBE 3TCLA 4JFDA 2CUIA 4KKNA 1A0QL 1DQMH 5JNYB 2AEPH 5ENWB 5EZIL 3I75B 1FZMB 5ITBL 1Z9SA 4K7PX 4HEPG 4LF3B 4OF6A 3WS3A 3HI6H 5JHDA 1KB5A 2EDFA 1DSFH 1MPAL 1D5XB 3EDEA 4I13B 4P23A 3OR7A 4HV8A 1V5JA 5BCAA 5GRYA 4RGND 5ADPL 2VSCA 3HMXA 3MA7A 3TWCL 2RAMA 1I8LA 5ISZB 3BP7B 5DJ6A 2AABH 4M6OH 1U8MB 2VQ1B 4M7KH 3PDOA 3ORJA 5ACZB 4JFOB 3FB7B 1IE5A 4JN2A 2ZZUT 2DL2A 4Q2ZA 5EBLB 3CFKB 1LK2A 3MUGA 1JE6A 5I1CH 5LXGL 1BLNA 4R97B 1T1ZA 1H5BA 1FV1B 3KLHC 4HH9B 2DMCA 1AO7A 1MFBH 4CW1A 1J10A 4ZFOA 3KJ4B 4NHCL 5CFHA 4M6NL 3MRLB 1ZGLM 3BPCB 2RGSA 4G6KH 4PGCB 2IQ9H 4JANA 1ZK9A 4FTVE 4GBXD 2Q1EA 1EMTH 3T0VA 5FECB 1EIBA 1I1CA 3QUYC 4NUGL 4OGYL 5I6XC 4PJ8C 3TV3H 1C7SA 1P9MC 3BGAA 2YUZA 1OD7A 1EHLL 4QRRD 4Y0GA 4PRPB 3W9DA 3EFDL 5JZ7C 1IZJA 5J06A 1VFAA 4EUPH 4ODBD 1UH2A 1NMBH 3ALWA 1VFOA 4M3KB 4LGSB 1FO0H 4NZUL 2Y4SA 1J1OL 1ZA3A 1X4XA 4AQ1B 5FHBH 1AI1H 5DJAB 3WFDL 2DJ4A 1RPQA 4BM7A 5CEZL 3JV5A 2HKHL 3NFSH 4PJ9C 2APTA 5EOQL 5E8EA 3MQIA 1F58L 1BQHG 1DN0A 1H0DB 4YHZL 1R3LB 1G7MA 1UJ3B 2B2XL 1GGCH 2PCPB 4YQXL 3U46B 2ARWA 5GGUB 3T0DA 4PJIE 2PYFA 2HH0L 1YYMH 3T8XB 2OMBA 32C2A 4HWZA 2B1AH 2Y9RT 3FONB 5EOCL 2J6EH 4J3XA 1I4FB 4ALAH 5IMOB 4PRIA 1NGPL 1DQJB 1S78C 5EIIB 1NANI 4NZTL 5I1HL 4O2FA 3BP7A 3QUML 2X70A 4DN4H 3BWAB 3ABZA 3DUSB 4KGJA 5FV2A 4JQIH 1S7WA 3RPKA 4JREB 3F7YB 5JIPA 3O11B 5ID0B 1GAFL 1EXUA 4WEUD 1N5YH 1ZOXA 4P2OD 5BXFB 3C5ZD 4JPIA 4D9RE 5L7XL 2UV3A 4D94A 5AYQA 3GJFH 4QCIA 5L2KD 3TO4B 1HHGB 3FN9A 4R4FH 4X5LA 1T7ZA 3TFKC 3BQUB 3B5HA 4WW1A 2NY0D 1QFWH 2FLBT 5FUOL 1A6WH 4XBPA 5FM8A 5IM7B 4NYLA 2K9UA 4MDIB 1PG7X 2MQ0A 4UDTB 2LAAA 3EYQD 3UO1H 3U7AA 3WDHA 4WNQB 4QTHB 3F58H 2AK1L 3SE4C 4L1HA 4RZCA 5ISZE 3KYOA 1V3MA 1FCCA 4IRJC 1JTOA 4TSCH 1FG2A 2IG2H 4J3OC 5L2JB 3SDAC 1EHLH 4UMGA 4EI6B 3EW3B 1MCFA 5GPRA 1IEBA 3GKZA 1FYTB 3ARBC 1NGZA 4G6FB 3MREA 3QDJD 2EO1A 3LZFL 1BX2A 4FXGB 4OV6F 1V7MH 5EU4A 3F8UB 3P4MB 3RI5K 1ZANL 3W39A 1CF8L 2SEBB 5D1ZD 4J1UB 4DFHA 5T33H 3I6LE 3FB5A 2HAZA 4I3SH 1CVRA 1S7TB 4GAJL 3KPLA 4X4XB 5MENA 3VI4F 1E28A 1QSED 1F58H 4KROB 2X1WL 3QI9B 2HT2D 1W0WB 3UX9B 3WNOA 1C1EL 2X70B 1NBZA 2XA8L 3QIBB 4IOIB 4X98A 1YEKL 2OP4L 3T1FA 3QG6A 5EU3A 3F7YA 4RX4A 4WFHD 2VR5A 3PHQB 1A5FL 3HZKB 2YZ8A 3O81A 5CIPA 5F8QC 4FQ1H 1A7QH 4LLWA 4HKJB 4HAFA 4XP9L 5GRZA 4Z77A 2Y36H 4GSDH 4IS6B 1DEEA 5FKAB 1E4XL 3MRIB 3LVEA 5B39A 5DJ2A 2BC4B 1C16A 1LO4H 2VOTA 2NNAB 3N1MC 5C0GA 5IESL 2Z91A 4XPAH 3C6LD 2YA1A 4WI6A 3CXDL 2XTJC 5GRWA 1NC2D 1VGKA 2YSSB 3CDGB 3UTQB 4CMHC 4XMLL 3E3QC 4X99A 2E9IA 1WLHA 3G5ZB 1FSKB 3VJ6B 5BW7C 4HIHA 4FFZH 1YC7A 1I1YB 3FOMA 3V4PH 1J0JA 1QBMH 1INDH 5T3ZE 4E41A 3VXPA 1FVDB 2B5IB 1K6QH 1F4HA 2VABA 4NDMA 2YA0A 4NKDB 1F3RB 4TULL 1RUML 2NY4C 5CUSH 3IDNA 4Q0XL 1A9BA 3U4EA 5HVGB 2D2OA 1I3RA 1L0QA 4NJAL 3BRFA 3G08B 4M62H 5GGSY 3DNKA 4ELKA 1UKTA 4BZ2H 2I5YH 1RZ8A 3E6HB 3NFPB 1QSFD 2OJEA 4KKCD 5D1XB 2DF3A 3HZVB 5HHQB 4P2RA 4TSCL 4R3SB 3ZDYE 3PE9A 2OK0L 1RULL 1S9KC 3P73A 3V5HB 4WY7L 1QZ1A 2HMIC 5JOPE 3HI5H 4ODVH 5FHAH 1RQ5A 1LWRA 1W0WA 4Y16A 1SM3L 2DIAA 1Y6MR 2X5PA 4O2CB 1JPSH 4X98B 3NGBB 3GI8H 3PNWA 4HIIA 3W9EA 3GSQB 4D3CH 3TYFB 3O6KL 3DUHA 1F13A 1RZFH 4DGVH 2GJ6D 2YKLH 2AXFB 2DD8H 3MV9D 4R2GC 1WBXA 1J5OL 3X12B 2DQCH 3VU2A 2PUQT 4U31A 5JW4Q 4KUCD 2VMFA 3C5SA 2ICWB 3LEXA 1AGCA 5C0GB 1FVCA 4K07A 4R7DA 1R3KA 3IGAB 4ZPTA 5I15H 3VD4A 5CILH 3UTPE 3KHQA 3JWOC 4U4BA 3L7EB 2D7PA 2H1PH 4FTVD 3TNMB 1I1AD 5IVXB 3ULVL 3LPFA 5EPMA 4Y4HA 4YHML 3DO7A 3RIFK 4BZ1H 4MQ7A 2B39A 5DDHA 1HYSD 1FC1A 3G04A 5HHME 4TSAH 2W0PA 4JFHD 1NFDB 2FHBA 1F4YL 3QFJB 1JMXA 5IMKA 2I9TB 1JN6A 2O5YL 5IOPA 4K8RH 5ESAA 2Z0BA 5IVNA 1CLZL 3P73B 4JFYB 1I8IB 2HWZL 1FZKA 4M6MH 4QRSA 1I9RL 4Y16B 2ZUYA 3KPRE 3WMSA 3WUZA 4FOMA 1D6EA 4WWID 3GIVB 3BD4A 1AGBB 4WV1C 3IETA 3D5OF 4TVPL 1EAPB 2CGRL 2EECA 3BI9X 3BRDA 3BZ4A 5DJ8B 1WUNT 5K9KA 5A43C 4XCYB 3IAPA 3DXAB 4R4NC 4LRIA 1V3LA 3KXFB 1OAQH 2EYSB 3O8XB 4WUUD 4IMLA 2ID5A 1RK1B 1JVKA 3U48A 2AABL 4M6OL 3SQOL 2IANB 4MJID 3U0PA 5BS0D 1UM4H 4MCYA 2VLLB 4MX7B 3RU8H 2JK5A 3OHXB 5D7JD 4MQXC 3C5JB 4Z7WA 2BY0A 5DQJA 3R0MA 3R8BB 1TVBB 3INUL 5J6HA 3OKOB 3ARBB 2CMRL 2GK0A 4MXVE 3L7FB 3RA7L 5DJ6B 2GFBB 4OD1H 1WWWX 3IJSA 4L29A 4Z7OE 5DTFA 1LP9B 1S7RB 1U8QB 5ETUA 3QO0A 4L9DA 3QUZD 4WHTB 4NM4H 2DWEB 5F70A 4OGYH 3O2DL 1RZKC 1X6LA 2OL3B 5EC2B 4KI5F 2CJUH 5IW6B 1T1ZB 2W0FA 3HNSH 3HMWL 4IDLA 2V2TA 3P2TA 1AQDB 4NQSB 2R0WL 2UZIH 2BY2A 2P5WE 3IRPX 5IKCB 5DGQA 5EZOL 2WUBL 4JFHE 4XC1H 5HGDB 5C3LD 3REWB 5DZOA 1H3XA 3K1KC 2IADB 1SYVB 3OXSB 5HHXL 4IRSB 1CGUA 1T4KB 4M61A 3FONA 5F3HA 2EEAA 2IALA 2E27H 4IOFC 4O58L 5EOTA 4PRDA 1RVFL 4ODSL 3TFKD 3BN3B 3UTZA 2EDKA 4L8DB 1QLFA 4UT6H 1A7NL 5HHVH 1FL5B 5MP6H 3DRTA 4FQXB 3ARZA 4F7TB 1Z9MA 2YWZA 3MJ8A 3RDTC 2BY3A 4IM8A 3U30C 3W11D 5LCVH 2WWMD 2WNGA 2FIRT 1T5XA 5FYJL 4XAWL 3VD5A 3PWJB 1MFEL 1MH5B 2OR8A 1IKFL 4LCUA 2EDEA 4KY1H 3FN0L 2RCSL 3QPQC 3GSOA 1IAIH 1D3CA 4NQCD 2XI9A 3U1SH 2V7NB 3VCLB 5E70A 3QISA 2MMXA 2X4PA 3OZ9H 1G0XA 4XHQA 5H8DA 2GT9A 5GRUH 5C9KA 4CVXA 5BS0E 4OLWL 4JFFB 5IB3A 1I4FA 5IMOA 3UDWA 1MRCL 4UT9H 1JI2A 2EKSB 4ISVB 2AV7B 4IDJH 4RMQA 2AJ3B 3MROA 4XP6H 5CJQH 1ZSDA 1YEGH 1DANU 4NP4H 1UXSB 4FFWD 3NAAH 3O4LB 1CGYA 5ID0A 3TF7C 2QHRL 4DCQB 3SE3A 2AXJA 3MV8B 1DZBA 5HD8D 3WIFB 1T1WA 3MRPB 1FNFA 5L88H 4J1UA 3FMGL 4ZUTA 5F7WC 3RIAF 4P4KA 1FL3A 1NGQH 3OXSA 5B21A 4OZIE 2BXZA 3ZDZE 2R0WH 3M45A 5TH2B 2VLJE 2WLYA 1IAKB 2BSTB 1HYRC 2VAJA 3U0TB 1IGFH 4F7EB 1WITA 1U8KB 1UVQA 1MWAA 3STZA 5C09E 2NW2A 3MTRA 3AXLB 3QHZL 3SDCB 5CEZD 1KLFA 3W0WA 3O9WB 5GGQL 1CFSA 3BKMH 1U91B 3V2AR 1LE9A 1DEEB 4WFED 3LEVH 4X6EA 1UCTA 4JO3L 2R15A 3MLRL 4XCEB 2A6KA 3HUJA 1RUKH 5MI0B 3ARUA 3DX9A 3V6ZB 1JGDA 1QR1A 3BPNB 4YGAB 4MB3A 4JAMB 2IPTL 3BGMA 4JFQB 1RK0B 1QKZL 2R56H 3ARGC 5BJTA 1HE7A 2WV3A 2M2DA 2XXCB 4XVSL 4OQTH 4PJ9A 4QRTB 3C09B 4EI5B 4XNZC 4YGVB 5IVXF 1CGXA 4P2QD 3D2UD 3ZKMD 2IF7A 3FT4A 3TA3B 1P1ZB 2EC9U 1DBAH 4NKDA 1IM3A 4FQHB 2JJSA 1N6VA 5IFAH 1CL7I 1KPRB 5KVGH 5EULV 1NCBL 3MBEC 1QYGL 4Z77B 1WT5C 1ZLVK 4WI8A 1RIUH 1BVLA 4JZJA 3ULUC 3UDWC 2DQHL 3D39D 1SJEB 4JZOA 4DTGH 2R2BB 4EOWL 4KHXH 4R7NA 1IC5L 2NNAA 4FNLL 2NY2D 4PB9H 1D5XA 5TE6H 3EJJX 4PD4J 1VGKB 2YSSA 3VFNB 4MB5A 3FQRA 3BVNB 4UB0H 3WO3B 4HLJA 3DXAD 2KKQA 3U7YL 4WI4A 4PV8A 5C6WH 1YPZF 1PKOA 2JCCE 1FVEB 4J3WA 4X6BA 2Q86A 5FK9B 5F96H 3U7WH 2HKFL 3B5TA 2XN9A 5B38B 1JWUB 3EDDA 3PDDA 5BMFL 5BZDA 4PR5A 4JKPH 2P48B 2QADD 4JFPB 4M5YL 1FYTE 4PJBB 1G9MH 2YK1H 4EN3C 1INQB 3QQ4B 3PF2A 3VXTB 2P5WA 2ZCHH 4L8SC 2MPAH 4LCCB 3OJ2C 3JTTA 5EA0L 3ZL4L 2OJEB 2IQAA 5GGQH 2PXYD 3BPCA 1D5MB 5F88B 4K9EL 5EO0A 4N8VA 2UVFA 2IFFL 2QQNH 2YKLL 4JVPA 3F5WB 4QHUA 2D0FA 1BZQK 1ZHBB 4YFEA 3TESA 3CSYB 4I2XB 3CVHL 4QHKJ 4YWGH 5D71H 2IPTH 2APBA 1RUAH 2DI7A 2P5ED 2C3WA 4UT7L 4MAYC 4YPGB 4OCWL 5FGBA 3SQBA 1JWSB 5CEZE 4HMEA 2P47B 5IVOA 4MD4A 4QT5B 1XGQB 5GGTA 1U2CA 3HPJA 1QFUH 4FQHA 3ROOB 4PJDE 3RPIA 3MRJB 2DWDB 4Q2ZB 5B38G 4I3RH 1UZ8A 2NY7L 3N9GH 4L1DA 1P5UA 3X12A 1LHZA 3M8OH 1OT1A 3IDUA 3FFCB 2VO5A 3BE1L 1ADQA 3IAGC 3ARVA 1A9EB 3DWTA 4OZGB 1EUUA 3H9SE 2CDGA 1CFVL 1JJUA 1YEIH 4PLJC 2D7NA 3CSPA 1M7IB 2DQIL 2H8PB 1DVFD 4GRLC 4BKLA 5E9DB 3SDXF 2VXQL 2P8LB 5DMKB 1AGFB 1J8HD 4HD9A 1FORH 5FO8B 2ZKHL 1EVTC 2F74B 3GJFA 1OAKL 4PJ7B 4UIMA 4OB5L 4NOFA 4HZAA 1HOCA 1I3VA 1JNHA 2F53B 1WZ1H 4ZXBD 1HSAA 5I19L 1HIMH 2RBLA 4PRHD 3ECBA 3NFNB 4WO4B 3DYMA 1PVHA 2Y07H 3WHXB 4HGWA 1NLBL 4U1SA 3MGTB 4OFDA 3ARDB 2BRRH 5J3HC 4WW2C 1HHKA 1ES0A 3PP4H 4ODUA 2A9NL 3DUUB 2AJYL 4H0HB 4OI8A 5CEYA 2K7PA 4NZRH 1D9KC 4YHIB 1JTPA 1N7ML 5GJSL 4MNGE 1OAQL 1OWRM 5C09A 4LLMB 1DUYB 1HH9A 5GGVY 2VL5A 4Y5YC 3OKEB 4YDLC 1OPGH 3MRBA 4G7VL 3OXRB 1S7RA 5ETUB 4QOKB 5FA3B 3C6SB 3RPIB 3MJ6A 12E8H 3SCMC 1CR9H 1MJ7L 2Z31A 4KC3B 1XR8B 2WBWB 1BD2B 3DMMC 2QQKH 1CQKA 4MB4A 4ZUSB 4P5MA 4HJ0D 4LGRB 3FRPA 4TPRH 1HKLL 1IGIL 3NZ8A 4CADB 5J1TC 2PW1B 2KZWA 1ZMYA 3LIZL 3MNWA 2NY4B 4KRPC 2YA2A 3MOAL 1NBZB 1NFDF 5FO8A 3C6LC 3TYGH 3V95A 1FYHB 4JHWL 3ZTJH 3LH2H 15C8H 3FRUB 2EXYD 1A3QA 4HIXL 4HJ0C 2EC9T 3QDAA 3SGDH 4I5BA 5E2UH 4L4JA 4P0DA 4U2ZA 3PWLA 1Z5LA 4ZO7A 1D9KA 1NPUA 1IEBB 4S0SD 1XH3B 1IQDA 3LQZB 4JJHA 3QXAA 3UBXI 1A7NH 3NPSC 3DXAE 2D4DA 2BVOA 3OKLB 4ELMB 2WUCL 4NM8L 2NTSP 3WIIL 1S3KL 5JDJA 1PLGL 1G7QB 3DUUA 3DTXA 1T4KA 3QXTA 4X99B 2AEPL 1WWCA 2F53D 2KPNA 4N1HB 4YFLF 5CBEA 1A7OH 5TDPA 1PX4A 2A74B 1KIRB 3QEGL 3MMEB 5FB8B 1IAMA 4EVNA 1QLFB 3BZDA 1JGLH 4QTIH 4KI5C 1NGXB 2FB4H 4IOIA 5E2WL 1FO0A 1G7PB 1WAAF 2ARJA 3ZYZA 3CVIL 2D7OA 4PRPD 1YMME 4GRLA 1BAFH 2ADFL 1F8TH 3QI9C 4GKZA 4OLWH 4QNPF 3MV8E 4I8DA 1NJ9B 4DCQA 2BOBB 3QULA 4AH2B 2ZCLH 3EYFB 5JQ6L 3DETD 4DVBA 2ZG2A 1MUJA 2X4RB 3D25A 4NQUA 3ARDD 2P5EE 4CN1A 2EDDA 3SDXB 2QQKL 4NPYB 3BDYH 1KFAL 1F4WH 3G5ZA 2D9CA 2WP3T 2EC8A 1A3LH 1JP5A 5I1DB 2PN5A 2VIRB 1K4DB 4HS6B 4M9OA 4BFIA 1FRGH 1BEYL 2PO6C 3FRUA 3IDGA 3R0NA 1NCDH 1HH6B 1UZ6F 3O4LA 4NGHL 5AD0B 4ZD3H 1MCWW 2G2RB 3WFZA 1IQDB 5CP3A 1ZLVH 4Y5VC 3CU7A 5MERB 4WTZG 1BD2E 5F89B 1LEKA 1AI1L 2DJUA 4ONGL 2BJML 3D3VB 4S0TD 5TGBB 5FDWA 3AB0B 4BQ8A 4P2RE 4YBQD 4Z0XB 5CZVH 2A73A 5B39G 2PO6B 5I9QB 1JNLH 4GG6F 5BJTB 3IU3B 1FZJA 3VG0L 3G6JF 1QRNE 5GHWH 1MVUB 3RWCA 1KACB 1ZHLA 4ZAKC 1E4XI 3KLSA 4D0BB 2HH0H 3MRDB 2XZAL 3E3QE 4NFDA 4ZO6A 2KQMA 1K2DA 2VDRH 4TQEL 2I9LA 3SCMD 4JFOA 3B9KC 3I6GB 1A6ZA 1IGTA 4L5FL 3S36X 5GS0C 3HG1B 3FB8B 1GIGL 3VXOB 4JZOB 2YD6A 5ABDE 3RVUD 3ZYJA 5J9PB 4Q58C 4PGBB 4PJEB 5L2KA 1S7QA 2E7MA 1IGCH 3MACH 4I77L 4LHJB 1TTUA 4CN4A 5I1GL 5GSVA 4L8BA 4Q9CA 2R9HC 4PJ8D 4NKQB 4HUMB 5M95B 5CS7A 5E8DH 3RHWF 4OD3L 3GIVA 5EUOF 4N9GB 2AS5M 4NJ9H 4YHLL 4YDKH 4LBEA 5JW5A 4MA3A 5GS1A 2YC1A 4D9LL 1N2RA 3AM8C 4NO3B 3NA9L 3THML 1IM3B 5DJAA 2DL9A 1SY6L 5FXCH 3G5YB 4F7CB 2R4RL 1YMMB 3MV7E 1OSZB 3KXFA 5DO2C 4QGTA 5DMYA 1L7IH 1FRGL 1WCBA 4J8RA 1NDMA 2EDTA 2ED7A 5IOPB 3QEQE 3QEQD 2FSEB 5MHSE 3GMRB 2ZUSA 3CX5J 2V5TA 1R6VA 1UJ3A 4OUUA 1G1YA 3MNZB 4X5XA 3VFNA 2GQHA 3I9GL 3KPRB 2YBRA 1TVBA 2QTEA 1ZHLB 2MPAL 5EA0H 2IC2A 1MLCB 1WC7A 2WMPA 4NQEE 4U3CA 4KHTL 3GZKA 2DBLL 5J0BA 1PG7W 2HG5A 3C9NB 1KC5L 4F33A 1JFQH 1CLOL 1G7LA 3BFOA 1OSPL 2XN9B 4N5EC 5HYQA 2H26A 3VXSE 1XGQA 3L5XH 5JDSA 2OTWA 3GKWH 4LASH 4NRZB 2EXYC 5JR1H 2P8PA 1SEBB 4OZIF 4LEOA 2W38A 3QDGA 4FQQB 4JRYD 5IF0B 3BDXA 3MYZA 4PGBA 4PJEA 4P48A 5F88A 3REWA 2CK0L 2X1PA 4N8VB 1QFUL 1G6RA 5FUZL 3BZFB 1JNJA 1FL6B 4FTVB 2HVKA 2O26U 1A3RL 4GRMA 2Z8VC 2CLVB 3NTCL 4GQPH 5F7HA 1IMHC 4HUXB 4E41E 2P45B 3DRTB 1SJXA 1MHEA 5AZEH 3H6JA 1IBGL 3VFWB 3WIHH 4BUGA 4EJ1C 4R0LA 5FA4B 2QSQA 3FCTB 4XVUC 1UWGL 4K94H 2R0ZL 1YDPA 4JM4H 3TIDB 5GGVL 2DIBA 3VXUE 1RD6A 5IG7B 3NIFF 3OV6A 4XP4L 3NCYP 5CUSL 4M6AA 4HX1A 1MLBB 1CXHA 5DS8B 4U6VH 2QHLA 3MSPA 4G8EB 4X6CE 4BZ2L 4MNGB 4YXKH 5J3HD 4WV1A 5DT1L 4H20H 1IAOB 4X80H 3MV8D 3KPRA 5DMGD 1SVZA 1VACB 3MBEA 3FO9A 4HXBL 5F3HB 3CSGA 4U1LB 1PZUB 5DJ0A 4KJQD 2C1PA 2DKUA 5CIPH 3TNNA 3MRKB 3ZSSA 4S1QL 1ZVYA 2F5BH 3WN5C 3SKJL 1BJ1J 2AJXH 4YE4H 4FQXA 1YJDH 2FJGA 3V0WH 5CJ5A 5DUPL 4ZFZA 2X9YA 1F97A 3BAEH 3QWRA 1RFDL 5C0AB 1W8OA 4M8QB 2OR7A 4PRHA 2FEEL 2UWEA 1H8NA 1K8IA 1BD2A 2E9BA 2WWMC 5DRZB 4AEHL 4D3CL 1RU9H 1MIEL 3R1GL 1A64A 1BZ9A 3MLTA 5E6ZA 4YX2L 4PLJD 4NIKB 2ZG1A 3OKDA 1QRNA 5DURB 12E8L 2EDYA 4OAWB 1XGUB 2R2EB 4OLYH 4P2CG 5B8CB 5CEYB 5E6IA 3D87B 5GQBA 3TVMB 5IMMB 1B6DA 3TBWB 4HUVB 4L3EA 4N1EA 1CN4A 3MBXH 3EYUL 2YPKA 3QUKB 4FA8A 2BOCB 1GGIL 3ULVD 2B0SH 5A40E 2QR0A 4FG6C 3W0WB 1WJ3A 1A2YA 4HXAL 3ARGB 4TOYH 3QUXC 1W0YT 1XF1A 1NUNB 1QLRA 3P9MB 3SGJA 1LEGB 5E0QA 5IG7A 3VD9A 4JO1L 4X4YA 4GW5B 2WQ8A 5D9SB 5KSAC 2NY1C 4TUKH 4FQJH 4DK3A 3DGCR 5CHNA 1FNHA 4F2MB 4HIXH 3HZYB 3WN5B 3KJ6H 3RL2A 3O8XD 1TJHH 3BXNB 4OF3A 4XI5C 3DMMD 4OCYL 4PG2A 1RZ7L 3NCFB 1OWWA 5D6DC 1T03H 4YHOH 3LEYH 3TA3D 5HD8C 5E1HB 3V5DA 3RZCD 1U8KA 3SE8H 3PQYA 3PL6C 2DLEA 1FBIH 5JW3H 2D7QA 1LD9B 3VE0A 2X4OB 5E8OB 1X5ZA 5JUEL 4GQ9H 1S9XB 4U7KA 5FYKE 4OGXH 3C8HA 3EOYG 2V17L 4WFFD 1GZQB 3MFFB 4PJ8B 3NH7H 4WEBH 2OZ4A 2HT3D 4NO0B 4OKDA 4TSBH 3VFGL 5I8OH 1A22B 4FXLA 2YRLA 1G84A 5DR5L 5E9DD 3LMJH 4O51A 2G9HB 4OZHE 4QRUA 3OKDB 5CEXA 1XCQB 1XGUA 2R2EA 5EN2A 1HSBA 5I1KH 1TPXC 3U9PL 4M5ZL 5JLZB 2NY5L 5EWIH 3S3SA 3S4SA 4JG0H 5IHBA 1I1FB 3T3ME 2V2XB 4O2EB 2VXUH 2BDNL 3LKRA 1CVSC 2VLKE 3TO4D 3MRRA 3NCBB 4DN4L 3VXMB 1RIVL 3NVQA 4ONFH 4YXHH 1GOGA 4PJBA 4BSJA 3TT3L 4U0RC 4TVPE 1ZS8B 5ADOL 3B5GA 3CVHB 1GOFA 3CZFA 2CDFB 2OQJB 1EGJA 3MRMB 4V2BA 5DRNB 1ZTXL 2R0LH 1DBKH 1WEJL 2D9QB 3UZEA 5A2LH 1YY8A 2P43B 2GCYA 4RA0C 4P2OA 4ERSH 3VG9B 4NRYA 4XNUL 3STBA 3TV3L 5J12B 1YC8A 4NOBA 1KT2A 1RZKH 1T21B 2FHCA 1F3DH 3ALXA 3U30B 4H1LG 2X4NB 1NC4D 4BJLA 1ONQB 2FEDC 4RFNC 1AC0A 5GGSB 3L3HB 3QDJE 5CD3A 4ZTOH 4ONGH 4H88H 3MCKB 3AVEA 3BX7C 1LD9A 1BFOA 2LABA 4LLQA 4YHOL 2WM0A 4FABL 1J0IA 4PJ5D 1A6ZB 1GZQA 4HLZH 2DQUH 2BZDA 4TNVK 2F5AH 3NIDF 3MR9A 2JKXA 1NBYA 2B1HL 4GMSH 5JW3L 1AHWA 4FQIL 3D3VA 2GTWA 5FDWB 5TGBA 5ID1A 5JUEH 4WDIA 4U49A 1ZANH 5F3BA 5CLWA 1UCBH 4CDGC 2B1AL 3PXHA 4K3JL 4DKEL 2EZ0D 4WEBL 3ZKNC 2CH8A 4NZJA 1M7IA 1JIBA 2ESVB 1P69B 5T1LD 2BHZA 3WFBL 5J11C 1JGEA 3ZYOA 4EXPX 3FZUD 3U2SA 4Y4FC 4Y1AA 1NCNA 2WBJA 2CO6B 5K59E 1LP9A 1GAFH 4LVNB 3ZKQD 5EWIL 1JGUL 2EKJA 3RVVD 3S37X 3ROOA 4PJGE 4RISH 2XZCH 5C2BH 4O4YH 3H0TA 4XI5D 5EC2A 4OT1L 5F6IB 4PTTB 5E08H 3D69B 1BPVA 4D0CA 3A67L 1X5FA 3DVIA 2D03L 2EIZB 4YIQA 4PJIF 4U6HA 3TT3H 2ZCKL 1FAIL 2F54D 3CUPA 3ARXA 3WKML 5E8NA 1KJVA 2LTQC 3B6SA 3MBED 3HR5A 1BFVL 4X7EC 1G7IA 1UM6H 3BP4B 2WW8A 1T20B 1WC7B 1WZKA 3DSNA 1NC2A 1DBBL 3D0VA 5E2TL 1CU4L 3OKEA 1FFNA 3OAZK 4IRSC 4IJ3B 4LK4A 3GK8H 4XVJL 4MXQD 3ULVC 3W11C 2YC1B 5DJCA 1BQUA 2E7CA 3DVNB 5ALCH 4OZ4A 1Q0YH 2HT4D 1X4YA 3FT3A 1BLNB 4IBLT 2ERJC 4W4OA 1IGYA 4P3DB 1JFQL 1NMCB 1EJOL 4XP1H 2CRIA 2ICWJ 1X7QA 2JJUA 2CDEB 1GHFL 5ISZD 1I85A 2YUWA 4NN7C 4WUUB 1YN7A 2EZ0C 5F3BB 2XIDA 4POUB 1HHKB 3FTGB 4CVXB 4JHBA 2CLVA 2YPLD 3ZDXF 4D0DA 4EUPG 5EOCH 2XOTA 1YECH 2OBGA 1M71A 1ZT1A 4LKCB 3F7VB 4QHMA 1T7XA 3ARYA 5FKPB 3H7LA 4R0LB 4LNVA 3JTSA 2C26A 4MMXC 5HDOA 2RJMA 5DI8B 2HFEA 4JJ5A 3UJJH 3NTCH 1NEZG 3TIDA 4V1DB 4JGUA 4LSUH 1IT9H 5GGRY 3KDMB 2A77H 1U58A 1NFIA 5EG6C 3HLAB 1RZJH 5D7JC 2P7TB 2FZ3B 2DQHH 2P46B 3SPVB 5JA9A 4WIQA 5HGBB 2HJKB 3MRKA 3T2PA 1F90L 4W6WB 2ZCKH 5T1MA 3P9LB 3MOBL 4R9HA 4JO2L 2JCCB 2YUXA 4DQOH 1EBAA 2E8YA 5C8JB 3WE6A 1KN2L 1BFVH 2IBZX 4JEGB 1ND0B 3OAUL 2CPCA 1Q9OB 5C08D 1TLKA 2HFTA 3GJEB 3H9ZA 2WWKO 3MPCA 1IGYB 2XQBL 5FYLE 4C56A 4YC2C 4L4TE 3O6LH 3MZTA 4P9ML 5HHMD 4HWEL 1RFDH 3U4BH 1ETZB 4MNGA 1L7TL 5IMLB 5IVZB 2NLJA 4Z8FH 1AJ7H 4F58L 3BKJL 4D0DB 2AXGB 4JFFE 5F8RC 3HRZA 5INCA 5I1DA 4HC1L 1GHFH 5KVEL 7FABH 4UQ3A 2HT3C 1J1XL 5CSZB 2HJLB 2FX8L 3TN0B 2X4TB 4FZ8H 4ODHL 3HMXL 4YWGL 3T0WA 2DQCL 2XTJB 3O3BB 1OW0A 4FQ1L 2ZOLB 1F6AB 3G5VA 1HK6A 1VADA 3QZWA 5D7LD 5AG9A 3GSNB 1SJEA 3SDDD 1CLCA 3V6FB 2NY7H 4LLYA 2WIIB 3FB5B 5T1LA 4JZNB 5AWNL 3IU3A 2LVCA 3M17A 2H1PL 1AGDA 4JM2A 3QI9A 4YXLL 1MFDH 2FR4A 4LARH 1S5HA 1I9JH 3BH9B 5E1AB 2N7AA 2DS4A 1TTGA 3ES6B 4NO5A 1UACL 1HHHA 1TJHL 1QRKA 2R29L 4FXKB 3RP1A 5JO5B 3L6FB 1IGTB 1F4YH 1FNEB 1FORL 3GSVB 2J88H 4KI5E 3BN9C 3QUMH 4JN1H 1FNAA 5FKAA 5IBTH 5DD1H 1RIHL 1NCTA 3PWVB 1JPST 2Z4QA 3BWUC 5E2JA 5JW4N 1D7FA 4L4VE 4P46B 2IQAB 4MZ2A 3T0XA 1FNSL 2G9HA 4BELD 5D5ME 3X17A 4HAGA 1I3UA 5TPWH 3PDGA 4UBDD 3VWKA 5KN5B 4NN7B 3NACH 2XTLA 1MCWM 2HT4C 2BNRE 4HIHB 3S98A 4I9WD 1L0YA 4YJZL 1E27A 3C60D 3MRDA 4E42B 5ICZA 3VFOB 3BSZH 4OI7A 1KELH 1K2DB 1H3UA 5KTEH 4NO3A 1A6WL 1BECA 3ARFC 1BMGA 1KCRH 1NEZB 2VDNL 2V5SA 1KCUL 1BQHB 1VADB 1OPGL 4JPWH 1NDMB 2RQ8A 3VXUB 4NC1E 4ODHH 2VDQL 1FZMA 4FZEL 4GW1B 2A6JB 2VDPL 2FJFA 1K8DA 3OAZH 3IDMB 2JELH 2O5ZL 4PV9A 5CZKA 5HDBE 3JWDC 2NY6D 5EBGA 2ORBH 5MEPB 1HCFX 2A6DB 2R2CA 3P4NA 5JLZA 4XCCH 1LDSA 4K3EH 2ZSVB 3SBWC 4XTRD 4HK0A 1ZTXH 1URLA 2VQ1A 1KTKE 5JW5B 4LKXB 4DKFL 1YEGL 1I9JL 1HOCB 4L8SB 1I7ZA 4XMPH 5L8LB 2P8PB 2GIYA 2FECI 3VDCA 4ONHA 1CD0A 5TQ2H 4TSAL 2EDLA 1F00I 1R5WA 3VFMB 5HDBF 2HT2C 1AGCB 4GXVH 2GTWB 3N50A 1T83A 4NQCA 3SDCC 3JV4A 1G6RB 4E9LA 5D7LE 4P2OB 1S7UA 4GSDL 2AXHA 4TTGA 5IK3A 3L7EA 5CCKL 1OP5K 1JGEB 3DI2B 1W72A 2HLFD 3QCTH 5E6YA 3DRQA 4QYOA 5IFJA 4MLIA 2NY3B 4W81A 5BOPA 4IRJD 1J0YA 3QFJD 4JY6B 4XWGL 1BGXH 5BRZD 3WJJA 1SEBA 3TZVC 4EDWL 4KDTC 4JY5H 4WI3A 3DSFL 4F37F 3FN3A 2F8OA 4P5MB 3BMVA 1DN0B 3FO2B 4BFGA 4R26H 3MLRH 1IC7H 4U6HB 3D6GA 1MHHB 1NCCL 4M9PA 4A6YL 2DLIA 5EU6A 1YYML 4WWKB 3GSXB 2XZCL 1FZKB 1MI5A 5C2BL 1Y18B 4ALAL 4B53A 4DGIL 4MJ2A 1OGTA 2IWGA 2LQRA 3HAEG 2X7LA 3FZUC 1LILA 3ROLB 2PYED 2X41A 1TVHB 3QRGH 5KSAA 1S7WB 2D03H 1MCSA 5I1CL 3ZDYF 4RMWA 3LN5B 4X6DA 4B50A 2AEIT 5DJCB 1N6QL 1OT2A 3QCVH 4HKBA 4OD2A 3BP6A 5EBMB 1KYOK 4UTAH 3O0RH 4UIKH 5D6DA 5L9DL 3B9KB 4Z7UF 2GSIA 3UTTA 4NUGH 4HX1B 5JHDD 2AQ2A 5CJ8A 2WWKT 1EK3A 1J1PL 4KZEL 2H9GB 3UP1A 35C8H 1JPFB 4QLRA 5DMIL 3WFEH 4LNRB 1IGFL 3HE7D 2IMMA 4QHNA 1BJ1H 3CPLB 4UILH 3VXSA 3U4AA 3AB0C 4CVZA 5FKPA 1QLEH 1G7PA 3PL6D 4G9FD 3VD3A 1A2YB 2XWBA 4M7LH 4JJ5B 1R3JB 3LEVL 4GKZB 5LGHL 1VHPA 4JRXE 3V4UL 4GUPB 5EUKB 3G6JE 4H1LB 3GJFK 5FCUH 3MREB 2W0FB 5DFTA 5IHLB 3T0EC 9CGTA 4PUBL 4OF0A 2FYYA 3W39B 1SJHB 2V6HA 3BZEB 3D39A 4NWTH 4DUVA 2CDEA 4L5FH 5H37G 4RAVA 1PYWB 5D70L 4OAWA 4JY5L 2X7LB 1T83C 1IT9L 3MCLH 4HCRL 3UTZB 1QBBA 1B0RA 3RJDA 1HI6A 5KSAB 3QFDB 4ZOCA 1CLZH 3O2VH 5IROC 3T1FB 4P9HH 4MA8L 1RUAL 1H8OA 2PTTA 4UOW1 1HH6A 5FDYA 1U8HA 4NUJA 4XH2B 4B7IA 5MHSD 3KPSA 3MFFA 4OLEA 4CL7A 4KK8C 1JV5B 1FYTA 3KLAB 2CUHA 3C2AL 1P2CB 2OYPA 1SMAA 3N9GL 2J8OA 3LS4H 3FO1A 5FUOH 1LO5A 4DZ8B 1EEZA 5INDB 2W1NA 2R4RH 4UAOB 3MV11 3TT1L 2OXHA 5BV7L 2GT9B 3VI3E 4XMLH 1E4JA 4XWOD 4HQQH 2E7LA 2VL4A 4OZFA 4ZTPH 2VZ3A 3HI1B 1LK3L 1QUNA 2AXGA 4Q9QL 2C3GA 2JJVA 4OCSH 2ATPA 2NZ9C 1J0ZA 3N1FC 3WFEL 1R5IA 1U3HC 4HKXA 5TQ0L 4NDMB 5C0CE 3VWJD 4Q0XH 2LV4A 1I3RB 3VFPA 3C5ZA 2RB8A 3OKKA 3GJEA 5HHNB 2CMRH 3CVHA 5IR1A 1I85C 3L3JA 5EZLB 4KTEL 2XZZA 1HIML 5D1XA 1DUZB 4WJ5B 4K9EH 1Q0XL 2AKRB 4OZIB 4GS7C 1RULH 4AL8H 4ZQKB 3HMXH 4Z76A 5I1EH 2GY7B 2R39A 1N6UA 5AUMB 3LKOB 4G8FA 5KANI 4JKKA 4POZD 3SOBH 2Y5EA 2F58L 4YUEH 3MRGA 1OM3H 4F7EA 3BH9A 4K3DL 5DA4A 4GKNA 2BVUA 1A14H 3H3KA 4PP1C 4O2CA 4LPYA 1V05A 2Y36L 3BT2L 2NW2B 3D85D 3PWNA 3ZTNL 4XBGB 4I3RL 2CR3A 2IAMA 4Z9KB 3LS5L 3MCLL 2AXFA 4HCRH 3AU1B 3T3PE 4QRPE 1LE9B 2DQEL 2Q8AH 5HHVL 1P2CA 1CGWA 5IIEB 1QYGH 4YDVA 5DQDL 3MRMA 1MIMH 4JPKL 4P3WA 1PKQA 5I8EB 2ZUVA 4O02L 3QWRD 3I75A 1RURL 5HHQA 2OX5A 2K3TA 3WFCH 3CDYA 5A3ID 3V6OA 4RAUB 1A6PA 5FUCE 1MAMH 3ARFD 2ATPB 3FQTA 3OKMA 3BRGC 5E1AA 4TUJB 4E42A 3WJLC 2XWTA 4ZNEA 3GMOA 3K7UA 4FQXD 2FATH 4RX4D 4OB5H 5IUSA 1CE6B 4HKXB 1IEAA 4PRHE 2I25N 5JDSB 5I19H 1Q1JL 3WO4C 4OKVB 3QG7H 4UNTA 2AJXL 4OCRL 2B8OT 3NACL 5CGYC 5HGGS 1EDQA 1H5BB 4M43H 3QDGB 1NBYB 2VN4A 1A1OA 1AC6A 4MD5A 4U1GC 4P46A 5DC4B 1OP9A 4ODTL 5HDQH 2GKIA 3NOIA 3X3FH 4QGYA 3RZCB 3DV4A 5FECA 4KTYA 3ULSA 4G9FE 4ZSOA 5SX5H 4OTXL 1XR9A 2WP3O 3MUZ1 2OZ4H 3WL9B 3DROB 2VDQH 1FP5A 3T2QA 2VDPH 5ERWA 4U1IB 1T04B 3L3KA 5K9KB 1CR9L 1MJ7H 5BRZE 4Y5VA 1REIA 4R4BB 1BBJB 1NEZA 1T0NA 3ZE0E 1D5IH 2VKWA 4G8GA 2YZ1A 5D1QD 1RZJC 1YQ2A 5IB2B 2ADJA 2YD3A 4IMLB 5HI5D 3O9WD 1UB6B 5FHBL 3BW9A 5CGMA 1XF3A 2AK4B 3QAZB 3ZSTA 1PG7H 4LSVL 4HC1A 2NX5D 4FQCH 2J8UF 2EIZA 2FJFB 4WUUA 4RIRA 3U46A 3ULVH 3D0LA 4NBXB 1R3IL 3PP3K 5F1IA 1BQSA 32C2B 1MIML 1T1XA 1WF5A 1WT5A 2BVPA 4JPKH 3FO9B 4MA7L 5ECJE 1GGCL 4YQXH 5DJ0B 4UBDC 4I18C 4JKWA 3KJ6L 4GAYB 4GXVL 4H5SB 2ENSA 4HCRA 4X6FA 5C0EA 1AHWC 2XACC 1A6VH 2APWA 3QUYA 1Y0LA 2A9MH 4DWHA 4WHTA 1FJ1B 1KIPB 2DLFL 4NC2B 1YEJL 3BN9D 4V1DA 2CJUL 1EGJH 1RAMA 3B8YA 4NM8H 5JIKA 4AZ8A 4AMKL 4YBQC 4RFEA 2WUBH 4JFXA 1YEFH 3X14B 2HYMA 1S8DB 3EYSH 2P7TA 3GSXA 4XWGH 2XPGA 4M43L 1MF2H 3HE7B 4HUKB 5DA0B 1I8MB 2XRAL 5I1JL 5CKGA 1SQ2N 3SJVD 4UDTA 5TDNB 5EB9A 1IC5H 1F11A 4Y4KB 4WWKD 4OSUH 4YZFF 1GPOL 1T04A 3D18B 2I07A 1MFNA 5GGTH 1I1AB 1LEIB 5FYLL 4LOUD 4MQTB 3HAEB 1KIQB 1CFTA 2OL3A 5E5UB 1P53A 1XF4A 4JHZA 1JCKA 3V4VL 4X4YB 2ITCB 5GISL 3EO1B 1VSCA 3IJHB 4ONOA 4WI7A 3MGTA 4G8IB 1M7DA 1A4JA 1NDGA 2VLRB 4RGNE 2IADA 1G9ML 1FIGL 1F4WL 1JI1A 2BCKA 4HF5L 4MXQC 5F1IB 1MI5B 5IB4A 1S5IH 1WFNA 3MACL 2H2SD 3L5IA 3RY6C 3ZL4H 4U6XA 5CBAA 4KKLC 4PRDB 2IH1A 4ZUVA 3X3GH 5CSZA 1TTFA 5D2LF 1QBAA 4YHPA 3PQYB 4NQTA 3QJFA 3PHQA 3LH2L 1PBYA 4ODXB 1RHHB 5BRZB 2ZOLA 3EO0A 4KJWC 4QXUH 4J3VA 4AIXA 1T2XA 3PWJA 1UYWL 3UTTB 3LD8C 4WUKH 1XCTB 3AROA 3F7RA 4ZDHA 1CFNA 5L0QB 3DX8B 3QP3A 2HJFA 4IHOA 2BVQB 3O6FC 4U1HB 3HE7A 3P3YA 3WUWA 1QQDA 1VPOH 2GSGA 3N85H 2AEWA 3I9GH 4ZFOL 1OAYH 4U1GB 1OARH 3V79C 1OD9A 1QSZA 5ESVA 2J1KA 4Y2DB 3R8QA 4FFYH 5I66A 2DBLH 1B0GA 4F8TA 2XTJE 2MOVA 4OFYD 4O9HL 2VRAA 3AREB 1R3JA 3HC3L 3TJEL 5D72L 2CD0A 3BUTA 3KPSB 4UNVA 1OVZA 1MNUL 5C07A 5J1AB 3G5VB 3SEPA 4F7MA 3GMNB 4ZOBA 3QXAB 1AKJB 4YDJB 5LG1A 4M1DL 3C6LB 5KSVB 3RKDD 2Q6WA 5FYLH 4BQ6A 5A1AA 4R3SA 4WFEE 2J6EL 3Q5YA 5F7FA 1UGNA 3QEQA 3WNMA 2QQLH 4M48H 4C83A 3IJYB 3RNKA 2CK0H 1OHQA 4XPTL 4MDJB 1FFOA 1CXFA 2JJTA 3L3IA 3DARA 3QUZA 2JB5L 3HI5L 4ODVL 4N0UA 4TVPD 4PGEA 5CD3B 2CRYA 1I7UB 3HNVH 4HPOH 1ITBB 5F7KC 4LDOB 4P2QB 4EBQH 5I8CA 4G8GE 3BIKB 3QPXH 2C3VA 4OLVL 3BYTA 5T3XL 3WIHL 1NJ9A 5CZXD 3FMGH 3RWHB 4C56D 3ULUF 4TUOB 4X6EB 3GK8L 4JZJB 5SWZA 4K94L 5KOMC 4GW1A 1DUZA 2X4QA 4KHXL 5J56B 5IV2A 1G0DA 4K2UH 3C5SB 1JGDB 3LEXB 4FQXC 4PB9L 5JIIA 4X7TB 5EDXA 1YPZE 3IGAA 3UO1L 1QNZH 1NGYA 1ZE3C 3WUWB 2A6DA 3P4NB 5H2BA 1VB9A 1XGYH 3IRZA 3MV7D 1BOGA 2HKHH 5F1KC 5IJVB 4J2XA 1LNUB 3V7MA 3KWWB 3MRCB 4GJTB 1BWWA 1E27B 1AY1L 4LPTA 5FYKD 4JFEB 3TA3A 3PHOA 4XPGH 5JXEC 2XFXA 5AD0A 5D2LA 3K2MC 5I1IH 5DUPH 1OARL 1S9YA 5E6IC 2P5WB 1U3HB 3RBSA 5C1MB 5T33L 1NFDA 5HDLA 4HJGA 2R56L 5D1ZA 3VXUA 4GAJH 4WJ5A 1JF1A 1QPXA 2APVA 3VRIB 1QFWM 1HNFA 4YBLB 4KK6C 4YIQB 4DFIA 3W5MA 3VA6A 4K71B 4PG2C 3CNKA 3CK0L 3SJVA 4ELME 1S7UB 4K8RL 5DEGA 5AYUH 1IGCL 4I77H 1GSMA 3WDIA 1RMFL 3VGAC 5MEND 5ANMB 3T65B 4QRPD 3DI3B 1FVEA 4OM1L 4X6BB 2NY5C 5FK9A 3HE7C 5HHPA 4HUUB 3JBG7 1C7TA 4KH2A 1WWAX 4Y4HD 4PPTA 4RRPA 3O8XC 3RTQD 4KKAD 5FYJE 2CIIB 2A38A 1JHTA 1Q94B 5KVMC 2GJZB 4XPAL 4IIQA 4MAYB 4PJEE 3FB8A 3VXOA 4HPOL 2BSRB 1RJYA 4HHAB 1P7QB 4FP8L 3RAJL 1BJMA 3TVMC 1ADQL 4Z78B 1HDMB 3UPAA 2YWYA 3O41A 5I17B 4Y4FB 1MEXL 3MYJA 4TUKL 5J8OA 2W60B 1RSFA 2PR4L 1CGTA 3RKPA 1D6VL 4ZXBA 1CQYA 1JPTL 3MLWL 5HHOE 3QUXA 4S1QH 4Z5RB 5FOJA 3KWWA 1EEUA 1R3HA 1NSNH 2DM3A 3IFLL 1VA9A 1JZ2A 1QO3A 4NJAH 4YPGA 4J4PA 4BSWB 3QRFM 3LN5A 4PGJA 2JJTC 2XFXB 1SBSL 3OB8A 2VZOA 2MQ3A 5LAXB 1M1SA 2XICA 3HN3A 3LN9A 1J1XH 3TPUA 2XNAA 5LBSH 2AV1B 3V0AC 4X9GA 5I8KH 5C08B 3ECBB 3NFNA 4WO4A 3MOQA 1WAAA 1CI5A 3MV9B 4HDIA 4OUOA 2GTZA 4CJ0A 4NKIH 2OS7A 4XPGL 4HGWB 5C0JA 2NXZB 3DOSA 2WBJD 4P23B 1B3JA 4LPCA 5BS0A 3BEVB 2IPKB 3NMEA 4JQXA 2VXVL 4JCMA 1PEWA 3SPVA 1HWHB 1IQWH 1N7MH 2DYPA 5A2IH 3QXDA 1FCGA 1KLUB 3GNML 5E24E 4LVHC 5C09B 3WJJC 4RMVA 2R1YB 3O6KH 2M1KA 3TZVA 2YMXL 1PQZB 3TM6A 5HHPB 3CK0H 5J57B 2E27L 2I24N 1N0XH 3K8MA 1UM5H 1UJTA 3C6SA 2EDOA 5MP6L 3QIWB 1FH5L 5HYJB 1DANT 3MGOB 4AIZA 1A6UL 3BPOB 3TJHD 4KV5E 3MRHB 4XP5H 2P5WD 3NCMA 4AENA 4PREB 1IAIM 3B9KA 3ILQD 1PFCA 2J7LA 4ZUSA 3GMLB 3RUGE 5IHZA 3OJVC 4H26B 4RFEB 1HKLH 3RWIA 1NQBA 3B4NA 2COQA 4RAVB 1EFQA 1JWMB 2ZUXA 1PYWA 2X09A 5KSBE 5DD1L 1ES0B 5FF6B 4KMTL 3H2WA 4Y8DC 2G60L 3AS3A 1BFSA 4K7FA 5ELIA 4F3FB 3SE8L 5D2NA 1TFHA 4XTRC 5MI0C 5DD3H 4CUCA 1EZVY 4EN3A 3P0GB 2AJ3A 3MROB 15C8L 4BSWA 1ZGLA 1G9NC 1UXSA 2V7HA 3WLWC 3V0VA 2GK2A 3S97C 5FHAL 3QNXA 2AI0H 3KLAA 4XC3H 2EE3A 5T3ZD 3DYOA 3S88H 3LMJL 4H8WH 1YPZA 3UPRA 5DSCB 3QH3A 3X14A 2H3NA 4NHCH 1TCMA 4FQIH 1PLGH 3T09A 1V7NH 1NCUA 2GJ6E 3BEVA 4DGVL 4RFOL 4Z18A 5JPNB 5IB4B 3DVGB 1A7OL 3LD8B 5TDPB 3QIWD 3DHMA 4O2FB 3T0BA 2CGRH 2IH1B 3O3EA 1MY7A 5GISH 4TTDC 1MFCL 2XWJB 4CKVX 1JUFA 1Q9KB 4WI5A 5K59F 1NMBL 3CH8A 4G80B 5GS2H 2EEDA 1JHLH 3O6MH 4KK9D 5JOPD 4MWFA 1GGYA 4PRHB 1NFDE 3VGHA 2DKSA 4QY8A 3ULVF 5EBWB 3Q0HA 5EUOA 2JLLA 3GBNL 3QULB 2IBBA 1RUPL 1YNTB 2I27N 3UYRH 4QRQA 2RHEA 4R96A 1XF4B 5E2VL 3VXRD 1G0YR 1WEJH 5DVNA 5I9QC 3SKUD 4M1GH 5DO2D 3OKLA 1KGCD 4ELMA 4AYFA 1EEZB 5INDA 2ERJB 3QIBC 5E08L 4Y5YA 3INUH 4HWBH 4OGZA 5E8PA 5DJZA 4PJAB 2X9WA 3DTXB 1KJ3H 3SHSA 4JDVA 1FAIH 4PBXA 1N4XH 4WU7B 1AD0A 1IC4L 3WKMH 2ZOKA 4OFIA 4GKNB 3OKNB 3TC9A 2F19L 4AT6A 4Y2DA 4KMTH 1EFXB 3FFCD 4C4KT 4R8WH 5HI4D 1P1ZA 1U8OA 3AREA 1TZHB 3CDCA 4X7SH 1VPOL 2HWZH 2FIKB 3C8KB 3NN8A 3TBSB 5MEOB 1QOKA 4PJ5B 1LEGA 3BD3A 4M00A 2VUOA 1OOAA 1DQQA 2WSKA 4F15C 5HBBA 3QEGH 4XNQB 1JPGB 5DK3A 4LSSH 1T1YB 3PWUB 4DOHB 1J0HA 43C9B 4Z76B 1HXYA 3BXNA 4FFWC 4OJFL 3TJEH 1F3DJ 4XC3L 4EOWH 4WRLA 5MEPA 4HJJH 4X6CB 2VAAB 3KYKH 2CO7B 2AP2A 4PGDB 4ZAKD 1TDQA 2YD5A 5T1KA 3KNBB 4YBLC 3CH1A 5ESVB 4OFYA 3QG6B 5EU3B 3S9DB 1C5BL 3BD5A 2YXMA 5B38A 1DTUA 1BQLL 3S5LA 1Z2KA 4XX1G 3HE6B 1FGNH 1IGJB 2NYYD 3OGCB 5HI3D 1PGRB 4PRNA 3G9AB 4XGZB 4LQFL 3HG1A 4JKPL 4DVRH 1CFQB 3GMNA 3A67H 4NO0A 3HZMB 43CAA 3PL6A 1V7ML 1WWBX 4LCIH 3DX7A 4OGAC 5F89A 4YLQT 4YHYB 3RA7H 3BAEL 2UY6A 4QRUB 3K4ZA 5L9DH 4RRPG 4HIEB 2XQYG 3EUUA 4ORGB 2Z8SA 2Y5TB 3MJ7A 4G9DA 4ZSOB 3O4OB 4NP4L 4PS4L 1MVUA 3RWCB 5IGXH 1JL8A 4NGHH 4Y1AE 4ZD3L 3VRLE 5K9OB 1PSKL 4D0BA 4LDEB 5IFJB 2Q20A 3CLFH 3H7BA 4LBEB 4JB9H 3IYLW 1NAML 4OGAD 3K8KA 3G5YA 3G08A 4XP9H 4E0RA 3EYUH 1L7IL 3K74B 2VITB 1GGIH 3EDFA 2NTFA 1RVFH 4ODSH 1JNLL 1XF3B 2AK4A 2APXA 3RVTD 2FO4B 4WCYL 1CICB 5DK2B 3OB0K 3V4UH 5IESH 3WJLA 4N0FA 4F57H 1I9IL 2YHGA 1JGVH 1JTTA 4MYWB 5GIRA 3LPWA 5GSVB 4WWKA 3X11A 3V52H 1MCPL 1OCWH 3DMMB 3H9HB 2DYPD 3ALPA 1GC1H 5I1AA 4KI5D 1BOGB 4KQ4H 1OB1B 3S8WA 1LNUA 3GMQB 3QR2A 1ZEAH 2HG5B 2ZNXA 3T3MF 4GT7A 1E6JH 1GL4B 4X6FB 1A7PH 3GJFB 4PJHF 5T5NG 2R1WA 3O45B 1CICD 2EH7H 3HE6A 1RZ7H 3BH8A 2JJWA 1ERNA 3IT8D 2E3VA 3LEYL 4PRNB 1S7VB 1U93A 3O2VL 3RWGA 1WIUA 4MA8H 3TCLB 2I5YL 4M7KL 1WIPA 1NGPH 4ZPVA 5JNYA 4JLRB 2GI7A 4JFXB 5FGBC 1JK8B 1U8IA 3B3IB 2X05A 4L4TA 1LE5B 4JANB 2WK2A 3K0WA 3CC5B 2V2WA 1BZ7A 5FYJD 5D8JH 2BERA 4U6YB 1NAMB 2F15A 1S9VB 5BV7H 4XNMB 4RNRB 5DVOA 2QQQA 5ILTL 1IC1A 4L3CA 3DURA 1IBGH 3SCMB 4NZDA 3GI8L 1KN2H 4P9HC 2WBJB 4U33A 4M02A 3BESR 5ACZA 2NX5A 3FB7A 1I8LC 5H94A 4ZO8A 3VW3L 4DTGL 1UACH 4MSWB 1H3WM 3MLWH 3CFKA 4H25B 1MRFH 1G7JA 1XT5A 4I0PA 4PY7A 3MRFB 5C6TL 1JN6B 1JBJA 1X5HA 2YR3A 4GG8A 4U6VL 1XF2A 4UZGA 3O2WH 3QDMD 3QWOA 5AZ2H 2IPKA 4Z8FL 2E6QA 4P5KB 1IAOA 4OQ1A 2LE9A 5DQ9B 3ZLQC 3ZHDA 3RFZC 1CIDA 4WHCA 4XB8A 3KPTA 4UDUB 3EFFB 1FNLA 3SY0A 1T66D 4V2CB 2B4CL 3O45A 3D18A 5C0AA 5F1NB 2ZSWB 2D0GA 1I1AA 5CGTA 3PWLB 1U8HB 2EDJA 4PG9A 2B5IC 4CN6A 3WLWD 2CSPA 1V8HA 3P4OB 1AE6H 2VXSL 2XQYK 3ARFB 3RKDC 4A6YB 3LRHA 1HKFA 2VR9A 5DRXA 4MGXA 1KPUB 5JPMA 1NDGB 2VLRA 3OHXA 2JK5B 4QXTB 3UYPA 5C07D 4OZFB 1UADC 3N0PB 1KV3A 1N3NB 3WIIH 2UVEA 1RZIA 2GEEA 2L7JA 4WFHE 5FB8A 4XCCL 2EH8H 1PAMA 3KS0H 2VISA 4PP2A 1LO4L 4AEFA 2ARJB 3LKSB 4TVPH 5B4MD 4DQOL 4Z7QE 2FB4L 5TE6L 3BE1H 4X4ZA 5IEKA 3VRJB 3WFBH 2E5EA 4C4KO 2JCCF 1D5ZB 4JPIB 2BOBA 3K2UH 1E4KC 2W0LA 3O6FD 2AERT 3GMLA 5IHZB 3C6LA 1AXSA 1FC2D 1FNSH 4ZS6C 3S35X 1ZLWK 1XF2B 3C87A 1INDL 1CFNB 3DBXB 2DQIH 5JQHC 4OLZL 5AUMA 1S7TA 2OSLA 3EGSA 1K5NB 3U6RA 1VESA 2VUYA 5F7UA 2A6IA 3MJ9L 5D4QA 4ETQA 4LCCC 5I18H 2BMKB 3V7AG 5CKAA 3BKJH 3V5DB 2NCMA 5T3XE 4EN3B 3P9LA 3REVB 1K4DA 1WZ1L 1FBIL 5KTEL 4FRWA 2IEPA 3QCTL 4Q7DA 3MV7B 1RJZB 1RY7B 2V7HB 4PJHA 4EI6A 3DJ9A 4TUOA 4KI1A 2ZUQC 1QSEB 4UU9B 1CDJA 4KMQA 4DKDC 2QSTA 1KTDA 4L4VA 4I9WE 3OL2A 5EU4B 4YDVB 2BC4A 4IRJA 5JHLL 2W65A 4JQXC 3CFEB 5L2KE 3JV6A 3UPRB 4W4OC 4NZRL 2Z91B 4XVTH 1HEZA 3JXAA 2O5XH 3P30H 5I1KL 5IMLA 2WINA 3I02B 5HHXH 3RGVB 1RZFL 5JPNA 3Q5TA 4FFVC 4JDVB 4MXWH 3RWJA 1N3NA 4YEFA 1RUPH 5IJVA 1P4IL 5MENE 2XN9E 4O58H 1EJOH 1QVOB 3RZCC 5T5FL 4UQ3B 4PJ7E 4MHHI 3OKNA 4M1GL 5EU6D 1MAKA 1CCZA 1XIWC 3X13B 1RHFA 1KJ2B 1O0VA 1QA9B 2AJVH 4P59H 2NYYC 4MNHA 2L7UA 1WV7T 1U6AH 5JMRA 3BIKA 3GUTB 2YD4A 2N56A 3FL7A 3PABA 4HG4K 5EBWA 4LEXL 3L95A 5IW1A 4IS6A 4ZXBC 3C09C 3CZFB 4EI5C 2UYLA 4KDVA 3GSNA 5D1ZB 1K6QL 2AJSH 4UV4H 2KDGA 5DVLA 2YRPA 2DLFH 2QLVB 4P4KB 2X89A 4Y5YB 1HXYB 5HJ3B 3OR7B 1HCVA 4HV8B 5DHVA 3PGDA 3SKMA 1KT2B 1T21A 1JYWA 4X6CA 4PJIB 5TPWL 3I2CH 4GG6A 5KS9F 3E8UH 1MREL 3S4SB 3DROA 3FAWA 4Y2DD 1DQDL 2WIMA 3S3JA 3ES6A 5C7XL 3O4LD 1JZ5A 2G75B 3PV6A 1OL0A 4F7PA 2X1XR 3TBYB 3L1OL 1XGPA 5E94B 1XF5B 5KS9B 3ARWA 2IBGA 5GZOC 3QDGE 4K23L 3AAZA 5FO7A 3GMMB 4JDZB 6CGTA 3I3EA 3EDJA 4GMSL 3PL6B 1RZ8B 1UB6A 3E6HA 3NFPA 4HHAA 4Z78A 4R26L 1VERA 3H8NA 5DHYB 5ENWA 4JCLA 2JIXA 4I0KA 4U1KB 4GKSB 2DD8L 2HVJB 4K3JH 2QBWA 5E7FA 5ANME 1JGLL 4NRYB 4QTIL 3EFDH 5JOFA 3PWPB 3GSNL 3KPMA 4N8CL 3MX0A 4JY4B 3HNTL 4M7LT 1CZ8L 4LSTH 5C0RL 4GAYA 5F97E 5IVXE 4ESKA 1T22B 3TYFA 2H26B 5LAXA 4OIAA 3ILPB 5T5FH 2RIKA 5SWZD 5SWZE 3LIZH 4YHMH 2VLME 1ZHNA 4I4WA 4XMPL 1NGWB 1HQ4B 3W2DH 4G42A 1PSKH 4BQ9A 1RZKL 3O41B 1KENH 1YEHH 1QKZH 3PGDB 4NZTH 4HWZB 1MCNA 5D7KD 3QXDB 3QDME 4DOHE 1MCOH 1CDBA 2AJSL 1T20A 1OAZL 4L9LB 4QHLA 5ICXB 4MVBC 1LO3L 3VGFA 4P2YA 1CE1H 1MCBA 4QKXB 4ORZC 4J3UA 3RGHA 1QO3B 3KYNB 2UWEE 2M8XA 5KSAD 1VFUA 1B6UA 1LEIA 1XGPB 1Q0YL 1MCPH 4H8WC 2XNAB 4FMKA 4PJXA 2HA1A 3RWGB 4AENB 1PX3A 4KQ4L 2E7LC 2HLFC 2EYSA 1KTRL 3EAKA 3KPSE 4FFYL 4XNYL 2A0LC 4DKEH 5JXEA 3UXFA 4FG6D 2BHYA 4JM4L 4MCYB 4LGPB 1A7PL 5E2WH 5ESAB 4G8IA 1MQ8A 1QG3A 5EO0B 1WZMA 1PJ9A 1NCCH 4I18B 3JWDH 5D6CA 2VR4A 1DQJA 3ARGD 2C1PB 4OM0L 4TQEH 3SE9H 1NCWH 1B9ZA 1CTOA 1FLRH 3MZGB 1NC2B 4NQEB 4XMKH 3F7VA 1OM3L 1GC1C 4RZCB 4UUJB 4AY0A 1EAPA 3SKJH 3U36B 4Z7OF 3G6JB 2DIJA 5F72S 5JOEA 1MHCA 2DBJA 4OD1L 1GH7A 5I73B 2RR3A 1MHPH 1DLHB 1XEDA 3HLAA 1RZJL 2H3NB 4KXZH 5EU6E 1NBVL 1BEYH 3QWOB 4O02H 1ZLSH 5IQ7H 3VDAA 3QEHA 5JORB 3BQUA 3HNSL 4WU5A 1G6RH 3DLQR 1OGTB 3TVMA 3S34H 5DLML 5DMIH 2GSGB 3VGDA 4J4PD 3EFFA 4WNQA 3F12A 4H0IA 3FJTA 3KPPB 1MAML 3I84A 2H6PA 4MJIA 4UIMB 4X6DB 4J12A 2H2PD 3DVFA 1SBBA 2ORBL 3RVVC 1ZVSA 3QO0B 4XP1L 3BPLB 2L0DA 1UKSA 2F53A 3GM0A 1AKJD 1CYGA 3WS6A 5CSGA 1RJLB 2VE6A 4WTWA 3VG0H 1AY1H 5TDOA 2X89D 25C8H 4Q6IA 4KK5C 3P4OA 4KZDH 4IMKA 2BNRD 1PKQE 4Y88A 5IT2L 4HEME 2FX7L 5I30H 5DFVC 1P7QD 4I18A 3F6IA 4QF1A 5GSRA 1X5KA 1TVDA 1LP9F 4HC1H 5D7IE 2VLRD 1A14L 3OZ9L 5FO9B 1JYNA 1GIGH 3W0WD 2OZ4L 4CVZB 5TE4L 4HK3J 5GRUL 1ZGLP 3LKSA 1OAKH 3KPQA 4NC0B 3WIHA 2VZSA 2DTSA 4OM1H 3VXQA 5IEKB 5C0CA 1MHCB 3RWHA 3HUJF 1YNTA 1MCIA 1F6LL 1AXIB 3D39E 4LCUB 1NUFA 2FEDD 2NY3C 1DLHA 1KTLA 2CR6A 1LO0L 3DBXA 5DRXB 1N64H 1W8NA 4YO0B 3T0ED 1ETZA 2Q8BH 4QEGA 1EHAA 2AJYH 4U1NB 5DUMH 1EHNA 5I2IA 1OF2B 4R4ND 5JA8B 5C9JA 4JM2D 3VJ6A 1HI6B 2ZUQB 1P6AB 3REVA 2Z31C 3U9PH 1NGQL 4GS7B 2DQGH 2R0ZH 5DK0A 1EFXA 4I1NB 1OGAB 2HTLD 3GO1H 3QT2A 3MFGB 3MV01 1ED3A 2XY1A 3N1QC 5GRJH 1N8ZB 1DLFL 5DVMA 2EXWD 4MXVF 5C70A 1AXSB 5J7CC 3IXAB 4AEIH 2PW2B 1U8NB 1UQSB 4XNQA 3V6OE 4AL8L 3O0RL 1DBKL 1QEWA 4QF1B 5GSRB 4XT1C 4K9EC 1CFBA 4FZ8L 4ETQB 1QSFE 2GITB 1DQLH 4BZ1L 5JHLH 3MOAH 4XNUH 5DEZA 1X6NA 3OX8A 1RV6X 3SO5A 3TO2B 3B2VH 5EU5B 1J1PH 1T66C 1DN2A 4JHWH 2O5XL 3AMLA 2FCBA 3C60B 4GRLB 3JVGA 4ZTOL 4BQBA 2KBGA 4CJ1A 4I0CC 5GS3A 3ZDXE 4L4VD 4Y5XC 1M05A 3O3AA 5GS0D 1NBQA 5HHNA 4Z95H 1J86A 1FSKC 2LTQB 3DX7B 4PBWD 3V4VH 2VDOL 1LGVA 5I17A 4ZSOE 4NNYA 1R3IH 3IDMA 4HWNA 4MD0A 3FHQA 4WHYH 5DYOB 4RSVA 5LGHH 4CBPA 4ORGA 4L3ED 3SKMB 3GMPB 4G6AC 3TLRA 1UWGH 3VWKB 5E6ID 4GBXA 3KXFD 3S37L 5SWSA 4PUBH 3DYPA 4LAQH 5HGAB 4HS6A 4BFIB 3LQAL 1AQKL 1QA9A 3PV6B 1P7KB 1E4KA 2FEEI 2BNUA 3G6DL 4H20L 1KPRA 1OAXL 2GAZA 3Q3GA 1T7YA 1P7HL 1F4AA 2I60L 5FM4A 1G7HA 1B90A 4WEMB 1H3VA 4KROC 4LU5H 4Z7NE 1YEFL 1B4JH 5IMKB 2I9TA 2XG5A 2DMBA 4HFWA 3BQUD 2QV2A 2A6JA 2VXQH 5C0JB 2MQCA 2YK1L 1KCLA 3UAJD 2Z8WC 3L1OH 4JVUA 3HPLB 5GIRB 4G6ML 1FZJB 3BDYL 3VXRA 1N59A 1Z3GH 3BSZL 4PJIA 3LPGA 4POZC 3VI4E 4I2XA 5EIIA 4YBHA 1EEQA 5DFWH 3I6KB 4HK0B 4MJIE 4YAQA 4M7JL 2W9DL 3GRWH 5DURD 3D0VB 3IJSB 4L29B 4DEPB 1T22A 3QQ3B 4KJYB 4MD4B 3PJSA 2IMNA 1EEYA 5EU7E 1UZ8B 3LSOB 4IRZL 5D5MF 1AO7E 4G6JH 1U93B 1X5JA 1OAUH 3B2VL 4I0PB 4PY7B 3RUGF 3MUY1 1YY9C 5EZOH 3GRWA 3FFCA 3VFUA 3BKCL 1FAKT 5J9PA 1UWXK 4PRBA 4GKSA 4OCMC 3RZCA 1BIHA 1E4WH 2JB6A 2D31B 4G5ZL 3S5LG 5SWSB 4NYLB 2FD6H 4XWOC 5T1DL 5ICXA 2P8LA 1M6OB 3Q1SL 3MLXL 1EZVX 4PB0H 2RFXA 4LSQH 3PIQA 3AGVA 1KLGA 2OM5A 5C0FB 3MNVA 4KQ3H 3MJ8B 5HSFA 1IC4H 1T6WA 1ACYL 4OD2B 1P9MA 1FG2B 2VDMH 1C5DA 1HHJA 2MHAB 3DX6A 1NGZB 4WWKC 2ZKHH 1HQ4A 1QFOA 3HE6D 3GSOB 2E9WA 1KBGH 2FBJL 4WUUE 2XXMB 5C0NC 3LCYA 3U0WH 4C58B 2NY3D 3DPBA 3NGBC 4Z7NF 5IHUH 1NUDA 1I3GH 5I1LA 4AG4H 4UT9L 2R8SL 4JFFA 3ARBD 3UJIH 4R97C 5IB3B 1QNZL 4RA3A 1M7XA 2XRAH 4LLMA 2W59A 4YAQB 3H3BC 3T4YB 2XTJD 3VFRB 3BO8B 3C9NA 4PTUB 4F33B 4OCXL 5D7JB 1FL5A 1AGFA 1JUFB 1ZSDB 3RGVC 3L3GA 4LIQL 5GGRA 5EH1A 2F5AL 4N0YL 5K33A 2QHRH 5D72H 5DC0A 1T5WA 3VXSD 5E5MA 5L8KB 1OY3B 4HWUA 4V1DE 4XPBL 1XR8A 4JO2H 4HKJA 1T5XB 3MLYL 4GW4B 3CFJB 2EE9A 3SGEI 5I1IL 2EYTA 1KG0B 5I6XB 5B39B 3PGFH 5F7DB 4DEPC 2QQLL 4M48L 4MS8C 5HGHB 3JWOH 3P0YH 4W6XB 2PW1A 4HKZB 4PJFA 3QRGL 3SKOB 1VFMA 5ITFB 3BKCH 1BBDH 4HPYL 2A6IB 2Q87A 2BSTA 3HFMH 1IGIH 2BSSB 3IDIA 1VFAB 5IBLD 3HNVL 1C12B 1I1YA 2Q76B 3FOMB 4NQXA 5L6YL 1R5VA 3RL1B 3X3GL 1CLOH 4EBQL 2H6PB 2IAND 4MJIB 3TBTA 3B2UD 5F1SA 5IQ7L 3QNZA 5T1DH 3QXVA 4LLAA 5DLMH 2FIKA 3NN8B 1G6VK 4H1LA 1D5ZA 4X6CF 4HIJB 4S2SB 2A6KB 3HUJB 3STLB 2ITCA 4RMSA 1WGOA 3K1DA 4IJ3C 4DZ8A 3KPNA 4OBSA 4YK4C 5DS8A 4JAMA 3RAJH 1JPGA 4CADA 1RK0A 4TRPL 2FJHB 3PGCA 1DE4B 1YUHA 1NH6A 1NMAL 3CXHK 3VGGA 1H15B 3MNWB 3RX8A 25C8L 3MMEA 4F57L 3OF6A 2FGWH 1MY5A 4LSVH 2B1HH 4YGVA 4EUPA 2DMKA 2HLAB 1OCWL 4PJGB 3UZVB 5A2JH 1NCBH 1BREA 4S1RH 4XNXL 1ZEAL 3JUZA 1IGJA 2FNBA 4S11A 3VFPB 1K8IB 5CZVL 3UROR 4PJGF 4LCYA 1T0MB 3KR3H 4RBPK 5I74B 3VFVA 5GGVH 3LV3A 1IEHA 3CVIH 2R2BA 1KTLB 5TE4H 5BW7A 3OGOE 1HN1A 3T77B 2CKBH 2FLRT 4JFQA 4PJFB 4J4PC 3M1BA 4I2XE 3U7YH 4ZFFA 3OQ3B 3TBVA 4G9DB 2F58H 3EDKA 4MDIA 1KSRA 2W9LA 1LO2H 3MLZL 4PV8B 4URTB 2VIRA 2JF1A 4QTHA 1GXEA 4DAGH 5LKNA 5EPMB 5D2LE 5L8JB 4JO4H 4Z7UA 3VFOA 2OJZL 1R5IB 2PF6A 5BV7B 3E0GA 3NIDE 4OV5B 3LKQA 3ZZ1A 3G04B 1ED3B 3NPSB 2DQEH 2VYRE 2ZJSH 3I85A 3OKKB 4LAJH 1KCRL 1PZ5B 5DHVH 1KEGH 4NQDB 3RWFA 4GRWB 4XNZB 4DVBB 1KEMH 3T08A 3P40A 4GLRH 2Y06H 3FQXA 1OP3H 4CU7A 4YNYA 4C83B 2C4FT 4UTBL 3KG5A 2PO6A 2OI9C 5A16A 3Q48A 4X7DC 4X6DF 1MJJB 3F5WA 5JOFB 3NA9H 3THMH 4OZFG 5GRXG 5I2IB 2NY6C 1CWVA 4UT7H 3DETC 4NC1C 4GG6E 4BSVA 3GB7B 5CWSA 1LQSR 4KJWD 5E4EB 5AEAA 2QEJA 4DUXA 5EU5A 2XYCA 1EERB 1VKXB 1SBSH 4PJGA 3IU4H 1JWUA 1AXTL 1A1MA 5BVPH 3CAFA 3C60A 4W68A 4LRNL 4KPHH 4PR5B 3RNQB 4Y16C 4QRRA 1U3HD 4JFPA 1BP3B 1MCJA 3FFDA 4M4PA 5SWSD 5FGRA 4I48B 2J3SA 3LV3B 4RGOL 4DGYL 4APQC 4OI9A 3BHBA 5I76A 1C16B 5HTSA 4P99A 2NY2B 3VFMA 2AI0L 3MLSH 1MFAL 2DQTH 4LSPH 1YZZA 5C0BA 3B3IA 1JNNH 3W5NA 4OIBA 3IFOB 4UQ2A 4KK9C 2V2WB 4PRAB 4U1JB 2P44B 1BFTA 3CD4A 4EXKA 3CFCL 2J4WL 2YPVH 3OKOA 2BNRB 3FQTB 4MJ4A 2BXYA 2JJSC 3B43A 4Y4FD 3QIWC 1CE6A 4PP1D 1IEAB 3NCEB 2CXKA 2VABB 4WW2B 4QT5A 4ZAKA 4C55A 1JNHB 2ZP0T 2J5LC 3GIZH 2ADJB 1NGWA 1FGVH 4XCNB 3HZVA 4UINH 2UUDH 3UYRL 5I8OL 3BDBA 3RVXD 3SJVE 3L5WA 4FP8H 3WS3B 1MCRA 3DSFH 1SY6H 5GRVK 1NEUA 2D0HA 4X8XA 5I75C 3E6FB 3UC0H 3GMPA 4GH7B 4X0KB 4GLRI 1KJ3L 2YPLB 3DIFA 4L9LA 4U6TA 3ROLA 1DUYA 3O4OC 3L5HA 1TVHA 2MWCA 4R0LC 4WFGD 3A6CL 3WLBA 3O4LE 3FB6A 1UXWA 3OB0H 4P9MH 5C0DA 4GAGH 3IFLH 1NSNL 4OFKA 2A83B 2EYRA 5EFIA 1P7KA 5I73C 1Y0LB 4QXGL 3ZKXC 1FJ1A 3G6JA 1Z3GL 2VZTA 3T4AB 4YHYC 1Q94A 3Q3GB 1CDYA 4JFDD 4MJ6B 4G8GB 1KB5L 1UH4A 3X3FL 5HXMA 5C08E 3QCVL 5I76B 4NHUB 1P7QA 5IP4A 2FX8H 5IF0A 2P49B 4MNQB 5JR1L 1DQML 3MYJB 5JHDB 1E6OH 1YJDL 2IH3A 1NKRA 2D31A 1FL6A 4U1JA 4ZYKB 2Y72A 4G6JL 5D6CB 4LNRA 5DZLA 3I50H 1RZIB 5IVXA 2YN5A 2AQ3A 3IVKA 4Y4KA 3VXME 3TWCH 4NQEA 3GI9H 3NZHH 2VL5B 1G7LB 3VFWA 3MNVB 1MIEH 1G9EA 3B9EA 5SX5K 3AY4C 5FA3A 4JN2B 2J8HA 1C5BH 3E1F1 4EI5D 3GHBH 1WBZB 1T7WA 1C5DB 1BQLH 4C56E 4JFFD 2V5YA 4BH8A 3UTSE 4GRWE 4PJFF 1GZPA 2JELL 2O5ZH 5LXGH 4YFDB 3MBXL 3H9SD 3CMGA 3LB6D 1XIWD 4PRBB 2PCPA 4K3EL 1DBJL 1S9WB 2BCKB 1HYSC 3BEWA 3V5KA 2AGJH 1VACA 5DJXA 5KSBB 1INEL 1SYSA 1K5NA 1G7IB 3BP4A 4FFVD 2J88L 4U6XB 1L9MA 3GHEL 3L3OA 3BO8A 4PTUA 5I0ZA 1P84K 1PD6A 2HTKD 1MWAB 3U83A 3BKYH 5HYJE 3QYCA 4X7SL 3E8UL 2PYEB 3LKNB 5E5MB 3MV7A 5LWYH 4X7CC 1Z9LA 3SO3C 3SGKA 4CVWA 5E5RB 5JQ6H 4N0CC 3K4DA 3O8XA 4ETYA 4CAGA 3TVMD 3PWPD 4OFVA