3VXTA

T36-5 tcr specific for hla-a24-nef134-10
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
199
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLWGTYNQGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T36-5 TCR alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 199
sequence length 199
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxtA02
1IGIL 2UYLA 1N6VA 4V1DA 4DGIH 4HLJA 4I0PC 5E6YA 3GSQB 3U83A 1HHIA 3I6GA 2MOVA 1ED3A 2UY6A 2W9EH 2VDPL 1NKOA 1MAKA 4ONHA 2V5MA 3G6AB 4MS8D 5E5MB 3DX9B 2X89D 1FG2B 4OFPA 1QBBA 4JCLA 1A0QH 3W2DH 3LPWA 5I1KH 1ZA6B 3HAEG 3MA9H 3MV9B 2ZP0T 5EO1A 5HHVL 5DTFB 1I7RA 3WKML 1W72H 5D96C 4YDLC 3MXVL 3F7PC 5E00B 1UB6A 4NJ9H 1LO2H 4O2CB 5EU6E 2X4TB 1A14H 4OF7A 1KUMA 2DJUA 1WIPA 1UJ3C 2BJML 2F5AH 3G5ZA 1G7LB 4ZYKB 5DT1H 5DJ8B 4LGSB 3RWJB 3ZHKA 4RZCB 1P4LA 2CPCA 2H8PA 1F97A 4JDTL 2EDLA 2CIIA 4O58L 4YHNB 3MV7D 4OGZA 2WMPA 3T4YB 5JMOC 3LKQA 5DEFB 2GJZA 2P7TB 4EN3B 3S96B 3QUMH 3QI9D 1EK3A 1CZ8H 4HDIB 1MJJB 1U3YA 3DROA 2P43B 1DL7L 2J4WH 3CSYB 1WFOA 3D6GA 4MHHG 1ZGLB 1CFNB 1IFHL 4QHMA 1W0VB 5I66A 5E9DB 1N0LA 4OD1H 4Y2OA 3SDCD 2MKLC 4LSVH 4WCYH 4XNQB 2HVKA 1B4JH 1DBKH 4NHUA 4V1DB 4X6FB 1KELH 4JFFE 5I8OH 1T22A 4CN1A 3QFDB 5H94A 4ELKB 2HFGL 3DGGA 3OB8A 4N8VB 4YXKL 4NGHL 3VXSD 5HYJA 4HPYL 1MHEB 3V7AG 2WANA 4PGDA 3F65A 3EGSA 1I9RL 4P23D 1F4YL 4PP1D 2ADFL 1W72B 4PJ7A 2VSDA 3FONA 4PJXF 5EO1B 3D5OF 3GHEH 4PRAB 3ZTNH 3HA0A 5C0AA 1UC6A 4PRIA 3UJJH 2A77L 3VD7A 3VWJB 3GMLA 3HZMA 5GGQL 2GTZB 2X10A 3O3DA 4PJBA 3RVUD 5T1LD 4DN4H 2ZUXA 4LLWA 3N9GH 4ZO9A 5ADPL 1NAKH 2WWMD 3UTPE 4O5LL 4LMQE 2Q86B 2VWEE 9CGTA 4ZO8A 4NZRH 3VDAA 3F8UB 4PJXE 2H8PB 1L6XA 3WNPA 4BKLA 4XH2B 4KTEL 1G9ML 3CVIL 1EFQA 4EDWL 3TF7C 3U30C 5FUCC 4TOYH 4YUEL 1R3JB 1T03H 2NW2B 2GJZB 1IILE 3ARVA 3V6ZA 4UAOC 3PHQB 4IS6A 4YNYA 1KXVC 1BQSA 4Y89A 4LSTH 1SY6H 5I2IB 4ODHL 5FUZL 3AB0C 1KTDA 4NNYA 4XNMB 3EOTH 4G7YL 4NCDA 2ZCHL 4X4XB 4LVNC 3RVXD 2ENYA 4QHKI 5JW3H 2NY7H 4NHUB 4O51A 3UZEA 1YN7B 3EDEA 3THML 4BH8A 4PJ8D 2DQJL 4P5TD 2AQ1A 3S35H 2GSIB 3VXRB 5H94B 1NBVH 4MVBD 3ARXA 3HZKA 1JWUA 4YQXH 1D9KD 1S7UA 4Z7VA 1H3WM 2VXTH 4BZYA 5D4QA 5JR1H 4NO2A 3EGSB 1ZLWH 3BUYB 1G1YA 1JPFA 4X9IA 3WDIA 5E08L 2ADJB 4MXQC 4IDJL 4MLIA 2JE8A 3OKKB 3FONB 5D7LE 3H9HA 3VXSE 1KTKE 3HRZA 2VIRA 3PGFH 5FCSH 3IDGA 4I0PD 2IAMB 3O0RL 3V6OA 2FBOJ 1NFDB 2AQ2A 3GMLB 1CGVA 4H20H 1V3JA 1MCKA 4YHKH 1T6VN 2GJ6A 3OF6A 4AEFA 4F15C 3BYYA 3D2UD 5JNYB 4Y19A 2OJZL 4G9DA 5EA0L 3J8F7 1GPOL 1N59B 3UC0H 5KJRL 1UQSA 4YR6B 4DQOL 3LOWA 4CADA 3OXSB 4LLQB 3WDHA 4M02A 1MCIA 2XNAA 1VFOA 3UDWA 1J10A 4JHWH 1FRGH 3MREA 1I9IH 1KCVH 3V6ZB 1VGKB 4RISH 4JHBA 4AYFA 4RSVA 4M00A 3WHE1 3TZVC 4W68A 4X4ZA 1FIGL 4LU5L 3PP4L 1NLBL 3KPTA 4HKBA 2VLKE 4J6RL 4DW2L 1IGIH 5C0NC 5E4EC 1U3ZA 1UVQA 3BGAA 4GLRH 4WW2C 1N4XH 2BHUA 3ULVH 2XZCL 1A4JA 4HIEB 3UTQA 1RJYB 4OD2B 2VDPH 4BH8B 1DVFB 4YDIL 5CEZL 4C83A 1FZJB 4L9LC 3HZKB 1LK2B 1QBML 4NFDA 3I9GL 2A6IA 3STZB 3PXHA 4ELMB 3MJ7A 4BZ1L 3C60C 3N1PC 1DQJA 1KSRA 5HHVH 3WKMH 1BQHB 3HCVA 3MXVH 3SGKA 1WLHA 5ESQA 3HRZB 3BSZL 3QWQB 1KEGL 2OL3A 3ZSSA 5C09B 2X4OB 3U4AA 2Y5TA 1JFQL 3MA7B 1DQMH 1OGAE 4UDUB 5GISL 5ANMB 3BI9X 2DQIL 4PGEA 1FNGB 2E8YA 3MV8A 2ARWA 4G9DB 1S7QA 4JDTH 3SDAB 4O58H 5CMAA 2ZSVB 4CADB 3ARDC 1VFAB 2APTA 2YD1A 4PY7B 4RRPA 4M8QA 4HUWA 2V9TA 1KJVA 5DHXB 4GMTH 2E7BA 2JJVA 2A38A 2NY6C 4QXGL 1JI1A 3I6KB 1H3TA 2I9LA 4HIIB 4YBQC 1U2CA 1P7KB 3ZDZF 1LEIB 2ZOLA 3BQUA 3HUJB 5HGHA 5L6YL 3ILPA 3BH8A 1FZOA 3CDGA 2BY1A 1PKQA 4LK4A 3BH9A 4NQED 4HKBB 3QNYA 4RGMC 1NGZB 4KDTC 2Y7QA 1X5YA 3SKOA 2ARJA 4P4KC 1DDHA 4BFBD 2CLVA 2QHRL 1A4JB 3RA7L 2HFGH 5LBSH 3GSRB 4OJFL 1ZTXH 3G08A 3ZDZE 2HJFA 3DVIA 4GAJH 5C0BA 3HPLB 3NA9L 1T3FB 1CD0A 1IGMH 1F8TL 1L9NA 1XR9A 3NOIA 1I9RH 3QRFM 4RDQG 3FRPA 1F4YH 1LO5A 2A6IB 3EOBB 1FP5A 5D7SL 2AJYH 2QADB 3V6FA 5EC2B 1SJEB 1MWAA 1JUFA 4YH6A 3QJHB 5H2BB 2A77H 3GIZL 4AL8L 5ESQB 1DBAL 5LKNA 1FL5B 5ADPH 4MCZA 4X98B 4O5LH 4XP4L 1WWCA 1FL6B 5GJTL 1FYTB 4AG4L 2CGRL 2N56A 1U3JA 4JCMA 4PJFF 3VXQB 2DBJA 1NCTA 2DYPB 3MNWA 1R3HA 4CMMB 3PDGA 1HHKA 3IXTA 1MFCL 4GAFB 1JGLL 1X5IA 3HLAA 3OJMB 5MHSD 1KG0A 1DUYB 2CIKB 3FOLB 3QDAA 4MXQD 3K4ZA 4LVHB 4OKVB 4FABL 3INUL 1KJVB 5EG6C 5JO5B 3KJ6L 4HK3J 2PUQT 2ZZUT 2AV1B 1K4CB 1QFUL 4ODHH 5FUZH 4PJFE 5FGCB 2ZOLB 5J1SC 5HGHB 4G7YH 1YDPA 2I07A 2ZCHH 4EN3C 4FA8A 5DDHA 5T33H 1SBBA 3TFKC 2V17H 2O5ZL 1AGCA 1J1OH 3THMH 1S9WA 2DQJH 3ARGA 4O2FA 1DDHB 1PZUB 3AAZB 4NQEE 5D9SA 43C9A 4G8GD 1S8DB 1HSBA 1VKXB 1OOAA 7CGTA 1WAAF 3TZVD 3ZDYF 2XY1A 2Q7YB 3FQWB 1XR9B 2PYED 4Y8AA 1Z9SA 1JRHL 5E08H 1KB9K 4LP4A 5IHZA 2ATPA 4LP5A 5ITBL 4RGNB 4BELD 5C0ND 5F1OB 2CMRL 5CHNA 5ALCL 4ODSL 5HVHC 4C59B 2AP2A 2ICWB 3ZKXC 2NY3B 4BZ2L 4Y2DA 3V5DB 3I50L 1KJ2L 1WAAE 5KTEL 4AQ1B 4U1KB 1F3DJ 2VDMH 2C4FU 1T2QH 5EA0H 5KJRH 1GPOH 3IJYB 3P0YL 4DQOH 3MNWB 2YWYA 3GJEB 1F4AA 3T8XB 1J8HD 5EU3A 3IXTB 3VWJC 3C60D 4R6UA 2VAJA 3EO9H 1IE5A 3HLAB 2G9HB 1ODAA 3I6LD 4JZOB 1G7HA 1FFOA 4I77H 3ZYIA 1ZWIB 5M7QA 5T1KA 2LV4A 4LU5H 1JMZA 5F9JA 1OQOA 5EUKB 5IB3A 5J7CC 3QDJA 3IVKB 1XH3B 1UWGH 1H9VA 2YUVA 4DW2H 3MJ8B 2JIXB 3GMRA 1FFQA 1M05A 3KGRA 1A7RL 3RWIA 2BNQD 3H3BC 2ZUQB 4UUJB 2XZCH 3TA3B 2ITDA 4P2QD 3ARDD 3VXMD 5L8KB 4M5ZH 4L8CA 4ZTPL 2FX9L 4F57L 5E8PA 5CSZA 3TYGH 1NUGA 4R4NC 5E8DH 5D9SB 1E6OL 3OMZA 3V2AR 2NY6D 4JKLA 43C9B 5FDWA 5GSVB 1QBMH 3G5XA 4YBQD 3P77A 3I9GH 3FO1A 3PQYA 5GGVY 3S4SB 4XMLL 4GKZB 4JO4L 5E70A 4MNQD 4P4RA 4P5MB 1ZGLM 2XFXA 4WW2F 4BZ1H 2YK1H 1JZ6A 3SE8H 4OLXL 1AGBB 1K2DB 5HY9B 3O6FB 4GRWH 4G8GE 1UWEL 5EO0A 5HYFA 4JFHE 2EKSA 4U1GC 1A6VH 4L4VA 2B4CL 5CEXB 2VXUL 3BSZH 1X7QA 4P4KD 2H26A 3SE4A 3PL6D 4OCSL 1JTPA 2PYEE 4WRLA 1PYWB 1E4WL 1JFQH 1XMWA 4KV5F 2VN4A 4WO4A 4WNQB 2BXYA 1EMTH 4Z7UF 3C2SA 4X7TA 2CK2A 3CFDB 4OZ4B 1TTUA 2IAMC 3GGWB 5SWSA 4W4OC 2MHAA 4KUCF 5EU3B 4QCIA 3QA3A 2OQJA 1MOEA 2ICES 3RWEB 3QCTL 4KV5E 2R2BB 1MIEL 5I9QB 4G6JL 4QF1B 1FPTL 2DM2A 4QXGH 1G7HB 1RZKH 3A6CH 3QCVL 1J8HE 4Z7UE 5LGJA 3ZYOA 4IHOA 2R69L 3MV9D 3DARA 3I6LE 3VXNA 2P8PA 5IHBA 4R7NA 4MJIE 4JFDB 3RWIB 3KS0H 4L8CB 1K8IB 1DP0A 4LHUG 1WZMA 4OJFH 3MLZL 1MCHA 2EYTB 3KR3L 2QSVA 2AAVA 2GT9A 2DQGL 3NA9H 5D5MB 2BNQE 2X4UB 3QIBA 5HBBA 1F8TH 5EULV 4P2QE 3VXME 2Y06L 4GRWB 5D7SH 4OFDA 2FJFA 4OZGF 4ZOEA 4EN3D 1ETZB 2LFGA 1G7IB 3OZ9L 1T1XB 1KLUA 3WIHL 3GIZH 4AL8H 3NCCB 1DBAH 4MNQE 2YRZA 3GJFH 1UM6L 2AJZA 1T21B 4XP4H 4WO4B 5A2IH 5C08A 5E9DD 5DJZA 2CGRH 2VE6B 1G7PA 3H0TA 5I71C 4OZGE 1JRHI 5J6HA 4V1DD 1HHJA 2AK4A 4XAWL 4W81A 4X7FC 3UZQA 5SWSB 4BQ9A 5GGTL 1BJ1J 2E7HA 3CH1B 3INUH 5DFTA 4JN2B 1YNTB 1QA9A 1Z3GL 3VE0A 3KJ6H 3CFKA 4PGZA 1S7SB 5IMKA 1TETH 3ELAT 2UZIL 3SDAC 2YD2A 3LHPL 2VZUA 4IHOB 2P8MA 3BVNB 3KG5A 2F8OA 2NLJA 2PF6A 1ES0A 3VWJD 2ADIA 1MH5A 2DMCA 2O5ZH 1WFNA 2A6JA 4APQA 3MV9E 2AEQL 4JRYA 3U48A 3MUGA 3V0WL 4PR5B 4FMFA 3I75B 2GSGA 2YR3A 4ORGB 3B3IB 3EYFA 2J1KA 3EW3B 5ITBH 2CMRH 5ALCH 3ZZ1A 1BZQK 4ODSH 4JGUA 2AXFA 2FJGB 1KLUB 3GJFB 4PJIA 3JWNC 5CBAA 4HK0B 4X9BA 4BZ2H 2YD8A 5EU5B 1KJ2H 1T66C 5KTEH 5JHDA 4MZ2A 2XWTA 3VI3F 4ONFL 4Y4HA 4R4ND 2QADC 1TMCB 2WINA 5DJZB 3QB7C 1RURL 3P0YH 4H5SA 3SBWC 5L88L 1HINH 2I9TB 1FYHB 4FNLL 1NPUA 3BZFB 3IJSA 3SGKC 1FO0L 1MQKL 2AK4B 3KPRA 2BDNL 2ZG1A 5AZ2L 4ZOBA 3VXRD 3LEYL 1RMFH 5HYJD 2OSLA 1NC4B 3VI3E 3VFRA 2YRLA 4ZUUB 3SDYL 2ADGA 1LO0L 2Z9TA 3IKCB 5HDBF 3T0EA 1PD6A 3CGTA 4LEOB 3PGDB 4H8WH 4EUPA 2MMXA 3D69B 5MEOB 4L4JA 4YGAB 4LVHC 1A7RH 1MPAL 2J8HA 2IAMD 1LO3L 4PRID 5I73B 1U58A 1ES0B 4ZTPH 2ADIB 2P24B 2FX9H 3PF2A 1U8QA 4WDIA 2V2XB 1AP2A 1G6VK 4HJJL 1G7QB 4AM0A 1BGXL 3IDJA 4XX1E 4RQQA 5E1AB 2YPKA 5GS2H 5HDBE 4AH2B 5A2LH 4KJQC 1EJOL 1EZVX 4NQCB 4JO4H 4XMLH 2DAVA 4EI5A 5HYSG 1NEZA 5JIIA 1AH1A 3E6FA 5FYJL 1UWEH 3LVEA 3D0VB 1NCCH 1PAMA 2B4CH 2VXUH 4Y5XB 4ZS7L 3WFBL 4OCRH 1KJ2B 1MIMH 4XC3L 5HPOA 4UIMB 2WLZA 3WLBA 5JHDB 1T1YB 5F7NC 1A7BA 5JIKA 3FOMA 4PB0L 3SKJL 4RGNC 3U4EA 4O02L 3MODL 5HSFA 1AFVL 4QEGA 3S5LG 2J5LC 1EERB 5IKCB 3GMMA 3DNKA 4JM2A 5DK0A 2NY3C 5CJOH 4OUOA 2CKBL 1CL7L 2YWZA 3QCTH 2DIAA 1MIEH 4DAGL 5JW4R 4G6JH 4JGJA 3TBVB 1JNNL 4LHUB 5KANG 3QCVH 5DD5L 3SHSA 5B38A 2O61B 4GAGL 2OSLB 1G9MC 1IQDB 1HXYB 2R69H 1Z0MA 2ADGB 5C0DB 1JCKA 4FXKB 1YNKL 1NFDF 3VXRE 2Q1EA 1OY3B 3T0EB 3QDGB 1ERNA 1M6OB 3N1GC 3QBTB 5D2LB 3RFZC 5IBTL 5TH2B 1HZHH 5IOPB 1AGEA 3WSQH 4PTUB 4RMQA 3MRNB 4PP2B 4U1HB 2VKXA 3CCHB 4ZD3L 5C09D 1XGYL 1TENA 1IC1A 1QRNA 5JZ7C 3MLZH 4J1UA 4F3FB 3B9KA 3FFCB 3KR3H 3B9DA 4JQIH 3WDJA 3QFJA 1TTGA 3O3BA 1MAMH 2IC2A 3TCLB 4RQQB 5A3IC 1NFDE 2Y06H 3SDAD 2OTWB 2ZUQC 3VJ6A 3TA3C 4EI5B 3WIHA 3E6HB 1T4KA 3MLSL 3ARGC 3OZ9H 4HFUL 2Z35A 4PY8I 5EBWA 5C0JB 4LLVA 4JG1L 3D0LA 4B5EA 5MP6L 2OXGA 1YA5A 1TVBA 3IU3B 4HS3A 2MQCA 4HV8B 4ERSH 1C12B 5HHOA 1HHHA 3MRQB 3O6FC 4MNGB 2CDFA 4FQQB 4U49A 5GGTA 4GS7B 1EXUA 3BRGC 3T1FA 1KB5A 5J9PA 2XWBB 4JR9L 5IFHL 4WEBL 4MYWB 3BKJL 3EJYC 4JM2B 4KVNL 3I2CH 1A9BA 5DK0B 4Y2DC 4AQOA 4LPYA 2OXHA 4XPFL 4ELMF 4RAUB 1S9VB 5TQ2L 4ZMAT 1HILA 2UZIH 1T66D 3LHPH 1QLRB 3QG7H 3WV0A 3F7YA 4K9EL 2NY4C 2NTSP 2QADD 4OV5B 3GBLA 1JZ4A 1SYVB 4RIRA 1KTLA 4BQCA 1H15A 4I9WD 1I3RA 5I9QC 5A2FA 1DQTA 1OW0A 2E7MA 3IFNL 3JVGC 2AEQH 4LFHD 5IVOA 4ELME 3V0WH 3A6OA 2PYFB 3AS1A 1FYTD 1QRNB 5GJSH 4J1UB 5DGRA 4UBDC 2DYPD 1RV6X 5C09E 4MDIB 4JANB 1T89C 1TJGL 1WZLA 3REWA 2Y07H 4ZUWA 5ANME 1CXHA 4TQEL 4WI8A 1JPSL 2NNAA 3HUJF 1YJDL 2DLIA 3BP7A 3VXOA 5EBWB 1B4RA 3O4LA 2B20A 2DQFB 2C7UA 3I02B 1TVBB 2VDNL 3ULVF 5J0BA 5GRVK 1MJ7L 4XP1L 1GGYA 4KHXL 3O45A 4HHAB 1DE4B 4DUXA 5HJ3B 4NDMA 4PD4J 2IPKA 2MSPA 5L88H 4KJQD 5GGSB 3SQOL 4OM1L 4FNLH 1J8KA 1EXUB 1FO0H 4ZOCA 4YDJB 3T1FB 4J3TA 3HUJE 1A6UH 3K8MA 1FDLH 3SE4C 3MJ9L 4X4MA 3V7AE 1U2HA 3LEYH 4WO4C 2FX8L 1IAKB 5JHLL 3ULVE 5HVWA 2K3TA 4WU5A 4U1IB 1UA6L 2GFBB 3WFHA 3L3IA 2OBGA 3IDYB 1XGQA 3SDYH 4FTVB 3IAPA 4HWBH 5KSVB 1TXKA 4Y5YB 4JFYA 2VH5L 3SDDA 4RGND 1DFBL 2A6KA 4JB9H 1LO3H 2B39A 2BMKA 4GMSH 2EIEA 1I3RB 2D3VA 3NZ8B 4G80B 5DR5L 3WHXA 2F54E 5C0RL 2NY3D 2ZUTA 1CL7I 2ZJSL 4WWKB 4LAQL 1RIHL 2P46B 4I3RH 4HJJH 2OJEB 4UU9B 2LU7A 1VERA 3WD5L 2VLLA 1E4XH 2XQYG 4XXDA 2AEIT 2EICA 3QIUA 3BAEH 4I9WE 4RBPH 3CPLA 4YAQA 2H6PA 4NO0A 5EU7C 1EJOH 2DIBA 1C1EL 2A83A 1HEZA 3F7VB 4UNTA 3ARFA 1CN4A 4XNXH 2AV7B 5EPMA 5I1AB 2VNCA 4KK6C 2W65A 3S7GA 5FYJH 1FYTE 2CXKA 3FCTB 5BS0A 4HIHB 3DIFA 4HUXA 3IXAA 3GB7B 2NNAB 5DK3A 4ZS7H 3BP7B 3GIVB 4XC3H 1J5OH 2CQVA 1PEWA 1I8KB 1MLBA 3MCKA 3ES6B 4KUZL 5JZ7D 1GAFL 4K3EL 5IIEB 2P8LB 2XZQH 3RL2B 4WI3A 4H88L 4TSAL 5IBUB 3TBYB 1PGRB 3SKJH 2JIXD 5A3ID 4O02H 1VADA 2IPKB 3MODH 1FO0B 1AFVH 5CJ8A 2CKBA 1IAOA 3HG1B 3TA3D 4MD5A 1J87A 4HEME 5FGCE 1U8OB 4OF5A 3QHFL 4DAGH 5E8NA 4OIIL 4PBWD 4S1DC 5F21B 2QSTA 3QXDB 1JNNH 5F7KC 3L3OA 5DD5H 2QQQA 4BSVB 4GAGH 3WFHB 2DLTA 1IGTA 3MFFA 1XGQB 1YNKH 5F70A 3TLRA 1JHKL 4U6YA 5CEYA 5IHLB 3DI3B 3O6FD 4JPIB 2X4NB 4K8RL 4ZTOL 3LS4L 3MRLB 2F58H 4K7PY 5IBTH 1RIVL 3U9UA 5IB2A 1G0YR 5SX5H 3RIAF 4PJ5A 3STLA 4ZD3H 4F33B 4M1DL 5LWYL 3EJYD 3QIWA 5SWZA 4F7MB 1U0QA 4MWFA 4G8IB 2EC9U 2CRIA 4RGNE 4NRZB 3EZJB 4XXDB 1JMXA 2ZNWA 3LD8B 4JFOA 5ICZA 3CIQA 3VRIB 2D9CA 5I73C 2NY4D 1CD9B 2EDWA 3MLSH 2W0KA 1OAXL 1UT9A 4JG1H 4HMEA 3DIFB 3IDXL 3IXAB 4NQTA 2ZWLT 5MP6H 1BD2B 3V4VL 1A6ZA 5L0QB 2I5YH 4M61A 4JAMA 2VAAA 1A1NA 5I17B 1C5DA 3QDJD 1JGUL 4YDKL 1QNZL 3P4NB 4UBDD 4EZMA 5GS1B 1RUAL 3B2VL 1NCUA 1DEEA 4JR9H 4JFDD 3EYOA 4Y5XC 1PZ5B 3S37H 3TNMB 4WEBH 1KIPB 5C71A 5GS0L 2CKBB 2Q76B 5CEZD 3JBG7 4MJ4A 2IJ0C 3TPUB 1N8ZA 3NBNA 3GZKA 4R8WL 3FQUB 3AXLA 1QSEA 1F4WL 1EAJA 4XPFH 3OAUL 4NWTL 4X7CC 2OR8A 5AAMA 2G75A 4IIQB 5KN5A 3MRIA 5J56B 4K9EH 4N0UE 4M3KB 2CO7B 1QFPA 3RWHA 2AQ3A 4G7VL 4LCWB 3N50A 1JZ5A 3FT3B 5IB2B 1NC2A 5A2KH 5HYIA 1KNOB 1HXMA 4JHZA 1NLDH 5CGYC 1A1MB 4XP6H 3CNKA 3DJ9A 5D70H 4LKCA 3K8LA 4WO4D 4MWFB 5C9KA 5F72S 3T0EC 1NCWL 2GITA 1WFUA 3DMMA 4MA1B 2WQ8A 1MHCA 4DVRL 2AEPH 4DZBB 2XWJA 3GSUA 1VGEL 3MRRA 1CE6A 4P59H 1TJGH 5ICZB 2VLRB 1IC4L 5SWSD 4BK5A 1JJUA 4TUOA 4CJ1A 4PB9L 1ADQL 1T7WA 4K3GA 5DEZA 2HTKC 5IEKA 4DKFL 2D2OA 1LP9B 4KI5C 2VDNH 3OXRB 5BZWB 4LLUB 1J05B 1WFTA 2VAAB 3L3HB 1I3VA 4KHXH 4EI5C 1BZ7A 1DUZA 3CK0L 2B4CC 1RZFL 2BVQA 2GCYB 3BFOA 4QRUA 3SQOH 4OM1H 1DEEB 2OI9B 4MD0A 1IMHC 4KK6D 2R0ZL 5D5MF 3MJ9H 3B83A 2FX8H 7FABL 5DUPL 5JHLH 1BOGA 1QSEB 1UA6H 4GRWF 4TUKH 5C0FA 4U1SA 3M8OL 4JFDE 4LLDA 2NTFB 2D7TL 4GS7C 5IMLA 1OHQA 3KPNB 1ZE3C 4XCYB 4YC2B 2VH5H 4JM2C 5HDQL 1BFVL 2XXMB 5T1MA 2UWEA 1DFBH 3O2DL 4LSPL 4FFYH 5D5ME 3K46A 3VFTA 2NX5A 5C0RH 2ZJSH 1OB1A 3L5IA 4LAQH 4GRWE 3C5JB 1OF2B 4NO5B 4CRPA 1G7MB 3WD5H 4RRPG 4S1DD 3G9AB 3GSWB 4U7KA 4GG6A 3RGHA 1ZT7A 2GITB 1C1EH 3DMMB 5JORB 2G5BB 2XWJB 3C5ZB 2EEDA 5IB4A 2AK4D 2KQMA 3PWLB 1Q0XH 1U8JB 3KPMA 4PV8A 3ZDXE 5C92A 1VA9A 3B9KC 5DJCB 5DJDA 5J8OA 3D25B 1NC4D 2MJWA 1MHHA 1SJHB 3VD3A 2Z93A 5FHBH 3VRJA 5DC9B 4KUZH 4P99A 1GAFH 1CDIA 3P40A 5AG9A 3P3YA 5DD6A 5ICXA 4H88H 3FL7A 3BWAB 1ZSDB 2R4SL 3PWJA 3MR9A 3U2SA 3VGEA 1F58L 4U6XA 4QRUB 1UXWA 4QXWA 5GRYA 1INEH 5GRZA 4UQ3B 1IEAB 3FRPG 3ET9F 4O00A 2G60L 4OIIH 2XA8L 2EO1A 1BOGB 2R0KL 1J0YA 4NQCD 1JYVA 3CDFA 3RJQB 3NCYS 5HDLA 2DJSA 4E41A 1JHKH 5CJQL 4ZTOH 3OHXB 3AC0A 3LS4H 4YHYB 1DQDH 4S11A 4LLMA 3SY0A 1RIVH 4U31A 4HKXB 5T1MB 3OAYK 3PNWB 2QQLH 4PJ9A 4RFNB 4MQ7A 2WSKA 4R0LA 3MX0A 4WI5A 5KAQF 1HHGB 2HKHL 5LGKA 3LN5A 4JRXB 5JHDD 2HVJA 1FNSL 1MCPL 4Y5YC 4Z8FH 3OJVC 2P48B 2IANA 1MEXL 4LCUB 2R2EA 4X7EC 1ZT7B 2CD0A 1MCNA 1YEDB 5CILL 5DD3L 4HCRH 2VYRE 2PTTA 3QH3A 3V0VB 4WWKC 2Z4QB 2CO6B 1EZVY 4PGBA 3KPRD 5HHMB 1OAXH 4NZUL 5K9JL 3GRWA 1RZJL 3IDXH 4OAWA 3O9WA 4XAKD 3V4VH 3VGDA 5DJDB 4IOIA 5CGYD 1T20A 3GMQA 3MRCA 4H1LA 1INQA 2W60B 5F88A 3BN9C 4X6CB 3OG4B 1LD9A 1JGUH 1Q9KB 3T0ED 4LCIH 1CLZL 3GKWL 4N0YH 1RUAH 4NUJA 5BZDB 5E4IA 4O4YL 3PWJB 4KDVA 4HEPG 5GS0H 2E7LC 3MMEA 3RWDB 4U6XB 1UXWB 4KZEL 4L3AA 1LE9A 4XWGL 4WVRA 5GGRY 3NCFB 1Y6NR 2NZIA 3SEPA 3FFCD 2HTKD 2JELL 5GS2D 4NWTH 3V5KA 3BP4A 3WE6A 3UTTB 5F3HA 2YEZB 5DO2C 4KI5D 1RZ8A 1A9EB 1G7JB 1JZ2A 1FLTX 3D18A 1KIRB 4ZFOL 4EI5D 1BZ9A 2YUZA 1EHNA 3TYFA 4E41B 4MB3A 3NFSL 3SY0B 4MCYA 1XF4A 1WZKA 2E6QA 1D6EB 2HRPL 4NN6C 4NQCE 3RY5A 1BFTA 4JPWH 5BVPL 4MQ7B 2O5YL 1TNMA 1IM9B 3O41B 1R3LB 1QKZL 1NCWH 1WT5C 2FX7H 2BX5A 3F12A 1U8MB 3PHOB 2E5EA 2DOCA 2DM4A 2IANB 1VGEH 4MAYA 2AJVL 4ZUVA 3BE1L 1IC4H 1BQLL 5A2JH 4JM2D 2PTTB 3QH3B 5JHDE 1ADQH 1MLCB 1HE7A 3RDTB 3JV6B 4AENA 2J8UA 4OAWB 2YPVH 2YA2A 3O9WB 1JL8A 3LEXA 5D7JB 1Q8MA 3LD8C 3J7HA 3GDBA 5D2LF 4IOIB 5F71A 1L4IA 3MRCB 5FF6B 1RZFH 2HLFC 5ID0A 3DETC 2R15A 4LGRB 2Q87A 5E5RB 4YX2L 1AY1L 1YEJL 1E28B 4GKOA 4QY8A 2R0ZH 5FKAA 5L0QC 3EO1A 1S9XB 3BP5B 2AI0H 5EIIB 3T0EE 5DUPH 7FABH 3QDGE 1G9NL 1QRND 1CGSL 5D2LE 1T6WA 3B9KD 3DX6B 2WZPD 3M8OH 5CSBA 2IG2H 3VFVB 5GS1C 1WICA 4X4YA 1RZ8B 3O2DA 4NO3A 1FFRA 3D18B 5TF1H 3U9PL 1X6NA 5DS8B 3MZGB 5HDQH 1BFVH 3TYFB 3FFCE 5DI8A 3PG2A 2FIRT 4LSQL 4PD4K 1P6FA 5F44A 4IIQC 2D7NA 5DHYB 5IFJB 4U6VH 2QBWA 3W39A 3FHQA 2A6DB 4PLNC 3IETA 2X41A 3WNMA 4PRDA 3QUXB 1U8HB 2VLJA 1ZVSB 1EEZA 3PIQA 3F12B 2VSCA 1TZHA 4OCNC 4NUGL 5BV7L 1BAFL 5E94B 3TWCL 4X7SH 4MAYB 4WTZA 3DVNA 2HLAA 2A9NL 4MNGE 5J11C 3KPPA 3LPFA 4ZUTB 3KLAA 4MA1C 5IQ9A 3V9FA 3NFPA 4PJEB 2UY7A 2V5RA 1FZKA 2XACC 2DQTL 2FO1A 1CT8A 4OQTL 4YHZH 5HHPA 4X83A 5CUSL 3L3JA 4HIJA 1WF5A 3CC5A 1F58H 2BVOA 1DBJH 2YZ8A 4MXWH 2DKUA 2JF1A 5EOQL 4OZIA 4WWKD 1I1YA 4QY8B 5FKAB 3U46B 1NDGB 4WW1A 4BFGA 5TE7L 5AAWA 2XA8H 4QOKB 3LQMA 3T2QA 3MRJB 2ICEB 1LQSR 2R0KH 5TE6L 2LVEA 4YHIA 3MRBA 4X4YB 2OI9C 3BN9D 4XBGB 4D3CL 3KPOB 1BWWA 1QFWL 1QRNE 1R3IL 3TEUA 3L1OL 2VKWA 2EDYA 4QT5B 1HSAB 3NABH 4MX7A 4K9EC 3TNNA 1O5DT 4RFOL 2HKHH 3KPSA 3MUHL 1FNSH 1MCPH 2FHFA 4YC2C 1N3NA 2Y1VA 4M6ML 2YXMA 3FQRB 1JV5B 5DO2D 3IETB 1Q38A 1MEXH 1PG7X 12E8L 5D7KD 1ZEAL 1EGJL 3HG1D 1TZHB 4G9FB 4JKPL 3TV3L 1IAIL 3QAZB 4NZUH 1KBGL 1K5NA 2HLAB 2JJTA 5K9JH 4MD4A 2X70A 3OGOE 3QNXB 1HQ4A 1FGVH 5IV2A 3DBXB 3DMMC 2Q8AL 1DSFL 3UO1L 2PN5A 5D6DA 5DD1L 1NBZA 2VZTA 1WBZA 3C5ZC 4IRZL 2OTUB 2C1OA 1S7WB 4XP9H 4ZNCD 1CLZH 4O4YH 2H45A 2RHEA 2FH8A 3QG6A 5FOBA 3T0WA 4BK4A 5TFSL 4PFEA 1WEJL 2BVOB 4FTVE 4N90D 1N2RB 1KC5L 4NN5B 2BHYA 4MNHB 1R5VB 5E8EA 1CDGA 2JELH 4WW1B 1CDCA 4FFZL 2ESVB 4LSSL 3KNBB 3C6LB 5B21A 2X6MA 2LE9A 1NGXA 5CP3A 4YHIB 4YXLL 1XZ0A 3SGJC 4Z0XA 4ALAH 5FYJD 1PFCA 4LF3B 5TE4L 2HLFD 1M7IB 2FLBT 3DETD 4OUUB 3V6BR 3NFSH 1TVDA 2HRPH 2Z8WC 3HE6A 3VXUE 4K23L 1BD2D 3LN9A 3MV11 3WS6A 3S88L 3OBAA 4IBLT 3H7BA 3EYVB 4JJHA 2O5YH 4O9HL 4J3VA 4D9RD 5DJYA 2EE3A 4R97C 3QNZA 5GRJL 1XGUB 1QKZH 3HZVA 3QEQA 1P9MC 4YHYC 5INDA 4U6TA 1GXEA 1MCOL 1FAIL 3BPOC 2Q20A 3NA4A 2AJVH 4L8DB 3BE1H 3G6JA 1BQLH 2XN9A 4YXHH 3F7RA 5H35A 1GGCL 1MJUL 2BNRA 3DVGB 4HPOL 4XRCB 4B53A 4EUPG 5C6WH 1GJIA 5D7KE 4IM8A 4DUWA 2E27L 3HG1E 2FWOA 1QP1A 3DVFA 5CLTA 3OGCA 4WWID 3MLPA 5ESAA 1WBZB 4OF8A 2EDOA 3KWWA 1RD6A 4LCWD 5GGVL 1YEJH 1ONQB 5L7XH 4FOMA 3P4OA 1P4BL 3GSVA 3OKNB 1TITA 2AJSL 5KOMC 3G6DL 4QYOA 1NEZG 2FIKA 3CFEB 4GO6B 3VGGA 1CGSH 2ZSWB 4ZODA 3BZEB 5DK2A 4Z7QF 1F3JB 1JHLH 4ZFOB 4G6ML 1NGXB 4M5YH 5B3NA 1MRCL 5BRZA 3U9PH 1IARB 2VLRD 4S10A 2HRLA 2J8OA 4Z0XB 5CJ5A 2GYSA 1D6VH 4YDVB 5C8JA 4IOFC 3FT2A 5E95B 4LSQH 1KJMB 1ZANL 5BJTA 4PJAA 1IGCL 5F3BB 4Z7QE 3A67L 4I48A 3H7BB 5FYJE 5CFHA 1EO8L 1NCDH 1II4E 1NFKA 1UH3A 2VR4A 5DJYB 4HLZG 2XT1B 3QNZB 5IW1B 3QEQB 3LB6C 3BUTA 3U7AA 1BD2E 1P5VA 3NFNB 1BAFH 3OKEB 3TWCH 2ITCA 5DVNA 1CLOL 5B38G 4PRHA 3R06A 4PJ9C 2XN9B 4EJ1C 4R0LC 3KDMA 3LIZL 2LU4A 2A9NH 1KCRL 1TCMA 1UWXK 3SCMA 2BNRB 4RA3A 2H32H 1QSED 2FGZA 2NY2B 3DX8A 4OQTA 3V4PL 4Y4FB 1NQBA 4U1LA 3BPCB 1UB5A 2DQTH 3RI5F 2FWOB 1BBJA 2EKJA 3DPBA 2ZUVA 3D39B 5CUSH 5SX4I 2X4RA 3O2VL 3ESUF 3HNTL 2ZCKL 2DQUL 1OAYL 3W82A 5EOQH 3O9WC 1RHFA 1PQZA 4G8FB 1FFNB 4PJGA 5D7JC 1ZLUK 3SJVE 4YBHA 2ICWJ 5HGAB 4WUUA 5TE7H 2ED7A 2DMKA 3QWOB 4I3SL 3TT1H 3PP3H 4HKJB 1YEHL 4LCWE 5TE6H 4O2EA 5GS0C 2RGSA 5FXCH 3DMMD 2YN5A 4R90L 4LRNL 2NQCA 4D3CH 3C5ZD 1QFWH 5DMGC 1KLFA 1R3IH 2OM5A 5MERB 1D5IL 1LP9F 3L1OH 3AFLA 2AXJA 4PLJC 5C8JB 3ALXA 4NRXB 4DKEL 3HMXL 5AUMA 3RJDA 1IVLA 2ZNXA 1ORQB 4HQQL 5C3TA 3B9AA 5B8CB 4KKBC 4RFOH 1F4HA 2VLRE 4M6MH 3QQ3B 3WYRA 1EGJA 3GI9H 4HKZB 4YIQB 5BV7B 3LDBB 2X4PB 1ZEAH 2X9WA 4FN0A 3LQZA 3REVA 1LP9E 1X6LA 1N5YL 5CINL 4OCYH 1IAIH 2BCKB 1B90A 4PRHB 3R06B 1VEMA 3EYSH 2H32B 3MOQA 1H3PH 1KBGH 5GS3A 4EI6B 3CFBB 5MEPB 4J4PC 3QUXC 3RUGB 1DSFH 4FQPA 5DD1H 4IRZH 4GG8A 1MF2L 4MAYC 1HYSC 3T3MF 1NBYB 5HHXL 2IBZX 2ATKA 1AHWA 1WEJH 1KC5H 4J8RB 1S3KL 2FB4H 3W5NA 4DN3H 3DTXA 3HMWH 4JRXD 5B39A 4FFZH 4LSSH 4GQ9L 1FNEB 4UV4L 1I1RA 1T04B 4O2EB 4YXLH 3T3ME 3IRZA 3IFLL 4HLZH 2VB5A 4NNXA 1JGEB 1HH9A 3DECA 1YUHA 5TE4H 1CLYH 4MB5A 4J3SA 4ENEC 3LN4A 5HHMD 5F7HA 3VCLB 4NQDA 2X4QA 1BVLB 5HYQA 4K23H 3L3GA 5F1NB 3Q1SL 3S88H 2APFA 4U7MA 1OPGL 4O9HH 3NTCL 4IMKA 5GRJH 3CZFA 4N0CC 3U1SL 2Q3AA 1FAIH 5F1IB 2FGWH 2VQ1B 4NQUA 4WU7A 4IMLA 5ITFA 3LQZB 2FDBP 3REVB 5I30H 4LSUL 1RZGA 5F9WB 5DMYA 5ILTH 1MJUH 4IOFD 3RNKA 2EE9A 3T0AA 4PREA 5KSAA 5E2VH 3UTTD 4NKOB 2E27H 1F5WA 4F7EA 1LVEA 5I18H 5TQ0L 4MJ6B 3BWUC 4OB5L 4K3JL 3FRUA 3F6LA 3O2WH 4G6AC 1A4KA 4OLZH 5EUOB 4E41D 4Z77A 4GG8B 1UJTA 4ZFFB 3LB6D 3QAZC 2I25N 3RVTC 2E6PA 3JTSB 4WI7A 5GGVH 2P44B 5DQ9A 4UV7L 1A7NH 1P4BH 2FL5B 4PJ9D 1NCNA 5FEBA 1FSKB 3G6DH 1F42A 1L7IL 3NIFF 2QQKL 1IM9D 1QYGH 3MRGB 1BBDL 4B50A 3U0WL 2C4XA 4G6MH 5DMKB 4PG9A 2IAND 3BKCL 5EZJB 4GRLB 5J6GB 1FNAA 1XT5A 1Z5LB 4HUMB 4A2MA 3D48R 4NN5C 4RGOL 2X4SA 2XG5A 4JRXE 1HH9B 3DSNA 3WNKA 4AY0A 4PRNA 1X5ZA 5CD5C 4OFYD 2FJHB 5E2JA 1ZANH 5C0IB 3WS3B 5DYOA 4X6CF 3C6LC 3NIFE 1UH2A 2OP4L 4NQDB 2X4QB 5ISZB 1IGCH 1NGPL 3O9WD 5HYQB 1VACA 3DUUA 5D7JD 3A67H 3DSFL 1TPXB 4PJCB 4MMXC 5IVZB 3UPRB 5F9DC 2JB6A 3E1F1 2FO4A 3L7FA 2MCPL 3L5WB 4QRTB 4WV1B 3CZFB 5DRXA 5GS0D 1JNLL 3AREB 1CLOH 3DYPA 1MHPL 3JWDL 5CGTA 4OLWL 2G2RA 1NAML 2D0HA 5BVJB 3LIZH 4X6CE 3KS0J 5CWSB 1NSNH 4PLJD 1OP9A 1HH6A 4HJGB 1YQVL 3RNKB 4Y1AB 5IB5A 4WUKL 4PREB 2IQAA 3V4PH 5DZOA 3BGFC 3JTTB 4KKBD 5JW4Q 2DS4A 4F7EB 1C5BL 1T0NB 1DBBL 1A3QA 3T65B 3IAGC 1RZJC 3O2VH 4NSKA 3UTTE 4V2BA 2ZCKH 2B0SL 2DQUH 4JY4A 1CQKA 1DN0A 1DQQA 4BUHA 5DJ0A 2DWDA 2HKFH 3MROB 5BOZG 1QLEL 1YN6A 2H9GA 3WFEL 1MUJA 1DLHB 5D6DC 1YEHH 5EU6A 4J4PD 4JY6B 3QUXD 3RZCA 1XR8A 3F5WB 4R90H 4LRNH 1CTNA 1ZHBB 3U79A 2LTQB 3E3QC 4JEGB 5JTWA 4MAYD 4QRPA 2FHBA 1HYSD 1JGVL 4AIZA 1D5IH 2JCCB 3G5VB 4DKEH 3HMXH 1ND0B 4HSQA 4HQQH 1I8IB 5EB9A 4R7DA 4TTDC 2IANE 2Z0BA 2YN3A 1DLFH 5DJXA 4OLYL 5GRUH 1FLRL 3CU7A 4AEHL 4JFXB 1FVEB 2DRUA 2PO6A 3QXWA 1OWRM 4Y88A 4D8PB 3VMPA 4PGCB 3BDBA 4JN1L 3L7FB 4M6NL 1MVUB 1RY7B 1A1OA 3QO0A 3QZWB 2PKDA 3O3UN 1QBAA 2UUDH 5DRXB 1FCCA 1N5YH 5CINH 3Q6FB 4ENED 4HGKC 4NM8L 5ACZB 4QOKD 2AXGA 3ABZA 5GHWL 4ZXBB 3X14B 3EYQD 2IGFL 1S7TA 4JFFA 5I1HL 1MF2H 1L0XA 4N0CD 3WXWL 5IP4A 2OZ4L 5TDNB 5HHXH 4MQTB 2IWGA 4U6HB 1T5XA 2NY2C 2QQNH 5E0QA 1DN0B 2YXFA 4PJHB 3SKNB 3H3PH 3DRQB 1QVOA 4NRYB 4J2XA 2BFVL 5E2UL 2DL9A 5DD0L 2FZ3A 4GQ9H 1MUJB 2X89A 4UV4H 5I76B 2M1KA 1HIMH 4M48H 3IFLH 1XR8B 2VLJD 4JO2L 5EORL 4PBVC 2DQDL 1MFDH 4G9FD 4G6AD 3HHRB 4FQ2L 1RJLA 1G9NC 1XEDA 4QRPB 4KKLC 4PJEF 1ZLWK 1BMGA 4H26A 3RWFB 3RVTD 3WFZA 4NZTH 3LKSB 3Q1SH 4PJXA 3HI6L 1OPGH 4NT6A 4GW5A 1ACZA 1AD9A 3U0PA 2WBJB 2DM7A 1TJIL 4MAUH 4QRRB 5F7YC 4X6EB 3T2NL 1MRFL 4KJYA 3ZL4H 1P7QA 1JHTA 1XCQA 1KLGB 4UOJA 1TCRB 1H8SA 1U8PA 2DJ4A 4PJEE 1EBAA 4OF3A 5B8CC 1HQRB 5D1QB 4LEXH 4XZUA 5CD5D 3QI9A 2VR5A 3PE9A 1KTRL 2ESVD 3C6LD 4HX1B 5ESVB 3LRSA 3PWPB 3SKMA 2EECA 5TQ0H 5BV7C 4GW4B 3LDBC 4OB5H 4BFIB 3FN0L 4U0QB 3S36L 2VABB 4J7RA 4D2NA 4QOKE 1IGYB 4UV7H 4Z0BL 3GSXA 1T5XB 1FN4B 1HNFA 1CG9A 2CUIA 3HNSL 3FT4A 4ZNEE 2D0GA 4A6YL 1L7IH 4ZQKB 4U1JA 3QEUA 4JG0L 3TN0B 5D7LA 4DJMA 3VXSA 2KZWA 3WXVL 4HFWA 3U0WH 1SMAA 3L95A 3AGVA 1BVZA 5BW7A 3BKCH 4CMHB 1GOFA 1VEPA 4QHNA 4Z95L 3TP4A 1AIFB 4RGOH 1IC7L 3MLVH 1ZLVH 3V79C 4YFLI 4XNZB 1IJ9A 1WBYA 2KBGA 2L7UA 3CUPA 1J0IA 1K8DA 4FRWA 2OP4H 3BOVA 1CQYA 1NGPH 3QXUA 2DDQH 3DSFH 3MUY1 4MA7L 4G9FE 3OR7A 4GW5B 4XXCC 2WNGA 3U0PB 3MRPA 4EQ2A 5F6IB 2MCPH 1W2KT 2W59A 5JXAH 1CFQB 5HTSA 1JNLH 2V7NB 1NAMA 4X8XA 1P7QB 1FVDA 1RHHA 3MJ6A 1MHPH 3IF1B 3JWDH 1YYLL 2NCMA 2F15A 3CX5J 5JOEA 1U6AH 4ZFGL 1X4XA 5AZEL 3S6CA 2VLKA 3CLEL 4JO1H 2XKNA 1IKNC 1YQVH 1U95B 2EDNA 1N6UA 3ARBA 4GW1A 4K7PL 2CH8A 3AM8A 4WUKH 1AD0B 5CGMA 2WUBL 4TTDD 4I18A 1OSZA 1BX2B 3BKYL 1JTOA 1IGFH 3Q3GB 5E99L 3KXFB 2LABA 2BC4B 1DBBH 3CVHL 4JFEB 1KT2B 4NP4L 1CFBA 2D4DA 2L0DA 1GGTA 5EO9A 4G3YL 2H2PC 2HYMA 1H5BA 4TULH 1OAQL 3LV3B 2ESVE 25C8L 2B0SH 1RUML 1AO7B 2Q6WA 2Z31B 4JY5H 2R1XB 3V0AC 2ZUUA 1T0MA 4P57B 1EAPA 3HPJA 1OT1A 5CCKL 5KVEL 4KJPC 1Y18B 4ETQB 3T0XA 4RWHA 3X11B 1CG9B 1QLEH 2IPTL 5AD0A 4K2UL 1D5XA 3FT4B 3WFEH 1ZGLP 4NWUL 5IHUL 3BGMA 1B0GB 5D7LB 2LU3A 3QEQD 1D9KA 3UPCA 3FO2A 2XICA 1FVCB 4BSWA 4HFWB 4EKXA 3RPIA 1RJCA 1QQDA 4FQJL 1OGAA 4H1LG 4JDVA 2XN9D 3P2TA 4KXZI 1UKQA 1FSKC 2QR0B 5ICYB 2Q8BL 4LVOB 4J3UA 2Z91A 3CUPB 4I0PA 2BNRD 2Y5EA 2CLZA 3HN3A 2NY2D 2VDLL 4ONGL 3GSNL 1RFDL 1WV7T 4AEHH 4XPGL 2KQNA 4R26L 1HN1A 2C5DC 5EN2A 4GRLC 4TNVF 2QSCL 5JDJA 3D2UA 3D39D 3TH3T 5JW5B 4FZ8H 4JN1H 4CU7A 4GSDL 1J0KA 4FS0A 2VRAA 4EDXA 4NJAL 5A16B 3RIAK 3NAAL 3KPLA 2VZOA 5IM7B 4F9PC 1FVDB 2VXSL 2EIDA 5F9AC 1QFHA 2EDXA 4HWEH 1QFWM 1YMHA 3SQBA 4KKLD 1TPXC 4LRIA 4NM8H 4IEFB 3BZDA 2VLKB 1YEGL 3ARBB 1B0RB 3VMOA 5GHWH 1HOCB 1UJ3A 4M7ZB 5EZLA 3IJHA 2VL5A 3E3QE 3HI5L 5I1HH 5IR1B 4I18B 3AREC 2P45B 4X6BA 1S7XA 2F8VA 3P4MB 3UXFA 5BRZD 4MSWA 2BK8A 2OZ4H 2O26U 1PSKL 1LGVA 4FQHB 4D9LL 1VEOA 3EBAA 1IAIM 2R1WB 2JB5L 2EIZB 1TJHH 2A74B 4GXVH 5I8EA 1EAPB 3OQ3B 3GK8L 2BFVH 2K7QA 5E2UH 1D5XB 1ZVYA 5DD0H 1N0XH 3EAKA 3WUWA 1X4ZA 3A6BL 3VDBA 1D5BB 3M17B 1AC0A 4WHTB 5JPMA 6CGTA 3ZKQD 4FP8L 1YYML 5D2NB 5EORH 2DQDH 2V7HB 4DZ8A 4FQ2H 3FQXB 4PRHD 4L3CB 3GNML 1QACA 4JDVB 3CFCL 3BZ4A 3MLUL 2F53B 4FXGA 3SKUD 3TC9A 1QLFB 3QEQE 3UJIL 4Z78B 5HI3C 1KEML 5CD3B 3P73B 4NIKB 2PCPA 3HR6A 1WCBA 4KTDL 5DHVH 5I74B 2LTQC 3QUYB 1FJ1A 4M7LL 1V7ML 1P1ZB 5EN2B 5I75B 2FSEA 1NBQA 1AGFA 3T2NH 1MRFH 1HCVA 2FECL 2BNRE 5ENWB 4NPYA 2HAZA 1BJ8A 2IH1B 4PJFA 3PXJA 2EDDA 4F8TA 4F2MB 3MRFA 1YMHB 3VFWB 4JKWA 3D39E 4AIOA 1YY9C 1OT2A 3IDMA 3SDXB 4X99B 2VL5B 3FN0H 3S36H 1TQBB 4K71B 4DCQA 1S7VA 4C58B 4NQEA 4JZJB 4YO0A 3BESR 4MSWB 1B9ZA 4QGTA 3TIEB 3TO2B 4DFIA 3Q6GL 4Z0BH 4A6YA 2YHGA 5IVXB 4XVSL 4ZXBC 1LK3L 1S9YA 3HNSH 2R1YA 4R4BA 3V5HA 3WFCL 5IF0B 4AK1A 2R8SL 1XGTA 2DKMA 3EFFA 1OQXA 4UT7H 3U7YL 2V2TA 3WXVH 2CRMA 5I1DB 3PDDA 1KENL 2WIIA 3OKYA 1CD1A 4Z95H 3VH8B 1J9CT 3MGOB 5JIPA 2WK2A 5ELIA 1WAAA 1ZHNB 1H3VA 1NJ9A 5FGBC 4M43H 4AJ0A 2H2PD 4LGPB 3RUGF 3CMGA 3PUCA 5SV4A 3X3GL 3TBSA 4KY1H 1UKTA 2YSSB 2C4FT 1IC5L 3IDNB 4X0KA 5DHVB 4EXKA 4KJPD 4MA7H 5HVGB 1BREA 3GUTB 3PABA 2PCPB 4UT6L 2YPLE 5ECJE 3EO0A 3N1MC 3QULA 2PR4L 1QR1A 4LCYB 3RUGE 4NPYB 5GRWA 4ZFGH 1JPGA 5AZEH 3CLEH 1K9TA 2WBJC 3PV7A 2W9EL 5I16B 2PO6C 2F5BL 5L2JA 4K7PH 3NCEB 1JYWA 1FG9C 2WUBH 3WIIL 1T7ZA 3CVHA 3BKYH 5E99H 3MRKB 4M8VA 1FE8L 4FQCH 1I7TA 3W2DL 4GRLD 4NP4H 3MJGX 5F89A 1CXFA 4G3YH 2VUOA 1P7HL 1L0YA 5D1QC 1C08A 2NY5L 1EHLH 1OAQH 4JHAH 25C8H 3K4DA 1RUMH 4F7CA 4UNVA 1LO2L 5CLWA 4NQDD 5ISZD 5KVEH 2BSTB 3MOAL 2IPTH 4K2UH 5KW9L 2F5AL 1SBSL 4JPKH 4NWUH 2J3SA 1NCBH 3LKOB 4G8GA 5T3ZL 2VUYA 3W0WA 4G6FB 5DT1L 1XF5B 1EO5A 3FO9A 4E0RA 5FO7A 3ARED 5KS9B 2PYEA 3RY6A 1GH7A 4DK6A 1IBGL 4ZUSB 5IROC 2BNUA 2EDTA 3SPVA 2YBRB 3MBEA 1V3KA 1P69B 3TN0C 5FGRA 4WW2A 3MRMA 1QRKA 4OFVA 3QUML 4ONGH 3GSNH 5EUOF 1DTUA 1CZ8L 4S0TD 5FB8A 3Q48A 1DJSA 4N1EA 1QSFB 4R26H 1N7ML 4CMHC 2QSCH 4OV6F 4XC1H 3GJFK 1AQDA 4L9LA 4XNZC 4GSDH 1I1AA 2DD8L 4S1SH 1Q9LB 1WBXB 1EFXB 2ZPKH 4WCYL 4NM4H 4NJAH 3SE3C 4MA3B 3NAAH 1CFTA 2VWEC 4LNRA 1J8HA 3LEVL 4Z7UA 1R3KB 2VXSH 3GMPA 1B4JL 1DBKL 1YPZB 2FD6H 4E9LA 4HUUB 3BN3B 5EUOE 2C26A 3WN5A 3MGTA 1XGPB 1YEGH 5F6IC 3L3DB 4Q0XH 5HI3D 3QUKB 5DQJA 3QUZA 4MJIA 3HI5H 3CVHB 3DXAB 4U3HA 4WI6A 4OFKA 2EYSA 3IDIA 1EPFA 3KYMA 4JREB 5IFHH 3S34L 2FECI 3M07A 5F89B 1F45A 1EUTA 2APVA 1I85A 1UG9A 3M1BB 4PJCF 4KQ4L 2BNQA 4F7CB 2W38A 2JB5H 4P2QA 3ARDA 4GXUN 3UJJL 3VXMA 1AXTH 1M4KA 1ZLSH 3N9GL 1WIOA 4H25B 5EBLA 4OZHB 3OKOA 4NYLB 32C2B 3A6BH 1YY9D 2N7BA 3W0WB 5ISZE 4MNQA 2Z31C 3FO9B 4E0RB 1CDYA 4PJCE 2BXZA 4R96A 2EYRA 3MLUH 3ZKSD 3HI1A 3GSNB 4KDTA 1PVHA 4L8BA 1MY7A 1XAUA 4RNRA 3MBEB 3UJIH 4B41A 1T03L 1KEMH 4YBLB 1IAMA 4OZGA 3PL6A 4ZXBD 3FB5B 3L7EA 4KTDH 3KPQA 3MGAA 1E4KC 3QQ4B 1SY6L 2VDOL 1V7MH 2IMMA 4M7LH 3NIGF 5DUMH 3TH4T 1LEGB 4D0DA 3EOTL 4PRBB 4Y1AE 2NZ9C 5I1JL 4LVOC 5DSCB 1KIQB 4Z7UB 5A1AA 4P3WA 3OAZH 5FYLL 5C1MB 2DQCH 3G6AA 3WN5B 5E5MA 3DX9A 1FG2A 3NIGE 3G04B 5EU6D 3JWDC 2JCCF 4D0BB 3QUZB 4MJIB 5T5FL 3GO1H 4CVZB 1ZA6A 3MV9A 3TVMB 2EYSB 5JR1L 5DTFA 1VFBA 4QRPD 2LVCA 4KHTL 3TBWB 5E00A 3GSOB 4ZFZB 3CXHJ 1ZHKB 3PGFL 2X4TA 3ARBC 4XVSH 5IK3B 1T1WA 1LK3H 4M7ZC 4UTBL 1RPQA 3QISA 3WFCH 4I18C 1G7LA 2WBJD 4ZYKA 1XGRB 3C08L 2JCCE 3U7YH 1H3XA 5FYJU 2YC1B 2ZUYA 3NMEA 4QRRD 4YHKL 3OKOB 3RWJA 1P6AB 4RZCA 4X8JB 3W9DB 2BVPB 1KIUA 1KPUA 5LCVH 1BIHA 3T4YA 3UROR 5DEFA 5JOFA 2P7TA 4EN3A 3MLXH 5D1QD 3S96A 3X3GH 2J6EA 1IC5H 4HDIA 3WNOA 1MJJA 4JHWL 3UBXI 1I9IL 3PWPD 3CSYA 4XPAL 2KKQA 1ZGLA 1CFNA 3TO4B 5DWUL 1W0VA 5D2NC 2HFTA 2NY1B 3OKLA 6FABL 1U8LB 2B7DT 4PJHF 4XNQA 4OGYH 2PR4H 1KCLA 3QJFA 4N1CA 4X6FA 1LEKB 3D87B 1LWRA 5FOJA 1SEBB 1N4XL 3FMGH 3ULVL 2GKIA 3ESVF 4UNUA 3QFDA 4ELKA 2Z92A 5I74C 3QUYC 4N8VA 2F5BH 3TN0D 3VXPB 5I75C 1QSZA 3WIIH 4KPHL 1YEEH 1MCBA 1MHEA 3H8NA 4OI8A 1FE8H 5EOCL 5EWIH 4PJHE 4Q74A 2AABH 3V8CA 5E56A 3EJJX 5C07B 1RU9L 1W72A 4PTTA 4PRAA 2NY5H 2ICCA 1VFBB 3UTPD 3TH2T 3Q0HA 3UBXA 4LRIC 3VWJA 2GTZA 3MOAH 1T1WB 5IFAL 5KW9H 4JKKA 1SBSH 3CX5K 4U2ZA 1DQML 2NMSA 4QRPE 5T3ZH 1CWVA 1TQBC 2Q86A 4JE4B 1TQCC 4DK3A 4JZJC 3HTLX 5FM5M 5GRXG 5JUEH 3VFOB 1P7QD 4Q2ZB 1XCTB 4XH2A 3K2MC 2D7MA 4UOW0 1IBGH 1KPUB 5LQBH 3QUMA 2MKWA 5DA4A 1R3JA 2NW2A 5JOFB 5GQBA 1CIUA 1F11A 4QRRE 3PHQA 4UIKL 2RQ8A 2O93L 4GMTL 2Y36L 5CP7B 3MLTB 3ZYZA 4UB0L 4NOBA 5I2IA 1N7MH 3F58L 2IADB 2QKIA 4TN9A 4JFED 5K9QI 5F7EH 4XNMA 5I0ZA 4ZSOA 4NNPH 1FC2D 3OKLB 2DD8H 4X4XA 3PWPE 1AO7D 2Z31D 3LEVH 3QJFB 1NANH 4N0FB 1YN7A 1Y6KR 8CGTA 5EZIH 1OAZH 2GSIA 3VXRA 3MQIA 2Z92B 4HAFA 5LBSL 3CDCA 2HWZL 1ZTXL 5D7LD 3UPAA 1SQ2N 4ZPVB 4GAJL 1IGML 4QRSB 3BUYA 3MNVB 3S34H 2ADJA 1GIGL 1ROWA 3OKKA 2AJYL 5JIHA 3ZE1F 4PTTB 2NZ9D 5BMFL 4KQ4H 5JA9A 1FGNL 2VDKH 2IAMA 3UBXB 4FQLH 3B9VA 1NFDA 4W4OA 5FK9B 2DLGA 3EKCA 4UDTB 2VN7A 3ZYJA 1ZT1A 5JNYA 1UZ6F 2BSSB 4BQBA 1N59A 4M4PA 4YR6A 3K2UH 3ZE1E 3OXSA 4LLQA 3QDMB 3QUMB 1VFMA 4IDLA 3RIFK 2VLKD 1F11B 5FAAA 1VGKA 3ARBD 1SY6A 4R2GB 5GGRB 1UZ6E 2VDOH 3GBMH 4N9GA 2QSQA 4JVUA 2QKIB 1KPVB 4MHHI 4ZSOB 5I1JH 3LMJL 1U91B 5T33L 4X6DB 1K3IA 3HAEH 3KXFE 4HIEA 3S97C 2V17L 1RJYA 4OD2A 4JFEE 1J1OL 5FYLH 1DVFA 4DEPB 4DFHA 2UZXB 5FM5O 1A7OH 4KROB 1FZJA 4F9LC 1LK2A 1AO7E 4PYHA 5IJVA 5T5FH 4HW6A 3STZA 1N5AB 1R0AH 4ELMA 5EFIA 2WP3O 2E6JA 4CJ0A 1BQHA 1EVUA 1OGAD 4G42A 4KHTH 5DVKA 4OT1H 2F53D 4GLRI 8FABB 5EC1B 5CZKA 4E42A 1IRAY 2FBJH 2CSPA 4UTBH 5C09A 3IYLW 2X4OA 4KK9C 2N1KA 2X1QA 3MA7A 4UDUA 4KDWA 4JREC 3QUYD 1WCQA 5ANMA 3C08H 3HRPA 1FNGA 4EVNB 1ZT1B 2VDML 1T2QL 5D1ZB 1OL0A 4RBPK 3SDAA 1QPPA 2ZSVA 3MPCA 1VFAA 1MREL 1S5IH 4PY7A 5JW4N 2OX5A 1KGCD 3RPKA 3EO9L 3P9MA 3ZO0A 5KG9A 4C4KT 2Y4SA 4XPAH 3QO1B 2VISA 3I6KA 4I77L 4YFLF 4HIIA 1P7KA 5D93B 2AKRB 1EEQA 1LEIA 3HUJA 5DWUH 3DOSA 1FNFA 6FABH 4NOFA 4N9GB 3RY6C 3U6RB 1LE5B 2ED8A 1GSMA 1UWGL 1NGZA 1MELA 1JK8B 5F97E 1S5HB 3HAEB 3MBEC 4YBLC 3HC4L 1YMMA 3VFPB 1R5WA 2P5WA 3GSRA 4M5ZL 5KVDH 4ZPTB 3FB7B 3TYGL 2XKUA 3OB0H 3MBXL 3VFMB 4KPHH 3P9WB 2ERJB 3HPLA 1T3FA 5E8DL 1I1AC 2JJSC 3MCLL 5EOCH 3H9SE 2F54A 4LQFL 3RU8L 3N0PB 5IJVB 3EOBA 1RU9H 1OCWH 4PUBL 3RP1A 5EC2A 2YK1L 5EFIB 3SE8L 1SJEA 3QJHA 4G42B 3SBWA 5C7XH 3WN5C 5H2BA 3T77B 1A6VL 2A73B 3B43A 5HD8C 4E42B 3RNQB 1RK1B 2VR9A 5D2NE 5IFAH 1FL5A 5SX5K 3QUZC 1T83C 4RCAA 4X98A 3RI5K 3OJDB 3SGDH 3TVMC 4KQ3L 1FL6A 1FYTA 2PXYB 4OI9A 2F53E 3ROLB 1EMTL 1YEIH 4YHOL 3VXQA 4OQ1A 2DYPA 4CMMA 1NL0L 1I85C 1E27A 4P46B 4XT1C 4OFIA 3NVQA 1I8LC 2CIKA 1DUYA 3FOLA 3SDXF 1D5ZB 1KULA 3HB3C 4OKVA 3IAQA 1OSPH 2JK5A 4LARL 2CDGA 4UIKH 4QWWC 5JO5A 1G0DA 3P9MB 5KG9B 2Y36H 2R9HC 4UB0H 1RZKL 1K4CA 2AV1A 4ZAKB 5IB1B 2VISB 2ICWI 3A6CL 1H8NA 3F58H 4S2SA 1KGCE 1K85A 5IVXF 4U2YA 1KYOJ 2R4RL 5C6PB 1EHAA 4XVJH 5KOVC 3C8HA 4NQSB 3SDXE 3VW3H 2PTUA 3NH7L 1J0HA 3ECBB 1YMMB 3PL6C 3AAZA 5DQDL 3TO4C 1X5KA 3WMSA 1R5WB 2P5WB 1I1FB 2NY1C 5EBMB 2HWZH 1S8DA 1VKXA 1VESA 3DV4B 4G6FD 1BJMA 5IVXE 5MENB 2Q7YA 3FQWA 3NCMA 4F80A 2F54B 4PV9B 2OS7A 2NY0B 1GIGH 1Q1JH 5L9DL 3EIFA 5CZVH 2XQYK 3K4AA 5I1EH 1I9JL 5BMFH 4FHBD 1FGNH 1WK0A 2EC9T 5K33A 1NUNB 4G8EB 1A3LL 2ICWA 4KTYA 3V5DA 1NCAH 4G6KL 1T7VA 1IL1A 1QSFD 3C8DA 4OM0H 4K7FB 4HGWB 4XBEL 4UQ2A 4U1KA 4GOSA 3IJYA 1FV1B 1A64A 3GJEA 3T8XA 1JGDA 1E27B 5L2KB 2XIDA 2H3NB 4NZDA 1PJ9A 1U3HB 1HYRC 2G9HA 5C0CB 3BJLA 4JZOA 4OKDA 4UZGA 2JK5B 2X7LB 3X13B 4F7TB 2CDGB 1ZWIA 4GH7B 5F9OL 1JP5A 4KK9D 4HUVB 3DXAD 1TETL 1JYXA 5EUKA 3IVKA 3KJ4B 1XH3A 3ZT7A 4S2SB 5KZCB 3MJ8A 2JIXA 1A8JH 5DLML 3ULUH 4LPUA 1DANU 3LMJH 3ULSB 3IKKA 4MZ3A 4UUJA 3TA3A 4IJ3B 3QYCA 5C0GB 4N0UA 3B8YA 1MI5B 5KS9F 4LSRL 3CFIC 4HD9A 5JDSB 5E2WL 5GSVA 4JFHD 4DVBB 3W0WD 3S4SA 4GKZA 4P5MA 1RUQL 3GMOA 1AGBA 1K2DA 4BQ6A 5HY9A 3O6FA 2VTFA 2VZ3A 3L3KB 3WKNA 3ZSTA 2Y9RT 4TNWF 4NQXA 2ZKHH 3MBED 5CEXA 2X5PA 1OM3L 5KS9E 2CRZA 2J2ZA 4H0IA 1PYWA 1NDMB 1G6RH 5FKPB 3MACL 4WNQA 1IM3B 1IL1B 2NY5C 4UQ2B 1YPZF 2EDEA 3R0NA 3BW9A 2SEBB 3CFDA 4OZ4A 1I1AD 4GAYB 4CAGA 3RGVB 3GGWA 3FFDB 1HINL 1MY5A 1QSFE 1JGDB 1MREH 1WTLA 4HBCL 1UADC 1SJXA 1CBVL 3OWEA 3QT2A 3RWEA 2R2BA 4GKNB 4QF1A 5HD8D 1GHFL 1F00I 1RMFL 3CXHK 4KUCD 3JVGA 1P84J 2DF3A 1YPZE 1KCSH 3QUZD 4MJID 3BP6A 3TVMD 4JGMA 2HN7B 1I7ZA 1A7QH 2BRQA 3EOAB 3IFOB 3K81A 4U4BA 1GRWA 4H8WL 4RX4A 2B1AH 4JFDA 1S9KC 3HC4H 1RSFA 3DXAE 4OZHF 1T89A 4R2GC 1K8IA 4ZDHB 2RAMA 3QDHA 3HB3D 2DWEB 2HFEA 4N0UB 2EYTA 2H41A 3MBXH 1I3UA 4QWWD 5D5MA 2R9HD 2X4UA 4BH7B 3AS0A 1R5IA 3MCLH 3WEXB 4MMZC 4LQFH 3RU8H 2C3GA 3QXAB 2V5SA 1A3RL 4PUBH 3GMOB 4NBXB 4Q9RH 4HS6B 1ETZA 4QHLB 4OZHE 1OP5K 4DEPC 1G7IA 1V7NL 1T1XA 1NCCL 4Y4KB 4NQXB 5KSUB 2EH8L 3W0WE 1ZS8B 1G6RB 5HDOA 2D7QA 5JXED 4OCRL 1MIML 1T21A 3TO4D 4UTAH 4KQ3H 4EIGB 2NY1D 4WGWB 4YHOH 4ZO6A 2VE6A 2DTML 1NL0H 3BW9B 4J23A 4G43A 3NACL 5JA8B 3WHE0 4OIBA 3CX2A 3DLQR 5CJOL 4NKMB 3CH1A 4JN2A 4LARH 3UTSB 1YNTA 2R0LL 3RBSA 3MRDB 3M45A 4HUNB 1S7SA 4HIXL 5D1ZC 3AY4C 2PNDA 5DRZB 5L8LB 3BVNA 3BP6B 5C07D 3HZYB 1RJZB 3HS0A 4WHDA 1I7ZB 2R4RH 1GZPB 2VJXA 4FFVD 5HHQB 2EEAA 5FO9B 1HZHL 3NH7H 2X2YA 3H42L 3WSQL 4GFTB 4PJDB 5D93C 5DQDH 4CVWA 2XPGB 4PR5A 3G5YA 3I75A 3B6SB 2HFEB 4ORGA 3B8SA 4JQIL 1F2QA 3VG0H 1RAMA 3MLYL 2DIJA 3B3IA 4XPBH 1MAML 1R5IB 3LH2H 1EJ6A 5DJ6A 5L9DH 5BXFA 2CLRB 5HPMB 1I4FB 1I9JH 1T5WB 3T4AB 1DVFC 3P9LB 3CZJA 4KK8C 2FJGA 3GJFA 2ERJC 3ZT6A 3B2UC 1A3LH 1OLZA 4HK0A 4G6KH 2YA0A 5EU5A 4WEUD 1ZT4B 4XBEH 2IBGA 1WTGT 3RWGB 4C54A 4ERSL 5CIPH 4L3EB 1HDMB 3TT3L 3F62A 4YJZL 1RUPH 3DUSB 5F93C 4XB8A 2I9TA 5FA4A 4X5LA 3BZFA 4TUJB 1YZZA 4G43B 2ZOKB 3I2CL 4P23B 5D8JL 3ROOB 3RTQB 2PXYC 1NC4A 4QRQB 5F9OH 5HXMA 2XXCB 3I3EA 3BD3A 4ZUUA 5J89A 4P46C 5JLZB 5TF0A 2WV3A 3IKCA 3QG7L 5ACLA 1U8KB 4LEOA 3PGDA 3HS0B 3D69A 5DLMH 5MEOA 1VPOH 5GZNC 3DRTB 1CXIA 2P24A 5E2TL 2V2XA 4ZAKC 3ISWA 4IRJA 5C07E 5T3ZD 3UJTL 1QO3B 1H0DA 1G7QA 1Z9OA 5INCB 1OARH 2YD7A 4LSRH 3MLRH 1HI6B 2MQ3A 5E2WH 2BERA 3G5YB 5E1AA 5GJSL 4AH2A 4NQCA 3ULVC 4JFQB 1RUQH 2AJ3B 2P5EB 5JOPE 5DJ6B 4LNVA 2Y07L 5BXFB 3D0VA 5ID1A 3BIKB 2OMNA 4Q9BA 4XGZB 3ARYA 3KLHC 1A7PH 4Y5XA 1OM3H 2HH0L 4N68A 2CDEB 1KJ2A 4R2GD 5A43C 3MACH 2F74B 2QL1A 4UIMA 1T1YA 2NY0C 4W6XB 2GAZB 4Z5RB 4YHML 4M62H 5ETUB 5GIRB 2KZ1B 1Q0YH 5TDPB 1BM3L 3K7UA 5IKCA 5FA4B 1BWMA 4D9QE 3B9EA 4HBCH 1OTSC 1CBVH 1A6UL 5FYKL 1FDLL 2A1WH 4RMVA 3FB8B 3TBVA 4LHUA 5JMRA 1GHFH 4QTHB 2O61A 4YFDB 1IQDA 1HXYA 1M7DB 5C0DA 4FXKA 1BLNA 3DURB 1U3HC 4HWBL 3QDGA 1GZQB 4ODVL 1M6OA 4KAQL 5D2LA 1FZMB 5TH2A 1KN2H 5IOPA 4PTUA 1NUFA 3MRNA 4JB9L 4PP2A 3CCHA 4GMSL 4U1HA 1J86A 1X5FA 3QPQC 1Q94B 4X5WB 2GTWB 4F3FA 4IRJB 4I3RL 2HMIC 1DQLL 1H0DB 3FFCA 3KJ4C 5FA3B 1E4XL 1J11A 1RULL 3TCLA 3BAEL 4U1NB 5D1ZD 3FKUS 2OTWA 4KVCL 2E7CA 4KZDH 4MDJA 1A3RH 4IJ3C 3SO3B 5T3ZE 1YC8A 4XNXL 3E6HA 1WISA 1F2XK 3U36B 1V7NH 3EFDL 5C0JA 5ID1B 2EH8H 4ORZC 2ZUWA 2W9LA 3WFDH 3IU3A 4KI1A 3JV5A 4HV8A 2NYYC 1J5OL 1C12A 1AGDB 4X6DF 1F4XL 3QDME 3VU2A 3MRQA 1VB9A 4MNGA 2XZQL 4OSUL 1QHPA 2DTMH 3MUZ1 4TYUA 2AERT 4FQQA 5IT2H 4K3HA 5HI4C 2XWBA 3NACH 5FYLD 4RMSA 3WJJA 1P5UA 3VI4F 1DVFD 2IEPA 4ZSOE 5IMMB 4KK8D 2R0LH 4WTXA 4RAUA 2E8ZA 5IG7B 4YEFA 1L7TL 1S9VA 3B2UD 4HIXH 3C6SB 3HE7B 4X6DE 2AS5M 1SEQH 3DV6A 2XA3A 4I4WA 1QLRA 1M1SA 3S3JA 2R2HB 4UT9L 4OV5A 1BLNB 4QLRA 1SYVA 4UOW1 2F58L 1E0OB 4HG4J 1NFIB 3H42H 3VI4E 4X9GA 2PYFA 4TNVK 3JV0A 3VGHA 5H37G 2HA1A 2PXYD 2EXYD 4OZFG 3MLYH 4P46D 1UM5L 5IW6A 4MDIA 4JANA 4D0CB 1JNHB 1RZ7L 4MDJB 1Y6MR 3QPXL 5GZND 1KYOK 3SO5A 3TESA 4L8SA 1A6WL 1EH9A 5F6HJ 1EVTC 2DQFA 4CGTA 3I02A 2C9AA 3EZ8A 4ZAKD 2I5YL 2ILLA 1PG7H 1Z6JT 3TT3H 4HHAA 1DE4A 5HJ3A 3QWRD 3MO1B 4JRWA 5GGSA 5D6CB 3ULVD 4Y4KC 4UAOB 4YDJA 5DRWB 2CUHA 2D7PA 1IKFL 3S37L 1YMMD 3V4UL 5ERWA 2P5WD 1AKJA 5D8JH 1IAKA 3GBNL 3VGFA 1PKOA 3KLHD 2D31A 3L5HA 3D1MC 4NC1C 4U1IA 2GFBA 35C8L 1K3ZA 2XG4A 3B5HA 4FTVA 4Q97A 2AK1H 5FYLE 5J1AB 5MEND 3DV6B 1YECH 2F54D 4I4WB 1PDKA 3LRHA 5KSVA 5K9KB 2NY0D 4Y5YA 5KANI 3O3AB 1W0YT 3VWKA 4ODWB 2HJLB 4YK4B 4KRPB 3BO8B 3NZ8A 4G80A 4L4TB 5D7IB 5GSRA 5K9OB 5E2TH 4WWKA 5I1LB 1OTSD 3UAJC 2QEJA 3UJTH 4UU9A 2OJEA 1NLDL 3WBDA 1CFSB 2PW1B 3C5SB 4XMPL 1A21A 5AYQA 4XP6L 3O11B 5D70L 5CS7A 3UEZA 2E9WA 1RIUH 3VXUA 3F7VA 3BEWB 1UKSA 1G1CA 3RBGA 2AEPL 2AV7A 4DGYL 5I1AA 5L2KD 1XF1A 4P49A 4X5XB 5IW6B 4OTXH 1U3HD 2HT4C 4RFEB 4P59L 1X5JA 3FCTA 3AMLA 4HIHA 2EEBA 3BRDA 3GB7A 2KUTA 2E7LA 2HH0H 3GIVA 2WW8A 4L8SB 2AJUL 3QPQD 2DI7A 1I8KA 3K3QA 3ES6A 3PHSA 1E4XI 2HMID 5IIEA 2P8LA 3RL2A 4N8VG 5KZCD 1INDH 3TBYA 3S3SA 4YHMH 4HUKB 4S1RL 1B0WA 1BM3H 1FO0A 15C8L 2BSRB 4DTGL 4CL7A 2EDHA 2I26N 3HG1A 3AU1A 1FBIL 5I19H 3S9DB 1U8OA 5I15H 2DM3A 5FYKH 1A6AB 1MI5D 1OTUC 5ERWB 1CTOA 1AKJB 1JWSB 3QXDA 4XX1G 1FL3B 3IFPB 3PWVB 4WHCA 2D31B 1UZ8B 2ZG3A 4Q58C 1WZ1H 4TUKL 5DJAB 4BSVA 1CDBA 4HWBA 2NYYD 1YMME 4FZEL 1H3GA 1WT5A 2P5WE 4X80L 3FN9A 2X4NA 4JPIA 3QEHB 4LPVA 4ODVH 4OZFH 4KAQH 3MRLA 3UYRH 3RTQC 3VWKB 3MCG1 5HI4D 5HGDB 1RZKC 5HYSB 4FFYL 1QEWB 5MENE 4FFWC 4YLQT 1TZGL 1EDQA 4F33A 4GKSB 5GSRB 4F7MA 3W5MA 4G8IA 1DQLH 4C4KO 3C60B 4NRZA 1RULH 3EOYG 1X5GA 4WFHD 4JVWA 3PP3K 3VXUB 3G9VA 4KVCH 3VRIA 1P84K 4CW1B 2PW2B 4XCNB 3K1DA 1TNNA 3EFDH 4P5KA 2IH3B 4R3SB 3S5LB 1Q0XL 3I3DA 5DRNB 1BD2A 5F1KC 2VDRL 5L2KE 5IEHB 2QTEA 1PY4A 5FHBL 1F4XH 5I17A 4YHLL 5C0CE 3JWOL 2RFXA 4NQVB 4OSUH 3C9NB 4I2XB 1I7UA 3P4NA 1M71B 5GS1A 3QSKB 4XHJC 1J18A 3TNMA 1PZ5A 3VXTB 1KIPA 5I6XB 4PRPB 2Q76A 3U0TB 3F6IA 3AU1B 1INEL 3TPUA 2XZAH 3FQUA 4NKQB 3RAJH 1L7TH 4C56B 2YUXA 1ZVHA 4IIQA 3BMWA 5EOTA 3SJVA 2WBKA 3Q5YA 4LOUC 4MQSB 4UT9H 4OZFB 1P2CA 1OD9A 1PBYA 4P4KB 2V5TA 1MI5E 4WI4A 5KVGH 1OAUL 4Z7NF 1DQDL 4LCWA 3HC0B 5LG1A 4Y4KD 1OP3H 1KPRB 2M8XA 2VLMD 3FT3A 4JJ5A 1KNOA 5DFVC 3L6FB 3DWTA 3PGCB 2QQLL 5MEQB 5B3JF 4QNPF 5AG8A 1A1MA 1CE1L 5ALBL 2YUWA 5C9JB 3UTZB 4CDHA 1SM3H 2EE2A 4Z8FL 4DZBA 3BXNB 3QHZH 1UM5H 3BYTA 4FG6C 2R23B 2VLRA 4Z7NE 1RZ7H 4HCRL 3ARZA 3FB6B 3QPXH 4IRJC 3KYKH 3UTSD 5B3JE 4QNPE 4P5KB 1A6WH 1C5CL 4WFHE 3ULUF 5C70A 1ZHLB 2D9QB 3HR5B 1LP9A 3OXRA 5BZWA 1AI1H 4LLUA 1J05A 3UAJD 4Z6AT 3D3VE 1IEBA 4DOHE 3T0DA 3OKMA 5E6IB 3L3HA 4BJLA 3SO3C 2DN7A 4Y16B 4PS4H 4J3OC 5DC0A 3O6KH 3QHTC 2W07A 4RMUA 1A6TB 2RFXB 2ENSA 3ORJA 2GCYA 4LCIL 1I7UB 1ACYL 4N0YL 3B5TA 2OL3L 4RX4D 1IKFH 3JV4B 2HT4D 3V4UH 3H3KA 3ULUE 1BQHG 3GBNH 1N64L 35C8H 2NTFA 5EOTB 3KPNA 4XCYA 3SJVB 1P2CB 4PLKC 4TVSa 1JF1B 4C57C 3HE7C 3QEGH 4JJ5B 3C5JA 1OF2A 4NO5A 5FO8A 4JPWL 1G7MA 2UYLB 3V8OA 4XMPH 1OTUD 4L3ED 4AEIH 4NCC2 4H8WC 3GSWA 4Y5VA 2K1MA 5ACMA 3OG6B 2FX7L 1HHIB 2VLME 3I6GB 1MRDL 1ED3B 5JORA 2G5BA 4DGYH 3C5ZA 4ONHB 5HVHB 3ZKXB 3PWLA 3HFML 1AQKL 4NC1E 1U8JA 3RTQD 2VL4A 4L5FL 3KHQA 5DJCA 4FQXA 3D25A 4FFWD 2AJUH 4TRPH 1SJHA 1I7RB 2YPVL 4RDQF 1UB6B 3CDYA 1IEBB 2VO5A 4FQIL 4NC0B 3OKMB 1MWAL 3BWAA 3UTSE 1ZSDA 3LPGA 4PJDF 4S1RH 5D71H 15C8H 4NHCL 4DTGH 1JPTL 3G5ZB 3PV6A 3SGJA 1FBIH 3MJ9A 4UQ3A 1IEAA 1FCGA 1MNUL 2APBA 5IW3A 2YKLL 1P4LB 1DCLA 4BQ8A 1U92A 2AI0L 2OR9H 5I8KH 3WLWC 2CIIB 3N1QC 3NPZB 4PIRF 3LKQB 2IG2L 3RX7A 4PJDE 2P5ED 4FZEH 1WJ3A 4LFHG 2XZZA 4DGVL 4X80H 1P9MA 3DROB 1F02I 2XRAH 3OHXA 5TF1L 4HS8L 3WJJC 3MV7E 4F37F 4HKXA 3PNWA 1F6FB 4QHMB 2Y25A 4XHJD 2RB8A 5I66B 1TZGH 4QKXB 2VITA 2VZSA 3ZDXF 1HHGA 1FH5H 2HVKB 5FO8B 4JRXA 1CK0L 3MZTA 2H1PH 4U6VL 4M6OL 4Y5VB 1T22B 4LCUA 4YK4C 4KRPC 1ZA3A 1OAKL 4U1GB 3DGGB 5FCUL 3ETBF 1YEDA 2R56L 4LOUD 3V0VA 2WWKT 4X7SL 2Z4QA 5HYJB 4L3EE 1GCFA 5J4MA 4PGDB 5DFVD 2VDRH 3LY6A 4FQXB 4PJ7B 2W60A 1A5FL 3ME0A 5C0AB 2ZG2A 4X6CA 4PRIB 4YHLH 3JWOH 2YZ1A 1Q9KA 5FECA 3CMOH 4YHZL 3HZMB 5IJKA 3O3DB 4PJBB 5BZDA 3L9RA 1J1XL 3IT8D 4LLWB 5DVLA 4FG6D 1WIUA 2NR6C 2BY2A 3RWDA 3R1GL 3VG9B 1DBJL 3PV6B 4MXWL 4L8SC 5CJBA 2UUDK 1V3MA 4OBSA 4IRJD 3RWCA 3UTTA 1U92B 4BKLB 2YEZA 1FNLA 1YC7A 5D72L 1A9EA 1G7JA 3QQ9C 1ORSA 5F7MC 1KIRA 4H0HB 1OP5H 5L8JB 4IS6B 4YNYB 3C2AH 1OAUH 3JUZA 2YRPA 3GFUA 1QBLL 1D6EA 1KTDB 5I1GH 2FEDC 4NNYB 1YQ2A 2P5EE 3NABL 3IDYC 2VITB 1CE1H 1IM9A 1NMCB 1R3LA 2OCFD 3O41A 5ALBH 5K59F 4O51B 1U8MA 3PHOA 4HCRA 3VWKC 1QTYT 1ZA3B 1BFOA 3MXWL 4XBPA 2AGJL 1JWUB 3FO0L 4PLKD 1MLCA 3RDTA 4OFYA 1S7UB 1FQ9C 3JV6A 4Z7VB 4YWGL 3KYOA 1C5CH 4NO2B 3HE7D 4LHUD 1JPFB 5D7JA 4HG4K 5K59E 1FGVL 5I71B 3H9HB 4NC2B 5FF6A 1MFNA 2VIRB 3IDGB 1YEKL 1NGWA 4PG2A 2BJMH 5FECB 3QDGD 4XP9L 1ACYH 3L9RB 2OL3H 1E28A 3OX8A 3S4SG 2GJ6B 4WJ5A 4Y19B 1S9XA 3BP5A 5EIIA 1UQSB 3AVEA 1N64H 3RWCB 3DX6A 5AYUL 2ED9A 3VFVA 1I1CA 4LVEA 5J12B 1CR9L 2XNAB 4JFZL 3SN6N 1ORSB 5I6XC 3MREB 1DL7H 5DS8A 3S3PA 4ALAL 3H9ZA 4Y7MA 1IFHH 4ZS6C 5CBEA 3R8QA 1NUDA 3W11C 5C3LD 5DHYA 4F7PA 5IFJA 3MUJA 2A6DA 1UVQB 3WLWD 4J4PA 4WHYG 3QUXA 1U8HA 2HG5A 3UTQB 1MRDH 1ZVSA 4KKAC 2BZDA 5E94A 4YXKH 4NGHH 1ADQA 4HPYH 4HT1L 5E7BA 4YXHL 4C83B 1BFOB 3HFMH 1AQKH 4XBPB 4GT7A 4AIXA 1ZLVK 4L5FH 4ZUTA 2ADFH 3KYOB 3MJ7B 2H2SC 1DQJB 4PJEA 4QXTA 3HCVB 4FQIH 2E9IA 1MWAH 5GGQH 4B0MM 3T2OA 4POZC 1A47A 1NGWB 2OL3B 4NHCH 4KRMB 4W4NA 2Y5TB 1JPTH 4NCC1 1PW3A 3DO7A 4KRPD 4L4TD 1KOAA 3H7LA 5L7XL 4PGEB 3OX8B 1MNUH 3U46A 1SVZA 4WJ5B 3MV8B 4RMRA 2YKLH 1NDGA 5E6IC 1S7QB 4QOKA 4Y16C 3LKNA 1G9MH 2UVFA 3CVIH 4KTEH 5CMAB 2ICEA 3MRJA 4EDWH 5E5UB 4CVXA 4YUEH 4M8QB 4HUWB 1JHLL 4XBGA 4ZNEA 4M5YL 3KPOA 4DGVH 1EA9C 4HS8H 1D6VL 2I9LB 4QT5A 1HSAA 3BQUB 2NR6D 1N6QL 5CBEB 3ILPB 3BH8B 1FZOB 4LSDA 3CDGB 1AXSA 1PKQB 3T0VA 3BH9B 3QNYB 1CK0H 2PTVA