3VXTA

T36-5 tcr specific for hla-a24-nef134-10
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
199
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLWGTYNQGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords T36-5 TCR alpha chain
total genus 33
structure length 199
sequence length 199
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxtA02
3BZFA 1UWGL 3OJVC 5D7LD 2BDNL 1IQDB 1V5JA 4WW2B 1WAAE 1YNKL 3MGTA 3QXDB 4LLDA 3UTQA 1IQDA 5FYLH 5IQ7H 4XP6H 1YJDH 4HCRL 4Y5VA 2R1XA 4MDJA 4RFOH 3AS1A 2MWCA 5I9QB 3SDYL 4P5TB 1XGTB 4F37F 5TDPB 2NY7L 3WUWG 1LEIB 3DIFA 2CGRH 4U3XA 3ARGB 4HS3B 1KEML 1QFOA 2GK2A 4W6YB 3G5VB 1MFAL 1G6VK 1MIEL 2B1HH 3NFPB 4PRPA 4WI6A 5AUMA 1O5DT 2DDQH 2WBKA 3QUMA 4U33A 1J1OH 3OAZK 4YHLH 3RX5A 4D8PA 2WP3O 5E56A 4JN1L 1QSED 3GUTB 3KPLA 2WMPA 3G6JB 3WKMH 5L6YH 1MFDL 1MCBA 1UA6H 1FZOA 2VE6B 5DD3H 3BSZH 2IGFL 3I6LD 4XNXH 1KNOA 1F6AB 4X7FC 5EDXA 4Y7MA 3UMTA 3EDFA 4L9LC 5C0BD 2HRLA 5JA8B 1BVKA 3LHPH 5HHPB 1BAFL 1VGEH 2B2XL 1Q1JH 2I5YH 4FTVE 4NQEE 4O5LH 5JA9A 4D2NA 3ZKNC 1BZ9B 1WT5A 4IOIA 4MHHG 4MNQB 4B5EA 2BDNH 4D0CA 1BVLA 1UG9A 5IM7B 5I74C 2R1WB 3QXUA 4WFGD 4X9BA 3MCKA 4LCIL 4M7LT 1PZ5B 5CMAA 4WHCA 4UDUA 3U9PH 4BSWA 3W0WA 4WJ5B 1P9MA 5E6IA 3MRQB 1A6TB 4JRYE 4BSWB 1C08B 1D9KA 4YAQA 4DVRL 3G6DH 3X13B 2J8UE 5FECA 1WV7T 5E70A 1TLKA 3DHJA 4RMQA 5IVZB 1P4IL 3PWPD 4X99B 4ORGB 1J1OL 3FZUD 1ZHBA 2AK1H 4PG2C 5FGBA 4Y19A 3R1GH 4H8WH 1CFQB 3VXMA 1ED3A 4Z8FL 4IHOB 3TN0C 1ROWA 4EOWH 1IGIH 3DGGB 5I18L 4E41D 1Y6NR 3MRDA 4JLRB 4HMCA 4XP5L 2AV7A 5GRWA 1QBMH 3S88H 1MSPA 3J7HA 3C9NB 4G7VH 4OZGA 3PNWA 4J3TA 3HCVA 4JVWA 1NGWA 5MERB 1N6QH 4JB9H 4UU9A 1KN4H 4YHIB 4ZOBA 1X5JA 1WQVT 3MXWH 5MERA 2A9NL 1IKFH 3C8DA 5JXAL 1YQVL 5FYJL 3BDXA 4PP2A 1H3PL 4GQ9H 5HVHC 4Y8DC 5IHUH 3PABB 4NQCE 4U1HB 5D7SL 4N0FA 3V5KB 1QLFB 5F89B 4LK4A 5ACMA 2SEBB 4HG4K 1PQZA 1NCUA 3IB4A 4GMTL 5DQDH 2HH0H 4G5ZL 2VR5A 4QHKJ 1XGTA 3VFGL 4ONHA 3WFZA 5KTEL 3QUXA 4HS3A 1I7RB 4ODUB 3QJFB 2YPLE 3NFSH 3M17B 3MYJB 4JM2B 5HI5C 4XPBL 2FCBA 4UI2A 5HGBA 1CFSA 2QQLL 1QFWL 3P0GB 4MJ5B 5FO9A 1W0VA 4NKIL 1JRHL 4UBDD 4H88L 4U3HA 4X6CF 1CT8B 2QSCL 1ORQB 1S7SB 4GRWH 1B4JH 3MUGA 3W39A 5I75C 1EHXA 1MNUH 2FNBA 3AREB 3IXTA 1DN0B 1K85A 1ORQA 4H26B 2NX5A 2LAGB 4KVCL 1JUFB 2XKNB 5BS0E 4QLRA 3LS5H 1F3JB 3EO9L 1KLUA 1CU4L 2A77H 5IBTL 2YUXA 2JB6A 3OKEA 2I25N 5DVKA 3RP1A 1XZ0B 3SO5A 5JOFB 5GS0L 1IL1A 3MOAL 3ZT6A 4ONFH 5JR1H 2J8UA 3NPSC 4CVZA 4K7FB 3H2WA 4XT1C 3GMOA 5FOBB 3SGEH 4EBQL 1P4BH 2KZWA 5KVFL 1HSBB 5HHNB 3MXWL 3HR5A 3A6OA 1RUML 4NNYB 3BYTA 2OJEA 1IM9B 1NUFA 2Y36L 1T20B 1SHMA 3M8OH 5TFSL 4YBQD 3RAJH 4ZQKB 4AEHL 2N7AA 4RGMB 4P5MB 4BFBD 4QWWC 4Y16B 2FJHA 4OFPA 5GSVA 2UV3A 4OZFA 5C0JA 3STLB 1ZK9A 5LVEA 4X4ME 4MNGA 4P3DA 5DQDL 4PB9H 3IT8D 1LDSA 2OBGA 3LKOA 5KS9B 5T1MB 2HN7A 1UXSA 2IANE 5EUKB 2YPLB 4KTYA 1FCCA 2JCCB 5IMOB 3HZYB 5K59E 1WCBA 5KS9A 3H9SE 1K4DA 3NN8B 4BSVA 3N1MC 2R8SL 3EOAB 4PJIF 2DJ4A 4HULB 3KPNA 4CVXA 4I9WD 4R97B 4AH2B 4A6YB 1BBJA 1RUKH 3ZYZA 4JFQA 3GSXA 1YYML 5FA3B 1JF1A 4M8QB 2DRUA 5DZNA 3WUWA 3V6ZA 2NY1C 2J6EL 1V7NH 2DLFL 3L5JA 4FQ1H 3MBEA 3M1BB 3REWA 4A6YH 3EYOA 5JUEH 3CVHB 1P4LA 1F58H 4PRNB 1DVFA 5IFJB 2BX5A 1QLFA 1FORL 3P3YA 5KVEH 3MRKA 1HN1A 2QQKL 1WAAA 1KXVC 4TRPH 2RAMA 5KVFH 7FABL 2C7UB 2XN9A 5I30H 3VGAB 5JOEA 2FATL 2ZP0T 5ELIA 5GISH 1XIWB 3MPCA 3LPFA 1RMFL 4QRUB 4N8PA 4AG4L 1VFUA 5JXEC 2F58L 5EZOH 3R8BB 5K9OA 3L3KA 2R0LL 2PYEE 2VLKB 1BVZA 4JO2H 1MOEA 2XXCB 2W65A 3LKQB 3C6SA 2GI7A 1R3KA 4MNQE 3VXOA 3MUGB 3DX9B 3W39B 2HVKA 4PLJC 1MVUB 1RSFA 2HFEB 3SKOA 1LEKB 2VLJB 4LPVA 1I9IH 4PRID 2XZZA 1MFEH 2MCPL 3VRJB 4QF1B 3TBWB 4M43L 4OCLC 4QXUL 1QVOB 4BZ1H 4ODTH 3VG0L 2R9HC 5DQJB 4HPYL 1ZXQA 5GGQH 4IRSA 5EC1B 4NZTL 4JZJB 2V9RA 1IGTB 1QBBA 1MREH 3E6FA 3SDAB 2P5EA 2J8UB 4CVZB 1QKZH 3KNBA 4LCYA 2QKIA 2XZCH 2BVEA 2ERJB 4MCYA 5HVFB 3ULVD 2OL3A 4M4RA 3IDYC 2ARJA 4UZGA 5ANME 3MO1A 5CP3H 1T0MA 4AL8L 4QCIB 3L5HA 1T7VA 1F58L 3OKDA 3EYFA 2QADD 3ES6B 1CDBA 3ZKMC 4OZFB 5LWYH 1JNLL 1D5IH 4ZUVB 4KMLB 2PR4L 3QEQB 4RAVA 1ZT1A 5JPMA 5HGAB 3BT2L 3S37X 3CDGB 4ZUUA 3T3ME 5IB5B 5EIIB 1K4DB 1KIPB 3S6CA 3TO4B 1NEUA 2OL3L 5CEXA 5I1JL 5DYOA 4PG9A 1AXIB 4OIIH 5EU3A 3WFEL 4LCWE 3SGKA 4M7JL 1ZA6B 2CR3A 1CF8L 4NQVB 2NZIA 3S35X 2LTQB 5DMGC 2VQ1A 4GAJL 2VDRL 3B5TA 3GMLB 4UIMA 1A2YA 3L1OH 3QUZD 4G80B 4ELMA 3SDXA 4M93B 1PKQE 4XNMB 1RURH 1G7LA 4G6JH 1PX3A 3Q1SH 4C55A 1BGXL 4XRCB 3MBEB 1CVRA 2N56A 3SGEI 3DBXA 4OQ1A 3DROB 3PHSA 3IJYB 2V6HA 1ODAA 3KPRA 4HLJA 4WW1A 5F7DB 4CN6A 4IS6A 3MRKB 4X4XB 2Y72A 4XNZC 3CD4A 4H0IA 2FB4H 3GJFB 3LQZB 1IZKA 1NC4B 2BFVH 1SMOA 3IDMB 1MCLA 2BRRL 3PWVA 1UB5A 2ZSVA 3KAAA 4EKXA 1XCQB 4HC1L 1NFKA 2PN5A 4LNRA 2FD6L 2FDBP 2HT3D 5D6DC 2W91A 4JQXC 3HC0B 3U2SA 4WFHD 5F1IB 3QNZB 1HXYB 3PL6C 4PRPE 3N06B 5ABDE 3ZKMD 1I1AC 1UM4L 3LD8B 4RBPK 3FONA 4C57C 4LSPL 2VLJA 4B7IA 4JVUA 3GRWA 3BI9X 3TFKC 2X4TB 2WINB 4LHQB 4KZDL 5F21B 3NTCL 4O4YL 5EWIH 4GAJH 4LLWA 5E1HB 3I3EA 1A1NB 4JFPA 5DMKA 3FRUA 1P69B 4H5SB 5J8OA 5ALBH 3QRGL 3O9WD 4K71C 1T5WB 3LEXA 4X6DE 1FJ1B 1IAKB 5DRZB 4D9RD 1BGXH 4KK8C 4WWKA 4MDJB 3CSBA 2VDLL 5I1KH 4EUPH 5D93C 3WFBL 1NDMA 4NO0A 4UT7L 1TZHB 1TCRB 4BYHA 5EOCH 3D3VE 4MJ6B 1YN6A 5BRZE 1QPPA 2AEWA 5FM4A 1N5YH 3B43A 3D0LB 2ESVB 2X70A 3BPCA 3O3DA 2O5XH 3OZ9H 4Y4KC 1YY9D 5DJ8A 4BM7A 3FO1A 5ITFB 5JDJA 1T22A 1A9BA 3LKPB 5EU5B 4LIQL 3VE0B 2FSEA 5EIIA 2YXMA 1A6PA 3W9DA 4LHJB 5EU4B 1SYSA 1OD9A 2DBLL 4GG6F 4MVBC 1BQSA 4X5WA 4NN6C 1N0XH 4Y4HC 3U48A 1FBIH 2EXYD 3DHMA 4X7TA 4G8IA 2R2CA 1AQDA 3OXRB 2DN7A 3DVNB 2IANB 5L2KD 2E7LC 4S1SH 2CO7B 5F7KC 4LAQL 5J56B 4HS8L 1MJUH 5F8QC 5JORA 1JHTA 1VSCA 2YSSB 3DBXB 4QHUB 3QIBB 1GIGH 1BZ9A 2XG4A 4HIEB 4LL9A 4DZBA 1GGIL 2R23B 4N0CC 4QHUA 1RULH 4O2FB 3T0EE 3QUMB 4HFUL 2R1YA 3X11A 4WFFD 4WWKC 4F3FA 2R2BB 1JHKL 1K4CB 1FLRL 3RVWC 1HK6A 3JTSA 4ONOA 5C71A 4IRZL 1HILA 2VNCA 2VAJA 1UB5B 2VDLH 1N3NB 3DSFH 4WV1C 1Q0YL 4GG6B 1EERB 4RGNB 1DBJH 3HRZB 3O2VH 1AO7D 5IVZA 1RVFL 2HT4D 2G2RB 3T0EA 1JNHB 5F9WB 3S5LB 1NBQA 3CLFL 5D1ZB 3GIVB 4Y19B 5HYJD 5A1AA 4FXGA 4FTVB 4NQEB 4PJAF 4L9LB 3JXAA 1MRCH 4O2EA 3UBXG 3ARDB 4JLRA 4Q97A 4C59B 4Q9RL 1S7WB 4FN0A 1F4YH 3C9NA 1D5XB 1CGYA 1PAMA 4WO4A 1MI5D 4OD1H 4ETYA 1N0XL 2VL5B 4O9HH 3UTTD 1JYXA 3PV6A 4GMSL 3DMMA 2GT9A 4AIZB 3TWCH 4Q2ZA 4GBXA 3PWLB 5DFWH 1JMXA 3SKJL 5HYQA 1A6TA 1E4WL 1ZLUK 2A73A 1ZMYA 4Q2ZB 4JM4L 4MD5B 3U30C 1D5MB 3F58L 1NCDH 4R3SB 3X13A 1KULA 3V8CA 1G7MA 1KBGL 5DD0L 2IEPA 4NQUA 1TZHA 1XGPA 5JLZA 3K4AA 5FO7B 4MJ2A 5C3LD 3BPCB 3O3DB 3DUSA 2OK0H 4TSAL 4YFEA 2VQUA 1NLBL 1DR9A 1PKQB 1T1XB 4PJ9B 4GO6B 4RMTA 3VE0A 2Z4QA 1QUNA 3TFKD 2A1WH 4X9GA 2KKQA 3TN0B 2VE6A 5H37H 2JTDA 3RKDC 1RK1B 1YYLL 1VESA 4R7DA 1XF5A 5IHZA 2V5SA 3IXTB 1INDH 3V5HA 2P47B 3H7BB 1T1WB 5JHLH 1SBSL 3IFOB 4OCXL 1Q0XL 2DTML 1W8NA 3NA4A 2R29H 4S10A 5FKPB 3KJ6L 3CJJA 2ZWLT 1BOGA 4OZHA 2NY3B 3G08A 1CD0A 3QG7H 1CYGA 4D94A 2OR9L 3MFFA 4KMTH 4OD1L 2YK1L 3I02B 1B0GA 1TVHB 4GBXC 4NOBA 4APQD 4XPGH 1NKRA 1HSBA 3TNNB 4ZFFB 1OGAA 3P77A 5A16B 4MAYB 4W6WB 3B3IA 2CXGA 5I8EB 3JWDC 3JWOH 2LU3A 1XF1A 3U0WH 1MCQA 1IGIL 1ORSA 2BNRE 3DYPA 1JWSB 4MQ7B 3GSWA 3ROLA 1VFAB 4U1NA 2Q8AH 4P3DB 3OXSB 3GHEH 4N9GB 3QUMH 3P4OA 4ZFZA 2IPTH 4ORGA 4H1LG 4WFGE 1RZ8B 1UVQA 3AVEA 4GQ9L 4X80H 4Q58C 4GXVL 2Y23A 2E27L 3W9EB 5F7HA 4JFDA 3W9EA 1P2CA 5MENB 3CFDB 1REIA 4N8CH 4Z7OF 4GMTH 2FX9L 4LHUB 4PD4J 5C0GB 3VDCA 5KTEH 5HHNA 1OAKH 1FL5B 2CO6B 1ZWIA 1LO3H 1S3KH 3RI5K 3ORJA 4I3SL 2F53E 5DHVB 4PJ8A 2IH1A 3PGDB 4MLIA 1C8PA 3WFDH 1I4FA 2VUYA 2CMRL 4LCWA 4NP4L 1QFWH 3EJZD 5KVGH 1BFVL 4EI5D 4XCCH 4HXBL 5DEZA 4KMTL 4NN5C 3P11H 1QACA 2IH3B 3MNWA 1UXSB 2OR7A 2YRZA 1CE6B 3IDJB 1DQML 3DXAB 2F53D 1OOAA 4ODHL 1KOAA 1CU4H 3VFRB 3RFZC 1ACZA 4GRMA 5GRUL 3QCVH 4FQIH 2QQNH 4YDIH 2EE2A 2H26A 4J23A 2CK2A 1A0QL 2W0PA 4R8WL 4I3RL 4XH2B 5JW4R 1RZFL 2ICWJ 2I9LB 2Q8BL 3GHEL 1ZGLP 2NXYD 3DVGA 2W65B 3LKQA 4IOFD 3IF1A 3SDXF 3MRIA 5D70L 3IJSA 1MRDH 1RV6X 3JV5A 4PJXF 3H7BA 3IGAB 1EVUA 4YK4C 4EI5C 2D7NA 1GZPA 1WK0A 3UC0L 4G6ML 3RIAK 4DW2L 2JJTA 4KRMB 2Y07L 5CZVH 5D8JH 1L9MA 4G8FA 2CK0L 3MJ7A 1QP1A 1P7KA 2AJ3A 3A6CL 1JPSL 4IRJD 3TBSA 4JPKH 4PJ8C 5M95B 3MA9L 1ZANL 4NPYB 3P9MB 4QRTB 4KQ4H 1FNAA 4NNPH 1KV3A 4QRUA 1DBBL 5SWZE 1DANU 3CNKA 2C3GA 4MVBD 3STLA 4Y19E 3PWUA 4JPWH 3WEXB 2VLKA 3MRGB 1NC2D 2H32H 1FNEB 4GKNB 4QY8B 5FOJA 5BV7B 4I18C 4HUWA 5EULV 3BVNB 5CLWA 5D7IF 1JPGB 1DVFD 2JJSA 5D7LA 2OZ4L 3IU4H 4XVJL 1TJIL 3UTTE 3OJMB 2X5PA 2VH5L 4ZUSB 5GJTH 4BSVB 3TV3H 2PF6A 1SY6L 1QFWI 5F3HA 4LU5L 4UUJA 1PSKH 2EDHA 3QO0A 3U46B 3SDAA 1FO0A 4ZOCA 1A7NL 4U1GC 3UXFA 3HMXA 5I1GH 4YHPB 3GO1L 3DV6B 3RWFA 4G7YH 3TP4A 1HKLH 1W72B 2CIKA 4KGLA 4PJIE 3O81A 3OBAA 5BO1H 1XCTB 2GITB 3VXQA 1UH2A 4ZUTA 5K59F 5IOPB 4AMKH 1QRKA 4L3CA 2Y9RT 1CTOA 1R5WA 3MNZB 4QRPA 4U6XB 2IBZX 2F19L 1FNSH 4X7CC 5T1KA 4HG4J 4G6KL 1BBDL 1LO0L 1ZT1B 5DJ6A 1TPXB 1T1ZA 3DROA 3BIKB 4QGTA 3PHOB 5B3JE 4Z7UA 2AERT 1FYTD 1X44A 2FL5A 3MLVH 4GSDL 3QDJB 2FBJH 2WUBL 1WEJH 4Z95H 3VXSE 4NYLB 3TIDB 1H15B 3SQOL 2R0ZL 1LD9A 2PXYA 1CXLA 1EZVX 4BFGA 5A2FA 1YEGL 1ZA6A 4NHCL 1NAMB 2E7MA 2APVA 3RJQB 5C0FB 4PR5A 2W60B 1UZ6E 2F8XC 3HE6A 5ACZA 3GMLA 2GQHA 2ZOLA 3NCYP 2OZ4H 3NIGE 4EUPB 4P23B 1CQYA 4XWGL 4AY0A 4WI7A 2Y6SC 4LKCB 4NQDB 2VLRE 4X83A 1KTDA 2HFFB 1LVEA 1N5AB 2W0FA 1XAUA 4WW1B 1C5DA 3D39B 4RMRA 4WTXA 4X6CE 2J8UF 5SWSB 3BXNB 1UYWH 3PIQB 1TJGL 5F7EH 1HKLL 1A3LL 3IDMA 5CD3B 4OD3L 2D31B 5GS1A 1DL7H 1J0ZA 1L4IA 4PV9B 1FAIL 5E03A 5A2KH 5I1JH 3EYFB 4LNRB 3ARED 3HE7D 1AGDA 4GLRI 4P48A 5ID0B 1MI5E 4M7JH 5IF0A 3WS6C 4WENB 3QDMD 1X5YA 4PY7B 2BHUA 2JB5L 4LCUA 1N0LA 4DN3H 2XY2A 3L1OL 3O2WH 3FO2A 1N59B 1N2RA 3RVXC 1QSFA 3FONB 5TE7L 2I26N 5F7YC 4Z95L 5IB5A 1LEGA 3MV8A 3FT4A 4JPIB 1OTSD 3MXVL 4S2SA 2EYSA 5HY9A 4ZFOA 3MGTB 1HYSD 4KROB 2FB4L 3FRUB 2IPKB 2BFVL 4ZOEA 1R3JB 3L3IB 4U1LA 4P5TA 1R3JA 2XTJD 4FQPA 4GLRH 3IETA 3IXAA 1M6OA 1HQ4A 2XFXB 3HZKA 5JTWA 4PTTB 3ULSA 4X4XA 3B8SA 4DAGH 3VWJA 5J0BA 4D8PB 1ZLVK 2Q3ZA 5E7FA 5JHDD 5D2NB 4HK0B 2P24A 3BYYA 1VACB 5EU4A 2P24B 3BPNC 1U8NA 4WI8A 3VH8G 3EYQD 4NN7B 4EN3C 1KNOB 3CFCL 4UT6L 2VXVL 5DHYB 1MJJA 2QEJA 3GMNA 1OF2B 1U2HA 3FCTB 3O2WL 5ACZB 2GSGA 4QGYA 5TDOB 3QJHA 3SN6N 1I3RA 4NCC2 1IEHA 4FTVA 3OKLA 4N0YH 4NQEA 4Y5YC 2R0KH 2APXA 1I75A 3ARGD 4NQDA 3JVGA 2X9YA 2C1PB 4LCCB 4OLUH 1PZ5A 2IMMA 1TETL 4Z0XA 1NEZA 2X1WL 2DQJH 5GGVL 2AEPL 2VN4A 3QEGL 4DKDC 4X7SL 5EBMB 3IJHA 5ANMB 4EUPG 3BH8B 1LNUA 2NY0B 4K9EH 1I3GL 1VA9A 5DRZA 4HAGA 1LNUB 1M7IB 5DT1H 1L6ZA 2DBLH 5IB3A 3BOVA 1UM6L 3T0AA 5CJ8A 3HNSH 1KJ2H 3OTTA 3FQRA 1LE5B 2VO5A 4PY7A 4HWUA 4IHOA 1AC0A 3MLYH 1MCHA 1CDIA 4MA7L 3HCVB 3SGDH 1U92A 2YXFA 1PKQA 1T1XA 2LABA 1S9YB 5D1ZC 1JPTL 4HFWB 3TYGL 3QWOA 5FUOL 4EDWL 1ZKAA 3T4YA 3OGOE 1IILE 4XB8A 4PRHA 3RX7A 5HI4D 3DMMB 3OAUH 4O51A 3MJ9A 4PRHB 3SBWA 3PQYE 2AEQL 3CZFB 3VA6A 1ND0A 1QBAA 1RK0A 4HV8A 3IFOA 3QXDA 2IANA 4KKLC 3RDTD 1RK0B 2NR6C 4GRLD 2XWBB 5DGQA 5FA4A 4JREC 3TM6A 4ISVA 3B6SB 5DUPH 2W9DL 3B9KD 3MRMA 1WFUA 1MHHA 1OCWL 4GAYB 5D7KE 1J88A 4LLVA 3QH3A 4MB4A 2Z9TA 3TZVA 1XR9B 1MWAA 5GGVH 1U36A 3HZMA 4F3FB 4M1CC 3CFKA 3OWEA 4DCQB 5T33L 3V4VL 5E94A 1R5VA 2UWEF 4LGPB 3GMQA 3ARZA 1LO2L 1I85C 1IEAA 1OLLA 4F37K 1IGCH 4L29B 2NYYD 1WF5A 2YN5A 4F8QA 2KL6A 1UCBH 3RPKA 3HNSL 2A9ML 1KENH 4O02L 6CGTA 4NJAL 4YXHH 1YEIH 3WNKA 3JV0A 4HWEL 4KAQH 3VGDA 4YHYB 2Y4SA 5D72H 3S5LA 4ZO9A 5I1EL 2BSTB 3BEVA 2GK0B 3DXAD 3KPPA 4NM8L 1JK8B 4UB0H 4YPGA 4DGIH 4H8WC 3BZDA 3ARFB 5IEKA 4GAFB 1NGXB 3VD4A 3MZTA 3MFFB 1F11A 1V3LA 1K9TA 2OR8A 5CAYB 1EGJL 4CL7A 3KPSA 4ZD3L 3S3SA 5DJDB 3NIFE 1X6NA 4OLWL 4D9LL 1CD9B 4P5MA 2NNAA 1G0XA 3IFLL 3TCLA 4M8VA 1UADC 2DM2A 4JR9H 5LCVL 1FQ9C 3H9SD 1ZT4A 4R2GB 1OL0A 2YD3A 4MD5A 4WY7L 3QFDA 3RL2B 3TZVC 1G0YR 5DUPL 2F8VA 1G7HB 1YEFH 4L4VD 4F7PA 5FYJU 5EIVA 1Z6JT 3SDDC 1EAPA 5H35B 3RGHA 3BP7A 4I18A 5D2NE 3F7RA 1CE6A 3QRFM 1G1CA 5K9KB 4HKZB 3DUUB 4I77H 2QBWA 1C08A 4G9FD 3HHRB 1JGUH 1MFBH 1ONQB 4FMFA 5EBWB 1WCQA 4JG0L 1Q38A 2OR9H 4UOJA 5F1SA 1IGCL 4N0CD 5C0BE 2I9LA 3VXTB 3H9HB 3LQAL 2A9MH 4KJYB 1E4JA 3LH2H 1ZLWK 3W82A 1ZHBB 4N8VG 3MROA 4JGUA 4U3CA 2MCG1 3K46A 2JK5A 3RGVA 4LARH 4NT6A 1RUAL 3PABA 3RX8A 3I50H 4L4TE 3G08B 4KY1H 5FUCC 4G6AD 3L9RB 3UYOD 2C7UA 2APBA 2PXYD 4YFLI 5GGSY 1TVHA 1MHHB 2FX8L 5J9PA 2XZAH 4MCZB 4LMQE 5JIHA 3VCLB 3TNNA 1IAOB 3FB8A 5J9PB 1Y6KR 4IMKC 2A2QT 3QJFA 4OV5B 3VCLA 4X80L 4GQPH 3VXUE 1S8DB 4P2OB 5IR1A 4JHBA 5F89A 1S8DA 4P2OA 4WY7H 2AXFB 5E94B 2VDOL 5BVJB 3WEXA 1HHKA 3LY6A 4LSRL 3GSOA 2WWKT 8CGTA 3C2AH 3WHE0 3G6AB 5EZJB 5GRXG 5GGRY 1AGFA 2NXZB 3S5LG 3V0VA 5E8PB 3MYJA 4JM2A 5FYJD 1T66C 1EFXB 5D7LB 2CGRL 4NQCB 4Z7UF 5DS8B 2Z8SA 4KDTC 1HWGB 3U0TB 5B39B 5J1AA 3RZCD 4NKDB 1J0KA 3RVVC 2P5EB 5F6IC 4XCCL 2AJYH 1FO0L 4KUCD 5CHNB 3AREA 5I1AA 4I2XA 3HMXL 1FL5A 3QWRD 3VWKD 1Z5LA 3VMOA 1DQMH 5IVXB 1FFRA 1BIIA 1XCTA 2GITA 3ABZA 3TYFB 2Q7YB 1Q9LA 4PJ8B 1I4FB 3U4BH 4YHOH 4I4WB 5L9DL 4V1DE 5SWZA 2KH2B 4P2QD 3QEQA 4AT6A 5JPMB 4I4WA 5KAQG 1YZZA 1YMMD 3OF6A 1FV1B 1BAFH 1VGEL 4NNYA 3MACL 5DK0B 3UJJL 2FZ3A 3QIUC 4PJ7F 4P2RA 2H6PA 2FEEI 4PJFF 3H42H 3T08A 1CLZH 1WZMA 4HJGA 2CLZA 5FHAH 4XCFL 1QBLH 2UVEA 3B9EA 3KJ4C 5CEZD 4XH2A 5IFHH 2ZUQB 4OGZA 3ESVF 5FCSH 3DVGB 2FO1A 3OAYK 1AD0B 3SDDD 1RUQL 4G80A 3G6DL 3L5XL 3BP6B 1G7LB 3VXQB 5CKAA 1ETZA 4YHZH 1ZOXA 4G6FD 4ELKB 4K8RH 4NJ9L 5JQHC 1QLRB 3I6KA 2ICWI 3WUZA 5JNYB 4ZO8A 3VGEA 3P4MA 4ELKA 4A2LA 4P9HC 1INEL 1JNNH 3ZDXF 3T0XA 1PFCA 3BP4B 4Y1AD 2E6JA 1AD9A 3HUJB 4J4PA 1R0AL 1J18A 1EBPA 2V2TA 3H8NA 3SO3C 3GKWL 5FV2A 3ZKSD 3T2NH 1HZHH 3V4UL 3S88L 2DQDH 3QULB 4QT5A 1L0XA 4QRTA 1HOCA 4W4NA 3VWJC 3DV4B 3M1BA 5F88B 1RZKH 3KS0J 1N6QL 1Z9OA 1KTRL 4FFZH 3HI6H 3T65A 4JRYA 2AJSH 2IG2H 1M4KA 2A9NH 4GUPA 3RRQA 2GTWB 4XMKH 1MJ7L 4P46A 3N1QC 4MQSB 4QY8A 1T3FB 5KJRL 2XN9B 3UJJH 5H2BA 4J12A 1QNZL 1RJLB 3C6SB 5B8CC 4P2RE 5BS0B 3HG1E 5TF1H 35C8H 2EKJA 1MVUA 1BQHB 1UWGH 1S5HA 1WZLA 4EDXA 2VDKL 3TA3D 1BQHA 3B2UD 2W0FB 4UUJB 3RWHB 4Y8AA 1MF2H 3NMEA 3KYNB 5GS0C 3EOTH 3SE8L 2CDGA 4OIAA 1CLYL 1FRGH 2FEEL 3Q5OA 4PJDE 3GSNB 2X4RA 1RUQH 3D3VD 4JKWA 3UO1L 4AM0A 3L5XH 1CGWA 3U0PA 1ZTXL 4WHYH 1FJ1A 1BPVA 3FRPA 5F9JA 4OI8A 4RISL 3FFDB 4J4PC 5MEND 5EN2B 4L3CB 5KSBA 4J3SA 5TJWK 4TNWK 1YN7A 4XBGA 2ADJA 4XC3H 5DFVD 5B4MC 4Y4FA 3KXFB 1L7IL 5HI4C 3GKWH 3VXSD 3ARGC 3VFOB 4YGAB 4WUKL 1O7VA 2EDXA 4PIRF 2JCCE 1TVBB 1PBYA 1KXTB 2UWEA 1RJZB 1WIOA 1IKNC 1J0IA 4QCIA 5E9DE 2IGFH 3QFJE 4NRZA 2IG2L 3FT4B 4JPIA 2RR3A 4JFED 3TT1H 1AR2A 1CK0L 4NRZB 4FQQB 5JO5B 4HPOH 1N64L 3MLUH 5KJRH 1HKFA 1OPGH 1UYWL 1TJGH 1NCNA 3HE7C 3OXRA 1F3RB 3E8UL 2EC9U 1G7IB 1RFDL 4ACPA 4LLMB 1I3VA 4XWOC 1NC4D 4KROC 4FFWD 3Q6GL 3SDXB 3D85B 4PG9B 3DWTA 2VITA 4UV4H 4Z7VB 1NAKH 1MF2L 4OAWA 3SY0B 4XX1E 2DQFA 2RIKA 3SE8H 1MCPH 3D39A 2HRPH 5HVWA 4XXDA 3EW3B 3HC4H 1FDLH 2DLTA 2HVJB 1NCBH 3ARBA 4U1JB 3PIQA 4OSUH 4POZC 5C07E 1DQJA 4LPWA 5DC0A 4PP1C 3VGGA 5I74B 2HVJA 3ARBB 3FO0H 3SDCD 5HYSG 4XNMA 1YYMH 4J1UB 5TE7H 4ZTOL 1YJDC 3K1DA 3O3EB 2JLLA 3T65B 4GG6A 5DURD 2NZ9D 5I16B 2ADIA 3G9VA 3HLAB 3RVTD 4U0QB 5I16A 3JTTA 1JWMB 4JKPH 2JE8A 3GJFA 1EHLL 4F33A 3EKCA 3JTTB 3S8WA 3RY5A 4KV5F 1YEJH 3RL1A 4O2EB 1ZE3C 5FIEA 5IQ9A 1B9ZA 4FA8A 3QHZH 4OCRH 1CK0H 5JZ7C 5F96L 2C9AA 3B8YA 2XOTA 3MJ9L 4XNYH 1T7WA 3S96A 1RMFH 1JZ8A 4OCWH 2XTLA 2AXGA 5BXFA 1S7UB 1RJYA 1A64A 3O4OC 4IJ3B 3DVIA 3SE9L 4RZCA 3ILPA 2R0LH 1OD7A 2HT3C 3E6HA 3JVGC 5KG9B 2FR4B 5IHBA 3NAAL 3UAJC 4ZXBB 4XP4H 2F53A 4U1LB 3JV4B 4J6RL 4ELME 2M1KA 3E6HB 2XWBA 5ADOL 1T5WA 3LEXB 3CU1A 3G6JE 4HKJB 1FZKB 3GBLA 4OBSA 5B3NA 5I17B 1P7QA 2P8LB 1R3LA 3OR6B 1FSKB 4FQXC 2MCPH 3DIFB 1I9IL 3BIAX 1CGXA 3HC4L 4Y4FB 2QQLH 1IGFL 5FYKH 4Q0XL 3NFPA 4PRPB 5DJAB 4M6NH 1M7DA 4U31A 3RDTB 1EO5A 2NY4C 4M1DL 3CFKB 2XZCL 1AJ7L 4WUUB 4E9LA 3IKKA 3G5VA 4RGOH 3TJHD 3IKCB 3BRGC 1X5LA 1DQQA 1MQ8A 5DZLA 5FGSA 4GXUM 4PRPD 1NCTA 4HGKC 4KJQC 4KKLD 3ZE1E 3U82B 5I75B 2JF1A 1DFBH 4LPTA 1ZSDA 2AKRB 5D1XA 5ESVB 1OF2A 3MV9A 1OAXL 3WNNA 2AJVH 4M9PA 3FHQA 3DX8A 1ZSDB 2AKRA 1UZ8A 2YD8A 5D1XB 5ESVA 3DO7A 4L3EE 1GAFL 3I9GH 4Q9QH 2GJZB 3LQAC 2DQIL 5TFSH 4AEHH 3GFUA 3CFIC 4JO4H 4RDQG 3O6KL 1BF8A 2DKUA 1MCOL 3UYRH 4F7CA 3K81A 2HMIC 4K23H 1XR9A 4D0CB 2OL3H 3IDNB 3TH4T 4BZ2H 5IM7A 5HHOD 5F1KC 4DZBB 3SE9H 1J1PL 5IHLB 5FB8B 4DUXA 3HZVB 5CMAB 3F12A 1FVDA 1CGVA 5ISZD 4TN9A 4PJEF 2R69L 2V2WA 2C5DC 5DEFA 5C6WH 5JIIA 4WNQB 4X6DA 5D96C 1A3RH 2D7OA 4IOIB 1TZIB 4MNQA 1L9NA 4WO4D 4EN3D 1SY6A 1S7RB 1PGRB 4G6JL 2R23A 1RZ8A 4YGVA 1N4XL 3RPIA 4ZUWB 2AEQH 2FO4A 3V4PH 2F9BT 1RUKL 5E6IB 4K94H 4Q7DA 2J1KA 1OARH 3KPPB 4YPGB 4GW4A 1A7OH 3ZYOA 1AJ7H 4LSTL 2F74A 3EOBA 4RGOL 5C0GA 3TPUA 3VI4E 2LU4A 4JFFA 3P30H 3EOBB 5JUEL 4XX1G 5D71L 3NIDE 4MS8D 6FABL 3T0EB 1U3HC 5DR5L 4L8SA 3RUGE 2GUOA 1H3UA 3NPSB 3WS3A 1UEMA 2EDTA 2QQKH 4PP2B 2GJ6D 4UAOB 5JOPD 1GAFH 3I9GL 4KHTL 5AWNH 4CMHB 5FA4B 3OX8A 1FZJA 5I30L 2E7BA 5GJSL 2CIIB 2P46B 1K8IB 2HFGH 4DEPC 3W2DH 4ZNCD 4BSJA 4XAKE 3NABH 4ODSL 5IMMB 4NJAH 2NY6D 4YXHL 1U8KB 4UNTA 1ZLSL 3STBA 4DVBA 4KAQL 5J4MA 1TQCC 5HYQB 5DTFB 1NUNB 2BSRB 2XA8L 2R69H 1CR9H 1B0RA 3ZTJH 1PQZB 4OGXH 1QFWM 1G7MB 3FQTA 1FPTH 3QUXB 1NLDH 2N1KA 2A0LD 1S7SA 3OG4B 4PUBH 4B50A 2DJUA 3M45A 3IGAA 2FLRT 5E8DL 3QUYA 5F1OB 2MQ0A 5HGBB 2YR3A 1S5IL 1WLHA 5LGHH 3WLBB 4ZSOB 3QZWB 1MREL 3MV9B 3R8QA 2D7PA 1VCAA 2IAMB 3B9KB 2EIDA 2RGSA 3DO7B 4R26L 4HF5L 4LPUA 2IJ0C 1KB5H 1R24B 2ICEB 3K74B 1BZ7B 3GI9H 5FGCE 1T6WA 4MZ3A 5HPOA 1F3JA 3RVXD 1L0QA 5IWLC 5L0QB 5D2LE 1AO7B 1F02I 2W38A 2AV1B 2BVUA 4CU7A 2PR4H 4M5YH 3BZ4A 1MFAH 4WVRA 4YXKL 1Q9LB 1T83C 1UWEH 5GS1C 1BOGB 4OZHB 4OZIA 1YA5A 2ZG3A 3CDFA 43CAB 4UQ3B 3HNVL 4XNUH 4F7PB 1GXEA 3BVNA 1SBBA 2PTTA 4GOSA 4PJBF 5KSAD 3RA7H 2QV2A 4TUKL 1RZIA 4ZFFA 5T1MA 4P9HH 5EUKA 2OQJA 4Y16A 5I71B 2V5MA 4Z5RA 1EIBA 3VFSA 2A6JB 1UA6L 5DI8B 4ZUWA 4U6YA 3AUVA 4MA8L 5DD3L 1OAYH 4MNGB 3VFSB 5J1AB 5EUOF 4XNXL 1MI5A 1MCRA 4GW4B 4DGYH 5KANI 1JHKH 1P2CB 1U95A 5CHNA 1JF5A 3ZDZF 1SJVA 4RAUB 1RY7B 5IGXH 3UTTB 4QTIH 4LHUA 5J89A 1DJSA 4LMQI 3T4AA 5SV4A 1WBYB 1ZWIB 1YQ2A 1EMTH 4XBPB 3L95B 4L8DB 4WTZG 4KTDH 3JV6A 3ISWA 3M07A 3QI9C 3VFTB 4Z9KB 5SWZB 4BH7B 3BHBA 1C12B 3HMWH 4F9LA 4RX4D 3FN9A 4PYHA 4RNRB 1ZA3A 3EDDA 1RJCA 1GGCL 4BH8A 1EFXD 2L7JA 1OT2A 3SCMC 4RFEB 3QFJA 4XGZA 5GGSB 3QDJA 4ZODA 4PRBB 1OTTC 2LAAA 1AHWA 4LQ1A 4QRRA 3DX6B 3GGWA 1W0YT 2FD6H 4ODVL 4ZS6C 3D2UD 1CXIA 1KN2L 2BY0A 1Q94B 4GMSH 4X6EA 3MLZL 5FYLD 1D5ZA 4OBRA 5GGUA 3U36A 5C2BH 3SKJH 1HHHA 4LSPH 3RA7L 4Z8FH 1XGUB 4EOWL 4HX1B 3N85L 4K7PL 1XGUA 5E8PA 4GXUN 2Y25A 5IMKB 3K7UA 5CSZA 4P2QB 4Y2DC 1WFTA 5GGVY 4FZEH 3HRPA 2DS4A 1J5OL 2MQCA 3P73A 3P4MB 5CSZB 5CJOL 1C5CH 3S3PA 1NC2A 2C3VA 4YC2C 1BM3H 5ALBL 2WV3A 3LOWA 5AZEH 2JJVA 3VXOB 1NC2B 1X5ZA 2C3VB 1IGTA 1ZLVH 5I1AB 3G6JF 1ZLWH 1KPUB 2AJ3B 5DRNB 5I1KL 3VRJA 1N7MH 3SO3B 4PJIA 4YBLB 5DRNA 1JUFA 1QEWB 2P8PB 4K7PY 3TYFA 5I15L 2AV1A 4PV9A 1CDUA 3SDXE 1HH6A 5CIPB 4JZJA 2BNRB 2YWYA 1HH6B 3MSPA 3GJFK 1IL1B 1YJDL 2QTEA 5FDWB 1J12A 2F54D 5E6ZA 4GKNA 3ZMRA 2ICCA 1I7ZA 1UC6A 1RQ5A 4KVNH 1EA9C 5BS0A 4JHAL 3VFUB 3TH3T 1IM9A 3WNOA 2A6KB 4MJIE 2X9XA 2QJDA 1E4XI 2A6KA 2B1HL 1HXMB 2DDQL 1FFNB 4HCRA 4HUXB 2E9JA 4NQDE 2JIXD 3L7FA 1HXMA 2Y5EA 4S1SL 3ESUF 2DB8A 3NGBB 3G04B 1JPGA 5DMJB 4JN1H 2ZOKA 3MOBL 3V4UH 1MCNA 3PWJA 3V7MA 2X4QB 2VQ1B 4P3WA 4Y4HB 1JYNA 4WDIB 3BP6A 1JFQH 1A2YB 1M71A 3PWJB 2YPLA 1G7IA 1QZ1A 1RZKL 3CFJB 1EAJA 4LLMA 3BSZL 3ELAT 5C3TA 3IETB 3IXAB 1RU9L 2AJSL 5AAMA 3CFJA 1G84A 1CBVL 1C5CL 2EIZB 2OMBA 4XMKL 3N50A 1C12A 4EJ1C 5AZEL 3PDDA 4XP1L 2O5YH 4IRZH 4MNHB 4XXDB 3QIBC 3BIKA 2EDBA 3CX5K 4N8CL 2X4UB 3QFJB 3SGJA 5TF1L 4XVTL 3DV4A 2FX9H 4U1MA 3RZCC 4D0DB 2HTLD 4DFHA 3TJEH 4M62H 5J6HA 3EYOB 1X5FA 4N0UA 5IJVB 4IS6B 1QLEL 5EIQA 2ADIB 1IKNA 5E8OB 3KPSE 1JGVL 2ZUWA 2GSGB 2XA3A 3X14A 3RTQA 4KVNL 2BMKA 3AAZA 4BUGA 2KPNA 4GG8A 2DMBA 1F90L 5CCKL 4ZS7L 3BEWB 3P0VH 5E99H 4EXPX 3RBGA 5IQ9B 3HE7A 2C1PA 2HT2C 3RY6C 1NBZB 2A6IA 4HWZB 4JRXE 2HJFB 1S9KC 4LAJH 1CFTB 4D9RE 1IQWL 2CDGB 1IT9H 1J10A 4CN1A 3TBTA 4WUKH 5BXFB 1MY5A 2VWEC 2HWZH 5IVXE 5I0DA 2VDMH 5I1IL 3DX9A 1AQKL 1A7RL 4LKCA 4TRPL 4HLZG 1QEWA 2K1MA 2OXGA 3O3EA 2FGWH 3ARBC 3HN3A 5EN2A 4WWKB 2VKXA 1Q9KA 3HI1A 2FATH 1GZQA 3QQ9D 2AQ2A 2L4OA 3TT3H 3HI1B 3TO2A 4HH9A 4AIXA 5BRZA 1J87A 4Y4HD 5GRVL 4IRSB 1A1NA 4JFPB 5DMKB 4R90L 2ZCKH 3PQYA 2DICA 3C5SA 2MHAA 1A4JA 1RJZA 5JXEA 3FO1B 3A6CH 3FQUA 5BV7L 4G6FB 4MZ2A 1NCAL 2BNQD 4WUUA 3E2HB 1WGOA 1DBBH 3V0WL 2P5ED 2WLZA 4IIQC 4I0PC 3WHE1 4M43H 5KSBF 2EYSB 1IC4L 5DA4A 2X10A 3QDGB 1C7SA 4P59L 3H3PH 1YECH 3EJJX 3INUL 4OUUA 4UINL 4XCNB 1RAMA 5GGQL 1XF2B 3GBNH 3X3FL 3CDGA 4M1CD 3O4OB 4IJ3C 1N26A 4XC1H 1KB9J 1XF2A 2P1YA 5T1KD 3WFHA 4HKJA 2Z31D 2XWTB 2B4CH 5C0RL 4QRRE 1KIPA 4HD9A 3TO4A 5B22A 3QH3B 3D48R 3QIWB 4P4RA 4ZFOB 5CBEA 1L7TL 2EIZA 5CS7A 5TE4L 4WW2A 2NY4D 3JWDH 5DLMH 1MCSA 3CDCA 1H3WM 1I9JL 2C4XA 3MGOB 5LWYL 4Z7UE 4M6MH 3S34L 1J0YA 3ULUE 5C8JA 2D0HA 2XYCA 2P45B 4MYWB 4IM8A 1OSPL 3V7AE 1XH3B 1U93B 2YSSA 4XNQB 2NY4B 3RAJL 1TQBC 3MLTA 4PJCA 2D7MA 3LS4H 4XPTH 3UJIH 3D9AH 3BQUB 1K4CA 3CXHK 3MUZ1 5I8KL 4KKAC 2F19H 3KHQA 3EYUH 3RNQB 1BBDH 1LO0H 5HHMB 3OAZH 5IMLA 5KSUA 5IB4A 4H0GA 1OAKL 3QJHB 4MQXC 2XTJB 1UH3A 5GHWH 1I9EA 1BD2A 2NY0D 1LO3L 3T0VA 4GS7B 5D1XC 1C7TA 3ARDA 1OTUC 3QPQC 3O8XB 4OFIA 3G5XB 4YDVA 1NBZA 4HWZA 1NMAH 1CFTA 1XR8B 2NY3C 1IC4H 3PGCA 4NP4H 4P59H 4B41A 1XF4B 3U7WH 4XXCC 4NKOB 3OKMA 4P57A 4QHKI 2H2PD 4OZIE 1EO7A 1L6XA 5J13C 4AIOA 2BJML 4E5XA 4ENED 3P40A 1V7MH 3OX8B 3MV9D 1V7NL 5E2JA 3TBYB 5IFAH 4FQ2L 2R9HD 2C3WA 4PB0L 1G9NL 4YDIL 5HGHB 2R56L 3SDCC 4TPRH 4I3RH 4UDUB 3P0YL 2X9WA 3EBAA 3RDTA 4PJ5D 5CSGA 1PG7H 2EEBA 1KSRA 1F4AA 5EBWA 2MHAB 1X5IA 4HJ0C 1MRDL 1H5BA 1ERNA 1N8ZB 5FYKU 4BZYA 4NHUB 4DZ8A 3T77B 3L3GA 1UM4H 1BOYA 3UYRL 5E00B 3LS4L 3UC0H 1CGSL 4NHUA 2IALA 3L3OB 4DZ8B 2D7TL 1YN6B 2Y5TA 2P5WD 4BZ2L 5D8JL 3VG9B 3O9WC 2XKSA 1JGLH 1F8TH 3MJGX 3C60D 4XCNA 4QHLA 1NFDB 2ED9A 3MRDB 2HT4C 3Q2CA 4Z7VE 3G6JA 3DUHA 3V9FA 5CINL 2DYPA 1KCVL 4P99A 1EJ6A 5MI0C 1BZ7A 4QXUH 4BQ6A 1CICB 3FAWA 2VSDA 3N0PB 3MRNA 1N4XH 2GY7B 4Y5VC 4LLVB 4MHHI 3QEHA 4Y4KD 3V4PL 4K94L 1XGYH 1G9NC 3SOBH 4PY8J 1V8HA 3QAZC 5FK9B 4YXLH 5IG7A 4UQ2A 4YFDB 4OCSL 3ZO0A 3T1FB 3OJ2C 5DF0A 4HXAH 5K9QG 1SJXA 5E5UB 3IRZA 4Z7WA 2EDKA 4UQ3A 1SQ2N 5LG1A 3P30L 5EO1B 5IB1B 4AL8H 3ARVA 1SVCP 5BV7C 3MBED 6FABH 4PBXA 4TPRL 2KDGA 3FT2A 3PDGA 3MCKB 3BQUA 2YUVA 5L2KA 4Z5RB 3SKMB 1INQB 1R5IA 4NKDA 3QA3B 3KPQB 4K3JL 5FO9B 4L4VA 2F74B 1NGQH 2PYEB 5EZLA 3KPQA 1RHHB 1T2QH 4WI3A 4Z0BL 1T89C 3WO4B 5EBLB 4XCYA 2CD0A 3W2DL 3AU1B 4L8BA 1JZ4A 1OLZA 4HS8H 2NX5B 4DOHE 4R96B 4APQB 5T1LB 4EVNA 4LVOC 3UTSA 3KXFD 3T8XA 4PLOB 1JK8A 2DD8L 3UTSB 1FL6B 1GGIH 4JDTL 4KXZI 2B20A 1D6VH 5JW4Q 5MEOA 4QOKE 5FAAA 1S7WA 1Y0LB 2LU7A 3L5IA 1TPXC 1RZIB 4ZDHB 4OB5L 1B2WL 1I3UA 3TBYA 2R0ZH 1UACL 2W59A 4U49A 1EUUA 3DSFL 3C5JA 4U6YB 2YMXL 1VERA 5F8RC 3CCHA 2DQTH 5HYJA 4F58H 2RFXA 4HKZA 1TETH 4F7TA 4PRHD 3BD3A 3QEGH 4Y16C 5HGGS 2KUTA 4X7SH 3SQBA 3CLFH 3LRSB 4G6AC 3LKOB 3JUYA 3MLSL 5H35A 2CLRB 2Y1VA 3RWIB 5E8NA 3UTTA 3ZKXC 3GK8L 4IBLT 4NO3A 1MRCL 3VXTA 1XGPB 5KOVC 3L95A 2QL1A 3DRQA 4WU5A 4E41E 5E6YA 1XIWD 1EX0A 2J3SA 3DRQB 4WU5B 1T89A 2YD2A 4LLUA 4J3UA 3BUYB 1ZVHA 4PJ9A 1HCFX 4LASH 1NGZA 4TVPE 1CLOL 5GGSA 1RZJL 1FAIH 1KTLA 4YZFE 4JY6B 3TJHC 2VXSL 5HDBE 4NPYA 3GGWB 3RGVB 2VZVA 4UNUA 2XI9A 1MQKH 4OGYL 4KZDH 2P8PA 4LSSL 1U3ZA 1QSEB 3GMRA 1R3HB 3WIHA 5FKPA 1S7VB 2BSSB 4DGYL 1J7VR 4N0UE 5T1DH 5FGRA 3L9RA 5K93A 3RZWA 2NPLX 2OZ4A 5KSVA 4YR6B 1ES0A 1X5XA 2EDOA 4JFHE 5EO1A 2RBLA 5ENWA 2OJEB 3IU3B 5INCA 1MWAL 4M7ZB 5EZJA 3WS6A 1NBVH 4ZUSA 1EFXA 2V9QA 5F70A 4JRWA 5IESL 3BW9A 1A9EB 2FIKA 5EA0L 7CGTA 3FQXB 4CADA 4MQ7A 4X6BB 5A2JH 3ARYA 3GHBL 1XT5A 3B4NA 4K3EL 4R0LA 1FN4A 2MNUA 4YC2B 1VKXA 2YEZA 2X4QA 4Y4HA 4G8GA 2A74A 2ITDA 1VGKA 2PUQT 1T21A 5DS8A 3UTOA 3QUKB 5IT2H 2DLIA 2ITDB 3UDWC 1H8SA 5IOPA 3T8XB 3MLPA 4UMGA 1EGJA 4F57L 3MLZH 4PJ5E 4BH7A 1BBJB 5D7IA 5HXMA 1BJMA 4U6XA 3R06A 4FABL 1W72A 2DOCA 4I48A 5EPMA 1T5XB 1A8JH 4GKSA 3N85H 4K7PH 1Z9LA 1T5XA 5SWQB 4RIRB 3T04D 2VXQH 4NO5A 1UJ3A 1NCCL 3OKOA 2M26A 4P2RB 5C7XL 3O6ML 4U1MB 3N1FC 3REWB 2VXVH 1P9MC 5KS9F 1SJHB 4G42B 4QNPF 4BJLA 3RI5F 2NTSP 2X1XR 5SWSD 5T1DL 5KVMC 1ZT7A 1CFNA 5E5RB 1BMGA 2VXUH 4QRPE 5FYJE 5BCAA 4X8JA 5HHOE 1AGCB 1AI1L 4OI7A 1ZHKB 2AK4B 4PJEA 2H6PB 2BMKB 3FMGH 2AK4A 1I8MB 4PS4L 2VLME 3O2VL 1J8KA 3S37H 1U8MA 4HZLA 3SY0A 4NRYB 1NDGA 4HGWB 4X6FA 2V7NB 3HE6D 2ZUYA 2DQEL 5J1TC 4R7NB 3H0TA 5DMYA 1GC1H 2J6EA 2KBGA 4P23A 4JO1L 4HEPG 4JG0H 2Z91A 4J1UA 2AJUH 1F3DJ 1IZJA 1MLCB 2KZ1B 4TULL 3FZUC 3I6KB 4XVSL 3SHSA 4E42A 5F88A 1GZPB 3QO1A 4OF6A 1ZAGA 2D3VA 1ZS8B 1IEBB 4JN2B 1KEGL 4XAWL 5DZOA 1BD2D 4P4KC 4FABH 4C56D 1IEBA 3WDJA 3L3DB 4JFEE 1H3VA 4RDQF 2OTPA 5IK3A 5BRZB 4BK4A 3KNBB 5ALCL 4YFLF 3T0WA 2XZQL 4ZAKD 1H0DB 5DDHA 5JOPE 3BRFA 1JV5B 5FUOH 1NCCH 4FQCL 4F7EA 3FN3A 5T3ZD 4HS6B 4PJ7B 1FIEA 2CJUL 3V52L 3GSQB 3T0DA 1QYGL 3OB0H 3UTSE 1FH5L 3HUJE 3MUY1 2FX7H 4DQOL 4XAKD 4XP1H 3KYAA 4G6MH 4Q74A 3G04A 4NC1C 5HGDB 3PWNA 2AK4E 2H9GB 1QR4A 2VLRD 4ZYKB 1U3HA 5C0CB 2NTFB 2W9DH 3MJ8A 1ZLUH 3BGFB 1BFSA 1RI8A 1HIML 3PWNB 2WWMC 2UYLB 3ROOB 4KUZL 5E0QA 5TQ2L 1G1YA 3UTPE 4HWBH 3RTQD 3GM0A 2W1NA 5JHLL 1GZQB 4YDLC 5T3XD 1D3CA 1CS6A 1QA9B 3MRBB 1U8OB 1QRNB 2X4RB 1GJIA 1GC1L 3KYMB 4JO1H 4M4PA 3TN0D 2WBJC 4P3CH 1F4WH 2NX5E 4ESKA 3KYKL 2AJYL 3NIGF 3U7YL 4Y5XC 1CL7I 1NFIB 2ADJB 4CKVX 4QHMA 1T4KB 1A1OB 5D72L 2VABB 5E24E 4MJ6A 2I60H 5DO2C 4QHMB 4FQJL 3BX7C 4PBWD 4UB0L 5M7QA 4FQLH 2VISB 2HKHH 1DSFL 3BD4A 1UZ8B 1JE6A 4ZXBD 1Z2KA 4GG8B 4GW1A 3AC0A 5C9KA 5HYSB 1LDPH 3V79C 1TTUA 1CWVA 2O61B 5C09D 4JKKA 4K3GA 1M1SA 1TZGH 1XGQB 4WHYG 1I9RL 4FQQA 1WWCA 5JO5A 2C3XA 3ARFC 1NDGB 4HGWA 4X6FB 1DBKL 1H3TA 2HLAB 4R4BA 2ENSA 1T6VN 2FJGB 1MJ8H 2FH6A 4KDVA 4R90H 4Q9CA 5C0AA 4WUUD 3NZHH 2K9UA 2UZXB 1FNSL 3JBG7 5DEFB 4HGMA 4YDKH 1MLCA 5F93C 1CZ8H 4JG1L 5JORB 2L0DA 1S3KL 3WDIA 3QO1B 3UJTH 2FBJL 1Q9WA 3SJVB 2DBJA 3WFDL 4U1JA 5E4IA 3HLAA 3OGCB 3T2QA 3BKJH 4EQ2A 1INEH 4LFHD 1XIWC 2YN3A 1F42A 1GGUA 1YC8A 4TYUA 3P11L 1SYVB 1JV5A 4LVNC 2BC4A 4OFYD 4M7KH 3EZJB 3WYRA 4G9DB 3WN5B 3MLRL 4RX4A 5ID0A 3T09A 3JWDL 4FQJH 2NZ9C 3TEUA 4GS7C 3I50L 1I9JH 1KPVB 3VMNA 3TLRA 2DQGH 4R8WH 3RUGA 1AIFB 2A38A 2HJKA 3KLHC 3S34H 1UXWB 3VFMB 4K55A 3VXUA 1K8IA 5INDB 2W0LA 1NGWB 2I5YL 1HHIA 1DBKH 5C9JB 3S96B 5A3IC 5E2WL 4R2GC 2GAZA 3D9AL 4DVBB 3BZFB 1B88A 2M2DA 3IDYB 1CDGA 3H3BC 1XF3A 3U9PL 1B0RB 12E8H 2F53B 4HSQA 4YDKL 5ECJE 3ULVH 1M7DB 1CQKA 3LDBB 4K3DH 1Q9OA 5TH2A 1UB6B 4XI5D 5FM5M 4WHDA 1OHQA 4BA8A 4Z78B 3W5MA 1UB6A 2VIRA 1NFIA 1VDGA 2Y06H 4O58H 3PGFL 3ZT7A 1NMAL 1EPFA 4TSBL 5C0CD 4ZSOA 1QO3A 5ESQB 4FP8L 4KRPD 4DCQA 4NWUL 1NL0L 1OW0C 3FQNA 3CH1A 4KKBD 4NNXA 1INQA 5B38G 4M7KL 2VC2H 4XP5H 4XMLH 2Z4QB 3O9WB 5D1QD 1VACA 4GBXD 5C08D 5EZLB 2LTQC 1IAIM 2ZUTA 2BVPB 1F2XK 5C0CE 4PJ9C 1S7QA 5IFAL 3KPSB 1DUZB 4J3XA 3SDAC 1S9XB 4IRSD 2BVPA 4NZRH 1IKFL 3QEHB 4TOYL 5C6PB 3MV9E 1YQVH 5FYJH 2QSQA 4K3HA 1UM5H 1FC2D 2M8XA 4PP1D 1D9KD 3D87B 2PETA 5CZXD 3WIHH 5I66A 4UILL 4UIKL 3QFDB 3RL2A 2J4WH 5DJDA 1G7HA 2OI9B 3BAEL 3PXHA 5TE6L 1CGSH 1C1EH 2DIBA 1Q72H 5D7JB 3ZZ1A 3R0MA 4ZQKA 2EE6A 4UV4L 4GBXB 4XPBH 2H3NA 3QQ4A 4WU7A 3DUUA 1ZEAL 5EBMA 3MLXH 2ICWB 3O45A 1NGYB 1CFBA 4FHBD 1SYVA 3FB6A 4U1NB 4Z77B 5AD0B 4PY8I 2WUBH 4MLSA 2J5LC 2D03H 1U8PB 1FYTB 1KYOJ 5IBUB 4M6OL 4XBPA 4NZDA 1XMWA 1U8PA 4FP8H 3BUTA 2XQBH 1I1AA 1X4XA 3T2OA 4QRQB 4OCSH 1X7QB 2N7BA 3UP1A 4NBXB 3MR9B 4XBEL 3UCRA 5FYLE 1I1YA 1HHGB 1NPUA 3CUPB 3C6LB 3QXAA 5HD8D 3TA3B 3F5WB 2Q76A 4HEME 1FIGH 5F44A 1GYAA 3GMPB 1LP9E 1BJ1J 2X4PA 2JK5B 2Q76B 5A43C 1KTLB 4JY5L 4ZNEA 4LEXL 3MJ9H 1MCDA 1UM6H 3F62A 4LCWB 5DTFA 4PJDF 3EYSL 1RUPL 5BVJA 4HX1A 3MRMB 1FNGA 5D1XD 3NBNA 5CUSL 4N5UA 5CZXC 1VPOH 3KJ4B 5J12C 3FT2B 5FV1L 5C07A 1OAZH 4LVHB 4RA0C 3TYGH 1DBMH 5E2VL 4EDWH 2V7HB 1G7JA 5ESAB 4ERSH 1MAMH 4UT9L 2R4RL 5B8CA 2JB5H 9CGTA 4OF7A 3UO1H 1MHPL 1I1FA 4U6HB 4OM0H 1MLBB 4OQTA 1BD2E 4KRPB 5DD5L 1MLBA 1CXKA 4RISH 1CT8A 3MRIB 2VXTH 3FT3B 1S7QB 3PDOA 3ZL4H 5ISZA 4CUCA 1DN0A 2CXKA 2PW1B 3HB3C 4OGAD 1KCUL 4NQCD 3W11D 5KOMC 5KZCB 1U0QA 4PJFB 2J12B 4N8VB 4WFEE 5EU7C 4C54A 1P84J 4JFDB 3MODL 3ARXA 3HFML 3HTLX 3NPZB 4XBEH 1AGEB 4IEFB 1GPOH 43CAA 1O7SA 1NGXA 1CXEA 1Z5LB 3BPOC 4YO0A 2PO6A 1JHLH 3TT1L 3K8MA 5LKNA 4OZIF 3REVA 3K1KC 3WE6B 4OZIB 2BHZA 1D9KC 2E7CA 3QIBD 3VFWA 5KSBE 3FB6B 3C2SA 1MI5B 4UTBL 3RNKB 2GTZB 4CMMB 2FEDD 1DE4A 3CPLA 1CLOH 4X8JB 3DARA 4PREA 3OKNA 1VPOL 2OLDA 4NRXA 5DJYA 2IQAB 3K8KA 4MD0A 4PG2A 2CLZB 4MQTB 3QIUD 2E7HA 3D2UA 4DKEH 3ALWA 3LPWA 4PJ7E 5A2IH 1QR1A 3C8KA 1FDLL 2R4RH 3D2UB 4KI5E 3O2DL 4CU8A 4CVXB 1EHNA 1U95B 1FO0B 1YDPA 4PJAA 1C16A 5DD5H 2LQRA 1DQDL 1YDPB 4PJAB 2F5BL 1CFVH 1T2JA 4MD4B 3ZL4L 3ULUF 1DVFC 4ZNEE 3IVKA 4AYFA 5GIRA 4FS0A 1OWWA 3KPMA 4JEGB 5C09E 2WBJA 4WI2A 2EH8L 1FNHA 4QRPB 3HFMH 3HAEA 4GUPB 4HC1A 5EA0H 2MPAH 5F7DA 4JAMB 2ATPA 4WW2F 3CZJA 4I77L 3IDXH 1FNGB 4PJEB 4WWKD 1SEQH 4HQQH 3IU3A 3MTRA 4JRYB 1NEZG 3VXRE 2EICA 3BPLB 2A6IB 3CMGA 1LD9B 1TMCB 2PXYB 3LEYH 2ZPKH 5I1CH 4OIIL 2W9LA 3U36B 4KWUA 4X6BA 2OTUA 5JW4M 4PR5B 1P5UA 2BOBA 1AE6L 4LARL 1FN4B 1EBAA 3WJJC 5HYIA 2VDRH 3MYZA 1KCSH 3SE4C 4KY1L 2ZUXA 3AGVA 2UYLA 1R6VA 5EG6C 4ZXBC 3LN4B 3KPOB 2XZAL 2YRLA 3QDGD 5CP3A 2WINA 5E8DH 4X5LA 3FOMA 3O2DH 4HIXL 4JVPA 2DTSA 1S5IH 3RIFF 5DQJA 5I6XB 4KFZC 1AI1H 2X4OA 4D3CH 2AVGA 4X6CA 3C60C 4DKFL 3QG6B 2UVFA 1X9QA 2ITCA 4ODBD 5EO0B 1A22B 3RVWD 4NBYB 4FFYL 1AR1C 1KTKE 3HA0A 4JKMA 1FZMB 2P5WA 4LSRH 1XEDA 2YPKB 1GGBL 5TDNA 1VFOA 3REVB 4LSDA 4WFHE 3GNML 4JFXB 3X12B 5I9QC 4R6UA 1J05A 3AM8C 4M48H 4M5YL 4YH6A 1BX2A 1Z3GL 3B83A 4CN4A 5DJCA 2B0SH 2ED8A 2DQIH 2ZOKB 1IGYA 3AS0A 1A9BB 5DK0A 1QSFB 4HLZH 1A3QA 4WTZA 4XB7A 1FO0H 5IIEB 1UCBL 3CXHJ 4K23L 3HMXH 1FFNA 3C8KB 4ZAKA 2CR6A 1PLGL 4S2SB 2VZUA 4Q6IA 5T3ZL 2WP3T 3O4LB 1YUHA 1OAYL 3Q5YA 5I2IB 5I1EH 5J3HC 1CCZA 5IKCB 3BESR 4YHOL 4O4YH 4PRHE 5EWIL 4WDIA 1AY1H 3QCTL 2HKFH 4MNHA 1DQJB 2GSIB 4RQQB 3RWGB 3CXDL 1L0YA 3HB3D 1EGJH 1J8HE 2H32A 2VLMD 3IYLW 3W0WE 4HK3J 2NY3D 5DXWA 4LNVA 5D1QB 4RWHA 1EMTL 4JHZA 5LQBL 4JR9L 4JANB 1IAMA 2X89D 4JAMA 5A2LH 4KTDL 5D1QA 1S7TA 4WFED 3SDDA 4ZG1A 4KJPD 1WBXB 5GRJH 4JY4A 1CICD 1WWWX 5CD3A 3L3HA 2UZYB 1GGCH 4LRIC 1BQLL 1XGRA 4PJXB 1HOCB 2VLJD 1J8HA 3RL1B 5E9DA 5DJZA 3MX0A 4CJ1A 4HWBL 3TF7C 1OWRM 4OD2B 4DGVL 3HRZA 1Y18A 3LRHA 5BVPH 1AH1A 4Y1AA 4ODVH 1JWMA 3FB7B 1VFBB 1YEDB 1MCWW 1GHFH 1MIEH 4JQVC 1Z3GH 4PJHF 1JGUL 1MFBL 3AAZB 2MMXA 2XKUA 3JWOC 2Q6WA 4X0KA 2VRAA 4RMWA 1YNLL 2JKXA 3K2MC 4E5XB 4ODSH 5DMIL 1BFOB 1P53A 1FLTX 1U6AL 2DQDL 4DK3A 3PV6B 1S7UA 4XHQA 4PJDA 1JPST 2X4TA 1ZHNB 3B9DA 1U8OA 4OGXL 3O3BB 3DURB 3TIEB 3LN9A 1CN4A 1JZ7A 1T7ZA 2B1AH 1DSFH 5C09B 1FPTL 2IPKA 4U7MA 4AM0B 1G6RB 1FLRH 3MRHA 1WJ3A 4K2UH 3AB0B 2BC4B 3DLQR 2EC9T 1KACB 3ULUH 1Q9KB 3FQUB 3T77A 1E27A 2PNDA 4Z76A 3BGMA 3X3GL 4ZFGH 5JLZB 2Y5TB 3IFNL 3NVQA 1T80A 4FQXD 1ITCA 2FHCA 3I84A 3DJ9A 4EI5B 3T0EC 1B0WA 4F9PA 1U92B 4DVRH 2E5EA 3QEUB 4O00A 1HHJB 5HJ3A 4LBEA 5IB2B 2BVOB 1NBYA 2FJGA 1EZVY 3A6BL 2I9TA 4ZTPH 1DUZA 4OFDA 5IKCA 1XF3B 5C0AB 4G9FA 3VD5A 2P8MA 2GJZA 4LOUD 4PGJA 1WT5C 5JHDB 3QDMA 2V5TA 3CX5J 1X3DA 5HHPA 1TITA 3Q6FA 2D9CA 5DMIH 5TDPA 3QDMB 5HVHB 1U6AH 1Y6MR 4G7VL 1LEIA 3LZFH 5IB1A 2ATKB 2VITB 4Z7VA 4NUGL 1XFPA 1G7QA 3LDBC 4YJZL 1HE7A 1M7XA 3DI2B 3QI9D 3VXUD 1E6OH 5GZNC 4YHKL 1OTSC 2W92A 2DQGL 2BNQE 2VMFA 1F5WA 3L3JB 1I8LC 4M6AA 4AEFA 5D7SH 2R1YB 4X6DB 4N1HB 3MLUL 1N64H 2O5YL 3MRJB 1VADB 3L3HB 5AG8A 1TZIA 1NMCB 2Z31B 4M03A 4EN3A 5KSAB 1RHHA 3O45B 1AC6A 1JZ3A 3E8UH 1TNNA 4G9DA 2YA1A 2AABL 4GRLA 1YYLH 3G5XA 4EIGB 1YNKH 3HE6C 1F97A 4N68A 1FFOB 1X5HA 2BCKA 1QLEH 2DIJA 5GGTH 4XP6L 5IB4B 2BSTA 4F33B 4OKVA 2Z0BA 1UXWA 5I66B 1EJOL 5D7KD 2Q1EA 2I27N 1K8DB 1LHZA 3QG7L 4PJBE 4YDVB 2ILLA 1Y0LA 1ZGLM 5DO2D 3MR9A 4NFDA 4X9IA 5I1LB 1KEMH 4ZS7H 3T4YB 4ZTOH 3WS3B 3P0VL 4KRLB 1HNGA 1QFUL 3QUZB 4XPGL 2MOVA 5F7UA 3L7EB 1ZHNA 5IMMA 3CZFA 3ALXA 3V6OC 1DBAH 3LS5L 4OZ4A 3V2AR 4NKMA 2Y6SD 3RZCA 1R0AH 3ILPB 4ZSOE 4E41A 1G6RA 3LAFA 3PWLA 2CIIA 2AK4D 5CJQH 1Q9OB 3WHXB 3WKML 3ARFD 3JV4A 4MXVE 2CLRA 5JR1L 4ZPVA 3VFNB 2ZG2A 1YEJL 4GAYA 1EAPB 4HZAA 3RTQC 1N6VA 5KN5A 5DJ2B 4Y4KA 3SE3A 4OCRL 5ICXA 2IALB 3L3OA 3PV7A 1X5AA 3DRTA 3C6LD 1MJ7H 1PYWB 4OT1L 5ICXB 4P23D 1G7PA 2DAVA 3DRTB 1GVIA 4OFVA 3F6LA 1AP2A 2DQUL 4YEEA 4QHLB 4MAYD 5KW9L 4P49A 5DHVH 1C5BL 2DQHH 1R24A 2ICEA 5I15H 2BY3A 3IF1B 3H9HA 4KJYA 3CU7A 4J6RH 1SM3H 3BGAA 4WWID 3WLBA 2BVOA 1I1RA 3CK0H 3I2CH 1XF5B 2FWOB 1AO7A 1KJMB 3FFCD 3EOTL 2IAMA 1CI5A 1V3JA 2P8MB 4PJFA 4NT6B 3BE1H 5F6HI 5LGKA 5FYKL 5BZDA 1ZTXH 4UINH 4MXVF 2CQVA 4YIQA 4WEBH 2WWMD 5EORL 1MEXH 3FN0L 2NNAB 4G8GE 2CPCA 5LAXA 1IBGL 2WNGA 1L7IH 1U3HD 3EO1A 5AAWA 4POZD 1RZ7L 3NIDF 1JIBA 1FNEA 4LVHC 4NGHH 1MHCA 4HHAB 1JFQL 5F9DC 4IRJB 5IW3A 4AENA 5I1DA 3SE3C 3WO3B 3RNKA 4Y0GA 2A6JA 4LRNL 5ISZB 1YMMB 4FFWC 3OKNB 1KJVB 4LEXH 1FFOA 3QZWG 4JO4L 3MCLL 1R5IB 3SE4A 1JJUA 3IAQA 3EDEA 4E0RA 3U0TA 4XPTL 3UJIL 3VDBA 1OPGL 3JV6B 5D7IB 5IW6A 4KPHL 4Y5YA 4MJ4A 5KW9H 1RFDH 4WO4C 1RIUL 3AROA 2Y7QB 3VU2A 5FGCB 2WUCH 3VW3L 3GSXB 3TPUB 2C4FU 3TJEL 3GMPA 3I2CL 1FNLA 3WUWB 4MD4A 5IVXA 4L8DA 4HUVA 4PRBA 1J11A 4LVEA 2KQNA 1DLHA 5HDOA 4B53A 5IW1A 2EE9A 2P49B 5C70A 2EZ0D 5DVLA 1U3JA 5E6ID 3WIIH 3ZSTA 4ERSL 4H25B 1YPZB 3WD5H 1Q94A 4LSVL 2LVCA 5T1KB 3PGDA 5DJ6B 3RVUC 2YA0A 4KK6D 4OM0L 1YPZA 4L5FL 1E4KA 1NKOA 2BK8A 2XXMB 3QR2A 3PP3H 3O6FB 4ZPVB 5JZ7D 5GSRB 1HHHB 1GOFA 2B7DT 3RJDA 4NRXB 5DJYB 3FN0H 2W9EH 3C5JB 2RQ8A 1IAOA 3LKNB 1HH9B 3QQ9C 5KN5B 4XVJH 3NACL 4G9FE 1RPQA 4X6EB 2HTKD 2G60H 4HMDA 1RD6A 4Y4FD 2PTVA 3QWRA 2VLLB 4NGHL 3L5WB 4OLXL 2VDML 4JFYA 1T03L 5C0FA 3GEWB 1GPOL 1A7NH 2IMNA 4KHTH 5AWNL 4EBQH 4J3VA 3KWWA 3EDKA 4G7YL 4GAGL 1RUMH 2NY6C 2ZKHH 4P2QA 5L8KB 4XVUC 5GIRB 4V1DD 5CJXC 1P4LB 1T7XA 3BH9B 1DVFB 5IFJA 5FM5O 1JTTA 3TVMB 1ZLSH 1ACYH 2JELH 5T3XH 3WFEH 5E9DD 3HUJA 4I8DA 4Z7OE 2R39A 3TBVA 4I2XB 4JE4B 4DOHB 4EZMA 4KROD 1CG9A 3JSSA 3AS3A 1BIIB 1WEJL 2R8SH 2BNRA 3MO1B 1JWUA 2P7TB 1AXSB 2YC1A 5TDNB 2GTWA 5L8JB 1Z0NA 4OLZL 3VFWB 4L5FH 4P46B 1XGYL 5JPNB 4NHCH 5DD1L 4YR6A 4ZUVA 1I7ZB 4CADB 2YS4A 5GRZA 3VFUA 1HCVA 1N2RB 1N59A 2J6EH 4JQVA 2EDYA 2DLFH 4R97C 4OZHF 3VD7A 3MRPA 4D9QE 1MFCL 5TPWH 2BNQB 4HDIA 3G5YA 1MUJA 3HAEH 4HC1H 3FQXA 3B9VA 4MDIB 4MAUL 1FORH 2A83B 3U79A 5DYOB 2EE3A 2EO1A 1MUJB 1NANH 4M6ML 3CX2A 2X4SA 2X4OB 4YXKH 4P2CG 7FABH 1VKXB 1MCJA 4RRPA 5HI5D 3U0PB 4DN4H 5I6XC 3HNVH 5GISL 1KJ3H 1ETZB 1LP9B 4F2MB 1A7QH 4HUVB 4AG4H 4YDJA 4U1IA 2NMSA 4L9DA 1NUDA 3DTXB 1UWXH 4L8CB 4BFEA 3VGAC 2DI8A 1AD9B 1OGTB 1ZA3B 3ARWA 1R3IL 2X4UA 3T2PA 5GHWL 1PKOA 4HIIB 3V6OE 2QR0B 1MFEL 1EO8L 1F2QA 3MNVB 4GT7A 4KH2A 4BZ1L 1D7FA 1IM3B 2QHRL 4U1KA 4K7PX 1B2WH 5CJ5A 3U7WL 3TIDA 2ENYA 5E8OA 3E3QC 3LV3A 5MHSE 1HNFA 1OARL 4WV1B 4Y1AB 2XRAL 4QXGL 3O0RL 4OV6F 1KYOK 2BJMH 5CGMA 3BKCH 4PRDA 5EFIA 2X1PA 5F9WC 1MCKA 5HVGB 1PX4A 4NZJA 1PEZA 1DLFL 5DUBA 3QP3A 4Z7NF 2R56H 5HSFA 2XWJB 1Q9WB 3P73B 3SJVA 1KCRL 2NW3A 3P0YH 1G9ML 1KGCE 2HFFA 5JDSA 1NCWH 25C8L 3UAJD 1KIUA 3DMMD 5GPRA 4HT1L 1HEZA 3QG6A 5GJSH 1BJ8A 3BH8A 3BIBX 3KLAB 4N9OB 3WFCL 2RJMA 1UT9A 4HUUB 1AKJA 2HFTA 3QQ3A 5EZIL 5KSBB 1JZ6A 3TNMA 4JFXA 3X12A 2OSLB 5SX4I 5JW5A 3QQ3B 1JGLL 1F8TL 5L88H 4MMXC 2XA8H 2J88H 1WVZA 5F1IA 3RUGB 1IFHL 2X7LB 1BLNB 3FQWB 2BERA 3VFMA 5FGBC 3QUYC 3MUHL 5BMFL 2EXWD 3OB8A 2QHRH 3U7AA 2DI7A 5EU7E 4J3WA 3KPTA 1F6LL 1FG2A 5LGHL 3SOBL 4OF5A 5F7LB 4QXGH 4NZUH 2DLHA 3F7VA 4X5WB 5HGDA 4FXKA 1RVFH 3UTQB 2BZDA 1NAMH 4NQTA 2Z8WC 4HF5H 5GRJL 4OQTH 3BKCL 3KYMA 4Y5VB 3KYOA 5KG9A 2FR4A 1KCLA 4X7TB 1KB5L 3STZB 3GI9L 2L7UA 3QAZB 2MJWA 4OZGE 2Q87A 2G5RA 1WZ1H 2PCPA 2V2XB 1P7QB 2P8LA 3S3JA 1A7PH 1F4YL 3AB0C 5FKAB 2NY5H 1JGEB 4GW5A 4GKOA 1PVHA 4NFCA 1MWAB 2H2SD 5HHOB 1KJ2L 2X1OA 4PJAE 3DPBA 3V5DA 1IC1A 1Z9MA 3AY4C 5EOCJ 3I6GB 1MHEB 1WWAX 2AGJL 4HK0A 4PGEA 3MNVA 3W9DB 1OAUH 3MLTB 1KBGH 5BZWA 1F45A 1SYSB 2H1PL 5DA0B 3MV11 4M1GH 5KBNC 4MA8H 4QKXB 3OL2A 1NBYB 5DC4B 5C7XH 3QIWD 5CEZE 1MAKA 2IADB 1RU9H 3OAUL 1AO7E 1IFHH 4IMLA 1BVKB 4H1LH 3DX8B 3C5ZD 1JNHA 3VI3E 4K2UL 3FCTA 3F7YA 1CD8A 2VLJE 1K5NA 1WFOA 3DYOA 3ULUL 3TESA 1U91A 3ECBA 1A14H 1JYVA 2NYYC 4XVTH 5DRXA 4R4BB 3QIBA 1JTOA 2NW3B 2X4NB 4K71B 4O2FA 2AXGB 1INDL 3GB7B 3WJLA 1CXFA 1NAML 2CDFB 3QXTA 3X11B 1F4XH 2R2BA 4OLVL 1NQBA 2DTMH 2DWEA 5CZKA 2ICWA 2R29L 1B4RA 1JGVH 1HINH 4QTHB 5J57B 3WHXA 5E4EC 4Z76B 1MH5A 3C87A 5I17A 5LXGH 3MCG1 1IC5H 4C58B 1QRNE 1FBIL 5E99L 5FO7A 2WAHA 4P2OD 4CW1B 5GQBA 2NXYB 2EEAA 5HHME 3WO4C 5FM8A 1YMHB 1AIFA 4LAQH 1JP5A 4M5ZL 4NM8H 5IP4A 5J11C 5D7JD 3WNLA 1ZGLA 1A7BA 3IKCA 4JFFB 3LIZL 4FQCH 2ZCLH 4PV8A 4OGYH 1A7RH 3TN0A 1GIGL 5DQ9B 4CU6A 4AIZA 4D9LH 4L8SB 3MROB 5SX4H 3LMJH 3MRNB 1QYGH 2IBGA 3S98A 4XTRC 5DQ9A 2EECA 1KJMA 3MC0A 4GXVH 2IC2A 1NSNL 3KYOB 5D93B 1Q1JL 1A6UL 5I8CB 4JJ5A 4P4KA 2XWTA 5MEQB 2VZ1A 4O5LL 1NBVL 2CH8A 4V2CB 5I8CA 1JGEA 1NUGA 3ARGA 2VIRB 3W11C 1KFAL 4LCIH 5FK9A 5IR1B 2BXZA 3O6LH 1IE5A 2YPVL 3GHBH 3HZVA 5ESQA 3RWDB 3O41A 3PG2A 4KK9D 4K3EH 1LP9F 3F7QA 4RGNC 3UPRA 4WTWA 3H3PL 3RWDA 1T2XA 4FZ8H 5D6CB 4LSUL 1VEOA 4KXZH 3GUTA 3D69A 1T1YA 4HHAA 1AFVH 4XPHH 3GBNL 5IT2L 1S7RA 3G5ZA 3MV01 2CDEA 4YQXH 3W81A 2BP3A 4XCYB 4L29A 1AR1D 4F57H 1LQSR 3KDMA 2R2EB 2IADA 4PGDB 5T5FL 2FO4B 3KLSA 4EVNB 2R2EA 3NCEB 4OUOA 2KQMA 4X4YA 1AGEA 1RUAH 3AXLB 5CJQL 4HUMB 2CUMA 1VHPA 4U0RC 5HHXL 2VXQL 5MENA 1IRAY 3EYQC 5I76A 2ZCLL 3HR5B 3O6MH 4X5XA 1KN4L 4NC0B 1FC1A 5DRXB 4NUJB 1OSPH 4PGBB 3U30B 5IEHA 1XR8A 2Q7YA 3CMOH 4LDOB 4OZFG 2CRMA 3MV7E 3IS0X 4JFDE 4NKOA 4P57B 5CP7B 5HDQH 4E41B 5I8OL 3GJEB 5L0QC 5MEPA 4AT6B 4DW2H 1UJ3C 5CP7A 4I5BB 4CMMA 3EYUL 3QPQD 4PS4H 2CK0H 1IJ9A 5CILL 3S37L 4HAFA 5CGYD 2IQAA 1SM3L 1W8OA 4G3YL 3MNWB 4QOKA 5GSRA 4M62L 2ZCHH 3NN8A 1UEYA 1RZKC 1MELA 4I18B 4MWFA 4KTEL 5J6GB 2P48B 3LRSA 4JPWL 4LLQA 4FZ8L 3BP5B 1MPAH 1H3GA 3RWIA 4OKDA 5GS2H 4KDTA 5KVDH 1F90H 2DKSA 4WEBL 4XXCA 5E1AA 1YY8B 5EORH 4YHIA 4MNQD 3TA3A 2X1QA 3IJSB 3IU4L 1DLHB 2FWOA 2NW2A 5IW1B 2VR4A 4OZHE 1CDYA 2NY2C 5DFTA 3FOLB 2YZ1A 4H25A 4N1EA 4M61A 1SY6H 3WLWD 5IBLD 2E9BA 4LU5H 3FOLA 5L2KE 1DZBA 1RZ7H 1W0WA 4DUWA 5HHXH 2D0FA 5I1IH 4PJ5B 4CJ0A 1JNJA 2IPTL 4LF3B 43C9A 3GIZH 3CMOL 5ENWB 5F6HJ 3MCLH 4KI5C 2ESVE 4OTXH 3NZ8B 4MB5A 3ZHLA 1JGDB 2NLJA 4OV5A 2YD7A 3SKNA 3EO1B 1WWBX 3DVFA 4QRSA 5C6TH 2YC1B 4OF0A 3BW9B 3T1FA 1HDMB 4Y19D 3ZDZE 1RIUH 1ES0B 5I1DB 12E8L 5F97E 3SJVD 3D25B 5D6DA 4FOMA 3SKOB 2CDEB 2ZCHL 2ESVD 2HTLC 1A4KB 4QF1A 3HS0A 3TBWA 5F71A 4D0BA 2CKBH 1KCVH 4QWWD 5AZ2L 3EO0A 3S4SB 3WD5L 4PGZA 5F3HB 1BWWA 3O6FD 1UFUA 3EO0B 4BKLB 3CAFA 4NWUH 2RHEA 4LCYB 4YDLB 5HHMD 1AKJD 3QYCA 1FSKC 1CD1B 2EYRA 4KQ3L 1HZHL 1VGKB 2VC2L 1I1CA 3MBXH 2FJFA 1CD1A 2EYRB 4WW2C 2COQA 1YY9C 3U1SL 2YPKA 4FQ1L 5E2TL 4TTGA 4F8TA 4TVPH 2I60L 3OKOB 5GRUH 3HI6L 3VRIB 2XV6B 3IFPA 3QPXH 4TOYH 3GJEA 1U58A 3BO8A 4LKXA 3K0WA 3DTXA 4H1LB 1UM5L 4MQXD 5FFLA 1RZFH 1U3YA 1U58B 2HP4A 3BO8B 3NCFB 4YO0B 4TQEH 3D0VA 4Y2DD 3VH8A 4NQXB 3QDHA 1QD0A 2GTZA 5EUOB 2HMID 5D70H 4UILH 2YOCA 1TCMA 3D0VB 2FHFA 3GIZL 5GGRB 4UTAL 2J4WL 1NGQL 1OW0A 3PXJA 2FZ3B 2AAVA 4XMPH 1T2QL 2I24N 3LVEA 4Z0BH 5D2NC 1MVFA 4JFDD 2F58H 3FO9B 5EZOL 2A83A 2VLLA 5I8KH 1P5VA 3NZHL 3L7FB 2AJZA 4AH2A 3PQYD 1CLYH 1FRGL 1OSZB 2A6DA 3E3QE 3HUJF 4G43B 3DV6A 5EBGA 4JPKL 1U8QB 1QSFE 3H0TB 1T7YA 2GSIA 4AEEA 4MD0B 2YKLL 2PW2B 4RBPH 5AYQA 3S36H 4KQ4L 4NCC1 3UJTL 3ILQD 4NNPL 1PG7X 2JJTC 4JM2D 2X09A 4ODTL 3VG0H 1MCEA 3TVMA 4HPYH 4U2YA 2AQ3A 4L4TD 5JNYA 5DJXB 1T1ZB 4NN5B 1S7TB 2IFFH 1DQLL 2V17H 2VQTA 3V0AC 2DQTL 5J3HD 2ATPB 2DKMA 3BD5A 4PJCE 5C07D 5IK3B 1T04B 3FTGA 4GFTB 4BFIB 1JMZA 1NGZB 1LK2A 1QFPA 2ZSVB 2XN9E 1HI6B 3MLWH 3L6FB 4L3EB 3TV3L 1XIWA 4PB0H 2NLJB 4C56A 1UZ6F 5HHVL 5K9OB 4XP9H 1DN2A 2B8OT 4UBDC 1PG7L 1QFHA 4C56B 2W60A 1LGVA 4TQEL 3X14B 3BT2H 3D3VA 4UOW1 3MRCA 3P4NA 4XPFH 3GKZA 4JPVH 1J0JA 4JM2C 2GCYB 1II4E 1BHGA 2ARJQ 4YK4B 4UTAH 1U3HB 3C09B 5H2BB 1U8IA 1A4KA 4LASL 3GSQA 2Z35B 3SGKC 3WNMA 3Q6GH 4KDWA 1KCKA 3NCJH 1I7TB 3RWCA 4F80A 3AREC 3VXSA 3FOMB 3ULVL 3VGHA 5HY9B 1SEBA 4K3DL 2NTFA 3MJ8B 3NH7H 4NC2B 4RZCB 3RWCB 4X9HA 4EQ3A 3U83A 3GSNL 4H5SA 5KS9E 2QKIB 3S36L 5KANG 5CINH 1M71B 4NQSB 4R4NC 2H41A 5GS1B 2A74B 3Q1SL 3L3IA 4PJGB 5GZOD 2B5IB 1R3LB 3OR6A 1TCRA 1AGDB 4OF3A 3TNMB 2G9HB 4U05A 5F7FA 3IFPB 4L8CA 2OP4H 2ZSWB 4XZUA 1CDCA 1YEHL 5E08H 2DM7A 1DQLH 1WITA 3KR3H 3QUXC 4LPXA 3O0RH 1QSZA 4XZUB 3ZE2E 5I71C 4LSQH 4JKPL 3FFCE 1P1ZA 2VISA 4BQ9A 1P6FA 2ZG1A 1S78D 4PLKC 3LN5A 4NZRL 1DTUA 5IIEA 1HHJA 1KCRH 2VZTA 1EEZA 3FO9A 1G9MH 1AGBA 3D39D 3AFLA 5AG9A 4YPJA 2ORBL 2B39A 4NQVA 1YUHB 4S0SD 5I2IA 5DHYA 4HT1H 2WW8A 1FVEB 1U8QA 5L7XH 4PLJD 1S9WB 4ZPTB 1X6LA 15C8H 5T3XE 4XCEA 1OTTD 3VXRB 2H8PB<