3VXTA

T36-5 tcr specific for hla-a24-nef134-10
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
199
structure length
199
Chain Sequence
KEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMSIYSNGDKEDGRFTAQLNKASQYVSLLIRDSQPSDSATYLWGTYNQGGKLIFGQGTELSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T36-5 TCR alpha chain
publication title Structure of TCR and antigen complexes at an immunodominant CTL epitope in HIV-1 infection
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 199
sequence length 199
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-09-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxtA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3vxtA02
4P57A 4M3JA 3BD3A 3QCUL 3VFNA 3CIQA 4GXUN 3R0MA 3LKSB 1IEAB 4DAGH 4JDTH 3RWGA 3WJJC 2JK5A 5DRZB 1S5HB 2NW3B 2F74A 3BPOC 3VXUD 3NZHH 2HLFD 3BN9D 4I18B 2YS4A 1CICA 1F3DH 3TA3A 3D39E 1MNUH 2R0WH 4OTXL 5CINH 5EORH 3L5IA 2FIKB 4GKOA 1KPUA 4RX4D 4LPYA 4CN4A 2Y07L 3IU3B 4E5XA 4YHZL 1RZ7H 1UZ6F 3KPQB 4NQED 1LK2B 3KHQA 5EIIB 4QYOB 4OSUL 3BUYA 4ONHA 5F9AC 5I66A 1RUKH 4FQXA 2DLGA 4U1SA 1A6ZA 4J6RH 1H3PH 3MR9A 3TO4B 5ITFB 3LQZA 2PTVA 3O0RL 3V4VH 4JHZA 1W0WB 3DYPA 5FCUL 3T3ME 5FF6A 1P9MC 1FAKT 1GZQA 2BXYA 5E1AB 3H0TA 3TN0A 4KFZC 2FATH 3VFGH 4GW1A 1XAUA 2FZ3B 4LEXL 3T77A 3KYKL 5ALCL 4NWTL 3BD5A 2Z35A 5F6IC 3SBWC 1RIUH 4PGDB 4PG2C 1KEMH 3GSNB 4LHUA 3ZHDA 4JCLA 4L3EB 3NPZB 3H7LA 4WJ5A 1ITBB 3KLAA 4M5YH 3RIAK 1A2YB 1RIVL 2BNRA 2HAZA 4OCSH 4GMSL 4GRLC 5DUPL 4JPVH 4KQ4L 3JUYA 8FABA 1UQSA 1G6VK 2HWZH 3ARXA 3KLSA 1EO8L 3IXAA 4XP6H 3UO1H 4MLSA 4ONGH 3JTSB 3CFIC 3TZVC 3DTXA 3QJFB 4L3EE 1I9EA 3H9HA 4J1UA 1QNZH 4ZD3H 3DUUB 5FA3B 4DN4H 4ZUVA 2C9AA 2IALA 4Z7QE 4P5TA 2DI8A 4TRPH 5FDWA 4IIQB 1DN2A 4TUOA 4TUKL 5TE7L 1T22B 5D2NA 3WHXB 1NFKA 2EDOA 3S36H 1CVSC 3T2NL 5JDSB 5GZNC 3NCYS 3MJ7B 3S34L 1KXVC 3MLSL 1B88A 5DUBB 2DYPA 3DI2B 2FH8A 1XGUA 5DT1H 3T0WA 5EUOB 2Q6WB 4ZTPL 1QKZH 2A0LC 3O9WB 2BJMH 3ZDZF 4G80B 2GT9A 4OM0H 4JN1L 3BRDA 1S7RB 1FFPA 4L8DA 1Z6JT 2NX5D 3LKNB 1NLBL 3MRGA 3ARED 3EOAA 1Q1JL 2GY5A 4MQXD 5I18H 1QFWM 1DN0B 2ZUQB 1MIEH 4KI5D 4PY8J 5EUOE 3CFKB 1SY6L 5KSVB 2YSSA 5HTSA 4PLKD 5K9OB 4HFUL 2G2RB 1MCEA 4G7YH 3WNPA 4FZ8L 4U3XA 2E6JA 4XBEH 2LU7A 2VLRB 4H25B 4YJZL 3U6RB 3FQTB 5EBLB 1S5IH 1T04B 4MX7B 3HPLA 4APQA 3ZKQD 1TMCB 4M8VA 3FOMA 4WI3A 2XQBH 2PYEA 5D6CB 5F7WC 2BSSB 4JRYD 3QXVA 3QG7H 3Q5TA 1A6TA 3LY6A 2Q8BL 2QL1A 3WNKA 1WV7T 2I26N 3BDYL 4YFEA 3M1BB 4Q74A 3MRIA 3P4OB 4HF5L 2VLRE 5IWLA 4IRSC 1MCBA 4FOMA 4M8QA 5EU5B 4HXBL 4OZ4A 3MBEA 2C1OB 3QDMD 3STZB 2X09A 2A6IB 4K23L 1VACA 5EU4A 3B2UD 5MEPB 1OP5K 3UTQB 1JI1A 1NAMB 5B4MC 2R39A 3NACL 1SQ2N 4WCYH 5HJ3B 5IKCB 1CL7L 4OTXH 3P73B 1FN4A 1X6NA 4C4KT 1IGFL 4IS6B 1MCPL 3V52L 3JV4B 5BRZB 1R3HA 3RDTA 5I8OL 1IM9A 1WGOA 1X9QA 3GMPA 5IVXF 3HI5L 3MYJA 1KUMA 4P23B 2EE2A 2F8XC 3M8OL 1I85C 1W8NA 2MJWA 3GSOB 5DRXA 3WFBH 4KMLB 1FVCA 4JFZL 1NBVL 1MI5B 5BQ7A 3FRPA 4WDIB 5FCUH 1SJHB 5F3BB 1T5XA 3R1GL 1BOYA 3LN5B 4OFYA 5BRZE 1UYWH 1KJ3L 3DX7B 3NGBB 4V1DB 4F58L 5C6WH 3OKOB 5KVMC 5ESAB 3DROA 4LEXH 1UEYA 3KYKH 4PJIF 5IVZB 3KS0J 1NAML 2HVKA 1I8LC 4L4TD 5MEQB 2V5RA 3W5MA 4PGEA 4W6XB 5JMRA 4TQEH 3FQWB 4BZYA 3RKDC 2XA8L 1MI5E 4YWGL 1YEIH 1IAOB 3QWRD 2X4PA 4WY7H 4YEFA 4LLVB 3LEYL 3CDGA 1RIVH 3AMKA 4PJ9C 3FFCD 1KJMA 4GW5B 3HPJA 4GMSH 4HT1H 1YNTA 4J4PD 4L4JA 4V1DE 3V5DA 5DUPH 1NCAH 2YUXA 1ACYL 4WHCA 4KWUA 4KQ4H 3QQ3A 2NXZD 5CFHA 2Z8SA 4FMKA 2OMNA 2DJUA 1AR1C 5IHZA 5HDBF 1EO8H 1NFDF 1QLFB 4U6HA 5JR1H 4ACPA 4JHWL 1LO0L 2JJTA 4GW4B 4ISVB 1W72B 2X6MA 4WV1A 4NQXA 1W0VA 5DJYA 3BOVA 1HZHL 5IVXA 4HFWB 4RA0C 5F89A 3QNYA 1ERNA 2IANA 4Y2DC 1Q9KA 4PP1D 4KK9D 1U42A 2GW5A 3O81A 3BGAA 3QFJB 1GOHA 1DVFC 5TE7H 1ZHKB 3MRJA 3EYVA 3T2NH 1P7KA 2ZWLT 3QUZB 2BVOA 2WQ8A 1FNEB 4JZOB 4RGMB 3MLSH 4PJIA 4PRAA 4HUXA 1ZANL 4JB9L 2VUYA 1Q9WB 2EECA 5CZVH 3BEWA 1KB5L 3RGVA 3NCJL 4ZTPH 3DV4B 3QFJE 2NY2C 1A6AB 1DBKH 1AHWC 2V5YA 2AV7B 1Q94A 3EJZC 1ZHNB 3SGJA 4OFPA 4GFTB 5E5UB 3GSWA 3HRZB 5A1AA 5C2UB 2WLYA 1LD9B 5C6TL 3EO1A 3P77A 4Z18A 3BKML 1ORSA 2FRGP 4M6NL 1NFDA 2DS4A 1YEKH 3Q5OA 4OD3L 3TV3H 5AUMA 1CZ8L 1E0OB 1F3DJ 3C5ZD 5GSVB 2LABA 4HX1B 4O4YL 1G7PB 2GI7A 4N0FB 5I1JL 1DJSA 3TN0D 2R2HA 2CLRB 3ARYA 4JFEA 1TQBC 2VIRB 4KPHL 5FECA 1J12A 3EYFA 5I8EA 1REIA 5IW3A 1JWUB 3DUSB 1ED3B 2EYRA 4MNHA 5EUKA 2MPAL 1ZT4B 5SWQB 1UKQA 3GIZL 4LHUD 1UWEH 1JNHA 4QHUA 1A6UL 1GC1C 3OJVC 4ZFOA 1PGRB 3ETBF 4M93C 1IAIL 3V4PL 3SDDB 3I2CL 4DKFL 1K8IB 1JYVA 2OR9L 3NMEA 2Q8BH 4ZOBA 2ERJC 4N8VA 1N6QL 5IB2B 4ZXBC 5HI4C 1OTTC 3GBML 2CK0H 4LNRA 3BN9C 3TO2A 4HXBH 4DZ8B 1BOGB 4HKBA 4LEOA 4P5MB 4UZGA 1EK3A 1QLEL 3PXHA 4KDTC 5FM5O 3REVB 2E7LA 1OPGL 4FG6D 1IC7H 4MQ7B 4K23H 4P4KC 1JIBA 2I9LA 2N56A 4KAQL 3NACH 5E2UL 3BYTA 2X4QB 1WCQA 4G8GD 1UGNA 4JY4A 5DC0A 4AT6A 1KB9K 1CL7H 4P5TD 4Z7NE 3MROB 3QUXA 1PLGL 5C0GA 1MCPH 1OGTA 3KPMA 2X4SB 5IVNA 1NBZA 3GMMA 3QUYA 4YEEA 4F2MA 3VWJA 1J5OH 4LRIA 4IRZH 1MJUH 2VQ1A 5I8OH 5GRZA 1RZKL 2EDFA 4AM0A 4K2UL 2JCCF 3BP5B 1IBGL 3M8OH 3OKNA 3NCMA 2FJFB 1RV6X 2QSVA 1U92A 1I1FB 2BHZA 4PRPD 4HIEB 4JFZH 3ZDYF 2J8UF 3GBLA 3ULUD 2H32B 5D1QC 3R1GH 2H2PC 3PP4L 1KJ3H 3LRGA 1DEDA 1CGVA 1HQRA 3IDUA 3K4DA 2BSTA 2AEQL 1FLRL 5I1AA 4HGWA 4OLYH 1JF1A 2BSED 2YBRB 4RMSA 4KU1A 3RQ3A 4PJBB 1S8DA 3L3DA 3QDGA 2XA8H 1NC4A 4WWKD 3LEYH 2R9HD 1T4KA 4BFBD 3OKLA 1KPRA 1BD2D 1NC2B 1VFBA 4X4MA 1ETZB 2WUBH 4PJ7B 1GPOL 2DQDL 5LVEA 1ACYH 3UTSD 2OX5A 5H8DA 4NKIL 1NGQL 4K7PY 5TQ2L 2IADB 1FO0B 2MQ0A 3VRIB 1GOFA 5EO9A 3EFDL 1JGLL 3MLTB 4PJBE 3SE9L 3LH2L 5FB8B 5LGHH 4ODTL 4OCRL 2E5EA 1HZHH 4Y16A 3PDOB 2JCCA 4UUJB 4DGIL 2AJZA 4MMZC 4WENB 2W65A 4EDXB 4PJ7E 4XXDB 1PVHA 2IH1B 3ZO0A 4U1NB 3IDYC 1QBLL 2X4NB 1X4YA 2Y7QB 5TFSL 2J8UA 3BEVA 1G0XA 1QUNA 3CC5B 2VE6B 3VFSA 3WHE1 3RVUC 1Q72H 3MBXL 1G7JB 1CXIA 1MUJB 2EYSA 3GSUB 3WNNA 5FKAB 5H94B 1ZHBA 2GSGB 1ZANH 2BP3A 1EUTA 1CFVL 3DX6A 1KB5H 3IJHA 3NCJH 2FD6H 4RAVB 2A2QT 5J13B 1MCRA 1QRND 3CSYA 2DBLL 2H9GB 1FO0L 2XOTA 3MRHB 1CLYL 3NIFF 2ZUUA 3K3QA 3DMMD 3RDTD 3ZDXF 5E99H 5DEZA 4JN2A 5HYJA 1NFIB 1NGWB 4PLKC 3RU8L 1XH3B 3H9ZA 4WHYG 5ELIA 2MSPA 3U9UB 3C08L 3CVHA 5C6TH 5AAWA 1UWXK 2Q3AA 3BKMH 1CDBA 1FPTL 2ZOKB 1MCKA 4Q9QL 4M6NH 5DK2A 3ESVF 1CZ8H 3MRDA 3P4NA 3OHXA 4WGVB 5AWNL 5CP3A 3TBWB 4LQFL 4NKMA 1Z3GL 4KPHH 5GZOC 2V9TA 4XB8A 3WE6B 3M17A 4JPIB 4OQTL 3UPRB 1N8ZA 3UC0H 5D1ZD 1EGJA 3SDCA 3MRQB 4PJGF 1MCSA 4LHUG 3RWJA 2ZNWA 1OP5H 2MPAH 2C3GA 1F6AB 3BGMB 4PGCB 3GNML 3GIZH 1UZ8A 3MNZB 2WWMC 1BQHA 4HV8B 1HQ4B 1IAIH 4JO1H 3TBYA 2BVPB 1BZ7B 1I8KA 4PJ5B 3V4PH 3I2CH 4DKFH 2OR9H 3BE1H 1K6QL 3L9RB 1N6QH 4IJ3B 2A74A 3B2UC 1FH5L 3GBMH 4KVCL 3WXWL 4M7LL 4I0PA 1AC6A 2K7QA 3B6SA 4N0YL 1NMBL 3UP1A 3T4AA 3HN3A 1A6WH 4LMQE 1RZ8A 1QLEH 3ESUF 3HZMA 1A1NB 3AB0C 2X42A 1CQKA 2YRPA 5CMAB 2NY4B 1WWWX 3B9DA 4KAQH 3U46A 2IAND 2E6QA 2VLJB 4PJ5E 3CMOL 1GH7A 4QCIA 2FO4B 4HD9A 2C1PA 1AD9B 3EAKA 2AK1H 2D7MA 5LAXA 2IBZX 4MAYA 5E9DB 3L7EB 4WI9A 1FORH 3OZ9H 1JFQL 5FOBA 4LDEB 3RWIB 4GRLB 3O3DB 5E8NA 1U95B 2YEZB 1K5NA 1RZKH 2VZSA 1ZGLP 4XC1H 5H35A 4K2UH 1X5IA 4K7PL 4NO0B 5B38B 1BX2B 2RIKA 2VLJE 1J8KA 1IZJA 2E7MA 2G60H 3FJTA 1RMFH 1U6AL 1GGTA 1MCCA 3ARBD 4LAQH 2CDFB 3O3UN 2R56H 5E9DE 4XXCC 5IFAL 5EBMB 4OCNC 5TH2B 4OCLC 1G0DA 4ODVL 3PP4H 5M95B 4NQVA 1WTGT 1JGVH 4WRLA 5DYOB 2IGFL 4HIJB 1FLRH 4PP2A 5EZLB 2ZUTA 4Q2ZA 4OJFL 4UTBL 4M4PA 2PW2B 2V5SA 3DSFL 1U8LB 3K2UL 4WI4A 3IJSB 3MLRL 4S1SL 4HMCA 5ICZA 3ULVD 2ORBL 1CDYA 2I9TB 4HKZB 2D2OA 2YR3A 2YN3A 4JFED 5F70A 1NMAL 5E08L 3F58L 2Y36L 5H37G 1KYOJ 5C86A 4YO0B 5SWSA 2I07A 5IG7B 1E6JL 4NKIH 3W9EA 2BCKB 4PP1C 4JFDB 3NIGF 3EFDH 1NDMB 1MCOL 4LKCA 4PD4J 5CGTA 1FLTX 2APFA 1BZQK 1MFNA 1JV5A 5EO0A 3ULSA 5IMOB 1D5ZA 3BSZL 3VXOB 5DK3A 4BFIB 1YY8B 4HZAA 4DGIH 3BW9A 2E27L 3ARZA 1OSPL 4Y5XB 4MDJA 3VFWA 4L29B 3BPCA 1WAAE 3ZMRA 3U0WL 3MA7B 4DGVL 1TDQA 3B9AA 3WS6A 1CICC 1G7QA 3TA3C 4HGKC 3C6LA 3I3BA 4DQOL 4LBEA 4JFDE 5INCB 2R1YB 4DTGL 1CFTA 5CHNB 1RK1B 2GCYA 1IQDB 4K94H 3T1FB 2R4RH 4L5FH 4JCMA 3MBXH 3I6GB 1VPOL 1U91A 3MJGX 4PREB 3WFDH 2GTWA 2E7BA 1LEKB 4QY8B 1HYRC 3ALXA 4OI7A 4FQXC 1OLZA 3L5JA 5I15L 1CFVH 3IDJB 1Y6KR 5LXGL 4JFPB 3QXWA 4KDWA 3KPLB 1CLYH 1SHMA 2I24N 4JFXB 5CP7A 3VFRA 1MY5A 2BNQB 1TPXB 3DJ9A 2B5IC 5JPMB 2XWBA 4ZPVB 1OGAD 3TN0C 4H0HB 4M6OL 2JJWA 3DV6B 4R96B 3FRPG 2VDKL 1Q9LB 1MRCL 1OSZA 3D85A 2OZ4L 1T21B 2O93L 3WO3B 1WCBB 1N7MH 3OJMB 2ENYA 4UBDD 3THMH 1QR1A 2Q76A 5BV7C 4O2CB 1NCBL 2IMMA 3WFEL 2F53A 2BNQE 2XKNA 2Z93A 4Q9BA 5GGRB 4OQTH 2J6EH 4XP9H 3B9EA 1YDPA 3CFEB 4M62L 3W11D 4BFGA 5EH1A 4Y19B 4ZNEA 5A40E 3GNMH 3QDGD 5HYFA 2QADD 4GT7A 4XTRC 3MFFB 4UAOC 3QJHB 4XB7A 5F93C 1MHHB 2MWCA 4PJAB 1Q0XH 1JHTA 4OZIB 1LEGB 5CZKA 5IESL 1AE6L 4U7MA 3L3GA 5BMFH 1GOGA 5HPOA 2B4CC 1FH5H 3WXWH 4M43L 4M7LH 3GM0A 3G08B 4PRHB 4N0YH 3VH8A 4B41A 5BJTB 3PG2A 3IYLW 4P5TC 3X11A 5MP6L 2AKRA 2P8MB 4Y19E 5F7KC 1H3VA 1DBMH 1NGZA 5KSBA 5DMKA 1T7VA 2VLLA 5D2NC 2P5WB 4PJAE 1ORQB 4Z5RB 1XR9B 2VL5B 4R4BA 4HIHA 4RNRB 4NO2B 4OZIE 4TNVK 2QQQA 2X4RA 5L0QC 4ELMB 1DLFL 5ACZB 3IVKB 3RWFA 5GRYA 4PRHE 4PJ9B 1G6RA 2PUQT 1FZJA 3P9LB 1NPUA 1YPZF 5TDOA 2EDNA 1MFAL 2Y25A 2CIIB 2P5WE 2X70B 4FFZH 3CCHB 1B90A 4RISL 1KJ2L 5I1EH 1H3GA 3L7FA 1CLOH 4XRCA 1J0YA 2F19L 5EWIL 1AGBB 25C8L 4ELME 1NL0L 5K9JL 1DZBA 1KTLB 5HYQB 5I1IH 4XBGB 1SJXA 5F6HI 4LIQL 4XVSL 4PJ8A 4Y88A 4PJEF 4ODVH 1FIGH 1G7LB 2QJDA 2IGFH 4OT1L 4WWKC 1BWWA 5L2KB 5HYJD 2FECL 5T1MA 3VG0H 3IDIA 4UTBH 1E6OH 1AD0B 3GSRA 2NY1D 2DWEB 4ZUWB 1BHGA 2HT3D 1ND0A 5C1MB 1V7NL 3PUCA 2VO5A 3MRNB 4FMFA 4NIKB 1FJ1B 1A4KB 3TJEH 4S1SH 5I16A 2ADIB 3OX8B 5FO8B 1MCWM 1JWMA 4ONFH 3FCTA 5ESQB 4Z0XB 1X5ZA 2EDLA 3MCLL 4JLRA 1NMAH 2O26U 3KJ4C 1HYSC 2DQUH 3BD4A 2PO6A 3BAEL 5L2KE 2FBJH 5IBTL 4LRNH 1E6JH 1AHWB 1XIWA 2CRZA 3P4LA 3FB6B 2P48B 1BF2A 1ZMYA 4QWWD 2Y23A 1MCOH 4NHUB 2XPGB 3WIHL 1H3XA 5IWLC 1HHKB 1IFHH 3F7PC 5E0QA 2D3VA 1YPZA 3VE0B 3E3QC 4N8VG 3GB7B 4NOBA 5D2LF 1OSPH 1PEZA 2ED9A 1IL1B 1JE6A 3QIWB 4ENED 2VL4A 4DGVH 1IGIL 1EO5A 4WFGD 3EUUA 4QEGA 1OTSD 1DANU 3B9KA 2E3VA 1EH9A 2V2WA 1JPGB 4N0CC 4PJEA 4YR6A 1UWXH 3WDIA 4CU8A 3C8HA 5D7JD 5DQ9B 5F7LB 1F4XL 1VPOH 1Z9LA 4WFEE 1INDL 3MJ8A 3RDTC 2AJ3B 5D7SL 4ZODA 5I15H 4EVNA 1CLCA 5DD1H 1P5UA 1YMMD 4F15B 4LCYB 3VXMA 2J5LB 2NNAA 4OIIL 1I7RA 2HT2C 3FHAA 2XQYG 2ERJB 5CILH 5BVPH 4NO5A 1IC4H 2HJFA 3ARQA 3HC3L 1M05A 4HCRA 3C60A 4YAQA 1WIUA 3MLWL 1G1CA 2Y4SA 4KJWD 5F88B 1CGTA 5DGQA 2OI9C 3I6LE 4M6OH 3K8LA 2YUZA 2H8PA 5D70L 5F7YC 3TBSB 4OZHB 4LSUL 3FT4B 4P4KB 1TVHA 4I4WB 2OZ4H 3TBVB 4NQEB 1F8TH 2ICWA 3JTTA 1H8OA 4CW1A 4Y4FA 2Q20A 5GJSL 1L9NA 1NCBH 3BZ4A 5EU3B 3WFEH 4XH2A 4Z7OF 1QO3B 5D2LA 5FUOH 1I7TA 1FFOA 5HGHB 1U0QA 1ZWIB 4LLQA 4QOKA 5CJ8A 2Y5TB 4LARH 1SYVB 3PABA 4QRRD 4M62H 1VB9A 2E9BA 1GC1L 4XCNB 5CEZD 4OZHE 3KYMB 2EYTA 5CJOH 5D7KD 4R9HA 5H2BB 4EDWH 3LKPA 1MJJB 1CFQA 2UWEB 3LCYA 4NQEE 3T0VA 1I9RL 5LCVL 4I3SL 3QSKB 2CKBA 4FQLL 5IIEB 2JJTC 3NA9L 2N4IA 4WV1C 4O2EB 4K8RL 3PWJB 4EI6A 5KJRL 3ZYZA 4I13B 4E41D 5GGSY 4PS4H 4EXPX 3T0AA 4JVPA 5IHBA 4TOYL 2GEEA 1QBML 3T3PF 1J0KA 3PE9A 4P5KB 3BESR 5DHVH 2YZ1A 2LTQC 1CIUA 1QFHA 2CUIA 2UWEE 4XPFL 2NMSA 4JJ5B 4NKDA 2GSIA 2Q87A 1DLFH 3CAFA 4F7MA 3QEGL 1CXEA 2Z8VC 1MJ7L 2QQNL 4Z7UF 2AABL 3FQUB 4HJGB 2UY7A 3RGVC 3VD9A 2XWTA 3ZT7A 4XP4L 1RFDH 2MOVA 1SMOA 4PJFB 5DJDB 2DQJL 2ZUYA 1BFOB 1PY9A 2R29H 3CFBA 1MFAH 1XF2A 1I9IH 4JKLA 3TVMD 3H7BA 4ZUTB 2KUTA 5JHDA 5J1AB 1KJ2H 4LF3A 3KLDA 3VDBA 2F19H 5EWIH 1LEIA 3LDBC 4JKWA 1NL0H 1MHEA 5K9JH 2OS7A 3U4BL 3HZKB 4XNYH 5CWSA 3WSQL 3IDMB 5AZ2L 4RMVA 5KAQF 3FB5B 3IDYB 4PJFE 3PGCB 3PWLB 3T65B 2IFGA 2LU4A 3FB8B 1EEZB 3BH9B 3IRPX 1V7NH 3LS5L 5DEGA 1T1WB 2J7LA 4PR5B 2HTKD 1J7VR 4DGYL 4I2XB 2CRYA 3FMGL 1FFRA 2DQCH 4QF1A 1SYSA 1AGFA 4MCYA 2RBLA 5AZEL 5D7IB 3D69A 2NX5B 4S1QL 3O3EA 3MCKB 2Q86A 3BAEH 3CDFA 2EDJA 4U7SA 4K3EL 2ICCA 5HD8D 4M61A 4X8JA 5L9DH 4Z7UA 1BQHG 3G5VA 3WIHH 2UVEA 4RGNC 1C12A 3DURB 2O5YH 4AG4L 4I2XE 3CPLA 3GI8L 2XTLA 5F7NC 1X7QA 2ED8A 2VISA 5AD0B 3Q0HA 5IHLB 2E7LC 4P3DA 5T1DL 2AJSL 1I1YA 3ALPA 3BP4B 1YN7A 5D7IE 1F4HA 2NX5E 4KJYA 2GQHA 2W9DL 2D7PA 3LRHA 3G5ZA 4U1KA 3WS3B 4L9LB 4YBHA 1TJIL 4KI5E 4K07A 5K59F 3SO3C 2K9UA 5E5RB 4JRYB 1FCGA 1DLHB 4R0LB 3QBTB 1F4XH 2H41A 3QUYC 4OD2B 1INDH 3VWJC 1E4XH 4LRIC 5CKGA 1KB9J 1OQOA 4CU6A 3S96B 1XGPA 2DQIH 3OKEB 3UBXA 3OXSB 3OXRB 1DTUA 1BJMA 1H5BA 3QDMB 3G6AA 3T4YA 1BLNB 3ZTJG 4GBXA 4DVBA 3HC3H 4S1DC 4JRYE 4J7RA 4U6TA 3MLWH 4UBDC 2GUOA 4G9FD 2NYYC 3AB0B 2QQKL 4X4XB 4N0UA 1NGPL 1U8OB 4NM4H 1XGTA 1CD1B 2MQCA 3QO1B 5GJTL 2DDQL 1A3RL 3T8XA 3QDME 2JELL 3KPTA 4JAMB 5GJSH 4HJ0C 4U1JA 3HA0A 2GHWB 5I30H 3BVNB 1AY1L 1PKQB 5E95B 4Z77A 3LSOA 1T66D 3L3OA 5HBBA 1HHJA 5DTFA 1QFUH 1GC1H 2YPLB 5FKPB 4J2XA 1JGDB 3W39A 3RUGF 1SVZA 3W2DH 4TULH 3OKMA 1I9RH 5LCVH 4I3SH 2BRRL 4FQLH 1U8IB 4Z6AT 4L4TB 3NA9H 3QIUD 4Y16C 3ALWA 3KNBB 4K8RH 5DS8B 1PKQE 5KJRH 1TNMA 5I8CA 2XZCL 3MRLA 3QA3B 5C3TA 3E6HA 4P9HH 4ZDHA 3O11B 4TOYH 4FQ2L 1QBMH 1TCMA 4CN1A 2YPLE 1XCQA 4LU5L 4NQUA 4LPWA 3FFCB 3ZE1F 1DSFL 5KBNC 4XCFL 4XPFH 1C5CL 1F6FB 4MJ5B 3KPPA 1SEBB 5C0DA 4JPKH 4L4TE 4PRID 2EDBA 4TYUA 1S7SA 3QEGH 1HIML 4YHKL 1KBGL 5DZOA 1MJ7H 2AABH 3E1F1 1QVOB 1RJZA 2WMPA 4XVTH 3S8WA 5CIPH 3SO5A 3UYPA 2C7UA 5J0BA 2DQJH 1AGEA 3FFCE 3L3KB 3S5LA 5JMOC 4G5ZL 4BSVA 2P7TA 5KVEH 1TJGL 4EIZC 4RDQF 1KJVA 1JTPA 4MJID 5CD5D 5F9JB 3FQNB 4XNMB 3VXMD 4Z78B 2NY1C 2UVFA 1KNOB 3RWGB 3W5NA 5CCKL 2J88L 1L0XA 3RUGA 3U4BH 2JK5B 3JUZA 4JEGB 4P99A 4NDMA 3WSQH 2BRQA 2F74B 3RJQB 3GRWH 1FSKB 5I1CH 3AS1A 4GG6B 3EOBB 3LV3A 3OSKA 1T1ZA 1V3JA 4JGUA 4G3YL 3LS5H 3TNNB 5TDPA 2W92A 1SBSH 1ZVHA 1S7VB 3SDCC 1KG0A 4UDUA 1UM4L 3FMGH 3FT2A 4LLDA 1WFOA 1MAMH 3QXUA 2FR4B 3SEPA 4QWWC 5AZEH 3D6GA 4QRQA 2Q7YA 4S1QH 1Z2KA 4EUPH 2FB4L 1BFTA 4D0DB 5LGJA 5IBLD 5IP4A 2FJHA 4GG6E 4WEMB 4RAHA 3PJSA 4M1CD 1U3HA 1K4DB 1ZLUK 5I8KL 4GXUM 4WW2F 5FF6B 4ENEC 1GZQB 4I0PC 5KSUB 1KCUH 2ZUVA 1HH9A 3TN0B 3EDKA 3GI8H 4CVUA 4XNQA 2ICEA 5T1DH 2AJSH 1RJLB 3UYOD 1OAXH 3CLFL 4NNXA 4WHTA 3VH8G 3O4LD 1JPTL 4P4RA 3HS0A 2Y1VA 1O7VA 3V6ZB 2FL5B 4DJMA 4LHUB 5BV7B 5IM7A 4YHOH 4XPHL 2P46B 4Z76B 2EH8L 3CFCL 4JRWA 3A6OA 4MAYC 5JHLL 3GMNA 3MGTA 4OLVH 3GBNH 4Y5VA 2ARWA 1IGYB 4OBSA 4AEEA 8FABB 3L3HA 4UAOB 1XGYL 4KJWC 2WBJD 4PTUB 3G9VA 2ZJSH 3HC0B 1D6EB 4J1UB 1AP2A 5A2IH 3IJYB 1U2HA 1QSED 3HE6A 3JV5A 4G8GB 4OUUA 1LP9F 5C92A 5JHDD 2QLVB 4P5TB 4JO2L 3T2OA 2QHRH 4FXLA 2QQKH 3B5TA 4TUOB 2FO1A 2PYFB 3ISWA 4WW2A 3G04B 4UOW1 3N1GC 4LLYB 5SX4H 3MFGB 5GJTH 4Y4HD 3WIFA 5C0CA 5BV7L 5IROA 1A6PA 1ONQA 2JELH 5FO7A 1L9MA 4JFFD 4KKCC 3ZZ1A 3IAQA 4DZBA 5FO9B 3Q6GL 4NT6A 4YXLL 4R2GC 1UACL 1AY1H 4PRPB 1XGUB 4G8GE 4XVJL 1R3IL 1J1OH 5F8RC 1LE5B 4DFHA 2DLHA 3ZE0E 4HMDA 4XNUL 1LMKA 4JRXD 3A67L 1N4XL 4LSVH 4C54A 4L8DB 2CDEA 2B4CL 3MRGB 3TYFB 3V5HA 4ZSOA 1KCLA 1SJEA 4PRPE 4PG9B 3QDHA 3GMQA 5F1IB 3QG6B 2XZCH 1P5VA 2L7UA 4WWKB 2CLZB 4W81A 4FQ2H 4CVZB 5DURD 3WS6C 4LU5H 3ULUE 4XPAL 4YK4C 1BD2B 4XC3L 4ZTOL 2VITA 3C6LC 5IEKB 3OF6A 5DSCA 3D3VD 1DSFH 1LP9A 1OAYL 2IPUK 1T0PB 3UTSB 2R0LH 3ARFD 5FUZH 3LZFH 2X4UA 3HPLB 1FNSL 2B2XH 2DOCA 4TTDD 1VFMA 3TT3H 1S78C 3TT1H 1KC5L 4UV4L 1IEBB 1BD2E 3MUJA 5E6IA 4G5ZH 2FH6A 4RAUA 2DM7A 3KYOB 1TJGH 2DI7A 2BFVL 4P3WA 4M8QB 3UTSE 2OTWB 4YX2L 3EYSH 2Z0BA 3C2AL 5CCKH 2J88H 5FAAA 3BQUD 4EN3A 3BPNC 2CRIA 1VACB 4KHXL 3MO1A 3H2WA 2EIBA 3CVIL 3O3AA 5GGUA 5K93A 2EDQA 4R7NB 5T3XL 1A1OA 5E5MA 4G3YH 4L3CB 1K3IA 5I1HL 5KG9B 1QRNB 4GH7B 4NFBA 4BH8A 5HD8C 3DMMB 4I48A 4NP4L 3RDTB 4YLQT 4BQ6A 2G5BB 4HWZA 3KLHC 2WW8A 1S9XA 3QNXB 1MQKH 4XZUB 2X4OA 2HG5B 1OAQL 3UJTH 4D0CA 5T3ZL 2QSTA 3QYCA 3VI4E 1ZA3A 3P40A 5BQ7B 4LSSL 3SGEI 2JIXD 3VMOA 1XCTB 1QRNE 1T5XB 3BIBX 3U0TB 1CCZA 3DIFA 2FBOJ 3GGWB 2CIKB 3VA2C 5HVHC 1JGUL 1UFUA 5IMLB 3CLFH 5D1ZB 3NFPA 5DJCB 3HZVB 1JPTH 4KV5E 5C0BD 1LO2H 1FL3A 2AEIT 2V6HA 2JKXA 4ODSL 1OF2A 2X4PB 3OV6A 4XPHH 5DJ2A 2EH8H 3CFCH 1I3RA 1AGDA 3PWNA 1ZGLA 3PGDA 1SEQL 1JNJA 3L5XL 4PV9A 4HAGA 1CN4A 1XR8B 2FX9L 1N2RA 3DWTA 4WEUD 5C0RH 3QWOB 1M6OA 1XGYH 4PGZA 3BT2L 4GRWH 4WHYH 1X5FA 4ZFZA 1A3LH 5BS0A 2VLMD 1TXKA 4G9DA 4NYLB 3LPGA 2HJLB 5F1NA 4TPRL 5CD3B 4MXVF 5ANMA 4OV5A 1CD9B 3TPUA 3K0WA 4G8IB 5IOPA 2IANB 4L8CB 1Q9KB 3LKQB 3PNWB 3R8QA 5I1DA 3ZT5A 2D9QB 3DRTA 2VDQL 2AJVL 3K46A 2GJ6A 1D5BB 4FRWA 2XQYK 1DUZA 4FTVD 3ARDD 3MRJB 3EYVB 3MV8A 4HH8A 2UZXB 5AYUL 1P7KB 1KT2A 5I17B 1CGSL 3QXAA 1AKJD 1T7YA 4OF7A 3CH8A 4N9GB 2IANE 1UACH 1KXQE 5DDHA 5JO5A 4XVJH 1S3KH 4OZGB 4HKJB 2VQUA 5CBAA 2EKJA 4FFWD 3ARBB 5C0EA 3QIUC 4XNUH 1XIWC 4ZS7L 3A67H 1GL4B 5EZOL 3UBXI 1QFWL 1XF3A 2JJVA 4YBLC 4OLWL 2B4CH 1BQSA 4DEPB 1EEYB 3LDBB 4XCEA 3ARGA 4OZFH 3L6FA 2BOCA 1OM3L 1MQ8A 1NFDB 2LE9A 4OZGE 1GGIL 3V9FA 5SWZA 3MRFB 4OCWL 3OMZA 1ROWA 5IMMA 3F5WA 1EXUB 4JFEB 3B9KC 1QLRB 1OAYH 5FGBC 4Q6IA 4LCCA 4ZFFA 1T7WA 3O6FD 5FHAH 1FNSH 1VCAA 2B7DT 1C16A 4M9OA 2ED7A 3CXHJ 1JNHB 4Q6YA 1K8DA 1VSCA 2YOCA 5C09D 3WLWD 1NFDE 4OGZA 3S35X 4AEIL 1I9JL 4L1HA 5CD5C 3ULVE 4U33A 1FGNL 5KAQG 1KC5H 2EO9A 4UV4H 3RFZC 2IQAB 4JFEE 4MNQA 1U93B 3QUMA 3UBXG 3IETB 4HS8H 3C60C 1TQCB 4MWFB 3N50A 1Y6NR 3R06A 2V2XA 4PRDB 3TO2B 1L0QA 4B53A 3KPOA 1QBBA 1AFVL 1FRGH 5DFTA 1RJCA 3MJ9H 4FQJL 2EE6A 1ZLUH 2C3XA 4KHXH 4NNYA 1IC5L 3PF2A 4FFYH 4JY4B 3CVIH 2ADGB 4Y4FC 5HHNA 3GHBL 1NEZA 4TN9A 5T3XH 5LWYL 2Q7NA 3VGGA 3QI9D 4XNXL 4LLWA 3X14B 5IBLC 1OAUH 4X6BB 3MRPB 1H8NA 1NBZB 3O45B 4M1CC 1KPVA 4NP4H 2VQ1B 4ZFOL 2OSLA 1HDMA 4HWBA 3OKNB 1OGAB 4KHTH 2OJZH 1U92B 3PHQA 1CFBA 1OAQH 1UEMA 3S3JA 5T3ZH 4NPYB 1N6UA 4NC0B 4OF0A 3MOBL 3O41B 2Q8AL 1E4WL 3VXQB 2P8PB 4XT1C 1L7IL 1N0XH 4CDHA 1MLCA 3GMOA 5K9KB 4HZLA 5I1AB 1JGUH 4O02L 4G6JL 4GSDL 5T1KD 5CUSL 5DC4B 2O61A 1OGAE 3QQNA 5C07A 1Y6MR 5HDLA 1S8DB 1RUPH 3QDGB 2QADB 4U49A 3MV9A 2DD8H 5D72L 4YXHL 2WINB 4W68A 1FZMB 1DUYB 3P9MB 4HS6B 3QRGH 1KPRB 2I27N 1CGYA 1V8HA 3L5XH 3HNSL 5I9QB 3FTGB 4RFEA 4YHPA 1TZIA 3BT2H 1JWSB 1R0AH 2BSRA 4YFDB 5BCAA 2AQ1A 2H26B 3QDGE 4U1IB 4TPRH 4LVOC 1HHIA 3S5LG 3G5XB 3SKMB 1S9VA 8CGTA 1CYGA 4GJTB 5B3NA 5DD5H 2GJZA 3U0PB 5EOCL 5F72S 2VDQH 2AJVH 4WO4A 3F7VA 4WI7A 2HJKB 5IR1B 3BEVB 1A7RL 3VGDA 1A0QL 1L4IA 2VXUL 4WTZA 4EN3D 3EHBC 3MXWL 1V7ML 5AYUH 2FSEA 4X6CF 3SCMA 1T0NA 2VDOL 5E8OB 3LQAH 2BOBA 4B0MM 1L0YA 5KVFL 1BVKB 1T20B 1J0JA 2FLBT 5CBEB 2DQTH 3DX6B 5CJQL 3QPQD 1UWGL 5ICXA 3RWEA 4AEFA 3IDNA 2H1PL 3IGAA 2ZCKL 2R0ZL 3WLBA 4JM2F 5HGAB 3ZDYE 2X40A 2AXFB 2UYLA 2M1KA 2EKSB 1HH6B 4OLXL 1QFWH 3ARWA 3VFVA 4U1HA 1JN6A 5J6GA 4AQ1B 1NSNH 4JO4L 5HYJB 5JPNA 4ZO7A 4D9LL 1VEMA 4ODXA 3O6ML 2NY1B 3WN5A 1WWAX 4F3FB 4HLJA 1OM3H 5T1LD 2NZIA 3DVGA 3CNKA 2VN4A 1T83A 5DK2B 4PIRF 5FUCC 3ARFC 3MRDB 5I76A 3T0EA 4W4OC 4NO3A 2A9ML 5HVGB 5GS1A 4RA3A 4TTDC 4N5ED 1VGEL 4RDQG 3WD5L 5HYJE 1CTNA 1NAKL 4LCIL 4L9DA 1ODAA 3RPIA 3RWJB 4H5SB 4W6WB 3IXTB 4HS3B 5HXMA 2XXMB 1HHGB 4AEIH 3V7MA 1BQHB 4IOFC 2H2SD 4MHHI 4YC2C 5DO2D 1H5BC 4X6CA 2SEBA 4M4RA 1I3GL 5HHMD 2DJ4A 1ZLVK 1YZZA 1DQMH 2V2TB 1F5WA 4GBXC 2A74B 3AU1A 3QHZL 3T2PA 3B6SB 1KLUA 5C08A 5CEXB 1BJ8A 2ZG1A 3CVHL 4EI5D 3LB6D 1WTLA 1RZ8B 4FQQA 3G6DL 5BS0D 4NUJA 3D0LB 4JM2A 4HKXB 4HIIB 1XEDA 4JZJA 3V0WL 4FQJH 5D7JB 4C4KO 1IC5H 1TVBB 1F90L 3MRMB 1K2DA 4BYHA 5LWYH 1Q9OB 1RZJC 2H45A 5JA9A 1YMMB 4LVHB 1EGJL 1N5YH 4UQ2B 3A6BL 4WFGE 2EH7L 4HQQH 3GHEL 5BZWA 4YHIA 3CSBA 2V17H 1K5NB 1LDPH 4H0GA 2R2EA 4UMGA 4FQIL 4YHNA 3B2VL 4MHHG 3JWNC 5J57B 3ARUA 3BDBA 2CD0A 3LMJL 4LKXA 4PJGB 5BOPA 1JRHH 1H15A 4NQCA 1GVIA 3MOBH 1P4IL 1AIFA 2LAGB 5D1XD 2Q8AH 5A16B 3ZKMC 1YMME 5DJAA 3S88L 1INQA 5A3ID 2CGRL 4DN3L 3IKCA 1DQJA 5IV2A 2EDHA 1BAFL 3L5WB 1IKNA 4Q2ZB 1KIRB 3OAUH 4G6JH 1OB1B 4GSDH 3ARGD 1T7ZA 1BEYL 1MRDL 4NFDA 1A3QA 1DQQA 1HILB 4UINL 4OKVB 3GSQB 4HHAB 2XI9A 4QRRB 1D9KA 2YD4A 4YZFF 3QQ4A 4PJGE 4HPYH 3WNLA 1KIUA 1LK3L 5D72H 5TJWK 4U0RB 1EUUA 3MV01 1MFBL 5IJVA 5IK3A 5L2JA 4P59L 4WUUD 5DK0A 4NN5C 3HNSH 2ZOLA 2LAAA 4L1DA 1C7SA 1YECL 3X13B 5D8JL 3LKRA 5F3HA 3RVTC 4E41B 1EAPA 1ZEAL 3OKDA 4QRRE 4LKCB 5CEZE 3GJEA 1S7QB 3RA7L 4F9LC 2AQ2A 4NKQB 4MSWB 5D7KE 1JV5B 5EO0B 5C9JA 2BVQB 3VFOB 3O8XA 1KELH 1S9WB 1S9YA 2DIBA 3IF1A 2PW1B 3GKWL 4PPTA 2ATKB 4MDJB 1R5VA 5ALBL 5EOCH 4GRMA 1TJHH 4CADA 4AY0A 1G7QB 4PJHF 4JREC 5JW5A 4C83A 4IOIB 4E41E 2IPKA 4LBEB 2J6EA 3SJVD 1IT9H 1A7RH 3VFPB 4MD0A 4RFOL 1FC1A 1ZTXH 3MXWH 1DE4B 1IGCL 5DRWB 2W60B 5JOPD 1UXSB 3TVMB 5KVFH 3D2UA 2Z91A 3KDMB 5B3JF 4QXWA 3X17A 5TDNB 5CJQH 1BMGA 1UWGH 4H1LA 1YYMH 4PJXF 3BKJH 2ZCKH 2R0ZH 1BBDL 2Y06H 4U0QB 2A73B 3U7YL 1U3HC 2V7NA 3VFRB 5HY9B 4WW1B 4D9QD 2X89D 2E9WA 1X5YA 4MQSB 4D9LH 2VDNL 1MY7A 3O6MH 2CRMA 3GUTA 2UUDK 1B4JL 3RL1A 1UVQA 3BPNB 4PTTA 1OSZB 5JLZA 4LPUA 4QNPF 1MLBA 3LEXA 4E0RB 3REWA 1WT5C 2FWOA 2HN7A 3HG1A 3LRSB 4F8QA 4KZEH 4JM4L 5MEND 4JANA 3RZCD 2XKNB 4KKLC 3H42L 4NWUL 5DHYA 4CMMB 4HG4K 1VGEH 2JTDA 1NAKH 4AH2A 4DKDC 4LLAA 3N9GH 2DLFH 4Y5VC 3VG9C 1JZ8A 3OJ2C 4PJHA 4UQ3B 4PB0H 4R4FL 2NR6C 2F8OA 2VAAB 1FVEA 1J18A 2C4XA 1JNLL 1URLA 2HT4C 1ZS8A 1JHTB 1A64A 1B6UA 1I3GH 1XGQA 4GS7C 1G84A 4UT7H 4TSAL 3L3GB 3MGOB 3PL6D 4Y4KA 3QHZH 1R3JB 2GTZA 3R0NA 4MVBC 1NKOA 3CVHH 1B0GA 2JF1A 3DHMA 3PDGA 4ODUA 1NGZB 3C5SA 1DBJL 3V0WH 3HAEA 3VXRD 1J11A 4WW2C 1WBYA 4XBPA 5DA4A 4WI5A 5CP3H 2XZAH 5IROC 1F90H 2XIDA 2V9RA 4OLZL 2BY2A 5HPMA 3AC0A 3EDDA 1NBYB 2R2BB 2E6PA 5HHPB 1JPSH 3A6BH 1H3WM 2EH7H 5J6HB 2X9WA 2W07A 3GHEH 3FO0L 4HULB 2IQ9L 1I3UA 5I1LA 3BHBA 2A83B 3LIZL 3BP6B 3CU7A 1CGWA 4FQIH 5JXAL 3B2VH 1ES0B 1RZGA 3UZVB 4G9FB 4L8SB 1ZSDA 1KTKE 4HH9A 3SOBL 2OJEA 3QNZA 1P4IH 4OF5A 5AG9A 3MUHL 3RNKA 3I75B 5L6YL 3L95A 3S88H 3QO0A 2CGRH 4DN3H 4LSQL 3VD5A 2X1WL 3SDXB 2W9LA 4PGBA 1J8HA 3FAWA 4UTAL 1BAFH 4CBPA 3OGCA 1F4WH 3IDIB 1LO5B 1WBXA 1BEYH 3TBTA 5IW1B 2ICES 1AQDA 1KCSL 4UINH 4Q0XL 4G9FE 4QRTA 4OF6A 1Y18B 5EPMB 5JZ7D 5ERWA 3RNQA 1MFBH 4MB3A 3FQRB 1G6RL 1G7IA 3KPRD 5D96B 4R97B 4LPCA 3SDXE 1FYTD 4UU9B 5EC1A 2DJSA 1RVFL 3QIUB 4S0SD 5DVMA 2JB6A 3KXFA 4U1LB 5D8JH 4QHMA 1YUHA 3EYUL 4IHOA 4KKBD 2IBZY 4JY6A 5E6IC 4POUB 3AVEA 4YBLB 4P46A 2VZUA 5B8CB 2W0LA 1CLZL 2ZSWB 2R2CA 4C59B 2YC1A 1GZPA 5ETUA 3DPBA 5LQBH 4HJJL 1I1AD 1EHAA 4POZD 1BBJB 4H26A 2EEAA 3GKWH 3MA9L 4EN3C 3OQ3B 3ROOA 5MI0C 5ALBH 5GRUL 4PRIB 3VRLF 5J9PB 3MRRB 2ESVA 4Y1AD 4M1GH 2R1XA 3OBAA 1WZMA 4F7PB 3ZKSD 4NZDA 4WU5A 3DSNA 1V3KA 4I8DA 4X6EA 4PJEB 3SKOA 4RFOH 3IFNH 1KLGA 1IGCH 1IGJA 1SBBA 1H3TA 3MRBA 1NEZG 3QH3B 4YHML 3L3IA 4UNVA 5DLMH 4Y0GA 4C58B 4MJIB 2AXGA 2IC2A 3VXMB 1UJ3B 4PRIE 4X83A 3WJLC 1DEEB 5I19L 5IMKB 4HBQA 1BBDH 1GGBL 3EYOB 5JIIA 4YAQB 4PJEE 2GFBA 3SHSA 2ATPA 4EXKA 3L3JA 1AO7D 4PUBL 2VDNH 1DL7L 1OTUD 5HI5D 3IFOA 5BZDB 1A7QL 3MCG1 1B4JH 1LO3L 1R5WA 2VWEC 3MNWB 2X9YA 3GJFA 4MLIA 1F4YH 5GRVL 4MJIE 1ZLVH 5GSRB 3VXME 2APXA 1CTOA 2NLJA 3BWAB 3TH2T 4X99A 4P3CH 4F7TA 3MRCA 3H3KA 5FGSA 1JTTA 5EU7C 4JM4H 4UT6H 4XH2B 1A6VH 5KTEL 1JYXA 4YBQD 3H42H 1GGCH 1WICA 1WVZA 4KROD 5DO2C 5JUEH 1J10A 3VFUB 3S9DB 4Z0BH 3KG5A 1EMTL 3FONA 1UA6L 5I6XC 3CD4A 4KUCF 1BIIB 4LLUA 4EI5C 1JNLH 3LKPB 3LHPH 5JNYA 3V0AC 2VXSH 1FNAA 1FDLH 3S7GA 1UC6A 1MREL 4HCRL 4PRBB 4TSAH 3O4LB 3BIKA 2DLIA 4X9FA 1ACZA 3B43A 5FYJL 3S3PA 4FXKB 3MGAA 3VWKA 2C3WA 3HNVL 5JOFA 1TZGL 1DBJH 1XGRB 1RPQA 5IF0B 3VD4A 2EDEA 1OQXA 4BH7B 5T33H 4GMTL 3BGFC 1EEQA 2W1NA 4HUWA 2P5EA 3ES6A 5FCSH 3L5HA 3HE7A 5C0JA 3Q2CA 4U6XB 2P49B 3DETC 3QZWA 1FE8L 2WBJB 2VC2H 1P1ZA 3IDGA 3O4LE 4F7MB 1FNGA 1A9EB 3C5JA 1CGUA 5EOTA 4NUGL 3FO0H 2IQ9H 1Y0LA 3S4SB 5BXFA 3O2VL 3CGTA 3KVQA 3NBNA 4YHLH 1FFNA 1QSEB 3I85A 1R3KA 5BW7A 3Q6FA 2FCBA 5JHDB 2CKBL 1JP5A 2PXYD 3RWHB 5ESVB 4FQCH 3UTTA 5IW6A 3NCFB 1LEIB 4X6FB 1MHEB 3ARGC 1RJYB 3QIBA 4YIQB 4Y4HB 3CSGA 3SDAA 4LSQH 5EOCJ 1C08B 2P43B 3HB3C 4JFFB 3EO0B 5KSAA 1PYWB 3NFNA 3QUKB 2HMIC 4UTAH 3FT3B 4LQ1A 4MD4B 4TNVF 5D5MB 1QSEE 5ID0A 1ADQA 3PHOB 4HK0A 4G42B 3RX5A 2C4FT 1R3LB 5IB5A 5JHDE 1KCSH 1C5BH 5EN2B 5E2VL 3KYNA 4GKNB 4JRXB 4Q6IC 5GS0L 2CR3A 1BVLB 4WNQA 4ETQB 3JWOH 5FA4A 1G6RH 2OTUB 4QF1B 1SYSB 1WWBX 3STLA 3GSXB 3FB7A 3N1MC 4JGJA 4JFFE 1FZOB 4D9RD 1RVFH 1FG2A 3O3BA 2CLVA 3OKKA 5KVDL 5D5ME 1B6DA 2FX8H 2DQFB 5E00B 4Z95L 3RPKA 3EYQC 3V95A 4R3SA 3FO1A 4Z7UB 1U3ZA 5EG6C 5DURB 1CLZH 1B2WL 4JRXE 4LCWA 3CDYA 1DBAL 5JDJA 3RVVD 4HJJH 2VISB 2P45B 3D3VB 5FYKL 4U1MA 1I1YB 1YN7B 3GO1L 2DICA 4R26L 3ARFB 4H88L 2WQRA 4X7TA 5GRUH 3ZKXC 4AENB 4XWGL 4HPOL 3G5ZB 3DBXB 2ITCA 3IDXL 4K3DH 4XI5D 3WHE0 3WIIL 2A1WL 3FFDB 2FHCA 4P2RD 4A6YA 1WUNT 2X9XA 4HIXL 4FXGB 1I7UA 1P2CA 4YHMH 3X3GL 3D3VE 4BUGA 1ZLSH 1YEDA 5KN5A 1S7WA 2K1MA 4BK5A 1H5BB 4YDLC 3MMEA 3G6AB 3T4YB 2PTTB 3VFTA 5T5FL 4CJ0A 4P2QA 1GGBH 3BQUB 1UCTA 4DVBB 2XG5A 2CK2A 3V6BR 4F9PA 3TZVD 3TJHD 2OXGA 4GKZA 5JQHC 1U8HA 3QXTA 2WK2A 5E7FA 2Z8WC 3NPSC 3RZCC 1LO3H 1CFNA 2A77L 4OLUL 1V05A 4GG8B 3CUPA 2C3VA 3T8XB 5HHQA 2Z31D 4U1JB 3V6FA 4RRPG 4XGZA 3A0OA 5KTEH 5HHOD 5GZND 3RL2B 1K85A 5CIPA 3WO4C 2D31A 1OD7A 2JIXB 1EMTH 1UA6H 4GO6B 4ORGA 2A0LD 1HNFA 2XN9A 4ZO9A 1TFHA 2X4TA 1HEZB 1P7QA 1F42A 4X5XB 4HCRH 3GEWB 2BK8A 4ZPTB 1MVUA 2NPLX 4NSKB 4HAFA 4NN7C 5C0BB 3GRWA 3NZ8B 5A2JH 5I8CB 4ZO6A 4AL8L 3T3MF 5FYJH 4P46D 2UV3A 1X5HA 1EFXD 4WO4C 2X7LA 3IFLL 2IG2L 3VXSD 2R23A 2XV6B 5F1OB 5E2TL 1U8KB 3VJ6A 1LQSR 1IVLA 4GMTH 1RZJL 3BZEA 1X5KA 3CX5K 1EHXA 3KPPB 3P11H 1OW0A 1FE8H 5F7MC 4I9WD 1T1XB 1UADC 5C0BE 4EUPA 4RSVA 4NN5B 1RJZB 4BQ9A 4OGYH 3MLUL 2B0SL 2M26A 3O2VH 5DD6A 3NA4A 4IOSD 4KJPD 1WFTA 2CKBH 4TNWK 1A8JH 2VUOA 4H1LG 3OJDA 3PV6B 4RFNC 3VXPB 5ID1B 3NABH 1HI6B 3NZHL 3LKSA 1IEAA 3ARDB 4FTVB 4QRPD 4IRSD 5DVOA 1KN4L 2VLME 3EGSB 5HHXH 1I8IA 2R0WL 1T83C 5HYIA 1S5HA 5JZ7C 1AKJB 3K1KC 3T0EC 4ZYKB 4I18A 4Z7QF 5GS1C 3LV3B 1T1ZB 2J12B 5B4MD 4UV7H 1RUQL 2FIKA 1N59B 1NCUA 5DJ0B 3DVNB 5E2VH 1RUKL 1Q0YL 3K8MA 5GS0H 2GIYA 5I1GL 3C8DA 4FTVE 4X9BA 3KPQA 1LK2A 3T08A 4QYOA 4X5WB 1BM3H 3UPAA 2Q7YB 1JVKA 3WFHB 4JFOB 5INDB 5LGJB 5KVDH 1S7TB 2Z8RA 1YEEL 2BHUA 3TO4A 5ITFA 3MPCA 3VFGL 3W0WA 1N3NB 1W0WA 3OKYA 1TITA 4YPGB 4JO3L 4D2NA 1RIUL 4JM2C 1DQLL 5FYKH 4JZJC 1VENA 3GO1H 3ZE1E 2I25N 4H88H 3O6FB 3TNMB 4XWGH 4M5YL 5EUOF 4HPOH 3G6JB 5M94B 5DZLA 3IDXH 4PGDA 1CFSA 5C09B 3GSNA 1Q38A 2ZSVB 3HAEG 2A1WH 3HUJB 4L3EA 4JPVL 2A6JB 3RKDD 5DI8B 3MGTB 2HWZL 4HIXH 4XP5L 4Y5VB 5E2WH 4QT5A 2YKLH 1CK0L 4ZMAT 1RURL 3X3GH 3UO1L 2HVJB 4HWEH 3L3HB 2FJGB 1QBAA 1QNZL 4U1GB 5C8JB 3G6JE 4GS7B 1AR1D 1I3VA 5SV4A 5C09E 3JTSA 5GGVH 4ESKA 1MIMH 3HUJE 2VOTA 1A9BB 2P8LB 4J3TA 4GAGL 5FA3A 3DO3A 1YN6B 3EFFB 4Y2DD 2KQMA 4M7KL 3QI9B 4IIQA 2ZG2A 4KROC 1EA9C 3QIBD 4WI6A 1T22A 2E8YA 4K94C 4H8WC 1IKFL 5DJ6B 1JF6A 2XZQH 1D9KC 1DVFD 5IBUG 3WHXA 5DT1L 5JDSA 2PNDA 4NRYB 4RIRB 1MWAB 5DUBA 4NN6C 4M9PA 5EUOA 4JDZB 3MREB 2Q6WA 1PX4A 4BZ2L 3O9WA 2VLKA 3PGFL 4U4BA 3ZSTA 2GITA 2NY2D 5I18L 1N64L 1I8MB 2F54D 1S7RA 3ZYOA 3EJZD 3PWVB 5T1KB 4R6UA 3LKNA 4LGSB 3O8XC 3Q3GB 3FHQA 1E28B 2OP4H 1DN0A 1LHZA 2VNCA 4NQTA 1PG7X 5FGCB 1F58L 3CFKA 4S1RL 1QPXA 2IG2H 5KSVA 2V5TA 5DVLA 4GRWF 2G2RA 4XMKH 3P4MB 5DSCB 3DX8B 3RGHA 1RZJH 1WC7B 2VLRA 2XQBL 4H25A 4WVRA 2HRLA 3FQTA 5EIQA 3U6RA 3RVXC 1T04A 4MX7A 4JQXA 1DR9A 4BK4A 1D5XB 5FGCE 3MLUH 5D6CA 5C0IB 5JW4R 2B0SH 4QTIL 2BSSA 5F7HA 4KTYA 4UI2A 4YDJB 1PZUB 5GGQH 4MA8H 1QEWB 2G75B 4K55A 2ITDB 3M1BA 1IAIM 2G9HB 1G9MH 3P4OA 3OTTA 4PRNB 4ZXBD 5HI4D 1OTTD 2YWYA 3BPLC 4WCYL 2WP3O 1KN4H 2C1OA 4K8RD 4EN3B 2YD6A 3STZA 5MI0B 2A6IA 1MH5B 3MRKB 7CGTA 1W8OA 5MEPA 4QLRA 1FL6A 4IM8A 4KC3B 3P30L 3ILPB 2FECI 3ZE2E 1HOCB 4P4KD 4LL9A 1VGKB 2CQVA 5GGUB 4X7CC 5HJ3A 5IKCA 4HUKB 1A1OB 5IT2H 2BNUB 1QSFD 1RUQH 3X3FL 3P73A 2HYMA 1Q0YH 3I9GL 5I1GH 3JV4A 5BRZA 1RIHH 4I48B 4EOWL 3WFBL 2AQ3A 2K7PA 1ZXQA 2X4OB 3EZ8A 4P23A 3RP1A 3RVVC 4D0CB 5T1LB 1YEEH 3MTRA 3GSOA 1UYWL 3GDBA 4Y4KC 1MI5A 2OTPA 4WFFD 4WDIA 1KIQB 1SJHA 5MERB 5F3BA 3GZKA 4JO3H 5I1KH 4PLJC 3LN5A 5IQ7H 4XI5C 1DQLH 3DX7A 4V1DA 1P7QD 4TQEL 3OKOA 5D1QD 3B8YA 3RWCB 4CJ1A 2H2PD 5ESAA 5IVZA 1GCFA 1YEIL 4WY7L 5MEQA 4LGRB 2IEPA 1XF4B 3DGGB 3FN3A 3FQWA 4UIMB 2I60H 4HT1L 5L88L 3GSVB 3O6KL 3BN3B 1NCAL 4MXQC 4FS0A 2EXWD 1IAOA 4LLVA 1AGDB 1RK0B 5HHMB 4XP5H 1CK0H 1E4XI 1RURH 3QZWG 3IU4L 1ZV5A 5JR1L 2VWEE 4KGJA 1WIOA 3NCBB 3TJHC 4D8PB 4XCYB 1OAKH 2GY7B 4EI5B 1FL5B 3HCVA 2ILLA 3HNTH 5BS0B 3C09C 4F7EB 5C0NC 1A5FH 1FV1B 3FO2B 5F1NB 4OIBA 1U8QB 5EU7E 4JZNB 4OZFA 4O2FB 5ANMB 1GGYA 4GW4A 4ISVA 1W72A 4J23A 4Z7WB 5I75C 1CGXA 5HHME 2Z31C 4GAGH 4Y5YB 3K80A 2IPTH 4NKOB 1FVDB 1IE5A 4M7KH 2ICWJ 3UTZB 3QFJA 3F12A 1YY9D 1CDJA 4LLMA 1KCRH 1ZHKA 5DJZB 5BS0E 1IKFH 1WQVT 3BGFB 3JXAA 2R15A 4KXZI 3OR6B 3QXAB 4GLRH 3HI6H 3U48A 5CZVL 5ANME 2ZPKH 3QUZA 4JZOA 1WBZA 3RVUD 3WFCH 4CVXB 4Z7WE 3RTQA 5C9KA 1DBKL 3TLRA 4Z7NF 2COQA 2VTFA 5JXEA 5D1XB 1Q9WA 4S2SB 4BZ2H 1EO7A 1A6AA 3PGFH 2AV7A 5J56B 1N64H 4P46C 1OOAA 2DTMH 3QEQA 1RHFA 3ARGB 1YEKL 3DO7B 4XPGH 3TV3L 3HRZA 3MJ9A 1FBIL 5JIPA 3TIEA 2FDBP 1UENA 3MOQA 4RZCB 4YQXH 1LD9A 1GHFL 3PWPD 4XPBH 2VABB 5AYQA 3IS1X 3W0WD 3WBDA 1F58H 5GSVA 3F5WB 2A6DA 4S1RH 1G7PA 1BQLL 4WUUB 1NDGB 1VESA 2CLRA 2VN7A 2VIRA 4FP8H 1UWEL 4ZFFB 2VQTA 4KJPC 5GZOD 3DUSA 3AFLA 5KS9B 2WANA 3S6CA 1ED3A 5MEOB 3SDYL 5SWQA 4FZEL 1RI8A 2HFTA 1VEPA 1CVRA 4LCUB 1WSST 2OXHA 4QTIH 2CK0L 5E2JA 2WWMD 4MXVE 4MA7L 5DMGC 3SDDA 4MNQB 3K7UA 1K8IA 4WUUE 3DARA 4X9IA 2DQHL 1IC7L 3R06B 2V2XB 3D18B 2IF7A 4JY5L 5GS2D 1U3YA 4DZ8A 2MHAB 4AIZB 5KS9E 1JGEA 1BOGA 4P5MA 3SJVB 4NCC2 4CL7A 3REVA 4X4YB 1IARB 2Z92B 3KPNB 4MQ7A 2NY6C 2EICA 3P30H 4GAYB 2VR5A 1J5OL 4IRZL 1A7OL 3X3FH 1MJUL 5F21B 1QPPA 4LVNC 4X8XA 3I9GH 1AXIB 1ZA6A 3UEZA 1YEGL 1QG3A 2X4SA 4C56D 3SJVE 1F3JB 4EOWH 3RWDB 2D7TL 1HDMB 2CH8A 1TETL 5JOPE 2VSDA 2NQCA 3V8OA 3BP5A 2YPLD 2FJFA 2ZKHL 3QUML 3NFSL 2BMKA 4XCCL 1I1FA 1HXYB 4HIEA 4KQ3L 4NRZB 4OLYL 2MKLC 4QTHB 2VLKD 3BO8A 2HFFB 4QXGL 2H32A 5MENB 4NGHL 3RZCB 3VWKC 4D9QE 1II4E 2E9IA 3MQIA 1B3JA 3IAPA 2O61B 2EE9A 5EU6D 2YBRA 4O00A 2JLLA 5HGBB 3F7YB 2WUBL 4NRXB 5L88H 3O6KH 1FNLA 1LVEA 2NXYC 4J12A 4OLEA 1KB5B 2GKIA 4MB5A 3ROLB 1NC2A 2F8VA 5GISH 3HMXA 5MENE 3PL6B 1ETZA 1YJDC 4HWBL 1IC1A 3IU4H 5D7LD 5JIHA 4YHPB 1PG7W 4YHYC 4H20L 5LGHL 5BW7C 5IHUL 4EUPG 2IADA 2VB5A 3PQYD 4OFDA 2A9NL 1NLDH 3H3BC 1OL0A 3MLTA 3VXRB 5FB8A 4PB9L 3QIBC 2ADJB 4FN0A 2YD8A 1G1YA 3BP7B 3PDOA 1VKXB 1Z5LB 5CJBA 4UUJA 3T0XA 2VYRE 4EDXA 4LSPL 3EDEA 3F7VB 4XXDA 2IH1A 4U1NA 1Q72L 1U58B 2X4NA 2Y7QA 5SX4I 1CICD 5HVFB 1F2QA 1OP9A 3TA3D 1X3DA 2NY3C 2FSEB 3WYRA 3CC5A 2VE6A 3Q1SL 5D9SB 3LKOB 3VXRE 1P84K 1G7JA 2FD6L 1MUJA 5E8EB 1FG9C 3GSUA 5H94A 1N0LA 2GSGA 5IVOA 4MNGB 5JTWA 5E99L 2W59A 3VRJA 1RULL 4FQXD 4RAVA 3W81A 5KW9L 5ADOL 3R4DA 4KVNL 1EHNA 3DRQB 2H9GA 1U36A 4MDIB 4U1HB 5FM8A 5J11B 4RFNB 5ENWB 1NFIA 1NGWA 1FBIH 2W9EH 4M5ZL 1XH3A 4JHAL 2W0PA 1GHFH 3PWUB 2ZOKA 4NQSA 3DYOA 4MNGE 3AXLB 4NO3B 5BVJB 3KPRB 1DBBH 3UC0L 5HHVL 1BQLH 1G7HA 2HTLC 1FYTB 2D0GA 4ZFGL 2LV4A 4O5LH 3WE6A 2KZWA 3UPRA 3X12B 4JO1L 1U8JB 3SDYH 1F6AA 2BNRD 3BGMA 4PGCA 2DMBA 4FZEH 1I75A 3BE1L 3MNZA 4M7ZB 2SEBB 4HV8A 3SPVB 1I1AB 43C9B 1M7IB 3KPRE 2J4WL 4XTRD 1HQ4A 3I02B 1NCCL 2BVPA 1BZ7A 2ZCHL 4MA7H 2EC9T 4K8RC 4PJ5A 2EZ0D 1L6XA 1A6WL 2APWA 1FYTE 3L9RA 4NNPH 4U6YB 2DQHH 5F9OL 1JHLH 4F9PC 5J1TC 4EJ1C 4Y1AB 4JY5H 4P9HC 4FQQB 4LSRL 1YA5A 4ODBD 4BM7A 4JZJB 2DMKA 3W9DB 2VDRH 1A1NA 5EFIB 3EDFA 1A4JB 5DJ8A 2AK1L 5CMAA 3CZJA 1WAAF 2XY2A 1FORL 1CU4H 2N7AA 2VLJA 3OZ9L 4X7EC 4ZQKA 4ERSH 3T0DA 2AVGA 1A7OH 3VCLB 2BC4B 3C9NB 4XC1L 4Y1AE 5E9DA 3SY0A 1WJ3A 3IKKA 2DYPD 1YEGH 3RWIA 5IQ9B 1CT8B 1EZVX 4GRLA 3DXAA 3GKZA 3O3DA 4JFQB 1F6LL 2F9BT 4P2YA 3VW3H 1U95A 2D7TH 3NIDE 2YEZA 4YHNB 1HCVA 2G60L 1RMFL 1AO7B 1S7UB 1TETH 5DVKA 4LAQL 2ZKHH 1XFPA 3QUMH 3NFSH 2R56L 4XCCH 4NO0A 5B38A 1BX2A 5DF0A 1RD6A 5F8QC 2VDML 1JGVL 4J3VA 4KQ3H 4I3GA 2PF6A 1U2CA 3ILQC 4ZS6D 2CDFA 2AXJA 2AK4A 4QXGH 5IV2B 5EBMA 5TH2A 4NGHH 2YD9A 5CLWA 5DYOA 2Z4QB 3KGRA 2EXWC 4HIJA 4KROB 1JPST 3QEQD 5EZLA 5JOEA 1LE9B 1AO7E 2OM5A 2YRZA 4K71C 2PW2A 4HUMB 1UB6B 1AGCA 4PJDB 1P6FA 1U8LA 2XKSA 3I50H 2YXMA 3IJSA 5JW4N 5C0FB 5T3XD 2MKWA 5IK3B 4HWNA 1E27B 5KVGL 2I9TA 4NN6B 2CUMA 4OFKA 4APQD 5IFJB 4HWBH 3CX5J 4B7IA 1WAAA 3U2SB 4LSDA 3SN6N 2OL3H 3DYMA 4YO0A 2PYED 1EBPA 1HYSD 4H20H 5I71B 5IHUH 2EXYC 3J8F7 4Q9RH 5DR5H 1PD6A 2BCKA 2ARJQ 4PJDE 3NAAL 4JFDA 2A9NH 1YMHB 9CGTA 5T3ZD 2W0FA 4YFLF 5C9JB 5A2LH 1YY9C 1KENL 5DMIL 4PB9H 3BISA 5IB4B 3VXOA 3IF1B 4BFIA 3AMLA 3GFUA 1YY8A 3MBED 1OVZA 4AMKL 2HLAB 2CKNA 4Y5XA 5JQ6L 4L29A 2K3TA 4LSPH 4CADB 4UOW0 4K94L 4BSJA 4I18C 2R4RL 4L5FL 4H8WL 4C83B 2EDKA 3WFDL 2PETA 3H6JA 3VGFA 2CMRL 5INCA 3V5KB 1RK1A 3Q1SH 2J1KA 4N0CD 3D25B 4OZIF 3I6GA 3BKCL 2PXYB 5CEZH 4PREA 4QY8A 2AERT 1LEKA 1FP5A 1CDHA 1QFOA 1IM9D 3IDJA 4FFVD 1RULH 5KW9H 5ADOH 4KVNH 5FEBA 1CF8H 4JFPA 3TO4C 3KPLA 4JFXA 1NJ9B 5GRXG 3ABZA 4BKLB 4QRSB 2HT2D 2BNQA 2F5BL 3CH1B 3BPOB 5JPMA 4ZPVA 4HUVB 4M5ZH 4X7SH 2WIIB 3BPLB 4ELMF 3DV6A 1N7ML 1T5WB 4R96A 4JHAH 4NJAL 4PTTB 3FQXA 4OFYD 3THML 1EAJA 1UXWB 1GAFL 4I77L 1Q9LA 3FAXA 4NM8H 3LEXB 3T2QA 1T21A 2J6EL 2QR0B 4XP9L 3B83A 1WCBA 5JORB 4MD5B 5HHVH 1LDSA 2CO7B 4O2CA 5DHYB 4ZFGH 3BFOA 2XT1B 4A2MA 2N7BA 2HRPL 5GGRA 2B20A 2IBGA 1WF5A 1Q0XL 4BZ1H 3S37X 1ULVA 1YYLL 4Y19A 1V3LA 1FVEB 5BMFL 2DWDB 1F13A 3MFFA 1EX0A 1ZS8B 3QJHA 4TVPL 3U36B 3G9AB 1MHHA 4KJQC 2J4WH 1NCCH 1PZ5A 2ZCHH 4ZAKA 4MXWL 4OZIA 1LEGA 1GJIA 2EDRA 2MQ3A 3D5OF 5F9OH 4D9RE 1DBML 1GIGL 1J05A 5E94B 3G08A 1R24A 3INUL 5F6IB 4PJXB 4LSRH 5BJTA 4OZFG 4IIQC 2P8MA 4MAUL 2WBWB 4P2RB 5D93C 2DQEH 3HR5B 2P5WA 4Z5RA 12E8H 1TZHB 1XR9A 2DIAA 4RNRA 4GQ9L 4NO2A 4KK5D 4ELMA 2D03H 4R90H 5B3JE 1R6VA 5ACZA 3JV6A 1HSBB 4N8PA 4OUOA 4PJXE 1JZ5A 4FFZL 2ZG3A 2GK0B 3BHBB 4CGTA 5I1EL 5I1LB 1ZT7B 1CLOL 3O9WC 4GUPA 3TZVB 4P2RE 3RGVD 2X1PA 4PYHA 1WZLA 1MHPH 1RZGB 3GJFK 2CIIA 3C09B 3F62A 5I1IL 2X70A 5CEYB 4HH9B 1T89C 1FIGL 2VDMH 1HCFX 1AGBA 2O5ZL 1U8NA 2YUVA 5I75B 5DRNB 3VG0L 1KTLA 5HYQA 1E6OL 4DVRL 3IRZA 1A14H 3GK8H 3V4UH 2Z31B 1IZKA 1MRFL 5IBUB 1U8MB 5TF1H 1G7LA 3QCVL 3OGCB 4IBLT 32C2B 3LN4B 4DW2L 5HHOB 4M3KB 3TJEL 5L2KA 3DVIA 2NY5H 4RMRA 4CRPA 4RMQA 4UDTA 1AD0A 4ONFL 2DWEA 3MRNA 1FJ1A 1T7XA 5CS7A 2DQUL 2NZ9C 1JPFB 5E7BA 1I4FB 2ADIA 4LAJH 4OM1L 3OX8A 2FBJL 1NGXB 2OQJB 4LRNL 5KVGH 5ESQA 4JQXC 4Z0XA 1UB5B 5HHOE 1IJ9A 2X10A 3L1OL 3P0YL 1IFHL 5HGDB 4OZHF 5E56A 4P46B 3NAAH 1EFXB 5ETUB 5EDXA 3VXSB 4C57C 5DMIH 1HHKA 1KENH 3TH3T 3V6OA 5TE6H 3VE0A 4RGND 4H26B 2X05A 3TFKD 3GB7A 3AS0A 2CDGB 4AMKH 3RX7A 1NKRA 3MXVL 5JQ6H 4O51B 1IL1A 5F71A 1G9EA 3QIWA 3NTCL 2R1XB 2VXTH 3MV7A 4H8WH 2JE8A 4P2OA 4WU5B 1OY3B 4G7VL 5FOJA 5ACLA 2CMRH 1KSRA 3P9WB 1JPGA 1HWHB 3BXNA 4V2BA 4X0KB 5DD1L 3VXSE 5F7DB 3QUXD 1G7MB 3L3IB 4XAKD 5DQ9A 3BKCH 3U83A 3TC9A 2YN5A 2XG4A 1DCLA 3CFDB 5BVPL 2AJ3A 5KSBF 3JWDH 5CILL 3QUYD 2AXGB 1TENA 4JG1L 3VWJD 1IC4L 4P23C 5DEFB 4QRPB 4I9WE 1DQTA 4LCYA 4IRSB 1DP0A 4QGYA 4XVUD 2APVA 3QULB 5IFHH 1HK6A 3DXAD 1QFWI 3BH8B 2D7NA 2PR4L 3VXUA 2P1YA 2F5BH 2YWZA 3MACL 4S1DD 2WV3A 5F88A 3MNVB 2R69L 1F8TL 3NGBC 5DHVB 3TBSA 4RX4A 3SGKA 1LNUB 4NJAH 4OZHA 2YPKB 3FT4A 1GAFH 2NYYD 1A7BA 4I77H 1X4XA 4CUCA 4I4WA 4KY1L 5TGBB 4QRPE 3TBVA 5FUOL 2DM3A 4X99B 2AK4D 2XY1A 2X5PA 5DWUH 3S98A 4LARL 3EBAA 3A6CH 4PJFF 5EU3A 1D5MB 4HJ0D 2HRPH 1VFAB 5CJOL 1NC4D 2XKUA 5HGHA 4F57H 2ZNXA 4ZUUB 4EDWL 2EZ0C 4IMLB 1ZWIA 2Y5TA 2QEJA 1SYVA 1YYLH 1J88A 4H1LH 4XCNA 4O9HH 1KJ2B 2AJYH 5H2BA 2RAMA 1INEL 4TVPH 2IPUG 4YE4H 4CU7A 3HLAA 4MXWH 3BZDA 4PS4L 5IIEA 4JVUA 3JVGA 3DX9B 1GIGH 4O2EA 1IM3B 3PWJA 3S35H 3INUH 4ZOCA 4Y16D 3MLYL 1T2JA 3PIQB 1JNNH 4MAUH 2A6KB 3BZFB 4P5KA 1CDGA 4LASL 5D7IF 4ZG1A 4EQ3A 5DFVC 5C0JB 1EFQA 4GQ9H 4LIQE 4JJ5A 2BVEA 4WU7B 3TIDA 1FNGB 1RFDL 4KI5F 1D6VH 3D0VB 3RTQC 2MMXA 5TF0A 1YNKL 2R29L 4NQDA 1I9IL 5ISZA 4HJGA 1FFNB 4ZS6C 1R3KB 3Q6FB 3MJ6A 4PJFA 5DJDA 1PAMA 4Y2DB 3CDCA 5J1AA 1JRHI 4XNYL 3TPKA 2GYSA 2RCSL 3QIBB 3CZFB 2O5ZH 5J3HC 4YNYB 4ETYA 1DVFB 4DVRH 1KTDB 3HZKA 3NFNB 2HH0H 1MRFH 3HAEH 2H6PA 3QCVH 4DW2H 2LVCA 3FB5A 3PGCA 2DQCL 3T65A 3FB8A 1EEZA 3BH9A 2AP2A 4O58H 4APQC 4YGVA 1T1WA 3V0VB 4PR5A 3BMWA 4L8BB 4OM1H 1QTYT 4I2XA 2NY2B 2F54B 3SDCD 1YJDL 1C8PA 1MCNA 2I5YL 5D7IA 2VMFA 4I0KA 4QXUH 5L9DL 3AREA 2CLVB 3MCKA 3IS0X 2J8HA 4OAWA 3QFDA 3SDDC 2YA0A 3L1OH 3P0YH 2O5YL 3MBEC 3QP3A 2UZIH 1FYHB 3GI9H 3MZGB 4BSWB 4RMTA 3EJJX 4YDIL 3GM8A 1RY7B 3DURA 3SE3A 1ZOXA 4I0PD 1P69B 1PQZB 4U1MB 1QA9B 2F54E 4ZAKD 1M4KA 4I5BB 5AD0A 3B9VA 3DLQR 4FNLL 3BP4A 1TQBB 3QWQB 3IFPB 3RY4A 3MXVH 2XYCA 1ADQL 3VU2A 3NTCH 1MCLA 2BX5A 4K9EL 2ITCB 1UCBL 2ENSA 2P24B 3WS3A 4L9LA 4HWUA 4G7VH 1E4XL 2XWJA 1H0DB 2DQIL 4FFVC 5D6DA 4K3HA 4M93B 4R0LA 4KZDL 4MAYD 3JSSA 2CJUH 1SM3L 3JBG7 3OKEA 2YD2A 4JG1H 5KN5B 4ZXBB 4G6KL 3OXSA 1U8PA 2YHGA 1I1RA 2X1XR 1GRWA 1QYGL 3QDMA 3U82B 1H9VA 4Q97A 3BDXA 3F6LA 3OG6B 1XF5B 1PY4A 2PR4H 2AEPL 4PY7A 3NN8B 2PCPB 5FK9B 2YD3A 1NCWL 4GKZB 3MACH 3WEXB 1HXMB 1JUFB 1U8HB 3MOAL 4NM4L 5B38G 1TCRA 2R69H 1WZKA 1QSFB 4P49A 2QSCH 4X4XA 2NTSP 1U8OA 5I30L 1IGTB 1AXSB 4KY1H 1CD1A 5HHQB 3QO1A 3LQAC 3MUGA 3CFJA 1MCWW 5CZXD 4JAMA 4XGZB 4A6YL 1QFUL 1UH4A 1KIPB 4ZOEA 4KKCD 5IUSA 3N85L 3CMGA 3I6KB 1NH6A 1E4KA 3BVNA 5CIPB 2OLDA 3W2DL 1AI1H 5E8PB 4R2GD 4TULL 3VGBA 1QSFE 4NOFA 5FKPA 1JGDA 4G6FD 5DJXA 2NW2A 5SWSD 1INEH 5A43C 4EBQL 1P7QB 5LG1A 5D1QB 2ZCLL 4CMHC 1U8IA 4NJ9H 1T1YB 4GG6F 4P9HL 4L4TA 4UB0H 1X5LA 3KNBA 5DS8A 2VDPL 4HUUA 3MLYH 3GJFH 4KK5C 3QA3A 2X7LB 3QWRA 4TSBH 2LFGA 1O5DT 4DCQB 4WFFE 5EO1B 1F11B 5EB9A 4G8FB 4JPKL 3VJ6B 4KTDH 4LASH 4J4PA 3S3SA 3BZEB 3C6LD 4NZTH 4MJ5A 1SEBA 1RZIB 4XVTL 3C8KB 3HFML 5IEHB 4ODWB 5DQJB 3WKNA 3MV7D 3T04D 1KGCD 1YNKH 5J8OA 4EUPB 4P2OD 3SGJC 4PD4K 1DDHB 1BZ9A 5KVEL 2HA1A 4YDVB 4HXAL 3C6SB 1S78D 5J13C 1P84J 3L3KA 1MFEH 2E9JA 3H8NA 4CAGA 1W0YT 4HSQA 2RCSH 1R5IB 4PJCB 3GRWL 5F9JA 3FQNA 4XNMA 4Z78A 5I1CL 2WP3T 4BQBA 1I8IB 1KNOA 3HZYB 2IFFL 2RFXB 1I7ZB 4D0BB 3T09A 4BA8A 5GIRB 1SBSL 3QHTC 5HDQH 3GMRB 3D85D 4GG6A 3EOBA 3FO9B 1BGXL 1MAML 1P4LA 1MCQA 3TNNA 3O2DH 3N1PC 2F53D 1S7VA 4PJCE 1J1PH 1YJDH 2FR4A 2X2YA 2C4FU 1CXLA 1S7XB 2I5YH 1M71B 1NMCC 1JBJA 2EC8A 3KLHD 4RMUA 3N0PB 4LHJB 1KCUL 4D0DA 3TFKC 5MHSD 4JHBA 3ZE0F 3PWPB 5ICYB 1BECA 1K4DA 3W0WB 4IJ3C 5GGSB 3SKNB 3C5ZA 4YDIH 1OAXL 4N68A 5KSUA 5GRJL 3HI1B 4X98A 1T0MB 1OARH 4URTB 4FNLH 1C5DB 1RJLA 4YHOL 2DKUA 4U7KA 1ADQH 3C2SA 1JK8B 5CGMA 2NY4C 5D4QA 3QUXC 3B5GA 4K9EH 4OLVL 1CFSB 3V6ZA 2FL5A 4FA8A 1UCBH 1IAMA 5JW3L 3PWPE 3GBNL 5DHXB 3ULUF 2DMCA 2EIZB 4G43B 4AEHL 4Y89A 4M1DH 4FQHB 3W0WE 5F1SA 2WUCH 4Z76A 2R8SL 4MA3B 4XVUC 1CR9L 4QT5B 4LFHG 4KZDH 1IGYA 2AV1A 1SM3H 2ZJSL 1QQDA 4G6KH 4CNIA 4B5EA 5DGRA 1NEUA 4PTUA 1RAMA 4ELKB 4NQDD 1QYGH 5ISZD 3HC0A 3H3PH 1D6EA 2QHRL 4IDJL 5EZJB 5DFWH 3UJIH 2AEPH 3GMLB 3IJYA 3RVWC 1U9KA 4XWOC 1NCWH 4G8GA 3QEUB 3MOAH 1WEJH 3BKYL 3D48R 3SKJH 4PJ8D 3V8CA 4KXZH 5D93B 1HWGB 1K9TA 4G8EB 2PYFA 5EBWA 3G04A 4C56B 4LLYA 3GSNL 3RI5K 3UAJC 1J1OL 1F45A 2CXGA 3STBA 4A6YH 5FO9A 4LOUD 7FABL 3N85H 2FEDC 4PRPA 2HP4A 2HFGL 4LSVL 4KKAD 2XFXB 3UTOA 1LE5A 1J1XH 2VKWA 3AAZB 1FZKB 5DMJB 3WCYA 4JDVB 2VLKB 4F7CB 1Q8MA 1A02N 3EJYD 2PO6D 1FNHA 2GITB 4EBQH 1Z0MA 4C56E 1XIWD 4KRLB 2ZCLH 4E42B 4L4VA 1EJOL 5EC2A 3TYFA 2H3NA 4R8WL 3VI4F 5EU6B 3MLXL 4QHNB 4M03A 1VERA 1WZ1L 1LILA 4PG9A 2VDPH 5F1IA 3QG6A 4Y5XC 35C8H 4WWKA 2CLZA 3KWWB 3FRUB 4CVZA 1A1MA 2R0LL 2GAZB 2VLKE 5FUZL 3LZFL 2EDYA 1F02I 3K81A 1BD2A 3WKML 1T3FB 2B2XL 5IEKA 4ONOA 2X1QA 2BVTA 6FABH 5D7LB 1CS6A 3B9KD 3WL9B 3TT3L 4KV5F 3UTSA 3KJ6L 3HFMH 5EU6E 3PQYB 3TT1L 5FYLH 1CG9A 3E6FA 1A7NL 4G6ML 1MWAH 4L3AA 1LO4H 4P57B 1X44A 3VFNB 4HXAH 4P9MH 2NTFA 1IEBA 3EYSL 2Y6SC 3P0GB 1J0HA 3TEUA 3KYOA 5D7LE 1TPXC 3QCUH 3VGAC 2OTWA 3C60D 4WEBL 1YEJL 1CICB 3PQYE 1CQYA 3TA3B 4R7DA 2IFFH 1KPUB 2AJXL 1MHCA 1FL6B 4E5XB 5FYJD 1CIDA 5DMYA 1RQ5A 1T2QL 4MZ2A 3I3DA 4R7NA 1BGXH 4Y4FD 3BUYB 4ONHB 5I66B 1CDUA 1NANH 2Y07H 4FQXB 4L3CA 1SJVA 3V79C 1MQKL 1QFPA 4U1SB 5KG9A 1QRNA 1A6ZB 4YHZH 4XAWL 3UJTL 4GRWB 3MR9B 3DMMA 4QOKD 4OSUH 3LQZB 2G5BA 3QNXA 4TNWF 4XZUA 2HG5A 2B5IB 3J7HA 4ZAKC 3H0TB 3O0RH 4GW1B 4MS8C 3T77B 1XCTA 2Z35B 3U0TA 5GRJH 3QXDA 3GGWA 2CIKA 4GRWE 1F4AA 1LO2L 4XNZC 5ALCH 4NWTH 2ZP0T 4WJ5B 3KLAB 5IMLA 5DJCA 5D1ZA 3HZVA 5K33A 4OZGF 4OF8A 2BNRB 5JW3H 2QBWA 3CJJA 4AEHH 3OGOE 2C5DC 2R8SH 1UQSB 5HSFA 5C0RL 4PV8A 43CAA 1CR9H 1UT9A 3IXAB 1T2XA 1M7DA 5GS0D 2AS5M 4AK1A 1A3LL 4QXTA 1VADA 1XR8A 5DVNA 2L7JA 3DTXB 1ZVYA 3H9HB 3QWOA 3HCVB 3P0VL 3LOWA 2BNRE 4OZFB 3ULVF 4ZUVB 2FIRT 2IALB 4NYLA 2HJLA 2CSPA 5FDWB 5CD3A 4IDJH 1FAIL 4G8IA 4L8CA 3LKQA 5D2NB 3PNWA 4JFYA 3BKYH 2QKIA 5CZXC 4KK6C 1IRAY 1UZ6E 5FYKD 3F12B 4DWHA 5L0QB 1D5BA 4TUKH 3VXNA 4LLMB 3IAGC 5AAMA 2DYPB 3ME0A 5F9DC 3GSNH 1S3KL 3OAYK 5I17A 3S34H 3ARPA 3QHFL 3EHBD 1WBZB 7FABH 3RTQB 1B0WA 2GT9B 4N9GA 5D2NE 3VFMA 2HFGH 1OWRM 4OZGA 4QHKJ 1VA9A 1FFPB 4HKJA 3ARBA 2KL6A 3EOAB 3WUWA 4JN1H 1O0VA 4DOHB 1OT1A 4ALAL 1W72L 3WFZA 3QEQB 3BI9X 1NLBH 1EEYA 1EJOH 3TIEB 4R8WH 3V6OC 1Q1JH 2YSSB 4ZOAA 2B8OT 2DKMA 3MLXH 1WZ1H 3CSPA 2DAVA 1YC7A 4HC1A 3MRFA 15C8L 1SY6H 3QIWC 2A6DB 5FIEA 3GIVA 4YH6A 2ICWI 4HFUH 5FHAL 4P2OC 3WKMH 1EXUA 4FZ8H 4APQB 4DOHE 1QLRA 4HLZH 4WWID 5FXCH 3FOMB 3G5YA 4FQ1L 5CSZA 3QEQE 2PYEB 3KJ4B 4JQVA 2F15A 3KJ6H 4K3JL 4W6YB 1A6TB 3KR3L 2B1AL 4LK4A 1Z0NA 1A7NH 4G6MH 4WTWA 5T3XE 4HS8L 3MRIB 2BY0A 4F15C 4IOFD 2J5LC 4OZ4B 3MBEB 2IQAA 1FRGL 3BYYA 1U93A 2OR8A