3VYPA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase ldtmt2-n140 adduct with meropenem
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
268
structure length
268
Chain Sequence
b'LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
publication title Crystal structure of L,D-transpeptidase LdtMt2 in complex with meropenem reveals the mechanism of carbapenem against Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.3.2.12: Peptidyltransferase.
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3vypA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vypA01
4JMXA 2MTZA 4XVOA 5DZPA 5LBGA 5K69A 4QRAA 3U1PA 5E1IA 3VYPA 3TURA 4A1IA 4GSRA 4HUCA 4JMNA 4A52A 2HKLA 5D7HA 3VAEA 3VYOA 5E1GA 4QTFA 5DCCA 1ZATA 5LB1A 4GSQA 4Z7AA 1Y7MA 3ZG4A 3U1QA 5E51A 5DZJA 4QR7A 4A1JA 5DU7A 3ZGPA 4A1KA 3VYNA 4LZHA 3ZQDA 4K73A 5DUJA 3TX4A 4ZFQA 4GSUA 4LPQA 5DC2A 4QRBA 5E5LA 5DVPA 4HU2A
chains in the Genus database with same CATH superfamily
3S2AA 4BQ8A 1ACYH 3BQUC 3FO2A 1UD2A 2GJPA 4QXTB 4N8CL 3BO8B 3DMMA 4C47A 2KZBA 3ARZA 3KPNB 4M7ZC 2CR0A 3PP4H 4H26B 3INUH 1J5OL 3DVNB 5AG8A 1E4WH 3G6JE 1ASQA 1ZE3H 2EECA 3HI1B 3TL5A 4XC1L 1DQQB 4NOFA 4K7PX 5AZUA 4OIIH 4Y9BA 5IJBC 3VM5A 4FXKA 3D08A 3TJHD 1U3HD 3BP5A 1TJIL 2OCCB 4GI6A 2AXGB 1X5MA 3E6FB 3V4VH 4UNUA 3RIAK 4LCWB 5CWSB 2JLLA 1REIA 3T09A 4ABUA 3QNYA 1CL7H 4AENA 8CGTA 2YPLD 1HNYA 3MLZL 3QJFA 1MUJB 2OJ1A 3EYOA 3P2DA 4HZAA 4QRQB 4RFEA 3BVTA 4PJ8B 1QP1A 2EVGA 1KYUA 2ADJA 1FJ1A 5BV7C 2VLJD 1FCCA 2Y9RT 3MRJA 2C26A 3KL3A 3GYRA 3KCWA 4UM8A 4TV3A 3GBEA 1DFBH 4HIJB 4NC1C 1KFGA 4LPVA 3OJ2C 3T1WA 1B6UA 2FWUA 1QSEE 5ACLA 1FNGB 1OW0C 3C60A 3BCDA 5H94B 1U95A 3QQ4A 1BZDA 1TT6A 3MODH 4TUKH 4G83A 5FUCE 1JK9A 1ZVHA 5EPMB 1BA9A 5GGTL 4XMKH 3O3DA 4HKZA 3GZQA 4ZS6C 2QQNL 1D5MA 3ZL4L 4BA0A 3MV7B 1BPLB 3A0OA 4GKZA 1MCOL 4F20A 1IL1A 4PSPA 3VQLA 3R1GH 1OV8A 5IW6B 2FBOJ 4FTVE 5HYQB 3EJSA 4ONHA 4C56A 3SYQA 1C9SA 5C71A 5DI8B 5T5FL 5FGBA 1RUQL 3UGUA 1DP0A 2ZXQA 2IDQA 4HZLB 5DRNB 4OGAD 2AKRA 2YMXH 4HWBL 4O02A 4JM0A 3CFKA 3APMA 5KSBF 2NNAB 1I1CA 4LP5A 1J18A 3D0LA 3NDYE 1DJHA 1SJEB 4LB8A 2TSAA 3A6BH 3NIFE 4LSTL 4P3CL 3WEXA 4UOQA 4F8OA 3VWJD 4TNEA 2G75A 5HY9A 1KXHA 3GUTA 5I75C 1CDGA 1EXUB 4ELMF 1FL6A 2FB4L 5HI4D 4N9GB 3C5ZB 4M7KL 2Y3NA 1JZIA 3MXVL 4I9WE 1AO7D 2Q86B 3SY0B 3O41A 3QCTH 4FCHA 4DGWC 5MEQB 1K8DB 4OAWB 3TT3H 1EDHA 1T7VA 4W4NA 6FABL 1A9EB 4YDNA 4B96A 4IRJD 2LHAA 4XMXA 4CNIB 4GUCA 4ZUVA 4FQXA 1DQJA 4GBXC 5EV7A 3BN9D 1QO3A 3D06A 4DUVA 1JJUA 2Y5TA 3GSXB 3WHE0 2EADA 4XNAA 4BZ2H 1JPST 2IANE 4GAYB 4FCAA 1OF2A 4RGOH 2YO3A 5DEZA 3T2LA 4LHQB 2YD2A 4M6OH 4B9CA 3BSZH 4G8IA 1PJ9A 1QLRA 1TF4A 2H5UA 3AABA 3QPQC 4X98B 3IGAB 2Y6SC 4KJWC 3RX5A 1TEFA 4CDHA 1XGUB 3MTXA 1SQMA 3KPOA 2YEVB 2PYED 1IGCL 1EDYA 2ZD0A 4PLKD 3WNKA 4AMXA 3VCLA 2HJLA 2PXYC 2EYRB 1QOKA 1G7MA 2DOCA 2R0ZH 4JHBA 2MHAA 2Z93A 4P99A 3K72A 3QCVL 5F3HA 2X3AA 3IB4A 2H2PD 2J1WA 3LKOA 3D39D 3KW7A 1KGWA 4M8QB 1SXAA 3L5WA 4NZTL 4FG6C 3T0WA 1ZKAA 2IJ0C 2ARWA 2A9NH 4N8UA 4LAQL 4NI6A 1OB1B 4WFED 5GS0C 2OBGA 2J56A 3S3BB 2R2CA 4DO5A 2Z31D 4YQXL 4XMPH 4GYBA 4AX3A 1ZXQA 2H9GA 2VDOB 2E3VA 3MCKB 5FB8B 4H2AA 3SOBH 1X3DA 3PGFL 3IGKA 4HLZH 3E1ZA 4WQOA 5IMOA 3TCXA 5LGJA 3FCUB 4WNSA 3L3HA 3FKUS 3MLPA 1I7ZB 5C0CA 1Q94A 5AWNH 1I9EA 3EOTL 3CU7A 4PJBE 4A1RA 4UTAA 4NWUL 1XBRA 4ANXA 3NEXA 4KMLB 1WFTA 3MLTA 5DS1A 3O9WC 2MFNA 1OCWL 1A6WL 2D4DA 3WKNA 5DMJB 4JM2D 3NCWA 4F7TB 4Z7QF 1TYJA 4QOKD 3VYNA 4XPGL 4MDIB 2ZKYA 4UM9D 5D6DC 1XR9B 2GBAA 2PPDA 3V0JA 2VMDA 4AGOA 4NAJA 3NOIA 2AEQH 4OW6A 5MP6L 2ROXA 2CO3A 4RAHA 1QWNA 5K1VA 4ZOCA 1RK1A 3EADA 4ABWA 2WTRB 4PBXA 4J8QA 3RAJH 4DH2A 4TRPL 4WO4A 4YAQB 4NRYA 5E6YA 1T7YA 2FYYB 4X4ZA 3U30B 4YXKL 4XOEA 4JFDD 3ALWA 1PKQE 3IWUA 3V4PH 3ZZSA 4AMKL 1J8HB 2HG5A 1I82A 5LJYH 1GMEA 1JHLH 1YPZF 1D5ZB 2X9ZA 3GTVA 5IG7A 1BVOA 1XL4A 2NX5E 4J8RA 4LPTA 5FYKL 4KNSA 2EACA 2YUXA 4ELKB 5KVGH 1XFPA 3BWAA 5HYIA 4LFHD 3FTVA 1QUNB 1NGWA 3UJTH 4F8TA 5KYYA 3S88H 4HJGA 1V7MH 4X42A 4QYOA 1NQBA 3LN9A 3CLEL 5HGHA 3IJHB 2FNWA 3MUZ1 4IQHA 2YQ3A 4NHCH 1QSFA 3IXTA 4M6NH 4OZ4A 4F3FA 4XXDB 4EDWH 2CBMA 1E9QB 3ZDYB 4Z95H 1RJZA 4ZFGH 5JA8B 1KELH 1NBCA 2WAHA 4R7NA 3U0TA 3VSUA 2ZKHL 4Q6YA 2P43B 4XRCA 4OZGA 5FGRA 1U6AL 4G3YL 4Z7VB 5JPMC 4MA8H 2A9DA 5EF2A 1ZRUA 5IM7B 5HGBB 4GIAA 3IPEA 1MHPL 2F54A 1FZOB 4CC4C 3HMWH 1WEJH 5I1IH 3SY6A 1MHEB 1OQXA 4AV5A 3IJSB 5C0NC 1TZOA 4L4TD 4MAYC 4XNUL 4BV1A 2XFXB 2I24N 2V8MA 2Y24A 5ANHA 4X6BB 4YSCA 2GW5A 1SJVA 2IFFL 2VQTA 1NOAA 3N06B 5BMFL 3IAPA 1DCEA 2Q10A 1NGPH 3UZQB 3EGSA 3PWUB 4D8PA 2PWGA 3EYFB 4UAOB 3MRLA 3EH4B 1A1NB 1E4XI 4P23D 1JXKA 3GBML 2HH0H 1U8MB 3ZTDC 4YSSA 4J28A 4ZUTA 4K5OA 3FBKA 1EAQA 1DZBA 3BFOA 1Z9PA 1FG2A 4AZ8B 1OAUH 4YK4B 3ZU8A 7FABH 1SY6H 1WG3A 2W65B 2PR9A 4ONFH 4R9HA 1A5FL 2B77A 2G0LA 5DRZA 4EKJA 5L0QB 1GS8A 3NRFA 4F7CB 1EHNA 5DEGB 4DP2X 4NM4H 3HS8A 3GSNB 1K8IB 3VI4F 2ZSVB 1KXVA 1GMIA 2AV1A 3UZVA 4PJDA 3SDDD 1EAPB 1S5IH 3Q6GL 1EO8L 1OKEA 3FO9B 5CM1A 2DWTA 3UAFA 1P4LA 3B9KA 1RHHB 4Y2OA 2CH8A 1PZ2A 5KYXA 1F3DH 4HA1A 4K2UL 1DJXA 4CN4A 3ME0A 4JFQB 2QVKA 4OSUH 4DEWA 3ARSA 3DGDA 2VDOL 9PCYA 5ID0A 5HDBF 1CBVH 2PF6A 1I8IA 4JLRB 4XNQA 1IAIM 1T0NB 3T6VA 3EHBC 2UWEA 4CSZA 4DVBB 4OCWH 1FPTL 2VM9A 1CXFA 2RR3A 4HETA 5HHMD 1TNMA 2A74B 3HE6C 3NPZB 3OZKA 5DD0L 5DZLA 5DD5L 3LSOA 5D7KE 4PJ9D 5AYUH 4A68A 3TO4C 4L48A 2PTTA 2Z91B 3BSHA 3EH3B 3FQWA 3GSVB 4HG4K 3SJVD 1E8ZA 1IGYB 4PLJD 2EDLA 4IMKA 4WNJA 2PW1B 4X6FA 3FC8A 5DK2B 2GYSA 5I17B 1MW1A 1TJMA 1AGDA 4DGVH 3S36H 4PJGA 3VFUA 3VXSB 3TPUB 4PS3A 4YOKA 1AR1B 2VQ1B 2HX8A 2Y69B 4Z0BL 4AYMC 2ARJA 2EIDA 4LIQL 5KSUA 3MBEC 3ELAT 3JWDC 5B1CA 2IG2L 5HPOA 3IWVA 2F54E 1S9XA 2JJVA 3BZEB 2IWKA 1N6UA 1RUPL 1EEYA 2DTMH 2G0KA 2DI8A 4GSXA 5BUAA 2C4FT 5D7EA 1RIVH 4XNZC 1KPRB 5JOFB 1M4KA 5DJ2A 3AS1A 3EDJA 2AQ3A 3K2KA 4WENB 4AYFB 4EI0A 1AGFB 3BPOB 4NQDB 1DBMH 5ICZB 3D2UA 1FZKB 3QUKB 4Y5VB 3RWEA 1DLFH 4TM9A 3BDXA 1T0MB 3BT2H 4YWGH 4XT1C 4QHLB 3FFDA 1P1ZB 4JPSA 2E6JA 1QW9A 4G6MH 1DVUA 3ATEA 1K4CB 1DJIA 4LARH 1VFBB 5T1KD 2XZQH 1ZE3C 5I1KL 5E2JA 2PP9A 3CQFA 1LEIB 4QPEA 2MJWA 1CICD 4KQ4H 2OL3B 4TLTA 2EDOA 3PWVA 1BLIA 1EJFA 1QG3A 2BMKA 2R1YB 3V6ZB 5FOJA 5TQ2L 1WFMA 1E30A 3IDXL 1FZJA 3RJQB 2YGPA 5EOCH 2ADGB 3HN8A 5J1AB 1HI6B 5JO5B 5CINL 4WK2B 1JXJA 3PU7A 4ZFQA 3KPRD 1LQSR 5JHDE 1C1EL 1MY5A 1FZMB 5GPRA 4RZCB 3QDJE 1OAYH 3FSVA 4MMXA 2J88H 1BPVA 3RTQA 3K4ZA 1XF4B 3N1PC 1AOZA 4RZKA 4U6XA 4KZCA 2OFQA 3N1FC 1F4AA 2WBXA 5CHNB 1JV5A 4OFPA 5KVGE 1H6TA 3ARUA 2IAMA 5TE7L 3Q8CA 2AJZA 2OSYA 1NUFA 5DQJB 3JUZA 4PJFA 4YHOL 2VOTA 2XN9A 2OAAA 3ZE0E 1KIUB 5KSVB 4MJID 1JSYA 1NCBL 4Q0XL 5GXBB 4ZTEA 5E8PB 3HAEA 1VEOA 2WKOF 2HJKA 2IBBA 4NO5A 4XP1H 4UILL 2F58L 3NGBC 5DS8B 2IV8A 2YD9A 3RNKA 4YIQA 2KUTA 3CE1A 2HFGH 4R2GB 2PCPB 1X5FA 4HOWA 3H8NA 5MENA 1TYEB 4JFEE 5EU7C 5KEZA 3X1BA 1ND0A 2YQ2A 1NCUA 4CVZA 4YHPA 1J0HA 3CFDA 4PJGE 4XP4H 4HXBH 5L7XH 1YMME 3BHBB 2BWQA 3GSNL 3DPDA 3VW3H 3QFJA 1YY8B 3ECBA 4UNTA 3SKNA 2Q8AL 4DEPC 4RGNC 1MH5A 4RSYA 4W1TA 5HI3D 3SQRA 4BXVA 1P1VA 2X1PA 1FSKB 1BMWA 2O5XL 3OX8A 3D6GA 3THML 1MCLA 1X4XA 2G5BB 4OZFA 1KZQA 3HC0B 3L95A 3RI5K 1MJ7H 4JRXD 4WWKC 3UFIA 2K8MA 3I6KB 1NCJA 4LRIC 4XP6H 1P4UA 4YH6A 3BKML 1JRHI 3E3QE 5HVGB 5TE6L 2CKNA 4X8XA 3T8XB 3WUWB 4R8WH 5IMLB 1N7MH 4UQ2B 3UJJL 4Z5RA 1KIRB 2GK2A 1BEXA 4HAGA 3PHOB 5GHWH 4BYHA 5K69A 5TQ0H 3BH9A 5IFJB 3BKCH 4F37F 6PCYA 5L6YL 5FYLD 2NY0B 1XTLA 1CLZL 2YBGA 4WWOA 3PGCA 5IHUL 4TUOB 2NTFA 1IFGA 4Q8BA 3NIDB 1SHWA 4NQCD 1HWWA 4L3EE 2B0SH 5IQMA 1SXZA 5I2IA 3EXJA 4U6TA 1KPVA 1WAAA 2IOIA 3LRSA 4Y4KB 3RHWK 4AQAA 2YAPA 1RAMA 1FVCB 2DEXX 3GSWA 3QHFH 4WUUA 1V3LA 2OSWA 3T4YA 4JFFB 4GQ9H 1B2YA 4U2ZA 2K0RA 2VDKL 1R3HA 1GR7A 3TV3H 1LWRA 4MNQE 1O7DE 4X6DA 4WFFE 4Y5YA 1X44A 1SYSA 2XN9E 4HS3A 4P2RA 1H5BB 1HEZA 5H35A 1T0PB 1UJ3C 4LVHB 1HC1A 2O6CA 3KGUA 3MLXL 4X9YA 4E9XA 1PFOA 2HMID 1RK0A 1VZHA 3AS2A 5CP7A 1H0DB 4OGZA 1RZQA 1TIUA 1Y6KR 4JJ5A 4KMTL 4R90L 5E8OA 3MACL 5KSAD 1CDHA 5I16A 5JHLL 2OMUB 4JO4H 3E7JA 2X53A 3KYKL 5IVXB 2A9AA 4RX4A 4F1SA 4EUPH 2X05A 5AZEL 4X7EC 4ODVL 1U33A 2R8SL 2BS9A 3L5XH 3QA3B 5C0RL 3EJUA 2FR4A 4NQSB 5CLWA 3WIIL 4KNUA 1ADQH 3UG4A 5GGSY 2D0FA 4CRPA 1CBJA 5AUMB 3V5HA 4WW2B 2BXZA 4PV1C 4NHUA 3V5DA 2XETA 1EERB 3FTGB 4RDQG 2IF7A 4JKPL 4ZPVA 2E9IA 2E86A 5SWZD 4Z7UA 2H8PA 3IDIB 1XSKA 2FWOB 3MLRH 2BSTB 2CLRA 3K80A 3MDJA 1WTGT 5F3BA 2DW5A 4OZIB 1KTLB 5GGRB 4R7DA 3ABKB 3P54A 4OZHF 4JM2C 1RPQA 3ORJA 1TQCC 2HFFA 3KHOA 4GP8B 3TA4D 1NCHA 2G60H 5I6XB 2RB8A 4BZ1H 5GS1A 4DFIA 2XZAH 5KTEL 2CGRL 4M62L 3IAQA 2ITDB 2BCKB 2ZX5A 4PGBA 1QRNA 4MBOA 1EMTL 1XGYH 4JM4L 3N6YA 4JVUA 4YVNA 4NJAH 1Z5YD 3ZE2B 2AJVH 3HB3B 3GMMA 2Q87A 2BLFA 3TU6A 1S4IA 1E4KA 2JELH 5HJDA 2YD0A 4NERA 4LLDA 1MAJA 1UOVA 1S9VA 1OANA 5F9WC 4O51A 4Z77A 1F90L 1Z7JA 3BP5B 5T1DL 3GMOA 2YSSA 3VNZA 4DWHA 1Y6NR 2QADB 3MC0A 1OAKH 4IM8A 5FA3A 4P46A 5A1AA 1DBBH 1VPOL 1YSOA 5ISZA 4OKVA 3KLAB 4YFLF 2BVQB 4LSPL 4RESB 3QNYB 4AENB 4PN6A 4C4KT 4QRSA 2YEZA 4YPGB 4N2CA 1HHHB 1CLCA 3L8QA 3LEVH 1DVQA 4JDTH 3QJFB 4U1JA 4APQD 1BF5A 3UDWA 4LLVA 2FQFA 2VLKA 2O5ZH 4N2NA 4RFEB 3LMJL 3U82B 5IBTL 5A3IC 4WFGE 5I0YA 1FJ1B 1O6SA 2KC0A 4X6DE 3O8XC 1P9MA 1QX1A 4HUKB 2Y2YA 3W56A 2GCYB 1HAWA 3B7TA 1SBSL 3Q2VA 1X7TA 2GIXA 3SEPA 5EBWA 5ADPH 1BLNA 2CDFA 1E5AA 3GHPA 3QG6A 4N0YL 4PW3A 4OCNC 4ZFOB 2BSCA 4AITA 3DYMA 4UIKL 4NAMA 1DLHA 4Z7NF 3SDXE 5ITBH 2JTDA 2ORBH 1RZ8A 3C60B 1B2WH 4LLYA 5DK0A 4JPQA 4B9PA 5KS9B 2B9BA 3NJKA 4I2XA 5I74C 1JK9B 4BFKA 4DN4L 3UJIL 3EGDA 4JQIL 3SKUD 2DM7A 1CPUA 3L54A 1D5MB 5KWYC 2WXQA 3CWGA 1UURA 5DR5L 2H4EA 1W6LA 1JGLL 2VDNB 3K2UH 3D52A 2ESVA 4J5VA 1HCVA 4FZ8H 1ZV2A 4W70A 5KAQG 4MDJA 4ONHB 4C56B 3WFBH 4FI7A 4BCXA 5T3XH 5L8JB 2MCAA 4FXGA 4GT7A 4ZNEA 2ADIB 3PNRB 5J4MA 1X5HA 4O02B 3VX1A 3M8OH 4EI5A 5C0JB 4ZS7L 1X9RA 4HUWA 5F0LB 4WW2F 3CFKB 3IFNL 3M6DA 5HHOB 2Y36L 5B1KA 3PRZA 4MXVE 3D0LB 5DA0B 4WGVB 5BCAA 5BS0A 4KTYA 3ARDA 3GM0A 4DPRA 5I8CA 1ZT7A 3KLHD 4ZG1A 5HY9B 4DKEL 4P4KA 5DT1L 1ITCA 2DQJL 3VXPA 3RPIA 1CLOL 1GS6X 1CFMA 3TPKA 4GRWH 5F1NA 3SKOA 3HRZC 3VH8A 8FABA 2QR0A 3O41B 3R4DA 1BXUA 3C9NA 2HT4D 1XIWC 2C7UA 4TSCH 4WF7A 2DWEA 5EUOE 2A9ML 4HBCH 1OGAD 4DTGH 2P24A 2FX9H 3LIZH 2AXJA 5DRXA 3WJJA 3KW8A 5ISZE 4ZUVB 3QH3A 1DQJB 4FQXB 3T77A 3VWKD 1O7DC 3SODB 3D34A 3KPQA 2J8HA 1G7QB 1QO3B 1QNZL 3B4NA 2Y5TB 3C75A 1U8NA 2B3RA 2IFGA 1KBGH 3GXDA 1KEGL 3GBLA 4U1HA 5J5EA 1BZQK 3VFGL 4PYGA 1DVFC 3OD3A 1JGVH 3ARBA 4G8IB 4M4PA 2W81C 4PLJC 4QXUH 3SCMD 3VXUB 4Z1PA 4PWKA 1GY2A 4QY8B 5AOZA 2CM5A 3ULVE 3EOYG 2HLAA 1R3IL 4NUGH 1LK2A 2NNRA 1OE2A 2UZYA 3KPOB 4PR5A 3AREA 3K8KA 3VCLB 2HJLB 2WAQA 3UX9B 3O0LA 4Y2DD 1NC4D 1NINA 3WTUA 2YPVH 3M88A 2MHAB 2V9QA 2Z93B 3GXPA 3K72B 3MRRB 3O4LE 2WBWB 5F3HB 2IPKB 2HRLA 5F7WC 4DVRL 3BDYL 5EWIL 5HHXH 5I19H 3F7QA 4EVNA 1UM5L 2GY5A 2E6PA 1BX2A 3L5WB 3W11C 2HG0A 5IWLC 1EGJH 1FFNB 1KYOK 3E8UL 4TLUA 4WCYH 5FM5O 1F4XH 2A2QT 3MNVA 1ZDQA 4I2XE 4NZUL 4QLRA 1EZVX 2K78A 1QFWM 4GJTB 4HJ0D 2O5NA 3FSZA 5HDWA 3BUIA 3QUYD 2Y2WA 4HYTB 1KIPA 4BGDA 3BLKA 4PJ5D 3F5WA 4X5XB 4J27A 1TCRB 1F41A 5IEHA 3HE7D 4RLDA 4L9LC 3QCUH 4UMGA 3L3HB 3IFLL 2JH2A 3QUZC 5FM4A 1Q94B 5C0CB 4ZODA 1ECYA 4I3SL 1ET5A 1HQ4A 3LPWA 2A1WL 4XVSH 3E2HC 2YUZA 3DX6A 2WXRA 1BIIA 5JORA 2PLTA 4V11A 2UX7A 4AIZA 4ENZA 4OM0L 4MA1C 1L7IL 2QQLH 4FL4C 3DIFB 3T2NL 3P77B 5BXFA 3BH4A 1U8IA 5BS0E 2J57A 2ROYA 5ERWA 1BJ1J 4JPIA 4LQFH 1X9LA 1T2QL 1B0IA 3A67L 4GP5B 1EH9A 3GMQA 4KXZI 1MN4A 1Z0MA 1OK8A 5D7JD 5FYKU 3VGAC 1D5IL 5LDSA 4BEIA 2QLVB 2WXKA 3LKNA 1J5CA 3TA3B 3L9RA 1HX0A 3BWUF 3CK0H 1QRKA 4JG1H 1MWAH 1NLBL 3GT6A 3NCBB 1BQHA 3FB6B 4MX7B 1OB0A 3RWFA 3BQUA 3QQDB 4NRYB 3ML9A 1AGEA 2Z8SA 4YHLL 3SDCC 1AMYA 5IT2L 4UQAA 2I07B 2VO5A 3EFFA 3K7UA 2HG5B 3JV0A 3X1FA 5IG7B 1PX4A 4ACTA 3GXUB 4J8RB 3RG1C 2VDNL 3E8VA 2P8MA 3TBTA 4BUGA 4JANB 3QNXB 5IQ9A 4BFBD 1DJZA 1JNNH 1RURL 4HOMA 4B3VA 4HJGB 1CGSH 4PJHE 1MJ8L 1ORQA 4GAFB 1EJOL 2CPCA 4RMRA 4HALA 4O02L 5HGHB 1NBYA 1DVYA 3TT1L 3EYVB 5KBDA 2CLVA 2VLRB 1PF3A 1QSFB 1W72H 2VMFA 1K3IA 2EXTA 2E8ZA 1EZLA 3OL2A 4N2DA 5F7KC 3ZKSD 1HE8A 2WCGA 3MAWA 4A2FA 1P5VB 1RJZB 4TS6A 1OE3A 2RAMA 1N3NA 4R7NB 3U0TB 4LXFA 4MQSB 3CU1A 1GHFH 4OZGB 4XRCB 1BM3H 4XNMA 3LHPL 1FP5A 4JGNA 3SO5A 3S5ZA 1FL3A 2UY7A 3MJ8A 4APXA 3KJ4C 1OM3L 5FYJH 1RZKH 4AC4A 1Q0EA 4A6YB 3LNHA 4V1DB 5J3HC 2ZWSA 4P3WA 4CSSA 2WXIA 2AEWA 1IKFL 1BQUA 1L3NA 3EFDL 5AB2A 1ZSDA 2VJXA 3QEQA 1D2OA 2J6EA 5T3XE 1C5BH 2P5EA 4OD2A 2A99A 3AC0A 3ULUF 5CMAA 3CMOL 4NSKB 5HVWA 4Z7WF 2HYMA 4UDTA 3MRLB 2JB5H 5HSFA 2YIHA 1U93A 2D3NA 2F5BH 5A2IH 2V5SA 2DICA 4B9ZA 2V33A 1M71B 1CYXA 1HNGA 3C6LD 1IIKA 3MJGX 5E1IA 3UTZB 1MCFA 5DRZB 2DN7A 3EO9H 3QJHB 4G8GA 1KT2A 4ZAKA 5A6LA 2BSED 3QXUA 2C5DC 3KH4A 3D0AA 4A04A 4GXFA 1OY3B 4M43L 3PP3H 1QA9B 4C55A 3K6DA 3TYGH 4PJDB 25C8L 3UZVB 1SHXA 2E59A 4H44C 2LU5A 1JZ3A 1Z5LB 4LSUH 2NNFA 1XZWA 1GH7A 5GRJL 5FDWA 4YDKH 3OGCA 1FA4A 1YN7B 5KUMA 5D7LA 4KTDL 1T2JA 3QZBA 1FC2D 1CDYA 2NY4D 5KYXB 4EBQH 1DVTA 2VDPB 2WMPA 3UZEC 4HS6B 5EOQL 2X1XR 2ZXBA 3KYNB 3ME0B 4ANUA 2OXGB 4Y4HB 5ID0B 1Q8MA 1I8IB 4XNQB 4TTGA 5JLZA 5IJVA 3MPCA 2UWEB 1OCOB 3D18A 5JQ6L 1BVKB 3A23A 3T6ZA 2I60H 4HEME 1ZLDA 4EOWL 2JKNA 4AYBA 3LSOB 4AMWA 3US9A 1PGRB 1UYWL 1HL9A 2HP4A 3O3UN 3UIYA 1W16A 1N70A 4HISA 1F45A 2R0KL 3FO1A 1AACA 4B5ZA 4UTAL 4R3SB 5FC9A 4DZ8A 3MYJB 3TH2T 3FQWB 4GBXA 1YYLL 5T8IA 2RTTA 1OPOA 1X7QA 3ARQA 5LBGA 4X6FB 1T21B 5JMRA 2EXSA 5GRZA 1BZOA 2DQCH 1KC5L 5D1QA 4UTBH 1QI4A 1AGDB 3P9LA 3FT0A 1KG0B 1WZ1L 2CE6A 2DEWX 3F2LA 2CMRH 5D2LF 4Z3IA 1EHLL 3MZTA 4FQPA 3JBG7 4OI9A 3D85A 3PQYE 5KSUB 1CZ8L 1LNUA 1CU4H 1V7NH 3C8HA 4J3TA 2VE6B 2VL5B 3ARFC 3NJMA 2F5AL 2UXFA 2QQKL 3QGVA 1G7HB 4G9FA 4MB1A 4WU5A 4FEMA 1S9XB 1DANU 4NO0D 5IOKA 4PWGA 2CIIB 1VKXA 3ZXAC 3L4TA 3ELQA 2ADFH 2WWOA 3QWQB 2X4UA 3QEQE 2APWA 3QI9C 2TRYA 1BZ9A 1JDAA 2L04A 5C07E 5L88H 2JI1A 4JRYE 3DV4A 1T83A 3CSPA 3U48A 4E41B 3TBSA 4NP4L 2NSXA 3W0WB 4PJXA 3FAXA 2C9AA 2PPFA 2B4CH 3NFSH 5CCGE 4QRRA 3FSWA 1JVOA 1YYMH 2RMNA 4KGJA 2AV7A 3IDUA 3S36X 2YD7A 3EJTA 1CFSA 1WCBA 2B1AL 3OJMB 4L1SA 4FQLH 1CFVH 4XO5A 4R0LB 5GJSL 1MPAL 1WHOA 1JYWA 1CGXA 2EJ1A 4KK8D 4N2BA 3PWVB 4A2MA 2DQHH 2KI6A 5F7LB 2ZCZA 3H7BA 4IRSD 1FZJB 5DZAA 5AAMC 1KB5A 1E6OH 4TNWF 4H1LB 3UAJA 2KLTA 1D6EA 4P2OD 3VXOA 1KXQA 3N0PB 1T6VN 1HZKA 1U8JA 3ALXA 2LAGB 4L18A 3DBXA 4KJPD 4I4WA 3R7QA 3ULSA 3BCFA 1I1AD 2HLFC 1NANI 1RULL 2OR8A 3FQYA 4KRLB 4MMXB 5I66A 2C9QA 1HKFA 1TZGH 3JUYA 4G59C 1YQVL 4KXCA 5E6UB 1WHPA 1JV5B 2FX8L 2XKSA 1MCHA 2BVEA 2K7PA 4ETQA 2IAMB 3BXNA 1E8XA 5D7SH 5AYQA 3MLVH 3AM8A 5LAXA 4PJFB 1J1OL 1RFDH 4LCWD 3UBFA 5FO8A 4F8QA 4Z23A 4P07A 4AL8H 1A3RH 1O9VA 2HJKB 3K5SA 3OB0H 2UZIH 4PRHA 1I1YA 2GSMB 4CL7A 4GMTH 3SGJC 4FQQB 2OZNA 1BG1A 1FNFA 4PJ8D 2J7LA 1ERNA 5TFSH 4BHUA 3AJ7A 5D8JH 1ZLUH 4PB9L 3NABL 1JVKA 5D1QE 5KN5A 2BIOA 5ADOL 1XSIA 3BC9A 3QAQA 4NNPH 5FYJE 2ZICA 3CFDB 5ALCL 1XCWA 4F1ZA 3CSYA 4BJLA 4PIRF 3QFJB 3WKML 1IQWL 1GPOL 1KOAA 1VCBC 3ECBB 4M9PA 2P7TA 3SKNB 3WKYA 4P5MB 2QGDA 2NYZA 7TAAA 1MH5B 5I5RA 3EAKA 5ABDE 2Q7AA 4YPJA 1K6QH 1P84K 1UT2A 2HVKB 5CJXC 4ES8A 3D12B 1IEHA 3OX8B 3L3JA 2VQUA 4X7CC 4HS8H 1I7TA 5HYJB 4OZFB 3LXCA 2VDRH 3DPBA 2VDPL 1AP2A 3U83A 1J11A 4TQ8A 4ODUA 5IHZA 4X5WA 3RTLA 3T3MB 3V6FA 4CC4A 3IE9A 1NFAA 4GI9A 2BS71 2I5YH 4K3DL 3QJZA 5E2TH 1LDPL 2B5IC 5HDOA 5C86A 3V95A 5AKSA 3P3RA 3FT2A 1FLRH 1Q9KA 4BFIA 4QRRE 1TZAA 5JUEH 1ZHBB 1ZGLM 5AFAA 4L1TA 4Q4EA 3BLPX 3SPGA 1B9ZA 3CGTA 1PIFA 2NXZC 4L1HA 4E2OA 5KBNC 3BH9B 1NWPA 1PDKA 4TNVF 5DGRA 2AW2A 1CIUA 1F4WL 3ECQA 3I75B 3PGCB 4YHYB 2J1ZA 1AHWA 2NTFB 4G8FA 4LL9A 2NR6D 1NGXA 4OLVL 1NFDA 1K9TA 4CUCA 3O6KH 4K9JA 3V6OE 4GOSA 4HAKA 2PO6A 2J1KA 3IJEA 4K5NA 2JKXA 3OWEA 4U6YA 2DQTL 5KUKA 1DQMH 5AVZB 1KPVB 3LRSB 4LASH 2QSTA 4HJEA 1IC4H 1PLBA 3SO3B 3ROOA 3C5ZD 4M5TA 2XWBA 4PGCA 2W0PA 2A6DA 4QUOA 3T4YB 1UB6B 3UPRB 3IMVA 1TFHA 4JHVA 4LPQA 1AKJA 5B3JE 3RDJA 1J86A 1R3HB 3WGUB 1AIZA 2VC2H 4D9LH 5AL0A 3QB7C 5ESQA 3Q5YA 2IDSA 4M6AA 4U1GC 5JMOC 4A1IA 3QXWA 4Y5YB 2WWMC 5J6HA 1YHPA 1EFXB 1U92B 4P2RB 1HEZB 3KXFA 3LVTA 3OAZH 5H35B 3U4EA 1V10A 2BSDA 2BM3A 4ZX5A 1KXTB 2Y4SA 4HGKC 1ZS8B 1A9BA 4O2EA 5DJCB 4QR7A 4NWTH 4Q2ZB 4U6HA 5E7BA 3PWPD 5CP7B 5CLYA 5F1IB 1PVHA 3TH3T 3RZCD 1QKZL 4JQVC 2BDNH 4MBRA 3BRGC 2X0VA 3MOBH 1HE7A 2Q20A 1Q0XL 2AEPH 3HNVH 3RWCB 2FR4B 4LMQE 1KTKE 4UT6H 4Z76A 4EXPX 3FQTB 5CBAB 1MRCL 3V5HB 5EF1A 3V5DB 1TLKA 3FF7A 2DLHA 4XH2A 1ZAGA 3L3DA 3MUY1 5TF0A 2ZWYA 3HUJE 2KT6A 2ZCKL 4Z7UB 2H8PB 2A6IA 1H15B 4FC3E 4PD4J 3O2DL 3ZKXC 3ESMA 5F3BB 2ADYA 5E08L 3MBEA 5C3TA 3B2UC 2BNQA 4HIEA 2DBLL 3IXAA 3WY1A 1QUPA 4HIIA 4LCIL 4DQOL 3PJSA 3MOAH 4FS0A 3GLDA 2KPWA 1B0GB 3K8LA 5F7DA 3U0PB 1D9KD 4AYSA 2V17L 4KJQD 3OKLA 1KULA 3NJHA 2YR3A 1FH5L 1DTUA 4U05A 4AVHA 1I85C 4DOHB 4FQIH 2R9HC 1NMBH 1BFOB 3PREA 4YSTA 1MCQA 1AD9A 1MVYA 1QRNB 2ZUQB 3QRFM 3CLFH 4IBZA 3ZMNA 1MREL 3V9EA 3AQDA 3QJXA 2WYZA 3Q9QA 2RCSL 1JMZA 3PYCA 1JTTA 4YUEH 2A77L 4PREA 5J7CC 5J11C 2CDGB 1GCFA 4XAKD 4O51B 4Z77B 4BWWA 4FQ2L 2YSSB 4JMNA 2PR4H 3GWJA 1LVEA 3GS7A 5FA3B 4P46B 4ZOBA 1UZ8A 5DTFA 5FHAL 3CCHB 3DVFA 2WWKO 1U3HA 1LP9A 2CKBB 3E6HA 3PXHA 4IOSD 3WD5L 2ZPKL 2W91A 3OG6B 4U1JB 4TVPD 4LLVB 5D1XD 2ICEB 3W9EB 3K0YA 1S7UA 1CMOA 2JKIS 1O6SB 2YPLA 2RHEA 4KKCD 1OP5K 4FLSA 4Y9EA 1I1FA 1WBXA 2VJ0A 4DK6A 2B7DT 1NCTA 4BCYA 2Z35A 3KXFE 1I9JH 3KLSA 4NCC1 4U1LA 1MCNA 1BLNB 2CDFB 4KHXH 5C6TH 2VLJA 3CHRA 3QG6B 5TTRA 1JNHA 1H8SA 1W8EA 1Y1DA 1INEH 3JTSA 2B9AA 5AALA 1RZKC 5EEUA 2AK4E 1MRFH 3ZDXB 2W80C 5BW7A 2EO9A 1FBIL 5FUOH 4XNXL 3F6JA 3AG2B 4LNRA 3ZKNC 1L0QA 1OAXH 3CN4A 4F8PA 5FW6A 1N6QL 4HJJL 4JPVL 3AW5A 1EPFA 3KPLA 4JQXA 1BECA 1JZJA 1M2VA 2H3NA 2NYKA 5C0BD 1HAUA 3S6CA 4ZTPH 2NY3B 3SIKA 2ENPA 5E4EC 4XPFH 3S4SB 3FU9A 1GOFA 3CDZA 4K94H 4S1RL 5FDYA 3WJLC 5BVJA 2ESVB 5G5DB 4HUVA 2CHXA 5EBMB 2GIMA 3CIAA 1A6UH 4MDJB 3RYMA 1TCMA 4GINA 2IH1A 3BUYA 2DWSA 4FXGB 4G7VL 1NEZA 1NCDL 4FKEA 4TNFA 4EI5B 5KYWA 4HUWB 5IVZA 5FS5A 3HVNA 5DDHB 2YJQA 4PJEA 4Z78B 3RILA 2WVVB 3LZLA 5EZLB 3ARDB 3BI9X 1JP5A 5I8CB 1C12A 4DK5A 2XKUA 5D5MA 1FNHA 3IJ7A 1DBAL 4UNVA 3NJIA 5CGMA 2W9LA 1BD2D 3V6OC 5T33L 1I7UB 4OLYH 3VJ6A 3VWJA 1UB5A 1JGUL 2NRDA 5F1NB 4LOUC 4OJCA 3SKOB 3AG3B 3VH8B 5F6IB 1B90A 8FABB 2QR0B 3VI3E 3QXDA 1KPUA 3S5LA 3AADB 1FNSL 1BG9A 2C7UB 1BXVA 3DV6B 5CU9A 2DWEB 5F9OH 1AO7A 4XMUA 4GS7B 5TDPB 5DRXB 3SE9L 2VN5A 2Z92A 4I3RL 4N8VA 3T77B 4ZNCD 2DAVA 4M7LL 1LP9E 3OR6A 1BEYL 1R24B 4L1BA 3AXHA 3KPQB 5FFLA 2BP5M 2AZAA 4KKAD 1U8NB 4IRJA 4OV5A 2WQSA 3NBNA 2E9WA 2VERN 3D25B 4U1HB 4R26H 3PF2A 4UT9H 3VFVA 3GIVB 1KYDA 3ARBB 4TULL 3H4FA 1P5UA 4HFWA 3DUSA 5EZIH 3KWUA 3NPSB 3BSZA 2AABL 4MMZC 2HLAB 5AOLA 1LK2B 1QZNA 2VM3A 1RVFL 1JWSA 4PR5B 3QO0A 3RIAF 2PWDA 1RU9H 1C08A 4LL1A 4PTUA 1CIDA 4IHBA 1FE8H 1A14H 5FCSH 3RWIA 2K4AA 2PYEA 4WDIA 1SYVB 5JW3L 2XWJA 1FGNH 3JZ7A 1UJ3A 1CLYH 5FOBB 3Q01A 2JNZA 1HQRA 4Q14A 5EBGA 4UWQB 3IFOB 1F3RB 2OA9A 5HDRA 1ZANH 3WLBB 1J0YA 3CIQA 3EJCA 1TKWA 5IHHA 5LNGA 1CYGA 3KR3H 2XTJB 3HNTH 3ZE1F 5B1JC 1KIPB 3VXSD 5MEPB 3EFOA 4L4VB 4XVUD 3F5WB 3B2VL 3IM1A 2B4CC 3C09C 3D0VA 2CDEA 2Z31A 2XRAL 1C16A 1PZCA 2BOBB 3IN2A 1GOGA 2H1XA 4ZUSB 1ZATA 2AITA 3S97C 1YAZA 1SXSA 4XO4A 1N5YL 3EJRA 1KEML 5IVNA 1SEQH 3HZVB 1H3XA 1T5XA 1BP3B 4XCCH 4QRUB 1BIIB 4A2DA 2PKDA 5JORB 1SNRA 3V79C 4LSQL 4OH2A 1QFPA 4KRPB 2J44A 3X14A 1PS3A 3GTNA 4PJ7A 1MDAA 4KRNA 3MRGB 4TTDD 1U8IB 2F19H 3ZUNC 4JPIB 4NQDD 4XPBL 4TSBL 3N85L 3HEIB 1N64H 3GMQB 4P2OC 3SKJL 1PYWB 1UA3A 3QR2A 4JM2A 2P1YA 4QOKA 2XG5A 4HHWA 1OTUC 3L9RB 4CAGA 1I3VA 3GMPA 3NFPA 2X12A 1I1AC 1N0LB 2MSPA 4UM9A 5CZKA 5IMKA 4CMMA 1UGNA 4GSDL 3EO1A 3HZ3A 3H9YA 4G72B 5SX5H 3BQUB 3RU8H 2J72A 3RWFB 3L1FA 2ZUUA 4ACPA 4BFJA 4IIZA 4XE5B 2X4TB 1MZYA 2XY1A 5GZNC 4M7ZB 1AO7E 4M00A 4MSWA 3UH8A 2R2EA 3QDME 4H2CA 5CLTA 4N2LA 5IESH 4JFDA 4UINH 1A1OA 3SDYL 3VGGA 4JN1H 5CP3H 3U1SH 5AVUB 3NMEA 3RZWA 2IQ9L 1ZMYA 2PPCA 2D7MA 2ZUXA 1FLTX 3VD5A 3KPPA 4IJ3B 5L4JA 5E2VH 3EUUA 5FFGA 3TZVD 3N40F 3RWHA 3CC1A 2F74B 2QKIA 5HHVH 1I8LA 1ORQB 3HZYB 1J1XL 4B5EA 4YSUA 1E4XH 1I8UA 3TCTA 4ZMQA 1G7LA 3IDNA 2I25N 1E2VA 3QWOA 1UUSA 2CLVB 1S46A 2AJUH 3GXIA 4N1HB 1U8LA 3OKOA 3CDGA 4FNSA 4JHZA 1JXGA 3C87A 4G8EA 1N3NB 2NQ3A 3ILQC 5BV7B 1NC2B 1TVHB 3S35L 2IPUK 1R0AH 4MWFA 4XNMB 5ENWA 2Q6WA 2NY6C 3LZRA 4YDIL 3VDAA 2UY7B 4XX1E 2YAFA 2UVFA 4GO6B 3IMUA 5DMGD 1F00I 2G2NA 3KD4A 1DJWA 1BBDH 1Y7VA 2EUZA 3D39E 4MJ6A 1VGEH 1N6VA 2GEEA 4YHMH 2E6QA 1MCWM 3VDCA 1P7QD 5JIHA 1JYVA 1P6AB 1ZSDB 4HUXB 5B4MC 3FW6A 2O4EA 5KBMA 2P5EB 4OD2B 4D3CL 5CMAB 1RIHH 4L4TA 1OP4A 1DVZA 1X5JA 2P52A 1CFBA 1XZ0A 1Z9SB 2OMVB 4UDTB 4ZD3L 3HHSA 5TGBA 3TONA 2X40A 1H3GA 1E4HA 3NDZE 3T1FA 2EO1A 4OLEA 4GKLA 1NIFA 1QBML 5AVRB 2KYIA 4OBSA 4PY7A 3RA7H 4GRLC 4HMEA 2CJSA 4MMYA 2ISDA 4HOZA 4NKQB 1NGYA 1JNLL 1NCGA 4P23A 2W9EL 4X6CF 5AW3B 5TJWK 1QI3A 4G8GB 2NR6C 1U8QA 3OV6A 2R69H 1S7TA 1BHGA 3SE3A 4DCQA 3PAZA 3PP3K 2NT0A 4N86A 4GXVL 4FQ1H 2EZ0D 4XWGL 3S0PA 4Q7DA 1RSFA 4LP4A 3WS6C 4G82A 1XGPB 3ILPA 3RL1A 3WE1A 1EBAA 1NIBA 2WYIA 2FEDC 4IGBD 4XBEL 1JL8A 4RCAA 2L7EA 4FRWA 3SDDA 4Q6KA 1RSYA 3OGCB 3SPVA 4H8WL 4HPYL 5EF0A 4OCYL 5C7XL 2NY0D 2ZKMX 5D7LB 4J23A 2NSQA 3T8MA 5I75B 1EUUA 5DLLA 2KPNA 2WMPB 3RL2A 4GQZA 3FSOA 5I15L 1GVIA 2MQCA 3UGEA 2BVUA 5JLZB 3DROB 3HRZA 4JRFA 4UYQA 2C9PA 4UANA 2I9LA 3IKCA 1CFTA 3B3IA 3KPSD 1HJBC 2F53B 3LYRA 5CIPB 2LTQC 4QTFA 1NDGB 5ICUA 4JFFD 4HF5L 3FO1B 3IPBA 4KITB 4DZ8B 1MQ8A 3RZCC 4GBXB 1Z9OA 4PJ9A 4AEEA 5FM5M 4Q9QH 3WFDL 5JR1L 5B1BB 2VR8A 1MEXL 1X7QB 1GYAA 1EJ6A 2R56L 3MJ9A 1VHPA 2F1BA 3U9PH 1C5CL 4JFZL 2WBJC 5C92A 3C5JA 5T1MB 5CEZL 1YMHA 3SJVA 3P9LB 1U3JA 3FMGL 3QWRD 2APTA 3L6FA 4ORZC 3D85B 2DDQH 1HCYA 3O6ML 3E1F1 3N43B 1DUZB 3VG9C 4PTTA 4R96B 2FBRA 1IEBA 4G9FB 3CDCA 4TSAH 3AACA 3IJ8A 5DEJA 1LM8V 5C08E 2F6AA 3QUMH 1IC1A 4ENED 1CLVA 1JS4A 4PRBB 4QRPB 4FZEH 3FYIB 1N10A 4HIQA 1JPSL 1CK0H 4XNYL 2BSRB 5T1JA 2X4UB 4FERA 1D9KC 3HAEG 4K71C 3N1QC 1BZ9B 2CHDA 3EJPA 1FORH 1T03L 3KYAA 4L4TE 4FABL 1H3PH 2F18A 3TBSB 4GUQA 1WS7A 4PJXB 3VXMB 1MFVA 3IKKA 2R83A 3DUUA 3LXBA 4WUKL 2OMWA 2YPKB 4X0NA 2COVD 4XPHL 1OGTA 1FDLL 3CHQA 2LGNA 1M1XB 3OKKA 5CILL 4HD5A 2D7TH 4AJVA 2H6OA 4L9LA 3S34L 1CFSB 1WCBB 2JJSA 2OR9H 1S7QA 2ICWA 1FFPA 1ZT4A 3QULA 2YRPA 4Y89A 1SJMA 4KKPA 5DUPH 5T1KA 3DSFH 4S0TD 4Q52A 5C3IA 3H56A 3O9WB 2IH9A 2WUCH 5DJZB 4ZMZA 4LLQA 5IHBA 4XN5A 1CICA 2DLGA 2JVUA 3KBHE 3KGTA 5AVXB 5DHXB 2WXPA 3VXOB 3SB3A 4IRZA 1M3IA 2NW2B 2ZJSH 1U8JB 2AK1H 3DIDA 5BVPL 3QQ9C 5M94B 1D2PA 4WIQA 4ZPTA 4QNPE 4OZFG 4TPRL 4YN3A 4DZBA 3Q0HA 4I4WB 4MXWH 4XWOC 3GK8L 3ULSB 5BZDA 4F91B 5I66B 2R1XA 3GD1C 3FUIA 1UM4L 4NQVB 2BRRL 3UROR 3KPRA 4HCRH 4L8DA 4DW2L 1F6FB 2B1OA 3V8OA 3GMLA 1T80A 4YLCA 5C2BL 2F2HA 3IBOA 3B56A 4JO1H 3DX1A 3KYMB 4QHKI 5DQ9B 3VU2A 2O6DA 2B1HH 4WJ5A 4NJ9H 5JXAL 1J88A 2QADD 3BXNB 4YXLL 2J6EL 2YZ8A 2ZE0A 3ABLB 4TLKA 3LIUA 4MGXA 2FD6H 5FO8B 1RQ5A 3OB0K 1NGZA 3SGDH 1JRHH 3LEYH 1JI1A 3CD4A 4KC3B 4PRHB 1I1YB 3U0WH 2ZWNA 4MJIA 1SZNA 3CUPA 5E5UB 4Z0XA 4X7DC 3WEMA 3LH2H 1ZLUK 5K9QG 4QAWA 5IK3A 3ZDZE 4NRXA 5AG9A 1MCPH 1VLXA 1BQRA 3BFWA 5KN5B 4Z9KB 5EOTA 1T7XA 2UX6A 2XIIA 4K8RD 4K94C 4OCXH 4QCIA 2QHRH 1QSEB 2X2HA 3CSYB 3JYBA 4JCLA 3G9AB 2GITA 1J8SA 4RWYH 2R0LL 5I28A 1H19A 1H3VA 2AQ1A 4CGUB 1DBJL 3VE0A 5CFHA 3N9GL 2OYKA 4XZUA 1GW6A 1WC7A 2E7LC 1CJYA 1J9SA 2EDJA 5E8EA 2V2TA 2X6CA 5AW0B 4NQXA 2ED8A 1XB3A 1L5GB 1AQDA 3B6SA 5HBBA 3AY4C 5ETUA 3G5VA 2BHYA 1I7TB 1U3YA 2HTLC 1AIFA 3DPBB 3KWVA 1AP2B 3EOBA 1UACH 3LQMA 2W9DH 4ODUB 5IHZB 4X5WB 2OMXB 3AB0C 3WY3A 1IAMA 4B9JA 3OHXC 4CVXA 4RAVB 12E8L 5LXVA 3AUVA 4FG4A 5C0AD 4JRXA 3FT2B 3CVDA 3PJLA 5IQ7H 3FTXA 3WSQL 3B8YA 3EYUL 4DKFH 1R47A 3RLSA 2LQRA 1I9RL 2JIXD 4HPOL 4FFZH 4A1KA 1PDKB 5HHOD 4PWJA 2NY7H 2YBRA 4OLZL 1YAIA 4RH4A 1QNIA 1IEAA 4QRTA 5E6IC 3KS0J 1R3LA 3TO2B 5AVVB 4EZLA 1NGQL 1MFNA 1EXGA 2Z8RA 2XBDA 2IBGA 3MXWH 3NCCB 4KVNL 4TVUA 2PO6B 3IJEB 5HGDB 1YNLH 3ZT7A 1S3KH 3WY2A 2V7NA 3BISA 2EIJB 2DQEL 5F0PB 4JR9L 3II3A 4E9LA 1OL0A 1O75A 4NQCA 1ILSA 3ROOB 1NOFA 4PM1A 2XWBB 4BFGA 3L4WA 2DLEA 1W15A 5D1ZI 3KWTA 3KYOA 1AKJB 2K6ZA 3GSRB 4K55A 1YZZA 4HPHA 1ZY9A 4K73A 3BAKA 1AE6H 3BGAA 1QWHA 5KJ4A 4OJAA 3G6JF 5J6HB 1ETB1 4LKXA 3LOWA 3MV8B 4NO3A 3JV4A 4GEJA 4X50A 3U4EB 2DIAA 2FECL 3LRHA 1CD0A 4R6UA 3RE0A 3UZEA 5I1AB 3F05A 4KQ0A 2R4RH 3L45A 4O2EB 3SE6A 3VGBA 4OM1H 4U6HB 3EHBB 1KCSL 3B7RL 3HC4H 4A2LA 4GQQA 1PLGL 1UG9A 1BOGB 3LPOA 4M6ML 3VXUD 5CJBA 4HWZA 1A6VH 4DGIH 5DUJA 1OGSA 2A83B 1HTYA 3SBPA 5KSAA 1Q9LA 3Q1SH 3P1VA 2FLMA 4GAJH 2EDRA 4FQJH 3RVWC 4EN3C 4HT1L 4XVUC 1WE5A 1Z9LA 4Z76B 2FBJH 3UADA 1LTXA 1IJNA 1JYXA 1KGIA 1ACZA 1RZPA 4JO5A 5KVEL 1OPGL 1TEGA 4GXUN 2OTWB 4F2FA 3ULUD 1LEGA 3L3DB 4FYRA 5EZOL 4KWUA 3GS0A 4JY5L 3MBEB 2EVJA 2BNQB 4HIEB 4Z8FL 1B9KA 3IXAB 5SWZA 4MD5B 4HIIB 1Q4NX 1IBFA 2J1XA 5DVKA 4TTDC 1MFAH 5F7DB 1IBYA 4NX0A 4FN0A 4FGMA 1GTFA 2YA0A 2YK1L 4PJBB 3T0EE 4AM0Q 1PG7W 2CHNA 4CW1A 1QQDA 2ERJC 3RDTC 5C0CD 4WV1A 1IGJA 3GI9L 4XNZB 1X5ZA 3LEXA 2WGNB 4PJ6A 1AD9B 1YECH 1SN0A 3LKRB 3HA0A 4HH8A 5IKCB 3DX4A 3CZFB 3MRHA 4IIQC 2CCWA 2E7BA 3H9SB 3FT4A 4PRPE 3U2IA 2VSCA 3RI5F 1F13A 3WL9B 3L2NA 4AEHH 3PJNA 5FYLE 1V27A 3RX7A 1IAIL 1U30A 1JD7A 1KJ2H 4GXUM 1IBGL 1F4YH 1MFDL 4QI3A 3UAEA 1UZ8B 3TA3D 4XO8A 1GJWA 2F1EA 4C8XA 2HUHA 3V4VB 1G9EA 4TF4A 1ZGLA 1KGJA 2GAZA 5AAMA 2WN2A 3G08A 5F71A 2JMRA 1AD0B 5EMYA 3RJDA 5D9SA 3HHMA 3MA9L 1PKQB 2PW2A 3QR0A 5F7EL 3AZUA 2XWTA 4A67A 2I69A 1S7UB 2YPLB 3KDMA 4UBDD 5EZJA 4APQA 2ITFA 5BZXA 1HEJC 1P2CA 4OQTA 4PLOB 1WBXB 1R5VA 5IB2A 3AWGA 1YY9D 2ED6A 5BZZA 3U9UA 3A4DA 2IPTL 3GRWH 3D8MA 4U1LB 3V8CA 1AGBA 2BIIA 3TC9A 1V5JA 2VLJB 1OSZB 1JNHB 2V3EA 3JTSB 2DBJA 2GJZB 3MLYH 3VH8G 4KI5D 2VSMB 1JOIA 4YBQC 5KW9H 4YBHA 4E9QA 1AXIB 1N8ZA 4LNRB 5DJXA 5F7HA 1WH0A 3IGFA 1Y18A 3T9WA 2VLRD 3GS4A 1CF8L 4KUZL 3JZYA 3P3TA 1HCFX 1KN2H 2ZX8A 2P48B 5IQLA 3KPLB 3QFDA 4V2BA 2VIRA 4YX2H 1M2VB 3VFOB 5DJYA 4S0HA 1CFQA 1DCLA 5D93C 2XPGA 3T2PA 2ZKXA 4IDJH 3CDZB 2OXHA 1ZK9A 2CHWA 2MCMA 5BVJB 5I1HL 2IH8A 4N0CC 4HUVB 2HA1A 4G6KH 5HGGS 2QPUA 4OGXL 2GSGB 1FO0A 2IH1B 3BUYB 3OAWA 4V1DD 5CR8A 2C9SA 5TE4L 1JF1A 2HN7B 4Y19E 1NEZB 4LU5H 1Z3GH 4DEPB 1RJLA 4KVCL 4RGNB 1T66C 4Y88A 1CDUA 4A7UA 4YSAA 3BAEH 1P4IH 3FTSA 5IVZB 3MRBA 3QPXH 5K33A 3WHXA 4F57L 1NA8A 2MRYA 4KY1L 4PJEB 1UWEH 2CCVA 2WWNA 1A0QL 4NC2B 5A2KH 4LKCA 3CVHH 4X6EA 3V0WH 3OAYH 1A3LL 5FCUL 1HFUA 4HULB 5D5MB 1KCLA 3SE8L 5GS2H 2MOGA 2YQGA 4H0GA 3X13A 4I18A 3ZKMC 2Q5BA 3OPUA 3IEAA 1C8PA 3HRPA 1ID5I 4OT1L 4I0PC 4FFVC 4P9HH 3VJ6B 2HWZL 5EEWA 3FNKA 2Q7YB 4AUYA 2MH4A 4O00A 3KDPB 4PJBF 3P4MA 1WIPA 3PGDB 2IBZX 4UZSA 3QXDB 3S5LB 1RUKH 4GW4A 4BM7A 5GGUB 1FFOA 4TOYL 2GUOB 1VERA 4X99B 4KK5D 2FGWH 4CDGC 3OR6B 1G1YA 2Z4TA 4LEBA 3JWNG 4KO9A 5GJTH 5TD4A 1V55B 4MAUH 5IB1A 4OV5B 2XTLA 3LN5A 3VWKA 4RMUA 4Y1AE 3VFVB 2VH5H 4GQPH 2BHZA 4WNQB 3HMXA 3PFQA 2Q9OA 2DQGL 1IKNC 3BKJL 4Y4HD 4JHAL 1WCQA 1WIOA 4XP9L 3TIEB 4LSRH 4YE4L 4S2SA 3DO7B 1JWSB 2JK5B 4M8VA 3QO0B 5EU6B 4C58B 4LHUA 4H25A 3SCMA 5T3ZD 5I73B 4KZEL 4NFCA 4OCSH 1C08B 2OQJB 4ZX6A 3AU1B 3BMWA 1BQHG 2VYRE 5FKPA 3RWIB 4UOW0 2PYEB 5D7IA 4WDIB 4NN7C 4KXZH 1ZA3A 2NY2D 4FFYA 4Y2DA 4LPYA 1NC4A 1UJ3B 3TASA 2NYYC 2GBTA 3PHSA 3IFPB 3ES6A 1ZIAA 4RSVA 3WLWD 4PVMA 3JTTA 3UO1L 1KJ3L 3PP4L 4WLCA 5K93A 4NKDA 3UTQA 4YEFA 5A2CA 1X5KA 2ATPA 3INUL 3CVBA 4IK6A 4KV5F 3Q6FA 3FYEB 1PD0A 4FLOA 1UHVA 3EFOB 4N8CH 4OIIL 2APVA 4XCNA 3D0VB 2CDEB 4J6IA 3TN0D 2Z31B 4K5MA 1N4XL 1C16B 3QEGL 4JDZA 1F1AA 1J5OH 3V4VL 1ZEAH 1J10A 2IGTA 4XC1H 4PRAA 3T0EC 5CZXC 3WFHA 2V4LA 3PABA 2YAOA 3HE7A 1CL7L 3D30A 3H55A 3WCYA 5IOPB 3L3OC 1YRKA 2H32H 2VL4A 1M1SA 3X14B 5LN4A 4PJ7B 2B08A 1HHKA 3GXNA 3MRQA 2KDGA 4OVVA 4MDRA 2BW4A 4E41D 2WB1A 3W0WD 2X7LB 2Y1YA 3LKSA 3MLZH 4XPAH 2MTZA 4JM2B 1TQCB 1U41A 4JEGB 1UVQB 1ZWIB 3GMPB 1EVUA 2UXGA 3NFPB 3VFNB 4UM9B 3O6LH 3FSAA 5IMKB 5GRUH 5D7JA 5SX5K 4F7EA 3H0TA 5K39A 1M7DB 2X4OA 4NZDA 5LBSA 4NOBA 4MKTA 2XQBH 1QEWA 2UYLA 3TBVB 1SXBA 4FNRA 3OF6D 2YRZA 4TUKL 1WPCA 5JHDB 1EX0A 1CTNA 3GZPA 2R2EB 3JT0A 4MSWB 1T89C 4UU9A 3V4PB 2YA1A 3RWJA 3VFPA 1A1OB 5F9WB 4OGYL 1DVXA 1OGAE 1P7KB 1S2EA 4GAGH 5E70A 3W39A 3W38A 1SVBA 5IY5B 1CXHA 3KPPB 4PRNA 5IUSA 1RUAH 4Y4FC 5GGTH 1QTYT 2QKIB 2ZUSA 1XGTA 3ZL4H 2WXMA 5DZJA 1MCOH 2DH2A 3FU7B 3IDNB 3MV9E 3QWOB 3BX7C 1OP9A 3ZE0B 2YMXL 2D2OA 2DL2A 2AQTA 2WWKT 1M6UA 4K8RC 4G9DA 3MLUL 3CDGB 4P8QA 3OC5A 3QO1B 1A9VA 4G8EB 2EXYC 3H2QA 3QFGA 4FKHA 5EU5B 3UTPD 3NG5A 1JZ6A 3O8XB 4C57C 3CMGA 3A6BL 4HWBH 1GW0A 2BXYA 4FULA 4K0OA 5ENWB 2Q6WB 5CSGA 4F92B 4QKXB 4O2FA 2EXWC 2WQAA 1OLLA 1JPGA 3I85A 3BP7A 4KKBC 2CO7A 2V5YA 4J3OG 4LSTH 2V0AA 4P3CH 2ID5A 3EH1A 4TXVB 5I0WA 1G7JA 3PWNA 3BWSA 3GHEL 1J5IA 2FB4H 3BVUA 4JRWA 3QFJD 1M42A 4ZUUA 4M7KH 3TT3L 2Z7UA 3MXVH 1XZ0B 1TETL 3PDOB 3X11B 4EKXA 3KAAA 4PJ5E 2VDMH 3FUHA 3HHSB 3N44B 4Y9CA 5TGBB 3TXAA 3S5YA 1F02I 3WNOA 5A16A 2OYPA 2JKLA 5E0QA 3VDBA 3WJLA 1KBBA 2FEJA 4ZW3A 6FABH 5HYJD 4NKIL 4GG6A 4MMYB 3WDIA 3ZG4A 4RGOL 4POZD 4X7SH 4DGYL 1FHNA 4NNYB 3MMEA 1OEZW 3BSZL 4U1NA 1U8QB 2WJ5A 3B9AA 3AMLA 5IROC 1FYTD 2WCPA 3MFGB 3C6LA 5J9PB 2O72A 4JHWL 4QRBA 1UXWA 4L3AA 1GZQA 3PAVA 2RACA 2ZP0T 4WRLA 2D9CA 2D3JA 2BSEA 3ILPB 4TN9A 4GKSA 3RL1B 3FH7A 3BUDA 3K8MA 3FQNA 1E9OA 5I24A 5FHBH 1KUMA 4F8NA 1U8HA 3SDDB 3O2VL 1JHKL 4E68A 5EC2A 1IGCH 4F24A 1AZUA 2VZOA 3RUGE 1ZT1A 3L9EA 1N67A 5IB4A 1KDJA 1A4KA 3D69B 3QCVH 3ASOB 4OF8A 1WWCA 1JF5A 3GSOA 4WTWA 2IXQA 1R33A 2PNDA 3HRZB 3WJMB 4NZTH 3IKCB 1CFTB 3VFRA 1XIWB 3NSXA 4LAQH 2P9RA 2F1AA 4ZX4A 4PI2A 4PGEA 3QDAA 5EBLA 3KBEA 5HHMB 2QPDB 1G7PA 5E4IA 5AWNL 1SGKA 4PJ9B 4BH7A 3DOIA 3PGFH 4PJCE 3K6OA 5T5FA 4YHKH 4GW1B 3CZGA 4QHKJ 1SHSA 5D72L 1JCKA 2YD3A 4W6YB 4WEUD 1EFXD 2X88A 4P2RD 2NY1D 3C5JB 1DVFB 3SJVB 4NWUH 1M7XA 1GZHA 3UPCA 4UTBA 4JW3A 3IF1B 3ZVVA 2VSKB 2KLRA 1I4FB 4MMZA 2ZX7A 3D4GA 1OCWH 1A6WH 1M9SA 2V2WA 4X83A 1U4EA 4I0CC 3ZE0F 3DK2A 4KJYA 1UT1A 5DHEA 3DOSA 2FL5A 4AVKA 3GGWA 2FATL 3QG7H 1B0WA 4XPGH 3UTSE 4ATWA 1ZTMA 1ORSA 2IWFA 4PUBL 1UADC 3D1MC 2X2YA 3DX8A 4XTRD 3RAJL 4MYPA 1YNKH 4X2UA 3GDCA 2QMKA 4X9GA 5TDOA 3HPJB 4NO0A 5MP6H 4BIKA 1BSIA 4BQBA 5BZWA 3LNDA 4M61A 3EW3B 5GZOC 1M53A 4PJGF 3BUPA 3DUUB 2FSEB 1HZHH 3VSTA 5KSBA 1TZ8A 2CPUA 4UT7L 5DRWA 2UZXA 3GJFA 1U3NA 4L9LB 4FA6A 4M3KB 4AMKH 2WSDA 1PCSA 2AAAA 3TH4T 4F2ME 3S88L 1P53A 5E94A 4FF9A 3WNPA 1FFPB 5FYKH 1XV8A 2W60A 5T1KB 1FAIL 4M4RB 5DURD 1CO1A 4HH9B 4PHXA 3DUHA 3E2HB 4ELMA 4NHCL 5EU4A 4M6NL 1IILE 1CICB 4EDWL 2E9JA 2XZZA 1I8KB 4MA1B 4Z95L 4OF6A 3KNBA 1EANA 5AD0B 5IJDC 3CLEH 1WZKA 4N28A 3QAZC 4YDMA 4DZBB 3K1KC 4P2OA 3MFFA 1E3ZA 4NBXB 2DLFH 5I5JA 5BZDB 1FFTB 2F9BT 4JZOA 3KPRB 5HHNB 2R59A 2VITA 2Z0UA 3BO8A 3OAUH 4L8DB 1A7RL 4PIBA 4BSJA 1MNNA 1VADA 4ZRGA 4CKVX 3NSDA 1I1AA 3HMWL 1WEJL 3O6FC 2AQNA 4H26A 4KK6D 4WJ5B 2M8XA 1U6AH 4G3YH 4ZI8A 3HI1A 1DQQA 3HG0A 4LBAA 5HJBA 4R5VA 2EYTA 3BVWA 1MHPH 3SDCB 3ZO0A 1TJXA 4ZW7A 1OF0A 2AXGA 5IV2B 4FDWA 4PB0H 3GTTA 4IOFD 4LCWA 3NIGE 4XNUH 5CWSA 1HSAB 5IB5A 5DC4B 1R46A 4MJIB 4MVBC 2X2IA 5FAAA 1RZJL 3CUPB 1RIUL 2BWDA 4Z0XB 2AAVA 3FOMA 5KG9A 3ZX1A 5IK3B 2JB6A 5BMFH 4L8SC 3HVDA 3QIWD 1QFWL 2CHZA 3L48A 3VD9A 7FABL 1KCKA 4PJ8A 1G84A 1KGYE 4QCIB 3A6CL 1IBHA 3GBMH 3IMBA 2A7BA 2GITB 4NM4L 3VE0B 4EE2A 1V3MA 2V2TB 3K6NA 2QPEB 2VR3A 3DYPA 5I71C 1A5FH 4NQXB 1S5IL 5CXPA 5ICXA 1SMAA 2L7JA 1IM9B 3WXWL 1UCBL 1N0XL 3G5WA 3HG5A 5T5NG 4MD0A 5IBUG 3G5VB 3CSFA 2Y2TA 3HG3A 4PWEA 5DD6B 2O93L 3KJ4B 3Q6GH 5H94A 1FVDA 1VEPA 1EO8H 4G80B 4LCCC 5EEVA 2OTPA 1LWHA 1VZGA 3JVGC 3IDYC 1QSVA 2LU7A 3TBWB 1NIAA 4UV7H 5FKAB 2GJ6E 2WO3B 1WZLA 2ZWKA 4LVEA 4W9EC 3PL6C 2ALAA 4P9HC 3VXNA 3W82A 2RJMA 3H3PH 4KXAA 4MQXD 2WZ0A 4K2UH 5F89A 4M9OA 5IW6A 2NZ9D 1RL1A 2RA1A 3OTTA 3MLWH 1FPTH 2YBRB 43CAB 1I3UA 2KS0A 1IEAB 3MJ9L 4O58L 4QRTB 5DRNA 3PDGA 5D71H 4PGDB 1F2QA 1R3LB 2ZOKB 2NMSA 5SWSD 2Y7QA 2WINB 3EKCA 4YSEA 1MG3C 2FAUA 4YFEA 1SLWA 1FUNA 3SD5A 4BA8A 1SJEA 2V7NB 3AQYA 1IC5L 2NR6A 2N56A 4ZMOA 1T1XB 4NQCB 4YDLC 4FKKA 5G2NA 1QHPA 3QIBD 4JFHD 3TJEL 3KYOB 1UT9A 1YPZA 3C5ZA 2CALA 4G1MA 3ATFA 4Z0BH 2DTML 1MVFA 3CZEA 1K8DA 32C2A 3SQOL 4I1NB 5A43C 5J56B 1S9YA 1H6EA 1A9EA 4TQPA 3T6WA 1RUPH 5D96C 2NY2C 3UYPB 1HH9B 1ITBB 4CBPA 1DLFL 3E9UA 1YVLA 3BD4A 4YWGL 4J4PC 3ARBD 3GSXA 3UBXI 4OKDA 4A7SA 4G6ML 3KM2A 4HWZB 4HQQL 4LARL 1FIGH 2YGQA 1U2YA 1OP3K 1BZ8A 2XZQL 2X9WA 4KZ0A 3PWPA 3UYOD 2KZWA 1K2DB 4P3DB 3V55A 1KCWA 1JG9A 3O4LB 2ZCLL 1N5AA 4YE0A 2LFEA 4EUPB 3RZCA 1NAKH 3M7OA 4X98A 1TMCB 4X5RA 1X9UA 1FCGA 2H1PL 3VSVA 15C8L 1XGUA 1PBYA 1QTSA 2IGLA 5SWQA 5TF1L 3BVVA 3GBNH 2EYRA 5EHFA 1LEGB 2BFGA 4IBVA 1SUJA 2VXSL 4LNVA 5D4IA 4NBYB 4DUWA 4E0RA 1A66A 3BGFC 3IDXH 3SDXF 2LOEA 4P4RA 1KBPA 5CINH 3ARFB 3SDAC 3WIHA 5SWZB 3WN5C 5BOJA 3RFZC 3ECUA 4L4VD 3V5KB 4AQ1A 4RWHA 3VM7A 1TTCA 2X4SB 4JFXA 4XVTH 4CW1B 3H53A 3D7PA 1QQDB 3S3PA 2C4FU 3MV7E 1IGJB 4RQQB 4LVNC 4DP4X 3B7YA 1D9KA 3QI9B 5FYKE 3H42L 1LO4H 2F8IA 2VZSA 4NENA 5SV3A 3LV3A 3MRHB 4J6RL 5TE7H 4MRCA 3CHOA 3FT4B 2IQAA 3WO4C 2MQ0A 4HJTA 4NN5B 4XP1L 3VGFA 3VI4A 4YHOH 1TOXA 1JDDA 3L17A 3F7VB 5CEZD 2ZG2A 2ZXCA 4YS4A 4N2FA 3CDYA 2HFGL 4NIKB 1GGIL 3L4UA 3ZQDA 2AEIT 4UILH 2F58H 4HIHA 4XN8A 1CI5A 4MXVF 5J8OA 5IJKC 4A66A 1IE5A 3UTTB 1NEZG 4IBYA 5I1JH 2F7QA 1F1GA 4MDIA 5ABZA 1ZGLB 2EUXA 2GAZB 4ZTOL 3MA7A 5LG1A 2DM2A 5IW1A 4WI2A 1XWVA 3BQUD 2PW2B 2WTRA 3T2QA 3GSNH 4IOSA 2N7BA 3BJ91 1SJXA 1A4AA 1GYCA 1Z32X 5EZJB 4APQB 4MJ4A 2Q8AH 1P2CB 5DU7A 2FYYA 5IB2B 1R5VB 4AW4A 5D1XA 3U9UB 3ZQ9A 3A3YB 1MJ7L 3BW9B 2ZWZA 5DQDL 1SDDA 5EUOF 2O5XH 2FIRT 4G43B 3THMH 3MBWA 4XP6L 2Y6TE 1D5ZA 4NUPA 2WJ7A 4DKTA 5DZPA 1S5HB 2QSCL 3IDGB 3S5LG 2JLPA 3RGVC 5I8KL 4ELKA 3QORD 1ZTXL 3B9VA 1QUNA 1Y18B 1ZOXA 3BKMH 3F83A 4BXSV 3MNMA 4N8VG 3VGDA 4MA7H 1DZ0A 2VIRB 5L8LB 4KTEL 5BOZG 3CZKA 4TUUA 5J12C 3CC5A 1NC2D 4Z7OB 1AJ7L 2XPGB 2OJEB 2ZOUA 3ULVF 2OXHB 3U46B 2ICCA 2B0SL 5C0BA 1BAWA 1PZUB 2JE8A 3MZGB 5IJCC 1NCCH 5E1AA 1CWVA 1ETZB 3D9AL 5LQBL 4XHJC 5DHVH 3RVVD 5JW4R 2O6PA 4HJIA 3ROLB 5IM7A 3QHFL 3VD4A 5DFVC 1RJLB 5HGBA 2E7LA 1TG8A 4HWEL 4YHZH 1CXIA 4GQ9L 2JKRM 3MRBB 4Z7AA 1IQDA 3TVMC 3GKWL 2DQFA 2R29H 4E9YA 4I7ZC 2B59A 3DBSA 3IJSA 3AY4A 4LKCB 4B9YA 4X6EB 2EVIA 4C59B 2XFXA 2YAQA 4ZS6D 4X6BA 3ZIMA 5B7FA 3L1EA 4RGMC 3X13B 2VDKH 1JD9A 2WNWA 2CXKA 1CD8A 2Z8VC 3EXLA 2B5IB 3S9DB 2VDQB 2ZSWB 3NRPA 3EO0A 3WG7B 2V9TA 1U8MA 1BD2A 3P4MB 1SVZA 4ERSL 4GRWB 5CJ5A 3VRLE 3LZNA 1NKOA 4GW4B 3L3KA 4HLZG 2NXZB 4G7QB 4ZFZB 3ASNB 3O11A 1FFOB 3FHEA 2WLHA 4O4YL 2DEYX 3L5XL 3QWNA 4R90H 3BGMB 3QK0A 4NZJA 3ZTJH 5JHLH 2UY6B 1K8IA 3KYKH 2ZSVA 3DHMA 4L8BB 1J05B 5AZEH 1UZ6F 4LIQE 4HX1A 4ODVH 2R8SH 4X8CA 5IB3A 2G3ZA 3MRPB 3LN5B 5D7LD 5C0RH 3VWKB 3FO9A 3WIIH 1F86A 5F7MC 3SPHA 4F9LC 4DJMA 5LBVA 3MLRL 1Q1JH 2XKNB 4H88L 5E2WH 3OMNB 1GJIA 2CM6A 4LP8A 2WKOA 1GGYA 2ZXDA 4JKPH 4S2SB 2ZT9C 4LHUB 3SCMB 2YMTA 4JFQA 3AS3A 2F53D 4OCRH 1J8HE 4BZ1L 4U1GB 3NCFB 5FKPB 2XZAL 2J71A 5D7IB 1URIA 1OT2A 2A74A 3P4LA 4P2QB 4ZOAA 1I9IL 2WXJA 1ZA3B 1O5DT 2WQRA 1KGXA 4GBXD 2FECI 4GY4A 4Y2DB 2QTEA 4PRID 1KCRL 1JF6A 5DZ9A 3GIZL 1LO0L 1NAMH 3CSTA 3FBQA 4NJAL 1SF5A 2CGRH 2Z91A 3TV8A 3CX5J 4M62H 4PJHF 3UTQB 4E5XA 1UQSB 5FK9B 5BRZD 4AXWA 5CCJA 4LCYB 2YKLL 1KLFA 1H6UA 2PW1A 1EMTH 3QPQD 2MOVA 5CJOL 2Y6SD 3ZDYE 4KJWD 4CSPA 4W9KC 4JZJC 4JDZB 1FNLA 43C9A 3VXSA 2WN3A 4G9FD 2PXYD 1DBBL 2VQ1A 4LFHG 3APFA 4Z7VE 4ADJA 3AXLA 1F90H 3KVQA 4QRPD 5T1DH 4YHIB 4H20L 3W9DA 4AEIL 4KOBA 1MW3A 4U31A 4FG6D 1NMCB 1J48A 5LAPA 4JDTL 5GS0D 4WK0B 1VPOH 3Q1EA 4M5YL 1HHKB 2O5ZL 2EYSA 5I6PA 3DTDA 2YXMA 4E9RA 4OQTL 3ZKXB 2WPGA 3BD5A 1OTTC 3L4CA 4Q9CA 2AQSA 1FHGA 3VXMD 2DQDH 5F9AC 2DLTA 3SPJA 4AYFA 5ADPL 3LMJH 2WW8A 1AGFA 4NQDA 5IBTH 1FZKA 1LO5A 1OD7A 4HSAC 4Y5VA 3VVWA 4OIAA 2FK9A 2E8YA 5AOIA 4NQED 4W9FC 5I8OL 4F7EB 2ORBL 1K4CA 3LZFH 3U6XS 4B50A 1VFBA 1KJMA 1XF1A 1WYJA 1EWHA 5LG6A 2UYLB 2KHAA 3O9WD 3QEHA 1XGRA 2WZ6A 3HC2A 1JI2A 1KCVL 2BZ7A 2OL3A 1HDMA 2WCSA 1XF5B 4Y2LA 1AHKA 2FDBP 5I8EB 3FTUA 2WD0A 1G6VK 2BZDA 5J11B 3RWJB 1BGXL 3ZY7A 1HL8A 2ADGA 1YQ2A 2VNCA 1BQLH 2WGXA 1HI6A 5LVEA 1ZSHA 2F61A 4LMQI 3K2UL 5F7NC 4PRNB 4DN4H 1TSHA 4GT0A 2DYPD 3JQOB 4FZ8L 2XG4A 4KKZA 3GB7A 1TVBB 1FZMA 1XGTB 5D2NC 3WFBL 3DI2B 1N2RA 1V54B 2Y0SA 3FRPA 5DR5H 1JGLH 3TZVA 3ET9F 3PV6B 1A6TA 3M8OL 3CG8A 1UEYA 3K5RA 3PV7A 1HOEA 4G9DB 4WKXA 1W72B 3DX0A 4MKMA 5IMMA 1XCXA 2DF3A 1XCTB 1BYPA 4NO2A 4ZW5A 4J12A 2YGNA 1YEKL 4G6AC 4ZX3A 3BOVA 4KGLA 3ZZQA 3IFNH 3VA2C 4O2FB 3EBGA 4L37A 4NCDA 3FRUB 2ATKB 3VYPA 2BS8A 2VDQL 4A2HA 2CO7B 3AAZA 5DS8A 1IFRA 2ZX9A 4MZIA 3CN2A 4M56A 3O2WL 1E5ZA 2WC7A 2JKJA 5C70A 1G7JB 1UXLA 1QSED 4Q74A 1QZ1A 1KN4L 1ROCA 2VWEE 4U7KA 5E1HB 2DQJH 2J6WA 3P40A 3TTYA 1J5HA 2VW4A 5F1KC 5F2FA 3T65A 1TZIB 1P7QA 2BO0A 3BPCA 3L1OL 3KWXA 4IHOB 4LF3A 4G71B 3VMNA 2EICA 2EC9U 2WQWA 3MJ7A 2CO6A 5F72S 4OZHA 3QXVA 5A16B 5E4EB 1YY8A 4P5TC 1R9FA 3HI6L 2A9MH 4XGZB 4GG6B 1KY7A 2E5EA 5A7BA 1S8DB 1KV7A 4FTVD 3MMEB 4WI0B 4XMLL 3T0AA 4U1NB 4ONOA 2AMUA 1QNZH 2AQQA 5C0ND 4MAYD 1GGBH 2JSFA 3PWLA 1GGUA 1XSJA 1KEGH 2NXYC 2C4XA 1UXWB 4XC3H 1GZQB 1LMIA 3NP3A 4N0UA 5JHMA 3TJPA 2H2SD 4NQDE 5KVDL 1UJTA 3O0RL 1C7SA 1XH0A 5F7FA 4OJFH 2CK0L 3FQNB 3G6DH 3V7MA 4FYTA 1PG7H 3MO1A 4FFYL 1U8HB 3WUWA 5HHXL 1XEUA 4ZUWB 5IMLA 2IOMA 3QNZA 1MI5B 4HUCA 1ZT1B 1KIRA 4WWNA 5DVNA 3Q44A 5BO1H 1EGJL 4O2CA 5DFTA 5INDB 4IGBA 1EO7A 2AMGA 3MJ6A 4BDVA 3BDYH 3ZTNL 1RHFA 4FLQA 1EQWA 3AMKA 2PWEA 2VKXA 1FL5A 4I9WD 3E8UH 3SHSA 2M2DA 4NZUH 2P80D 1XF2B 4OCMC 3RY6C 5EBLB 1J12A 4OUUA 3QCUL 5E2UH 3ZT5A 1L0YA 1AKJD 3KPSA 5K59F 1FVCA 4IEFA 2Z7ZA 3NK3A 1NKGA 3PHQA 2D7PA 5DWUL 1FRGL 1CDJA 3ZLQC 4BUQA 4JFFA 4W9DC 2VJ8A 3LD8C 2ZCHH 4P5RA 5E56A 2G2PA 4AYID 4Q97A 1JPFA 4GG8A 4H7VA 5AZ2H 3IFLH 3MV8D 4KUCF 1OSYA 2IAND 1XVSA 4I3SH 5DJ6A 4N85A 4KH2A 1U8KA 2A1WH 1Z1WA 4MMZB 3WN6A 3US0A 3V7AG 4J3OF 3EHBD 1AC6A 1H5BA 3RVUC 3HE6D 4OM0H 2BY0A 4BK5A 4KJYB 5LHDA 3QWRA 4FI6A 3T2NH 4JE4B 3DOSB 1C7TA 2FL5B 3B5GA 4R97C 4S1SL 3GGWB 1NFIB 3U7YH 4CC1A 2JI3A 4MJ2A 3TO4D 4PI0A 5C0EA 3DX8B 3LRKA 3VMOA 5EIIA 2SEBB 4U3SA 4MD4B 3HS0C 3RKDC 5IVXA 5TDOB 3I6LD 5B3SB 2LFGA 3MI6A 4LOEA 1MFCL 3QZNA 5BZWB 2EAEA 2HFTA 1NLBH 4NQSA 1ZGLP 2CBPA 3NCJL 4AH2A 5I1GL 5B21A 1TO5A 2BVTA 2ZF9A 2CBQA 3F58L 1MLBA 4WW2A 2AF2A 1A7NL 5KSBB 1IKOP 1GSMA 3C09B 4YHLH 3FTGA 5DRWB 4UDUB 3MBED 1B0RA 2F8OA 3QRLA 3C5SB 4IDLA 4U6VL 2YEQA 4KROC 4HLJA 1XDTT 2K6WA 1RERA 2JJWA 1L9SA 2ZXWB 3TBCA 4EIGB 3ZMEA 1CGSL 2BSTA 5E94B 2VDNH 2W60B 5HVHC 4OZIA 4PJAB 4N1CA 3D5OF 2X70B 1RURH 2EE3A 2XFGB 5EU4B 4ELMB 2N7AA 3L3GA 1MJ8H 5AB9A 2GK0A 4LPXA 5I30L 1EJOH 4F7PB 3JTBA 2W94A 1QVOB 2JCCE 4PS4L 3TT1H 2H6PB 3H9SD 1BM3L 3MFFB 4P2OB 4U1IB 3BFQG 3QDGA 1QACA 3Q2WA 5DC0A 1NTDA 4JZOB 4MXQC 1L9OA 2VITB 5GGQL 3ZPDA 4HJUA 4JAMB 4QXWA 1MAKA 1VADB 3DTXB 4JDEA 4HIPA 1I1AB 2WXNA 5IF0A 1IC7L 3S37L 2KLSA 3LPPA 1OM3H 3NIDE 3WTXA 3RIKA 4CADA 2EYTB 4MQTB 3IMSA 1C5BL 1XF3A 5EN2B 3UABA 4DO4A 2FUQA 3A24A 1U3ZA 4BSVA 4G5AA 5IB5B 3EFDH 3I3DA 2HFEA 3KLAA 2BVQA 2XYCA 3HJEA 3QORC 3FOMB 1KB9K 3F85A 5KG9B 2JB6B 4MHHG 4N68A 3AG4B 4WJG3 1HHHA 2NX5D 3KLKA 4YPGA 1HH6B 1A22B 4WW1B 2WVTA 2QHLA 1F8TH 5B3JF 2WQUA 4JFWA 1IARB 3CQPA 5E8NB 2Y1AA 4A55A 2AFNA 2NPLX 3Q8BA 5IHLB 1M05B 1V05A 2HCZX 4C4UA 3IU3A 1L7TL 5AENA 3FH8A 2GKIA 2GCYA 4PBWD 3TNMB 1WICA 2VWEC 4H8UA 1WFUA 2NDFA 5ICXB 4ZFOA 4LLWA 3FFCB 2LU3A 4JY6B 4K4KA 1TZHB 2FE0A 1RLWA 3RVVC 5FWRA 1E8WA 4MD0B 2W38A 1A6AA 1GL4B 5D1ZD 4PVNA 3AITA 4Z3JA 3N5AA 4M43H 4YDKL 1G6RA 4PH8A 3NP4A 5E6ZA 2XTSA 25C8H 5IVXE 4AIEA 3TESA 1FVDB 3RBSA 2K6YA 5I18L 5KS9A 5JZ7C 2VDRB 4H5SA 1YA5A 3A6OA 2YARA 2A38A 5GRJH 2X09A 1YJDL 2WLMA 1HILA 1BJ8A 3TYFB 3F8UB 4KTDH 3MRFA 3VXNB 3V4UH 2I60L 1JZHA 1ULVA 3IETA 4J1UA 5F89B 3SE4C 5EU3A 3QYCA 5C09E 5C0AA 4Z7QB 5MHSE 4RGND 2EH7H 3HUJF 2OP4L 3LPGA 4IBWA 2ADIA 4JFUA 4EOWH 4OZIE 3DXAE 3EJJX 1EAOA 2JIXA 3MR9B 4WY7H 5C0JA 1UYWH 2LV4A 2TRHA 4ODSL 4GRLB 3SKMB 1E4JA 2Y7QB 3N41F 5HHOA 4AGPA 3BZ4B 4HKJB 1W80A 1EUTA 2R0KH 4UTAH 4WWKD 2A9BA 1H3WM 2R0WL 4UTBL 2XN2A 3CHPA 1YYLH 1DFXA 1LEKB 5IROA 1GC1C 2QV4A 1SM3L 4WAFA 1X7SA 1KC5H 4PJAF 4W9GC 2X28A 5CEYA 3ZGIA 1CU4L 1SVCP 1I53A 3ZE2E 1WZ1H 3VO0A 4B9GA 3MRDB 1YPZB 5F0JB 1ZD6A 3NZHH 1EHLH 4G1MB 5ILTL 4DK3A 2WKLA 3HZKB 2VC2B 2RD0A 5D70L 1CZ8H 2APFA 1KFAL 4PCKA 2EH8L 2ADFL 4PVLA 5CN3A 1XD1A 1PFCA 32C2B 5E5RB 1DE4A 3HBPA 1PZSA 1S9YB 1QSZA 2KZ1B 3F12A 3FUDA 5E8DH 2NW3A 2VDLB 1XEDA 1Y6MR 4GIOA 2OW6A 4FQHA 3DJSA 4KDTA 4S1DC 1R3JB 2W07A 3G04B 3O3BA 3QZLA 4NRZA 1HWGB 1G7QA 2V2XA 2AJYL 2FEEI 1YYML 2VUKA 2C9UA 2LTQB 5EEYA 3PWPB 5C9JA 4WI6A 1QABA 4FQLL 2OJZH 1N5AB 2WZAA 4QHMA 5EU6D 3RZCB 3VXUA 1E3FA 4B3EA 3OMIB 4QY8A 3ETTA 1MJUL 5E5MB 1YUKB 4R2GC 1IFHH 2Z9TA 5T5NF 3HI5L 2B1AH 1KWKA 5SWQB 3QBTB 1E6OL 4F27A 2WBJB 2E9GA 3L9YA 3VD1A 3MRRA 3P30H 3W57A 1OSPL 4PVBA 2IPKA 4E0RB 5I76A 4OJYA 3J07A 4P4RB 3VG9B 1DJYA 1WAPA 2VXUL 1RUML 1DQDL 1FFNA 5I6LA 4ZSOA 2LU4A 5KS9E 4UV4L 4EPSA 4AQ1B 4Y8DC 1XSOA 1RMFH 2GJJA 1FSKC 1D5BA 4ICXA 2JWYA 1TTAA 4NAQA 4GNKB 4JFXB 1A25A 1RULH 3JSSA 5D7SL 5JDJA 3MLVL 2AXFA 5DYFA 4X5X