3VYPA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase ldtmt2-n140 adduct with meropenem
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
268
structure length
268
Chain Sequence
b'LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
publication title Crystal structure of L,D-transpeptidase LdtMt2 in complex with meropenem reveals the mechanism of carbapenem against Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.3.2.12: Peptidyltransferase.
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3vypA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vypA01
4Z7AA 5DZJA 5DVPA 2HKLA 5DCCA 3ZQDA 3TX4A 4GSQA 5DU7A 3U1PA 4JMXA 4HUCA 3TURA 4XVOA 5DZPA 4QRAA 4A1JA 4GSRA 4ZFQA 5LBGA 4A52A 4A1IA 3ZGPA 4JMNA 3ZG4A 5E1GA 3VYOA 5DC2A 5DUJA 4GSUA 4K73A 3VAEA 1ZATA 4LZHA 5K69A 4QTFA 4QRBA 1Y7MA 5D7HA 5E5LA 3U1QA 5E1IA 4QR7A 4A1KA 4HU2A 5E51A 4LPQA 5LB1A 3VYNA 3VYPA 2MTZA
chains in the Genus database with same CATH superfamily
3RB7A 3P9MB 5A3ID 3KLHD 1UEYA 1GC1H 3TN0C 2VTFA 2EYRB 3BO8B 3HUJF 3KCPB 4NFCA 4RGMB 4BKLB 5DZNA 1OCRB 2YUZA 3N5AA 5E8PB 3CFKB 4APXA 1AZNA 3PQYB 5KAQG 3SCMD 1PDKA 4XMWA 1XCQB 2CJ3A 5LO7A 4WU7B 3V4VH 1C5CL 1QRKA 1C1EH 3W9DB 1CGUA 3P2DA 3D6GA 3DX6B 3CFTA 5H94A 3RZCC 3JWNE 3MA7B 1ZLUK 3K5SA 5LB1A 5DUML 4Y4KD 1LEGA 4HCRA 1NGQL 2XRAH 1GW6A 4UDTB 5AG9A 2HTLD 5F9OL 2QL1A 1DFXA 5B7EA 3WJLA 1KTDB 2VXVL 1NPUA 1F42A 2DI8A 5EZOL 3ZTNH 3RGVB 2YJQA 4YE4L 4A38A 3FONA 4MNQA 2JKRM 2WV3A 1NJ9A 1NL0H 4Y16A 3KVDD 2X53A 5D93C 4TPRL 4U2YA 4N6QA 5D5MA 1CD9B 2BM3A 2OP4L 3I3BA 3ROLA 3WFZA 4DTGL 5KVEE 2R1XA 2A73B 3QUXA 1TZAA 1A7OH 2X12A 2YD9A 3T4AC 5KSUB 2DDQL 3RNQA 3L4UA 2WLLA 2R23A 3JZYA 3QQDB 2AQRA 1FIGL 3K6FA 2LQRA 3E8UL 3SJVD 3HZMA 3KPMA 4HS3A 2AEPH 3O6KL 3QO1B 4AG4L 5IESL 1R5IA 1I85C 3JV5A 5IHHA 1B4RA 1HK6A 1FLRH 4ZFGH 3MUZ1 4A6YA 1SY6L 4A52A 2WTRB 2W0FA 1O9VA 5HGBA 1X5IA 4NWTH 1OCZB 4RVBA 4PGEB 3HCVB 3E6FB 3MBEB 4LEOB 1JZ6A 4LPXA 2JB6B 3PQYE 1XDTT 2WLNA 1E7VA 3NJKA 2Q0ZX 3NRQA 4BCZA 3L3JA 3CQQA 1T66C 4ZUUA 4Z6AT 3ZQDA 1JOIA 2GABA 2OJZL 5DGQA 3JT0A 3QUML 3I2CL 4L2LA 1IAKA 3GZQA 4PREB 1F3DH 3IDMA 3RKPA 3V7AG 3GS7A 4AEHL 1TJIL 5DJ6A 3ZVVA 2UY6B 1BLIA 1OAJA 5LGHH 4FQXB 2GY5A 3X13B 1U8LA 2GSIA 3CFEA 1HXYB 3Q8BA 4JLRA 4AUUA 1IC1A 3K5RA 3HLKA 4LHUG 4NN5C 3RTQD 5JPNA 1SLWA 1E8WA 5H4YA 3T6VA 3MV8B 3TWCL 1RY7B 1ORQA 5C86A 1KBWA 1YAZA 1NANI 4UINH 1ND0A 2PTVA 3H3BC 4N5ED 1KGXA 2OMTA 2G30A 1ZGLM 4MA3B 1SMDA 2Y7OA 3DJSA 3IDIB 1RJLA 4RISL 1MH5B 3QFJD 2XVLA 3HG2A 4Y0GA 4NQEB 1H6EA 3RWJB 2MJWA 1S3KH 4LAQL 1HEJC 4NO5A 1BP3B 4FFZL 2CLVB 4CMHB 5A40E 4LLAA 1BQLH 4F7PA 4ONHA 2R15A 2ILLA 2BJML 3CC1A 3ESVF 4XPHL 3LIUA 1C16B 2F74A 2FT8A 4RFEB 3KPOB 2E27H 3H9HB 1CFQA 4UTAA 5GS1B 1NEUA 4FNPA 3RI5F 1JHTA 1SQ2N 4N1CA 2WZPD 5J13C 4XI5C 3C6LA 1JYXA 2DH2A 3K6NA 4OFYA 4HUCA 1WZLA 3BSHA 4GQRA 5E6YA 5FHAH 4AGMA 1OSZB 4PV9A 1T0OA 4NFBA 4BSJA 4FNUA 2NY2C 1T6WA 1MNUH 4HPYH 3WKMH 4PRPA 3KYOB 4ALAC 1LK2A 1YEFL 3A47A 4M6OL 4PGCB 2H2SD 3GXDA 4YPGA 1V10A 4ATTA 2Q10A 3MV7D 4WCYH 3U0WL 3V4UH 3P4MB 2WQXA 3HS0C 2NY0C 1AGCB 3IBEA 3BD5A 3ZY7A 2EDJA 3P4NA 3S8FB 5LBSA 1VKXA 1DUYB 2IJ0C 1UD5A 1KY7A 2AK4E 2Z0BA 4N25A 4O2CB 2WSPA 4FJYA 3UYPB 3OWEA 1DLFH 4PTUA 3SBWA 1CGSL 2PCYA 3SDXA 3G3LA 4U1KA 3OAYH 3L3KB 7PAZA 5FCUH 4PS4H 1TQBB 4ZUTA 4AYEC 4AYFB 4QO1B 4W4OC 3TT3L 3MV8E 3WIIL 4HKZA 4NC2B 1Q0YL 3U2JA 3KPPB 2CO6B 5FO8A 1A7PH 5CGYD 3TVMB 5L7XL 1WWCA 2X9ZA 1U8KB 1W0VB 1UA7A 2CK0H 4NQEE 4HZLB 4EI6A 2DY2A 1XH0A 4FYQA 1JRHL 4Y4HB 1FBIL 5GGVY 4UI2A 3UCRA 1QP1A 3AY2A 4G8GA 5DHMC 4PWHA 2QQLH 1NCDL 5E6IA 4CVXB 4UYPA 3VX1A 3PREA 3ARBB 3LPPA 4HAGA 5I24A 1SBSH 2PCPA 1S7WB 1BX2B 5GRWA 3WTWA 3ORJA 4B27A 1KGCE 3FYEB 3RDTD 1A4CA 1QLRA 4DKFL 1MREL 1WGVA 2ZYRA 4UTAH 5I1LB 1XGRA 4IM8A 3B9EA 2OTUA 1E9PB 3TJHD 2DBLL 2ENQA 2YS4A 4Q9QL 2HT4D 1QFWM 1I1FA 4NX0A 5AB9A 2XBTA 4GG6F 1U8NB 2XWBB 3L13A 4LEBA 4P46D 2WOBA 4IIQB 3QORA 3B56A 2V3DA 5BV7B 3X14A 1MIML 3HHSA 4AH2A 2NPLX 2O61A 5BZDA 2MPAH 2PPEA 3T08A 5LXGH 1LD9A 3QQNA 3EGSA 3QIWC 2NSMA 3D9AL 2OYKA 4BJLA 35C8H 1IM3A 5LBSH 2FYYA 3TZVB 2KQNA 1EJOL 1TTBA 4K8RH 3X3FL 2LLGA 2Y7QB 4WUUA 2CDFB 1KPVB 2V7NB 4JFEA 4OCXH 5IG7B 1J86A 5CIPB 4UZUA 5LGJB 4LCIL 1QSFA 2NNAB 3QJFB 3DX8B 3L8QA 5I1JL 1QI5A 1ZD6A 3LPFA 3E8VA 1IFGA 3P0GB 2G2RB 5H37G 5GGUA 4P2OB 2O5ZL 3F7VA 1L6PA 2X7LB 3FQ1A 3T6WA 5FR3A 5AVSB 4C55A 4PVMA 3E3QE 1W91A 1AOZA 5EUOA 4Z7UF 4HULB 5J1SC 1XXDC 4P9HC 2R4RL 4AEIL 3TEWA 4G1EB 2VZ1A 2EVFA 5AAMA 3CHPA 3VFPA 4M3HA 3L3HA 2QQQA 5TE7L 2X9XA 1DEEA 2CO1A 3LKSB 3MRBB 1FNLA 3EJJX 4GKSA 3MLVL 1KF9B 2HG0A 3MROA 1UA6L 1ADQA 1JFHA 3FT2A 1JRHI 2YQGA 3MYZA 2OMXB 2QQNH 2QMJA 3B6SA 3TA3A 4D9RE 4HC1H 3GZKA 5DQDL 3V6FB 1E7UA 1MELA 5F0JB 2BVPB 1K6QH 1JWUB 2D9QB 4PGBA 1V8HA 1KENH 4C8XA 4KRNA 4XWGH 3FUKA 3EO1B 5KVDE 2OV0A 1F56A 2DTSA 3H0TA 3UJJH 4BA0A 5F3BB 2DH3A 1DQJA 4EQ2A 5FB8B 3AACA 5I8KL 1KV7A 4V11A 2BWDA 2ICEC 4M48L 2J8UA 1IBFA 1JGVL 5IB1A 2E46A 3NJFA 5KZCB 5JHDB 2C1OB 3K74B 1ZANH 1ZTXH 4ZTPH 3X17A 3W39A 2XWEA 2BZCA 1N5YH 1AR2A 3WTVA 4NEHB 2EE3A 2NYKA 2KLTA 4AOFA 1Y18B 5CAYB 4TNWK 4TQ8A 2BRRL 4P2RB 1H19A 4CSPA 5JW4R 1QLEB 1INDL 1ETJA 3AFLA 4XO4A 4U1SB 1NDGB 3AUWB 3S35H 1UWYA 3I75A 1C08A 4G6ML 2A77L 3IGAB 3LKOA 2F18A 4FI8A 1LEIB 3M1OA 4Q6IB 4G59C 3BEWB 4EKXA 1OZUA 1YUHA 9CGTA 1PX8A 1Z7JA 2IG2L 4Z78B 1KNOA 3R1GH 2YQBA 4U1GB 2CIKA 5BZXA 4A7SA 1Q72L 3MRJB 5CCHE 3VQLA 5EC1B 2APXA 1BLNA 4OKDA 4ZMZA 3ILQD 4G8EA 5F7LB 1TZ8A 1AQDB 5F3FA 1K8DA 3IJHB 4XNXL 1AIFA 1TPXC 2JKNA 5AKTA 5I82A 2FWSA 4I48A 1PZCA 1JXJA 4L4VD 4WU5B 1PYWA 2QSVA 3QI9C 1X44A 4QF1B 1U8OB 3P0VH 1FGVH 4ACTA 4L2YA 2P3YA 5GSRB 4J3VA 1Z1WA 3IDNA 2CO3A 5CEYA 3CLFL 1T3FB 3TIEB 4UOJA 3P2BA 1T0MA 5JHDE 1YMHA 1LP9E 4Q4IA 3P0YH 5ISZA 5DJ8A 1GYCA 1HHGB 1X9LA 3D3VB 1NMBH 3JWDL 4JRXA 5GS3A 2OXHB 3LIZL 1DVFA 2VJ8A 3IETA 3KNBA 5IQ9B 4JQXC 3FU3A 5ESVA 1LVEA 1UCTA 4N0UA 1QHOA 2FATL 4P2RE 4Y19D 1UQSA 3GSOB 1KLGB 2EYSB 4JQIL 4K5NA 4UU9A 5F1NB 3SE4A 3WN5C 5ERWB 4OI7A 2D4FA 1P4UA 1I1AB 3SN6N 1KCLA 5D6CA 1R19A 3NFSH 1B90A 5IFAH 1NBCA 3UPCA 2VDQB 3CG8A 3L5WB 1MCWW 1I7UB 3T2PA 3JVFC 4YBHA 1EVUA 3BZ4A 3DI2B 5C7XH 5DHVA 4PY7B 3FK3A 2P8PB 4NQDB 2OXGA 2JF1A 1HWWA 2QFPA 3LS5H 4ZUVA 1NSNH 3CN3A 2Q6WA 5I66A 3LX9A 1NAKL 2OK0H 4D0BA 3ZZQA 3QQ4A 2DWEB 2L04A 3FHAA 4OF8A 3S9DB 1EJ8A 2NCEA 4PJAB 3FCUB 1OANA 4KX7A 1JMXA 5HYIA 2HG5B 4HIEB 2B20A 3I6KB 4QOKB 5SWZA 2Z9TA 5T1LA 4D9QD 4DKTA 4ZYKA 4E0RB 2WLZA 3H9SB 4A37A 3C8HA 4EN3A 3UYOD 3GSRB 3U7YH 4GMSL 4B3VA 2NY1C 1D7FA 3NZ8B 3KPLA 4KPHH 5ADPH 1F4WH 1U36A 4BUHA 2C4XA 2HT3D 3L4CA 7FABH 1QW8A 2DPKA 3F58L 2VLJB 3TBWB 2P24B 4QCIA 4IDLA 4YLBA 2HLEB 1R17A 2F8VA 3DBXB 3FTSA 5TDNA 1NL0L 1VFBB 3N1FC 1DFBH 2XQ0A 4I0PB 4DGVL 5B8CC 4PB9L 2VDRH 2WP3O 3MOQA 3PS6A 2VO8A 2EDYA 1IV8A 4HP5A 4LRIC 4QYOB 3WDHA 3D3VE 2XLLA 4Q6YA 1R24A 4YDLB 1KN4H 3DUUB 4XBGB 2JMRA 3PL6B 5E94B 1FAIL 4M8QB 1KFGA 3T71A 2NR6C 4WNQA 3B9KC 4PJFB 3GI8H 4ZAKA 3VFWA 1JD7A 3GS0A 1DANT 3P3YA 3ULUC 4P9MH 2AEPL 2PN5A 1YEWA 4FZ8H 4QPEA 5I0YA 3DOSB 4IOIB 1Z9SA 3MBWB 2B4CC 2F53B 2FWOA 1O5PA 4XRCB 5AOJA 1QA9A 5ACZB 1DBMH 1D2PA 3T8XA 2FGWH 2KI6A 5HHQA 4YDVA 2JK5B 5DHVH 1P7HL 4JG0L 1JZIA 2Y36L 1CD1B 5HVHC 3DIFA 3OR7A 1ZHLA 3NABH 4IJ3B 1M71B 1UM5H 4NQUA 1SJHB 4R6UA 3WS6C 3GMMB 1IC4H 4FHKA 2ATPB 4PJAE 4N2EA 2CU9A 1CUOA 4QOKE 1E2VA 5LWYH 3NQIA 4N28A 5DUBA 1S78C 4P2OD 4HKXB 1I8AA 3BDXA 3AU0A 3RAJH 4HCRL 2QPEB 2PXYB 3OMNB 2YXFA 5C0AB 4LVHC 1SXBA 2Q2EB 3QJZA 5IM7B 1HIMH 3ZL2A 4D9LH 5HJ3A 1YQVL 2WBJC 4BHUI 1AY1H 1BBJB 1BOGB 2AAAA 2ITDA 4XXDB 5EUKA 3VB9A 1DJZA 2XKNB 3CUPA 1ZMYA 1DL7H 1KC5L 1UVQB 3FUMA 4M3JA 3OAZK 2ATKA 4HDIB 2IAMB 3DV6A 1MKFA 3ULVD 1G0DA 5L0QB 3E9TA 4YDIH 3IXTB 1BQUA 3DGGA 3DX9B 1RP9A 1LL1A 1ZDSA 3QFDB 5CMAB 3O2VH 1CJYA 1RZQA 3K0YA 4PJFE 3O9WD 4BSWA 1LNUB 1FNSH 1S3KL 1ZPLA 4FE9A 4TYUA 4P07A 3BAKA 2P8MA 2ZUXA 3SDCC 4S1QH 2ZCZA 2AEWA 2F53E 4HOMA 2VN3A 3R7RA 3SO3C 1TVHB 4BZ1A 3W3BA 4EDXB 5IVXB 4A6YL 3NTCL 4PBDA 2P80D 2XWJB 1RPKA 3RKDC 4KFZC 5I15L 1ZTMA 2IPKA 4K15A 4LQFH 5J7CC 5GZOC 3ABKB 1A0QL 3HN5A 5KBMA 3KCWA 3LRKA 2YAPA 2OKMA 2CR0A 3V4LA 3V5DA 3DI3B 3OLIA 3MRKB 2ZKHL 1JI1A 2IV9A 4UT9A 4HPYL 3A6BH 1MNUL 4V2CB 1ROCA 2IMMA 4N0YL 3ARFA 4X7FC 3WEMA 3D25A 1CN4A 4RMWA 3ZT6A 1BG1A 1KIPA 4BK8A 2VQTA 4GG6A 4GMTH 4WCYL 1ZAGA 3V4UL 2W81C 4W70A 3QH3B 2AXGA 2DQFB 3ZT7A 1N3NA 2VQ1A 2WO2B 4H8UA 3GXNA 3P4OA 2BOBB 2WQAA 4NO0B 5KBNC 3QHTC 5MHSD 5KSBE 4KRPD 1HFUA 2VIRA 5C0AE 3ZZSA 4DO6A 4OD2B 2DQMA 3ABZA 4Z3JA 1SLXA 2KZ1B 3P73B 5DJ0B 2E7DA 4YBLC 1RXLA 4OLEA 1XMEB 3QIUD 3ZR5A 2OL3B 1E30A 1G7MB 3O6FC 4LZKA 2OTPA 5EO1A 2AJVH 3JWOC 1MLBB 1A7PL 3TN0D 1D5IH 3FB6A 4BH7B 2QPDB 3BKYL 3IPEA 4J3TA 4G9FB 1SLVA 2VZSA 4KJPC 4O4YL 2Q86B 3UPRA 3H85A 3APFA 3OC8A 2GYSA 3QAQA 3CC5A 4PGJA 1U30A 5GRJH 4WHDA 1MUJB 4LLMA 4JRFA 3MRQB 4BKSC 3T0EA 4M61A 1AZRA 3D2UB 1CF1A 3RZCD 1GL4B 2R2HB 1KB9J 1QBLL 4AQEA 1A9BA 4AK1A 4LLDB 2MH4A 1NBYB 1U8MB 4A55A 3LD8C 5FOBB 3SOBH 3EJYC 3UCQA 5KTEL 4UTAL 4MCYA 4Q0XH 3WSQH 4XPBH 5D4QA 1JERA 4KDTA 4WWPA 5L8JB 2YAFA 4Y9FA 3MRPA 4MD0B 5K93A 1OTUC 4BQ9A 5IMOB 2LU5A 5F3HB 1ZJAA 2JIXD 3U46A 4QD2E 3SKMB 1GYAA 5IJBC 1BVKA 1MJJA 3QUYA 1PU0A 4QRTA 3HE6A 3AB0C 3L1OL 1FC2D 3ETSA 3AS3A 3IXAA 5K59E 4F58H 4IRSC 5AW5B 2RR3A 2LLLA 2MPAL 3AGVA 1S7VB 2DQCL 4S1SH 1XB6A 5F7EL 3GPEA 2AKRB 35C8L 5LBSL 3VXRB 4EDWL 4DGYH 4LLVB 3MBXH 4AYID 4YEFA 4QR7A 3FO0L 4W93A 3RY6A 5FYJD 4K8RL 5DEZA 3UBXB 4IYKA 4L4TD 3ZE1B 2UZXB 1SJMA 2YD2A 5DWPA 3KVPA 5I8OH 3ARYA 1ZVNA 5E9DD 2CCLA 4MWFA 1UEMA 2HT2C 3NJXA 1U21A 2FB4H 4DP1X 4DH2A 4L05A 2ZF9A 3VXQB 2CDEB 2ZOTA 1XD1A 1TYRA 1I1CA 2WQWA 4X5PA 3HN3A 5F9AC 1O7DE 4HLEA 2VDMB 3ZIMA 4NQDD 4N68A 4MQXC 4W6YB 3A24A 3SCMA 2MFNA 5EIIG 4JY4B 4BFKA 2DM7A 3ZDXF 4CL7A 1NLBL 3O4OC 4Z7AA 4GRMA 3V2AR 4KI5D 4N2BA 4XOBA 3BUIA 5FYLL 4NUGH 4M5SA 1YECH 2XVGA 4LSQH 1MDTA 1WV7T 2NY3B 4EZKA 2Y3NA 5GJSL 3RWDA 1I8MB 3H9SD 2VLLA 4U1LB 4PH8A 3L3OA 3D33A 2IO5A 4ZUWB 1ZA3B 4X8GA 1KJMB 2E75C 4WHYH 2Q8BH 2X4OA 3IFLH 3VRLE 1AO7B 4B41A 1UM6H 4Q2ZB 1K6QL 4JHBA 3VFUA 4ZMTA 3BAXA 4TUOA 3I6LD 2HLFC 1KENL 1IE5A 4D0DB 4E41D 1U91B 2BNRB 3S2AA 1ZE3H 2EIZB 3UJJL 3VXRE 5I73B 3HAEG 4FJZA 4M03A 4HJ1A 4XNYH 4AT6A 4N22A 1W8NA 4IMLA 3HC0B 3LNIA 2CUAA 4M7KH 3MRCA 3ZE1E 4FABH 4XCEA 4ANKA 4DQOH 2F08A 4XCCH 3AUVA 4BXSV 2DEXX 2X5PA 2F7PA 4NZRL 3ARPA 1N5YL 1GJUA 1S9VA 2V5TA 2IH9A 4NN7B 4LKXB 5BZZA 4ZQTA 5J12B 5ITBH 3GSVA 2H3NB 2FTAA 3MDJA 4XBPB 2AQ2A 4QTHB 3EFOB 3P40A 4UAHA 1ZT1B 4P23B 1RZKC 1UOWA 2CKBH 5MP6L 1BAFH 1DBKL 3KVQA 3GBDA 3RL1B 5JIDA 2VYRE 2NY2D 1Z9OA 5AW2B 3UYRH 4JHWH 3S4SB 5J1TC 3S35L 1UHVA 2KBGA 5GGTA 1YYLL 1ES0B 1ODUA 4M43L 4YOKA 4QRSB 1F6AA 3SQBA 1IM9D 1BAGA 2GW5A 3QEQB 3L5XH 3AQYA 2FX8L 1SJVA 1ADQL 2F19L 3OLGA 1FIEA 3B9AA 3VH8G 1UB5B 3OHXC 3PXLA 5KYXA 5FA4A 3VSTA 4F8OA 4DKDC 1FLTX 1EX0A 4N2NA 3W11D 1AHWB 1AO7E 5C3IA 1S7SB 4F9LC 3Q48A 2P26A 1E9OB 3RTQA 5JQHC 2H2PC 5E1HB 5FUCC 4KHTH 2XKUA 4AQ1C 4Z8FH 1N0XL 3GHEL 1SVBA 1FC1A 3E2HC 2WNGA 5DS1A 3IU4H 3FSWA 1GKOA 4JVUA 3QFJA 2DQHL 3QCVH 4QRFA 4KTDH 4DF9A 4RAVA 4Z7OB 4MJ4A 1NCTA 3P4LA 4NKOB 5F6IC 4WKZA 3UZVB 2YLKA 2IPTL 2X3CA 3PAZA 5EBMA 3T2NH 3IFNH 5A2JH 4OF6A 5EZPA 4KJWD 1N8ZA 5E56A 3GYRA 4TVPD 2NUTA 1BIIA 1NEZA 4RETB 2BNQA 2QGEA 1I7TA 4Z23A 5L9DL 2V17H 1NMBL 3ZYZA 2OYLA 2FAUA 4HBCH 2BVOB 4NDMB 2NXYB 1EAPB 1BZ9B 2G3NA 4P3DA 3H54A 4U3SA 2VM9A 4JZJB 3S98A 3HNSH 4MJ6A 3V0DA 4EJ1C 4ZMPA 1VA9A 4G6KH 1IGIL 2DB8A 4K3DH 1T5XA 4CVWA 4QRPE 1J18A 4HOXA 4OD1L 2OZ4A 4NQCA 1DO6A 2X4SB 2XVKA 3BQUD 4JFPA 3QEQE 1G9MH 4B7LA 2P7TB 4O02B 4M8UA 3MRRA 3QIWD 2ED9A 3ATAA 3D09A 4ORGA 4JL2A 1BPVA 3LS5L 4NQXA 5AUMA 43C9B 5MI0B 4PSPA 2ZX8A 2OK0L 2DQTH 3U6XA 2FH6A 3K8MA 1E5CA 1VGEH 3WOVA 2KZBA 5IW1B 4B50A 5DR5H 4AC4A 2QPFA 3MNVA 3UP1A 3FULA 1BFVL 4AJVA 3WAJA 4R4BA 3MRDB 4HJGA 1U41A 1UOLA 2VRKA 4FULA 1FV1B 5K9JL 3QIBB 5MENB 4KK9D 5JIPA 1GVIA 4F24A 4OW6A 1JVKA 4PRAA 2XXMB 3MCLL 1S7TA 3TIDA 4F2FA 2C9PA 2E7CA 1OOWA 1S7UA 1KB5B 1F4WL 1SJEB 4Z7OE 3HI1B 2L0DA 7FABL 5DF0A 3CDGB 4XHQA 2O5NA 1G1YA 1ANUA 3KLAA 2WWKO 2WC7A 5AW9B 4FNQA 3RVWC 3ZKXB 1KTLA 4M4RB 3MLZH 2P45B 4N0FA 3V5KA 1J0HA 1KYDA 3EJZC 4XAWH 1XHHA 1MRCL 2UX7A 2X89A 1RJZB 5AWNL 2G2NA 1FPTH 2Q3AA 4MA7H 4PRHB 4GLRH 1MAML 1U3HD 4ZOEA 3VFTA 2Y1VA 2F58L 3ISYA 3KWTA 3ZQWA 3PDOA 5KVGE 4DAGL 3DDGA 4KVCL 2ICES 5B4MC 3H6AA 5IB2B 4FQ2L 4NZUH 4ZO8A 4EAEA 4P5KA 1LP9F 1USZA 3F65A 5JDSA 3WEBA 5I1IL 2VB5A 1DBML 4M1GH 1QKZL 5KSVA 3RY5A 2JJWA 5MEPB 1MCIA 3FH7A 3X12A 2H6PB 4K7FB 1S5HB 5T1MA 2BSTA 2DI9A 1ZLWH 1MF2H 2MHAA 1IFHH 4JO5A 4ZO9A 2X4UB 5LAPA 1K4CB 3DUHA 5T33H 4LSRH 2Y24A 3ZJAA 4A2DA 2YA2A 4L5FH 1J5CA 5IOKA 1CLVA 3F5WB 4IU2A 5E2WH 12E8H 3TNMB 5LWYL 1PQZB 3C6EA 1TF4A 3DPDA 5MENE 4X7TB 4M6NH 4KXZI 3P9MA 1J48A 3ARGC 3N2JA 2J5LB 4J28A 4NT6B 4UB0H 4DN3L 3ZTCC 4P2QD 3BO8A 4CBZA 3KCPA 4BKLA 2WGNB 4J6RL 4KQ3H 1FZKB 1TMQA 1TOXA 4IHOB 2P4AB 1HIML 2VW6A 3CFKA 4FA6A 5F9WC 3PQYA 5DMIH 1OB1B 3KYKL 5DFVD 3EADA 1QWUA 1XCQA 2B39A 4KZCA 4WU7A 3GLAA 3HC4H 3W9DA 1GMIA 4JM2B 1FZJB 4LVNC 5A16B 3UC2A 3MA7A 4PRNB 5DEGB 4PJXB 2ZONA 2YGPA 3CFQA 3MRLB 4M1DH 1ZV5A 1TYEB 3AY4C 4PRHE 3WFEL 4WJG3 3O2VL 4UDTA 4I77H 1IGYB 1MCKA 4MRCA 2WVVB 3VD3A 1QBBA 1N64H 1F3JB 4RRPA 3F7RA 3RGVA 1MCHA 2XWRA 1GPOL 3FQRB 1DVUA 3ZIYA 4DO5A 2J1ZA 3T6ZA 3FN0H 3OXRB 2VXQH 3UOAB 1CYXA 2Z4QB 4OT1L 2A73A 1QFPA 2ZXEB 3C6SA 4ILDA 5E0QA 3ZBMA 3KH3A 2CRYA 1JFQL 1JPSL 5KSUA 1FI8C 4XBEH 2MNJB 1R3IH 2EDOA 4L3EB 1U8CA 3QQDA 2APWA 4NHUB 1EDYA 1JHKH 4E36A 5LDSA 4LOUD 5FYKU 5LGYA 4KH9A 4AGPA 2DL9A 1ZHNB 1SEBB 4NZJA 3KPQB 4GMTL 4CMMA 4XNMB 3GBNH 3MC0A 5F7KC 1XIWC 2WAQA 3WDJA 3VNYA 3NA9H 2HFFB 2WTRA 3J8F7 2WMPB 2IQAB 5T3ZE 1TT6A 4UM8B 1AS8A 5FHBL 4PGEA 3HCVA 3E6FA 2IQ9H 2ZAGA 3MBEA 4NJ9H 4LEOA 4NPYA 2CSPA 2JB6A 1SN0A 4LFHG 3LPGA 4YQXL 2VC2B 3L08A 4LQ1A 3ZHNA 1U8QB 1RK1A 3ATDA 4NC1E 3BSZA 4W6XB 2VERN 1BVNP 2HN7B 3SE8H 1GIGL 4PREA 1XXFC 4ZRGA 2CGRH 1K85A 1D5IL 3MLYH 5IFJB 5IGXL 4XCYB 2VDLB 2UY6A 1EEYB 1AS6A 4H8VA 2IPUK 2BOLA 1D6EB 5ALBH 2BY0A 3X13A 1EEQA 2BNUB 2C9QA 5L2KB 1HXYA 1EZLA 5DFWH 5EN2B 1HHHA 3ASOB 3GDBA 3ZX1A 5FXCH 4M5YH 5DJYA 1KCSH 1NWOA 1RV6X 2FSEB 4I9WD 4KUZL 1H3TA 5D2NB 1J12A 4BZ1L 5CWSB 4FAAB 2QBWA 4L4VA 1M6UA 1Z9NA 4TRPH 4PJCB 5DURD 3W56A 4Q0XL 4HLZH 2NY1D 3BKCH 4MA3A 4XPBL 5CINL 1GXEA 3IDIA 1XWVA 4GP4B 4KHXH 4WNJA 4D7BA 4X4KA 3SDAD 4M7ZC 4L3EE 5J6GB 4JMXA 1YSOA 4NQEA 1I8IA 3RX8A 4JPWH 4Y8AA 5HDWA 3RWJA 4B9CA 2P5WD 4OFPA 4UT9L 5A2FA 3NCMA 2CLVA 3VCLB 5IKCA 4ISVB 3R4DA 2RGSA 4Z3TA 4FQJL 4MDRA 1IJNA 4F58L 2B14A 2X2HA 2Q7NA 3G5YA 1C16A 2HPOA 3QZWB 4RFEA 2X2JA 3KPOA 4KROD 3H9HA 3V0HA 4ZSOB 4S1SL 4L29B 5T5NG 5GS1A 2NR6D 3PFUA 4IOFC 1MW0A 1OSEA 3B9KD 4DGYL 1DLHA 5EEWA 2CG9X 4N6RB 4Y19A 3ULUD 4P57A 3RWEB 1D5ZA 4XHJD 1HNFA 3U36B 4OU3A 1AE6H 2YRLA 4MB3A 5I8OL 5EOQH 4QHLB 3KYOA 4PGCA 3BWUC 3GJFB 3MLWH 3OLDA 4DO4A 2FB4L 3BSZH 4OCWH 3L6FB 3P4MA 2CHZA 4YUEH 1JUFA 3S7GA 2DJMA 5KSBF 2DTML 4JHZA 3QFGA 1JZ3A 2CDGB 1DUYA 5C7ZA 3VWKB 4FMKA 3ZO9A 3UYPA 2ID5A 4O2CA 3IN0A 5L2KE 1FZMB 1Y6NR 1BMGA 2PYFB 2ZQKA 1CL7L 3DO7B 3QW9A 5D2NE 2N7SA 1GJIA 1NUNB 2YD7A 1NDTA 4AYFA 4QO1A 3FQTB 1AOHA 4PBXA 4PJCE 5E99H 5KOVC 3WY4A 3VGAB 4A2GA 3TVMA 2AERT 1BDYA 1U8KA 5TD4A 3QHZL 4HUXB 4ODXB 5ETUB 4OZFB 1W0VA 3H2WA 4B53A 4HZLA 5ALCH 4LT7A 4Y4HA 4GP5B 2BSDA 1ZK5A 1BGXH 4HAFA 3DSNB 4CVXA 3DX2A 3N44F 2VKWA 1DDHB 1YLBB 1BZ8A 1S7WA 5DVMA 4FG0A 3TYFB 5BNXD 1F6LL 1DVXA 2XDHA 4G7YL 2QADC 5DTFB 4WW2B 5HYSG 5CGMA 1TTCA 2LFEA 2DMGA 1I8LA 1RUKH 3QUZB 4RGND 5I1LA 1EK3A 1QYGH 4KKNA 4BH8A 1CGXA 5DDHB 1CLOL 3ZL1A 1E9PA 3ABLB 4FABL 5IT2H 2MEJB 1A6WH 3OXSB 1JZJA 3MOAH 1U8NA 2XWBA 4EO5A 4PJ7B 1A4KB 2UX6A 4HHGA 3LXUX 4IIQA 4XO9A 1J11A 32C2B 3GMNB 5I1EH 4CNIB 3RKDD 4N1HB 5ITBL 4APQD 2WLYA 4UZGA 4G6JH 1DSFL 2Y23A 5GZOD 4KOBA 5CZKA 3ZKQD 3ZYOA 4ODSH 4PCSA 2ZP8A 2J57A 3IJSB 3W2DL 3TZVA 4DGIL 4I4WB 4MZRA 3RI5K 4K5MA 2F5BH 5FO7A 2P42B 3IJYB 2Y7QA 1GYWA 2CDFA 1Q94B 1KPVA 2V7NA 4QTIL 5CIPA 5IVZB 2EVJA 1TETH 2V8LA 2VM4A 2WCPA 4NP4L 5LGJA 2K7PA 3QQ3B 2V7HB 4JPIA 4AKPA 2G2RA 3KG5A 3WG7B 4P2OA 4EQ3A 4IBQA 3CX5K 1GGCL 2IF7A 2X7LA 2LTQB 3MNDA 3SQOL 2QVFB 1CL7I 4ZDHB 4AYSA 5GZNC 1MAKA 3EDEA 3SPHA 2CBPA 2M83A 3WTUA 1ZHKB 1UZ6F 2WNKA 4G1EA 4N2LA 3O6FD 4HD9A 1U93B 4Z8FL 1F8TL 1OGAD 1RZ7H 3LKSA 3MRBA 2MQ3A 3GMOB 4FA8A 2WQUA 2OW6A 2DS4A 3QT2A 2NMSA 3BVDB 4KTDL 1MIEH 1QHPA 2AJ3B 2BWQA 2OMXA 3F6IA 3GT6A 3VRLF 3IFOB 3VVWA 4OLYH 1LK3H 3RDJA 2O93L 3V6FA 1F00I 1ERNA 1IILE 2BVPA 4N2AA 4PJ7E 4AC2A 3PHOB 4LNRB 3T2OA 1F4YH 3H7BB 2V17L 4H25B 2P80A 2FZ3B 3EJYD 1IEAB 1O0VA 3IMWA 4YHMH 5FF6B 3RE0A 3RTLA 3D4YA 2EO1A 25C8H 3QCTL 4PY8I 4TXVB 4R7XA 1Y7VA 3US0A 2YD3A 1UWGH 1T1WB 2K6YA 3ZE1F 5KYNA 1OTUD 2ZCHH 4G6KL 5JZ7C 1HQRB 4K5PA 5D71L 3NCBB 2OSLB 4LLYA 2OMBA 5GGTL 5KUKA 3HRZC 1MCNA 3C12A 3GIVB 4PCYA 5JHDA 1T83C 2C1OA 4F3FB 4CUCA 4YDNA 1G9ML 2G0KA 4A7UA 3FT3B 1A8JH 2DIJA 5A2KH 1QFUL 1FJ1B 5CCGE 3UAFA 1NCUA 2AC0A 3PXJA 1PEWA 2BZ7A 4P2RA 4M5TA 4KXDA 4S0SD 4B9GA 5D70H 1VGEL 1YYML 4HPOH 3ARWA 4FNLH 2HT2D 2MTAA 4U1SA 3MNWA 1M2VB 1NDGA 1RJYB 5GPRA 4AQ8C 4LVEA 2GJ6B 2VLME 3IGAA 4UIMB 3FU5A 1LEIA 3W37A 1C7SA 2Y6TE 4XN9A 1HZHL 4KMTH 4Q6IA 5E2VL 2YWYA 3V0GA 3ULVH 1X5HA 5F1KC 3HW7A 2KUTA 5KANI 5LHDA 4POZC 4AVJA 4J3UA 3WBDA 3G08B 1KIUB 2NQ3A 1IBHA 4Z78A 1ULVA 4V2BA 1H6FA 3MRJA 1J0ZA 4LLQB 5EOCJ 4HJJL 5EC1A 3OJVC 2QEJA 1BWWA 3JWNG 4WHTB 5BQ7B 5GRVL 1AQDA 3IJHA 3MLZL 2A9BA 3UGXA 2F54D 4Z7WB 2P49B 1FG2B 2K8MA 1MQKH 2DQGH 3J2PA 2Q7YB 3CH8A 4WU5A 4K71B 1FPTL 5I0ZA 3DIVA 4QF1A 1U8OA 1NQBA 4DP0X 1Q0EA 3X1FA 4YK4C 3NH7H 4M62H 1YZZA 5GSRA 3CFBB 2RJMA 1KULA 3V0IA 2F0CA 4NZUL 2BHFA 4HIIB 4N90E 4OFDA 1T3FA 3TIEA 2HVBA 2Z31C 3FUEA 3VB8A 4RX4D 3NYKA 1OP3K 2VOTA 4JCMA 2HLFD 2OZ4L 4M1GL 2D7PA 1TQTA 5HBBA 4FXGC 2NW2B 1A9EA 2X2YA 3DWTA 5AAWA 4GOSA 2OXHA 1QPXA 2FQGA 3D39D 5AD0B 4PJ8B 1H8OA 2G3ZA 2CLRA 4PVNA 3UG5A 4BZ2A 1BVLB 1QAWA 2AAVA 3FBKA 5AFAA 3FB8B 5F1NA 3GSOA 1KLGA 2AK1H 2EYSA 4LSRL 4NJAH 1WT5C 2CMRH 3ZR6A 2A6IA 2N56A 4WFGE 5T1KD 2LW3A 2XYBA 3FUIA 3LS4L 5DUJA 1I1AA 1P7BA 3EO9H 4CJ1A 4R7DB 2GJ6E 5E2WL 4EI5A 1I7UA 1OPGH 1WZ1H 3MXWH 4M6NL 4MAYB 5DMJB 1NMAH 2LOEA 1UKSA 1OARH 5EZJA 4PY7A 5I6LA 4NQDA 3AWEA 3MLUH 2IAND 3FQ2A 3VWKD 4DGWC 1JE6A 1KIQB 2VW7A 3LH2L 1RUQH 2X0WA 5D72H 4QLWA 4N2CA 4QRAA 3F7PC 4H8WL 2B1AL 2WBWB 1CICB 4PJAA 4XXCC 5CGBA 4YX2H 4PYGA 3UPAA 3APMA 4HIEA 1YEIH 3I6KA 1UADC 4QOKA 3KJ6H 1BJ8A 1UWFA 4M1DL 1KYAA 4P3CL 1RULL 3H9SA 1QZ1A 2EIEA 3N04A 4Z7OF 2XOTA 3VGFA 4I77L 3NZ8A 2O6EA 2ORBH 4U6YB 3BUTA 3QJVB 1NWPA 2A9ML 4J3OG 1JK8B 1N64L 3WUWB 2VLJA 3H53A 4GXUN 3RRQA 2I07B 4HISA 4U33A 2P24A 2NY6B 3TBWA 3U4AA 2CR6A 3FMGH 1JZ4A 2EZ0C 3U9WA 1JXDA 1ADWA 1S9WB 2WLJA 4X4XB 3PNRB 5TE6H 1VEOA 1H3XA 4PMEA 4BELD 4Z7QB 1CZ8H 3TEYA 2GBAA 2QQKL 3DUUA 2H1XA 2BSSA 2EABA 3D4CA 3PL6A 4XBGA 5E94A 3VM5A 4JCLA 3A67H 1JL8A 3VDAA 4H5SA 3MOBH 4PJFA 3NA4A 4LL1A 1YNKH 5FYJH 3SD5A 4LOFA 5LVEA 2LT9A 2R4SL 4OGXH 2E0PA 3DOSA 1P1VA 5EZLB 2WXJA 4DP2X 2E9GA 1RD6A 2NNCA 4PG2A 4XRCA 4D9QE 3T0VA 3EUUA 5B3SB 5ACZA 2H8PB 2X88A 3S0PA 2PP7A 4YZFE 2HFEB 3NA9L 4OLUL 4EXKA 5KBDA 3WO4C 2JK5A 1AP2B 4ZQKB 1UURA 2O72A 1AMXA 4ZO6A 3UADA 1WDAA 1CD1A 4L8CA 4HIHA 3VI4A 4PRBB 3VE0B 2C9SA 2IQ9L 2EXSA 2ZOKB 2G4EA 2K9FB 1M71A 1SJHA 4TSAH 1F4AA 3N91A 3ABGA 3GMMA 3JTTA 1OVZA 1YEGH 1WZKA 4KNTA 4N9GB 3FPXA 4G72B 3O8XC 3E80A 3O41B 1KGWA 2J56A 4KKLC 5IUCA 1MFAL 3HBZA 3MLYL 4MXQC 2DIAA 1NH6A 5ID1B 5CD5D 2X70B 2DBJA 3O45B 2PXYA 4ELDA 5ALBL 2R27A 1CF8L 5C0AA 4BFNA 5E7FA 4FDWA 5IM7A 1I7RB 5ESQA 1JF5A 3CLEH 2ALWA 4R2GB 5J0BA 3OX8B 3CZEA 5JXAL 2C3XA 1BBJA 1BOGA 1CMOA 1R0AH 1BW8A 4JPSA 5HHMB 1UVQA 1N9PA 1WTGT 4HDIA 2IAMA 4G9DB 4TRPL 5LN8A 1MVUA 5DJZA 2ZXQA 4ZXBB 3FFCD 3IXTA 2PYED 3K4AA 3DHUA 2VUYA 3QFDA 3DX9A 5CMAA 5E1QA 3TO4D 5JW4M 1M1SA 2K4WA 4PYHA 4E9SA 1LQSR 4HUNB 4BUGA 3OMIB 4JPWL 4TLKA 4OV6F 4DGUA 2HKFH 3NZHL 4YDMA 3RVWD 3AREC 1P6FA 2VR7A 4OCSL 5ELIA 1W0WB 4PR5A 3J07A 5GRVK 3SBRA 5J06A 3U4EA 2BS8A 1TVHA 3KM2A 4J3OC 4EDXA 5IVXA 1X9UA 1MG2C 2NQCA 2XWJA 1P7QD 2R0WH 4TL4A 2DLEA 5D1ZD 5DLMH 2WZ0A 5GGRB 4GAJL 5FLUA 1ZS8B 1LWJA 2YPLD 4XMPH 4AMKL 3HKZA 2WJ5A 3D69B 4J1UB 3DK2A 3NCFB 2GK0B 5AZEH 2ZUUA 1ZXQA 5FKAA 1AE6L 4C59B 1BV8A 2YD1A 4QHNB 3FQUB 4H1LA 2MCG1 3JVGA 3RNKB 2B8OT 3BSZL 1OE1A 1NOFA 3M8OL 4HGKC 2X1XR 4LB8A 4YUEL 3NPSC 3T65B 2CQVA 3QH3A 4TNGA 2DQFA 3BYTA 3D50A 1OAKH 3PP3H 2X1PA 3QRGH 1GGTA 1MCOH 1UENA 2CA3A 4IMKC 3QJHA 3U0PB 2BOBA 4PJBB 2DYPD 2F1AA 4OAWB 1KELH 4F9PC 4OD2A 2MPVA 2WIMA 4PWFA 1IQWH 2N7AA 5DJ0A 3P73A 5HJDA 4JM2F 1SRDA 4WUKH 1A3LH 3LVEA 4FI7A 4QUOA 2TSBA 3WIHH 1G7MA 4F33B 1VIWA 5F7AA 2C9AA 5IMMB 5IQOA 2I85A 1CE1L 1MLBA 2Q1EA 3ARGD 5E99L 4A66A 2YZ1A 1BF5A 1PSKL 2G3MA 1SNRA 4BH7A 1TJHH 4G9FA 4KJYB 3FDWA 4Q9RH 4FQIL 4XMVA 4CSZA 3FRUB 3GMLB 1AANA 3VTTA 2NOYA 1MUJA 3JSSA 5IW6B 1BGXL 3UFIA 5HHVH 3MRQA 5ES4B 1VGKB 2GJPA 4TVPH 3L3IB 3NEXA 3D2UA 5CSZB 2D3JA 2R2HA 3PWPD 1KGYE 1YN7B 4LLDA 4GUCA 1DR9A 1NBYA 1U8MA 1Y07A 1T2XA 4YLQT 5FOBA 5IBTH 2DLTA 3T4AB 4UM9B 5JA9A 1AR1C 1QLFB 4J2QA 2VMDA 4GSUA 1U3HA 1QYGL 2JCCB 4YC2B 4YHYB 3MAWA 3OF6D 3KWUA 1PNCA 3C60D 1EUTA 2G9KA 4MB5A 2I26N 5IT2L 1BBDH 1A6WL 1N70A 5IMOA 1ZIBA 3MOAL 4NKDB 5F3HA 3DJRA 2O1AA 2CBTA 3SKMA 4R4NC 4H1LH 1KYOJ 3MXVH 3PFQA 4ETQB 4YS4A 5I1EL 4NO2B 3IGFA 4RNRB 3JWDC 5HHOB 4TULL 4U3CA 4G6JL 1HKLL 1JNNH 3EYFB 1S7VA 3HFMH 5EBGA 3CXDH 1KY6A 1BZEA 1COBA 2AKRA 4PJ8D 3C5JB 3VXRA 4LLVA 4LPCA 4PJBE 3WENA 1KZQA 2MOVA 3UBXA 2F5BL 2G75B 3WFHB 3UEZA 4R7LA 4K3JL 4PAZA 4XCNB 15C8H 1MVFA 4C4KO 3HTLX 3IRCA 3DVNB 1UD2A 3FSZA 1UCBH 3A4AA 3C2SA 4RFNC 1A4BA 3DLQR 2WKOF 5DZJA 5EO0A 4ZK8A 2YD0A 1B9ZA 2CDEA 1RIVH 1GC1C 5CF3A 3DDFA 5HDQL 2CHXA 2FNBA 4IHBA 3U82B 4LSVH 4P2QA 2DL2A 1KFAL 2DMKA 5LQBH 3QHFH 4CU6A 1HWHB 2ZNXA 3QPKA 1OAQL 4P9HH 4NN5B 1T5WB 4NQQA 3L7FA 4R4FL 3G6DL 3BZEB 4YXKH 4FQLL 5D8JL 4HJ0D 5FIEA 1TNNA 4EIUA 1SXCA 1E5ZA 4P4KD 3I74A 3WNOA 4PLOB 2P5PA 1PKOA 1V7NH 4U3HA 4V1DB 4LLUB 1MIEL 3DK0A 4U1LA 5I1KH 2JCCE 3R06B 3LH8A 3NIDF 2AMGA 4RBPH 5C8JB 2YN5A 4NKMB 4ZUWA 4OLYL 1A6UH 1EO7A 5ICYB 2GCYB 4AE0A 1AO7A 1KBKA 3NCEB 1RPUA 4Q2ZA 4OKVB 2A2QT 1EJ6A 2H32B 2NY6D 3SPVB 1OHQA 1ACYH 5BV7L 3GSUB 2QKIA 1A66A 5HHOE 4K2UL 4YSRA 1IU1A 1F90L 5J13B 5DGRA 3TYGL 4D0DA 3KEHA 1U91A 2BNRA 3T2LA 5FECB 1HQ4B 2EIZA 3G6AA 3TFKD 2YBGA 4Y5VC 3D34A 2WZ5A 4LIQE 4ZZFA 3IS0X 2ZCHL 4OIIH 2HRPH 3HC0A 4DKEH 4JFWA 2UWEB 4NXSA 4UV4H 4PWKA 1G0XA 1Q9WA 3QDGD 3TBTB 1X5KA 2NY0B 3K1KC 5CP3A 4LFHD 2X9YA 4WQOA 4KKBC 4KX8A 4XMTA 5I6NA 3IGKA 4WGWB 4LKXA 4JKWA 1M53A 4IOFD 2H3NA 4XBPA 3L95A 2F7IA 3EH4B 1QBMH 3IWUA 1PBYA 2ESVB 1YPZE 1K8IB 1PLBA 2HTKD 2DM4A 3SKOB 2VDMH 4O58H 2Y7SA 2VN7A 3RL1A 3TXAA 4I1PA 3ILEA 4HPOL 1LYQA 4FNLL 4QY8B 3TF4A 3S4SA 4JGJA 4N4YB 1X4XA 1EMTH 3QZPA 1ES0A 3EH1A 4QRSA 4HK3J 1DQLH 3ULVL 3QEQA 4HAKA 3LQAH 4F7TB 4NGHH 3HE7B 4V1DE 4NYLA 3MV9B 2XV3A 2OX5B 4QXVA 2DLGA 3WJLC 4FYTA 4UAOB 4YXLL 3VYNA 2WXPA 4Z5RB 3SDYH 3F6LA 1A3RH 1AHWA 5L4FA 3OKNB 1BQ5A 4Y2LA 3HI6L 2NY7H 1LO3L 4LHUB 1MQKL 5HHMD 4KZEL 2HVKB 4QNPF 3QWNA 4WW2F 3QWRD 5CFAA 1CFSA 3MUJA 1LO5B 2QSCL 3WFCH 4JJ5B 2EDBA 4UNIA 3P3UA 4PJIE 4RWYH 3N85H 3UZQB 2XBZA 1CGTA 3WLBB 2YEQA 3EGXA 3LCYA 4HSQA 4NKOA 2P5WA 4O51B 5EMYA 3UZVA 4AXWB 2UWEE 3EIFA 5B3NA 2W1NA 4K7PL 1FL3B 1YJDL 3MI6A 2DJUA 3JZ7A 2ZX6A 1F0LA 5ADOH 4LARL 1HXKA 2LLNA 5DU7A 2WW8A 1WIPA 2YMXL 5JORB 1XSKA 4XP1H 1SYVB 3ZQ9A 2BVOA 4NDMA 1WWWX 2ESVE 2ICWJ 1EAPA 2BFVL 1UXWA 4OJYA 2GI7A 4JZJA 1J8HD 3CFIC 3GC3A 5CXPA 4PWJA 3OKEB 4ANWA 3KBHE 3N3EA 4Z9KB 2YAHA 4MS6A 1QLEL 4X9BA 2BY3A 2Z92B 1YYCA 3T04D 3L4TA 1TTRA 3OKOA 5IBUG 3TOPA 3OV6A 5FYKD 3LKQB 1MLCB 2X4SA 1BQHG 3D2TA 1J8RA 2XICA 1MCJA 2P7TA 3X1NA 5IHWA 4O02A 1OARL 4KH2A 1VACB 3NRFA 43C9A 3MV9E 4N0RA 2JQMA 3E0GA 3QC5X 4KK6C 5I6XC 3F01A 3WUZA 2NNRA 3TPUA 1XCWA 2CRZA 5IW1A 1C5BH 3EKCA 5SV3A 4EKJA 3TGXA 1N6QL 1P4IL 2DQEH 4KTEH 3U1QA 1GY2A 1YEIL 1T0PB 2YXMA 4GBXC 3CH1A 1FV1A 1RIHL 3B5HA 3QIBA 4FEIA 2ZWKA 5IQMA 1SQMA 3WTTA 5IUSA 2IBBA 3OGCB 4F8PA 5J9PB 1U8JB 4IGBB 1KB5A 4YNYB 1XF5B 2ORBL 5FUOL 1USQA 3HI1A 2YKLL 3WXWH 1A5FH 2N0MA 5ACLA 1KPUB 1CXFA 1QEXA 1U95B 4MA1C 4U0RC 5I23A 2J1WA 4QGTA 5F0LB 4M4RA 3MRHB 1KCRH 5TE6L 5FLVA 3GS4A 3RVUC 1H8NA 4UM9D 5C7XL 2VDPB 1RJZA 3NSYA 3KPNA 4PRHA 3OPUA 4OJFL 4JCWA 5DJXB 4Z95L 4BZ2L 2HP4A 3MLTB 2FHFA 2ICEB 4AV4A 3ULUH 1DVZA 1TQSA 1U33A 4Q74A 2RBLA 1MDAA 2NY4C 4IKNA 2FJHB 3KYAA 3D08A 3BFQG 4IK6A 4NKIH 5IB2A 5JQ6H 1NOLA 2P52A 2VDQL 2GY7B 2E8YA 4BWWA 2X3BA 3KXFB 3GRBA 4M7LL 5CS7A 5GXBB 1J5DA 3COOA 4Y2OB 5MEPA 3SEPA 4K7FA 5LXVA 3VXUB 1S5HA 3ENEA 4KNUA 4K8RC 2PWEA 3MLRL 2X4UA 3B2MA 2E7HA 1K4CA 4OM0L 3SBWC 4TSAL 1MFBL 1JPST 3KL0A 2BXYA 1MCPH 4OCYH 1AJ7H 3WTYA 2O5YL 4WGVB 1OL0A 3F5WA 2WXQA 5T1DL 1IMHC 3FTGB 4JVWA 4JO1L 2YRZA 1KXVC 3LHPL 1PQZA 5DJAB 3CBKB 2XN9D 2Y07L 1F13A 4J4PA 4DK5A 4MTMA 2ZX7A 4XGZB 3WHE1 4N26A 2CO7B 5EFIA 1FZKA 2FX9L 4RMSA 3CK0L 4IHOA 5GQBA 1TTFA 3JTBA 3RWCB 5JYMA 2R2EB 1OB1A 3MCYA 4K5OA 1AGBB 2ZCLL 1QBAA 4XE0A 2JJTA 5E6IC 1C5DA 4FZEL 2VDKH 1YMMB 2XA8L 1FGNH 3QI9B 2P5ED 1FZJA 4U6HA 1QWHA 4DN4H 5A16A 3HB3B 4PRNA 5DEGA 4PJXA 2XQBH 5ICUA 4AUJA 1GZQB 3IYLW 3GTVA 4WO4C 1WFNA 2JV6A 2HKFL 1IGYA 2IH1A 1RHHB 3P30H 4O9HH 3UDWA 2WVVA 1CFVL 2X4RB 3D12B 4JKKA 3L5HA 3L4ZA 3QORC 3H3PH 4X9HA 1F3JA 1KB9K 4NSKB 5JHAA 2CLZB 4GEIA 2WBXA 2VE6B 3FQRA 4HMCA 3ZRCC 3QWOB 4OFVA 5JOPE 5CGTA 3FU8A 5C07D 1ACXA 3IPBA 2Z4QA 3NCJL 4XMPL 4PW3A 5GRYA 5AZEL 3VXUE 4F7MB 4OD3L 4LDEB 3NESA 1CDHA 4L3EA 1TITA 4NHUA 1MY7A 1LXMA 4GSXA 2Z31D 5E1AA 1UXLA 2RQ8A 1SEBA 1BJ1J 1SM3H 4YZFF 4HFWB 1AXSB 1RUAH 1TJMA 1DO5A 2Z35B 1R4XA 2HFFA 4OUOA 2WMPA 2IQAA 4U6TA 4KAQL 5DQJB 4B60A 2BOCB 4UM8A 1V27A 1SMAA 3P9LB 1KELL 2PTTB 1OSYA 2CUMA 1IQWL 1I1YB 3AT8A 3FTYA 4GIAA 1L9RA 4LCWB 3ROOA 4OBRA 2D31B 1F1GA 5G4NA 5AAMC 4PJDE 1U8QA 4PPTA 4WUKL 1A3LL 3S5LG 1KDIA 5E8EB 1YMME 3D06A 4BK5A 2HN7A 4QRUB 1FL5B 2NX5D 2COQA 2WKOA 2GTWB 3QULB 4GFXA 3C5ZB 1TJHL 2NY5H 1PZAA 3LPOA 3E6HB 1OHZA 1EEYA 4OM1H 1D6EA 4EI5D 1BEYL 3TA3C 4CRPA 1FN4B 1PKQB 1RHFA 5I74C 2BNUA 3BDYH 3BD3A 2DM2A 2ZXWB 4MQTB 5EN2A 1UGKA 4S1DC 2F9BT 1QRND 1MCEA 3RFRA 5B8CB 1OF2B 1XR8A 4JHAL 1VFAB 4FQHB 3W82A 2ETWA 1U2CA 1NMCC 2ZZUT 4QXUH 1HYSC 5CWSA 1ZRUA 1WFTA 3MUUA 4PJCA 4HEPG 3I9PA 5DEJA 1RAMA 1CD8A 2ZG2A 1NKRA 4HX1B 4G3YH 5D1QB 4LRNH 1CTNA 5J6GA 2I24N 5J6HB 1BBDL 3II3A 2VDNH 1XD0A 1S5IL 4V33A 1EFXB 4BQ8A 1D9KD 1JGDB 1AKJB 2QSTA 3GKWH 4RX4A 4ISVA 4NNPH 4HIXH 4XX1E 1AYOA 1K3IA 1JDCA 2RQEA 1M7DB 3PGCB 5BZWB 4MB1A 1GW0A 4D2NA 1JGEB 2FX7L 1YN6B 3L16A 2WBKA 3QZWA 5HI4C 1JNNL 2L7UA 3HFML 1VZHA 3GPSA 2C3VB 2Z7ZA 5IREA 4ZSOA 4NPKA 1X9RA 4BSVB 4DERA 2K1MA 4AVIA 3CU1A 2KQMA 3MYJB 4JPKH 4N6RA 1Q1PA 3RWEA 4PGDB 1VPOH 1JMZA 2OFQA 4YHLH 2NZ9D 4JG5A 3U36A 3V6OA 3MX0B 5EN3A 3GTTA 4LCWE 5BMFL 1UCBL 2ZAIA 4QHLA 1OO2A 4GW5B 4IIZA 4XN7A 2NYYC 3HEIB 2Z7WA 4BFRA 1H9VA 2K6WA 3QPQD 3L6FA 3NBNA 4ODVL 1GOGA 2VNCA 3N1PC 4JFDD 2AABL 4LVHB 5C09D 1X5XA 1RZIB 1TQCC 2CDGA 5CJBA 4KJQC 4DWHA 3VWKA 2X0UA 5LNEA 4ZMVA 2NDFA 3QRFM 2WBJB 1IIIA 4HG4J 1PKQE 4PP1C 1MXDA 4UCFA 3U1SL 2QPSA 5FWQA 3OPZH 5KS9B 2PYFA 1EHKB 3MJ9H 3DO7A 3KAAA 2WQ8A 3IJ8A 3RGHA 3ECBB 4KKLD 2YGQA 1UACH 1E28B 2FECL 4L1TA 4PD4J 4AV0A 4WZ9A 5JW5B 4E9WA 3FQTA 3GB7B 2WB1A 3ESMA 4JUSA 1J1OL 5I1KL 2QVKA 3UTSD 2E7BA 4ZX6A 5D1QE 3SDCB 4UQ9A 1A6UL 4HUXA 4ODXA 5ETUA 3EFFB 4OZFA 4JFHE 3U9UB 1QFOA 2Y5TB 4GG8B 2NZ1A 4MS8D 5D2LB 3SO3B 1HCYA 1KN2H 4N87A 3TBCA 2KPNA 1UZGA 3OGOE 1BZDA 5IIEA 5JNYB 1YNTF 3QZLA 1ACYL 1N0LB 4HCIA 1OF0A 4DP8X 1DDHA 5GGVH 1PVHA 1HKFA 1DVFC 2I69A 3TYFA 2PW1B 2COVD 2MTPA 5DTFA 4FQPA 4I3SH 4WW2A 2DM3A 3QUZA 1CGYA 3V52L 3Q44A 3FYIB 2E76C 5JHMA 5DDHA 4EE2A 3SE4C 3ARED 2BY2A 2OMYB 4UV4L 3KMDA 3OXSA 2N1KA 4OFQA 4PJ7A 1A4KA 1MFCL 2PO6B 2XHNA 5FUZH 3F05A 5TE4L 32C2A 1IC0A 1OP4A 3GMNA 1RJCA 3OTTA 5EU5B 4CNIA 4YHOL 4K9EH 1EHLH 1I3GL 1RU9H 3KXFD 4Y1AB 2I60L 4PJBF 1RZKH 3CPLB 4YWGH 4A68A 2VDML 3DTDA 2N7BA 4PB0H 3IJSA 4I4WA 4ABWA 4YBLB 3VI3F 3BH8A 4DNLA 1G5GA 5EU6B 2ZWYA 3IJYA 4ZS7H 1MJUL 3S6CA 5I8EB 3SE6A 4Z76B 1Q94A 5KS9E 5GGSB 1QASA 5H2BB 1T89C 4KKRA 3BUYB 1Z0MA 2B9AA 3F7QA 4WW1B 3RQ3A 3K71B 2VLKD 5DEFB 2E5EA 1JZ2A 2EAEA 5JR1H 4POUB 3QQ3A 2V7HA 4EIGB 1TCRB 5D7IF 5EA0L 4EN3C 3VSUA 4NPJA 2YK1L 4NGHL 1XF3B 3IGLA 4NBXB 4AIEA 5H8DA 3O11B 4GW4B 2NTFB 1TDQA 3OL2A 4ZDHA 2O6PA 4HUUB 3US1A 3U4BH 1JGLH 3IAQA 3O6ML 5CZXC 5D2LE 5LCVA 2ZUWA 4ODBD 5JTWA 1ZHKA 2FECI 3BI9X 2C3WA 4X6DB 3S36X 3GI9H 1MHCB 1AFVH 3L2LA 1J0JA 4P59H 4XC3H 4XE5B 4AIOA 4CKVX 4CC1A 3VRIB 4CSTA 1MWOA 3GMOA 3HB3D 3WFCL 3QNZB 2EDDA 3CFNA 4LDCA 5ENWB 4OCRH 5DRWB 3TO4A 4RWYL 4PWIA 4S10A 2K4AA 1NCBL 1BXXA 2AJ3A 3NCXA 4HWBA 1PD0A 1A1OB 1CE6B 1ITBB 3IFOA 3MA9L 1MNNA 1V3LA 1WITA 1WCQA 5EH1A 5K9KA 5K39B 1FDLL 5K33A 3BW9B 3DMMC 3GLDA 4IRSB 4OLXL 1NIEA 2AQSA 3LDBB 3HI5L 3PHOA 4AUYA 3BT2L 4LNRA 5ADOL 4MZ2A 3H7BA 4H25A 1IEAA 5IEKA 5FF6A 4Y1AE 2HH0H 3T4YA 3UBXI 2YPLA 2F8OA 3UTTB 4W9HC 1J1XL 4NN6C 1T1WA 2EEFA 4PM1A 4G82A 4K3HA 5C0NC 5EU6E 2C7UB 4R4ND 4LNVA 2W94A 2GSGA 1FSKB 2Z1PA 5ABZA 4X2UA 3GIVA 1B2YA 1MFEL 2V6HA 5BRZB 4OLZL 4R9HA 3KL3A 3VO0A 5BUGA 5ICXB 1T03L 1YPZF 3FT3A 5GJTL 1SF5A 2FEEL 2DQJH 1D5XB 5FFOA 1UC6A 3V0EA 5D7LD 4G43B 1T1XB 3O4OB 3K4DA 5KAQF 4YVNA 5E8DL 3CU7A 4P2CG 5HPMB 4PBVC 1C5BL 3N0AA 5LCVH 5KSAC 2APVA 3KW8A 4X6DE 4C56B 3H42H 1M2VA 1RJYA 1ORSB 4XR8C 1PY0A 2GJ6A 4KTEL 1QWNA 2AITA 4HPHA 2OMVB 4UIMA 1OAUH 2WQVA 3K0WA 4WHYG 2B59A 1I8KB 1ZA6B 3C9NB 3O0RH 3KPRB 4LLWB 5DZPA 3G08A 1KIUA 5DVKA 2D0GA 1NCAH 3H9ZA 4HWBH 1U8IB 3EHBD 1J5OH 4WHTA 2FO4A 5BQ7A 1S9YB 3BHBA 1QABA 3BC9A 5C1MB 1TU2B 1KCRL 3PWPA 4Z7WA 4FG2A 4YDKH 1FG2A 1G9NL 2JKLA 1WO2A 3VD9A 1SFHA 2G60H 1YEJL 4Z7IA 1DZ0A 3OSVA 1RSYA 2BSRB 4PJIF 4AX3A 5HYJB 2OJEB 3UTTE 1YEKL 1IT9L 5MEQB 5ITFB 1YY9C 2MRYA 3OF6A 3GJEB 3D0LA 2FJGB 5KVGL 3QNXB 3ARFC 3HA0A 3REVB 1P6AB 2YPKB 3CDZB 4HIIA 1PMYA 4AKOA 5FKPB 2RA1A 1U8PB 1OAYH 3P11L 1L7TH 2GITB 2IOIA 5BRZE 3QDHA 3HNVL 1YDPB 2NW2A 2V9TA 4O02L 3OB8A 2OSYA 1OCOB 5AD0A 4PJ8A 3SGJA 4MJID 1BVLA 1RUPL 4LO9A 2N3JA 4C4BA 2XA3A 3W5NA 1NUFA 2X4QA 4NRYB 3LNEA 1IGMH 4IRJD 4BA8A 5C08D 4C56E 3DTXB 4KKBD 1KTCA 4R7DA 5DYFA 1HU8A 2FEEI 4HIJB 4FNSA 2I7OA 4WAFA 3QSKB 3V95A 3D87B 3GRWA 5I18L 3V4PB 3CHOA 4MAYA 1NFIB 2Y25A 3BIKA 1GS7A 3WELA 5C6TH 4RQQB 3ZW3A 1KB5L 1WLHA 2D7TH 2X3AA 3EYQC 1KIQA 5DJCA 3ERXA 2A1WH 3RVVC 1QNZH 4AQ1B 3T0EC 5EIIB 1J9SA 3VFRB 2ITCA 3S34H 1C9SA 2O5XL 3LKRB 3UO1H 1CICA 5B38G 3AADB 4B9KC 2JB5L 4YSEA 3E2HB 3EYUL 4Y2DB 4X5XB 3PGFH 2UZPA 1GOFA 2XCMC 3QXWA 4ZW3A 1URZA 5HYJE 2E4TA 5E4AA 1A14L 5DA0B 4WWID 4B6ZA 5D55A 1LE5B 3P30L 4MNQD 4MCZB 1G43A 4OTXL 1JK8A 3QUYC 1U58B 3WUWA 2H26B 5DA4A 4GQ9H 3HE6C 2I07A 3BVWA 1DJIA 4NO3B 4Y16D 4U1HA 4N1EA 5IEHB 4M29A 3QUXD 5TH2B 1S9WA 4FQQB 1OP5H 4X4XA 1ZE3C 5LGKA 2IANE 2F6AA 2K6ZA 4R3SB 1RERA 4QHMA 1J7VR 1BZ7B 3PJLA 3RY6C 4WEMB 1N8OE 3PV6A 5L2JB 1TCMA 4G11A 3L1GA 3UGUA 5DHDA 5AB2A 2P28B 1ZGLP 1WUZA 1UYWH 4AKQA 1XH3B 5EZLA 3OZKA 1LM8V 4TQHA 3F3HA 3C09B 3HZKB 3W1ZA 2BWIA 1RZPA 2H8PA 1NCWL 3LB6D 3VRJB 3GRWH 2HFEA 5TQ2L 3HOGA 2ICWA 2XN0A 3SD2A 5GRZA 2VRAA 4ZQKA 2XETA 5T3ZL 1F45A 4MMZB 3OHMB 2Z93A 4PRBA 3SCMC 3VE0A 2ZOKA 5GS0D 3BP7B 4ODHL 2GKIA 5FUCE 4QHUB 1V7ML 4R96B 5D9SB 3CXHJ 2W65B 3QCUL 3QZOA 4AEFA 1P0SE 4YIQB 4N9GA 3RG1C 3O41A 4JREB 1OCWH 5DFTA 4RGOL 3SPCA 1K2DB 2PPDA 4Y4KC 4YFLI 4KU1A 3TESA 3F7LA 1MI5B 2NY5L 2MOGA 4NQTA 5D6DA 5ID1A 3HUJB 3L3OC 2ARJQ 3OJ2C 2X70A 5EOCL 3O45A 2Y22A 4JM0A 4ANUA 4PJHA 3OB0K 4ZD3L 2H47C 2LE9A 3BDYL 3ETBJ 3VH8B 1MRDH 1P4LB 3GNML 3UTPD 2WTPA 5IQ7L 1T7XA 1DQVA 3M45A 1PZ3A 3OX8A 1A7NH 3B5GA 4PS7A 4K0OA 4TTGA 1FA4A 3FQXB 3GSNB 2OCJA 5CR8A 3BOVA 2BDNL 4NXKA 3TC9A 3FCGA 4LCYB 3BP5B 4G9DA 3LKNB 4YHZH 4HJTA 4K7PY 4TF4A 4GUQA 3RYMA 2YC1A 4ZXBA 5LNGA 2YD8A 1BOYA 5I19L 3IDXL 3DKHA 5LBVA 4KUCD 4JFFB 1Z2KA 1IAOB 4IS6B 4C83A 1PF3A 5F96H 2RAMA 3Q13A 3ARZA 4FI6A 4NNPL 3RWIB 1W0WA 1J05B 3H4FA 3VG0L 4WK4B 4OGYH 4TQEH 1TSRA 4ZW6A 4F20A 4GQPH 3C6LD 4OFYD 2QSQA 3DETD 1JZHA 2J6EA 4HV8B 4JM4H 1ZS8A 4AL8H 3U25A 1IKFH 4JY6B 4ZUSB 5CEXB 4FS0A 3EDJA 1BECA 4J1UA 2GK0A 4JPKL 1J8HA 3ARQA 3B7SA 4GB9A 4Q14A 4YHLL 4PRPD 2NY4D 3MUHL 4XVTH 2VC2L 4QHNA 3FQUA 1SOXA 1HCVA 2F5AL 3RNKA 3SKNA 3IMTA 5E70A 4YLCA 5C2BL 1G9MC 4UTBH 3HHMA 2XG4A 3FH5A 1WQVT 3FFCE 3T65A 4Y4FD 4P49A 3ZE0B 3RP1A 1MI5E 3ARRA 5DZAA 1OK8A 3HUJE 3CHRA 2BX5A 4WI5A 3U0PA 1IAMA 5I1AB 1TKWA 5F0PB 4OAWA 1JPFB 4JVPA 3RWGB 1WEJH 1NBVH 3CZJA 4PJDF 3QDMB 1TVBB 4PV8B 4UNUA 3RTQC 1F11A 3RFZC 3FQWA 2B15A 1OALA 3U9PL 1UACL 5IMMA 2A9NH 3L45A 4X98B 5FK9B 2X2UA 4NWUL 4NBYB 1XAKA 3JT2A 5LKNA 1X5FA 2QVTA 1RZFL 2R83A 3D85B 4KNQA 5IFHL 4KJYA 2R29A 4JFFE 3BGFC 3CNKA 1MFNA 3FRUA 1NTDA 3GMLA 4G8GD 3L3GA 1KN2L 3RUGF 2YFOA 1I82A 1M3JA 5FYLD 1MHEB 2R7EB 5IW6A 1VGKA 3F2LA 3CAFA 3L3IA 1JG9A 5CSZA 2WUCH 3X11B 2C3GA 2PR4L 4PS3A 1YN7A 2DLHA 4G7VL 3T4AA 4I3GA 4I3RH 4UM9A 4RAHA 2AJZB 4G6FB 5B1AB 5E5MB 1QLFA 4YGVB 2DIEA 4O5LH 3KH4A 3GK8L 1B3IA 2JCCA 4XO5A 3ECVA 5IQNA 4MXVE 5I0XA 2Q8AH 1AQKH 1G6RH 3QORD 4M93C 4NKDA 1XIWB 2RCSH 2H2SC 1JZ5A 4HS8L 5FUZL 1K72A 1NZRA 4ETQA 5I2IA 3A4EA 1ZT4B 4NO2A 5J8OA 3DSFH 4RNRA 1NAMB 4K9EL 5HHOA 2YGNA 4K94L 1UXSB 3EYFA 3CXFA 3S37L 3ZE0E 3SODB 2ERJC 2NTSP 1W0YT 3DHMA 3RZWA 3GHBH 4KKZA 1QFWH 4WUUD 2EE2A 4R84A 4XXWA 4NZTH 3NG5A 3GD1C 3L5IA 4GUPB 3WFHA 4JFED 1FORH 3O2DA 1JJUA 1Z3GL 2F15A 3QDME 1QSFD 2RALA 3S3CB 3DVNA 1HEZB 3EGDB 4KGLA 1DSYA 4F8QA 2EIBA 5T8IA 2CZNA 3E1F1 5GSVB 5CGYC 3SE3A 1WA0X 3MCG1 4NAQA 2GIYA 3HC2A 5F7YC 3WLWD 5HY9B 4L1BA 5BRPA 5INDA 2VITB 4P4RB 5HDBF 1Z5HA 2FQFA 5EIQA 1JGLL 1ETA1 4KWUA 1NBZA 2DD8L 4MAZA 5B1BB 2FVNA 4H8WC 3RBSA 2WYIA 5AAPA 1CTMA 1T5WA 2E74C 4JN2A 3MGOB 3BZEA 4HLZG 4ZW7A 1OXYA 4XC3L 4UNVA 4IK7A 1JN6B 5ID0A 1N5AA 3DA0A 4IEFB 3IDUA 4GKZB 4Y9CA 5DUMH 2WANA 5FM5M 5KJ4A 3RDTC 3CMOL 1NGQH 5TQ0H 5FX3A 5AENA 3THMH 2CA4A 1NANH 5DO2C 4OCRL 4BWUA 5IHUL 1OTTD 4LLUA 1QG3A 3D05A 2W92A 1YEEL 3R06A 1AYRA 2VDOH 2VXVH 2HT4C 4TM9A 5C8JA 4NKMA 5EZOH 4OGAD 4FLOA 4YE4H 5FV1L 1GS8A 4YDZA 5ICYA 2GCYA 5E6SB 3NCWA 1NGYB 4NC0B 5AZUA 4OKVA 1HOCB 1DJSA 4TPRH 4BFIB 2H32A 2OP4H 2VLRB 1MPAL 3U2IA 1E42A 3GSUA 4K55A 1DQQA 4GIPD 4KO6A 4P2YA 3BE1L 2JI1A 4F8LA 4I9XA 4EN2A 1UD4A 2B5IB 1KEGL 2W60B 5D7KE 5FECA 3AQDA 1FIGH 1LEKB 3E8UH 4WI7A 3S8GB 3WL9B 1ID5I 4WDIB 3V9FA 3O6KH 4KQ0A 1XQ4A 5IESH 2UWEA 2D0HA 4ZI8A 1S7XB 2FWUA 1BJ1H 4W9KC 4YGAB 3ESPA 1H3WM 3LXAA 4WY7L 1SY6H 2WXRA 3NN8B 5IR1B 1PLGL 3QEHB 4LSTL 2EC8A 2KL6A 1H15B 3S48A 2WQSA 3TV3H 1REIA 4L4JA 1HHJB 2DQJL 4LPTA 3KPSB 2IH3B 1A3QA 1X7TA 1G7PB 2ESVA 4RGMC 1K8IA 2ZXBA 4PW4A 3SKOA 4B7IA 1ICTA 4MMXB 5KS9F 2PWGA 2GEQA 4RAUA 5LCVL 2OJZH 3P54A 3ME0A 3QUMH 2M1KA 3I2CH 4HVBA 4W4OA 2HCZX 3X3GL 3OJMB 4AEHH 1TJIH 4TSCL 1OAUL 4P8QA 4OVUA 2R1WB 4UT6A 3STZB 1F4XH 4HS6B 3ETBF 1XL6A 3O0RL 2NXZB 4F7TA 4KJQD 3SY0A 2WUBL 3HE7A 3QBTB 3MV9A 5DLLA 4HWBL 2OX5A 2BIPA 4PP1D 2EC9T 4N2DA 4Z7UB 1JZGA 1QTYT 3DPBB 5D2LF 3ARVA 3FO1B 4Z5RA 4XAKE 1J5OL 3VD2A 4JFXB 4QTFA 3QDGE 3RGVC 3BLKA 1B2WL 4OZGB 3BEVB 1T80A 4B97A 3OKNA 1ZLSL 4KO5A 2QADB 2VLRE 1P7KB 4JRYD 4LHUA 3V0VB 1CDUA 2G60L 4YHIB 4IU3B 4EIZC 2HVKA 1UD8A 4I18A 5EBWB 1YEHH 4RISH 4J2XA 5J5EA 4JJ5A 4X4YB 3TURA 2H7WA 1NCCL 2D7OA 4LAQH 5AL0A 3MFFB 3UZQA 4FFZH 3VXMB 2Q76B 3K2MC 2GC4C 1A1NB 4O51A 3ES6B 1TLKA 2BJMH 3OZLA 4XPHH 3ILPB 5C9KA 3FUHA 1FL3A 1L7TL 3DV4B 4I13B 4EBQH 4JRXD 4NNXB 2GHZA 2JXMB 4MJHA 5IMKB 1DSWA 3LMJH 2VCOA 1NIDA 2F2HA 5JORA 1CFTB 1SYVA 3LEVL 3KPSE 3VTMA 4XN2A 3MBEC 2FEJA 4TNVF 4OIFA 2A4ZA 3OKEA 5BRQA 1CDGA 4M6OH 3CPUA 5C0IB 4FLSA 2Z92A 1P69B 3D0VB 4LBEB 3A6CL 1AXTH 4WEEA 3LKQA 1MLCA 2WZAA 2XXFA 3X1GA 4PRIB 4MHHG 5DT1L 5C09A 4HOZA 1VACA 2EDQA 1UKTA 2Z64C 2GTZB 3GQFA 4M7LT 4ABQA 4G83A 2JTYA 4Z7UE 4NUQA 1CGSH 5EU4B 3ILQC 3ET9F 4BFGA 1P1ZB 3GO1H 5B22A 4OZGE 2Y7MA 5CN2A 5SWZD 4X0KB 3WIIH 1A47A 2V3FA 3PGFL 4Z0BH 3OKLB 3EYSL 3K2KA 4EN3D 2XYCA 5L7XH 4S11A 3VACA 4LVOB 5FC9A 4QRRB 3VQMA 3BH9B 2X41A 4CILA 4HQQL 4BFEA 3OKYA 5J9PA 3OGCA 4W9ZA 1U8JA 1ACZA 4IGBA 1JRHH 2WNWA 4YNYA 5CZXD 3VXME 3TH2T 2BO0A 1GHFL 1KPUA 1AAJA 1NCDH 2F1BA 3K80A 3KLDA 5FYKE 4I0KA 3BVNA 3U2SB 2WIIB 3GEFA 1B6UA 3MRHA 3VU2A 4F7CB 1CK0L 6FABH 4N8VG 1MREH 4X7CC 4IKLA 4ZAKD 1PL3A 5HYSB 5DJXA 2DBLH 1P9MC 3ISWA 3UABA 4F8NA 3OR6B 1RIUL 3MLTA 4DP9X 2ICEA 4LL4A 3VSQA 1WAPA 2XZQL 3U7AA 1OQOA 1UYWL 3DC0A 2FJHA 1M7UA 3B4NA 5JOFB 1GA2A 5BS0E 3IAPA 1L3NA 3GRWL 4IRZA 1EXHA 1E4WH 1EGJA 3KXFA 3D9AH 4GNKB 4PRIE 1DBBL 4Y2OA 5GS2D 4HJEA 1EJOH 3X3FH 1OM3H 3VXUA 4FFVD 3D4ZA 1A6ZB 1XFPA 1JPGB 3CV5A 4EUPH 2HRGA 3CHQA 1WZMA 1GGIH 5I1JH 5IVOA 1Z5LB 3FB7B 2O5ZH 5E6RB 3NT0A 3FTGA 1DQDL 4PBWD 4WIQA 1A9VA 4AGLA 2WINB 3L4VA 3MLXH 5H37A 3TVMC 5C6PB 4QRRE 3C08H 1DZBA 3E3QC 1ZY9A 1YG9A 4GAYA 1PJ9A 3A21A 5LBGA 1JYWA 4XGZA 4JO4L 2CO7A 2R4RH 2BP3A 1EIBA 5BXFB 1OAZL 2FD6H 1LWRA 3GBML 4AEIH 1BSIA 2JTDA 2R2EA 2PTUA 1ZATA 4QKTA 3RWCA 2IOMA 5F6HJ 1QACA 4U7MA 2HX7A 4PGZA 2A6KB 3RU8L 1JNLH 1YMMA 2PW2B 2HUEA 2Z8WC 4XN1A 3EFDL 1KWKA 1UA6H 5JO5B 3H2QA 1N7ML 1IL1B 1I8LC 2Y7LA 2YQ3A 4CADB 1X5AA 1KGIA 3MMEB 3VD1A 5F96L 2HKAA 2J4WH 3VJ6B 1MFVA 3LZLA 4BCXA 3BQVA 2CCWA 1CYGA 1RHHA 4W1TA 3WNKA 1XCTB 3PAVA 2X4RA 4IIQC 2A7BA 2C9VA 4OGYL 4NSKA 2CLZA 5BV7C 5DZLA 1XF1A 3D18B 2VE6A 5FYJU 4Y5YB 3ZMEA 5IJVB 3QWOA 2QR0B 3B7RL 5C2UB 5C0CB 4IRZH 1EGJH 1XGQB 1AS7A 1FVDB 1LO0L 3SPIA 5I8KH 4PWGA 4M48H 1QOKA 3CSPA 3ARFD 4RCAA 1JGVH 1E3FA 4WWKD 1UGNA 4MBRA 1KYOK 3EH3B 3ALPA 3QNYB 2XX1A 3HG1B 4QGYA 4RZKA 2DI7A 5B1KA 1AG6A 3VD7A 1EZUA 2X4NB 5CJQL 5CEZE 4P2OC 4XNUL 3AMKA 2WWOA 2BRRH 5H37H 3EG9A 5IJKA 3GUFA 4PHZA 3O3DB 1D7BA 5DQJA 1F3RB 3WCYA 4EMZA 2BOCA 3KDMB 4OJEH 3P9LA 1INDH 2QFRA 4KVNH 2PTTA 2EACA 4J6IA 1O6TA 1WEJL 4X4ZA 2ZUTA 3SGEI 1NFDE 3LRSA 1I1YA 5IB5B 3X2QB 3T1WA 3PJSB 4LCWA 2A77H 1CFNB 1GH7A 1EHNA 2D31A 3EJRA 3JBG7 4HSAC 3ZDZB 5T3XE 2EO7A 3OKKB 5E8EA 3LJ3A 1M1XA 3K81A 5FW8A 3ULVC 1F97A 2A9NL 2ZKWA 3BP6B 4IBYA 4QRUA 1FL5A 3TO2B 1HHKB 4RLDA 2GTWA 3QULA 1CYWA 2IG2H 3C5ZA 5KVFE 3GUTA 4R7NB 1Q72H 1OLZA 4X8XA 4XP6H 3E6HA 1SOQA 2VN4A 5GGQL 3LKPB 1EEZB 2AS5M 2BC4B 2I27N 2WXIA 3OSKA 3GLEA 3TJEH 1FN4A 1PKQA 4QHKJ 3Q9QA 1B88A 4Y1SA 3T0ED 3TBVB 4JG1L 4XNXH 5CR1A 5E0FA 1SHXA 4FTVD 4HWNA 5FOJA 5B8CA 1OF2A 3VU1A 1VFAA 3DX1A 3A4DA 1M3IA 4UT7L 2UUDK 2WUCL 3MLSH 1RCYA 1BEXA 2RD0A 1KLFB 5C0CE 4BK4A 3HJEA 2F1EA 2GI0A 4L9LB 2G5UA 3LV3B 2J6EL 2HRLA 3BDBA 1RPQA 1RZJL 3QRBA 3NK4A 5FDWB 1ACCA 2AXFB 4JKMA 3QG6B 5D1QA 3CLFH 4ZX4A 1AQKL 5F72S 2DQUL 3QUYD 1YJDC 1JGDA 2IADB 4URTB 1AKJA 3HG1E 2B2XL 3CFCH 2X40A 4YSOA 1M7DA 3PGCA 2WKLA 4KX9A 5BZWA 3TF7C 5AKVA 1DN0B 1JGEA 4U49A 1YN6A 4OJDH 1OP5K 4OZIE 3ARDD 4GW1A 1KCBA 4FHBD 2ZIDA 4XX5A 4BSVA 1KJ2B 1QFWL 2TAAA 3KGSA 3LN5B 4NZTL 4MJIA 1L0QA 5CJXA 3MYJA 3KYMA 4J3WA 3WS6A 3G5XB 1T7WA 3HC3L 3QWQB 1ZVSB 4PGDA 3T5WA 3MTXA 1RZGB 3MX0A 3O8XB 1SUHA 1QTPA 4IRJA 4N24A 3QIUC 4QY8A 4Y9BA 5C08A 3ZDZE 4HJUA 4GW5A 1PZDA 1SN2A 3HBPA 1O5DT 1WZAA 3RA7L 1EDQA 1VSCA 4HFUL 4PJ9B 5C0BD 3L4YA 4GAGL 1NAKH 2VXSL 1B6DA 1UWEL 1RZIA 4DIXA 2R29L 3GDCA 3GSXB 1F2XK 1YUKB 3L3DB 1JZ8A 4C57C 5A43C 5KS9A 1J5HA 4L8BB 4E9TA 1JDAA 4M8RA 4UUJB 3ECBA 4GS7B 1OW0A 2EDEA 4XNAA 4WFEE 1E28A 4MFHA 4GMSH 2WSKA 1FFNB 2X10A 5TQ0L 3THML 3VXNB 3NEOA 3GB7A 5AKRA 2ZYSA 3L4XA 8CGTA 4U4BA 4ZTOL 1ZSDA 2VDOL 3K6IA 4P5SA 1QSED 5HHPB 3F58H 3CVHB 3EFFA 1DP0A 3U9UA 2Y5TA 2Q3XA 1KBGL 4DGVH 1SN5A 1OM9A 4PB9H 5JNYA 3QARA 4N2FA 3BUDA 5CP7B 1N0LA 3QR1A 4YSQA 2AW2A 3SOTA 1FAIH 3PE9A 2PW1A 3QGVA 3ARSA 4XVSH 5FGCE 1CCZA 1T4WA 1U42A 4MXVF 3QG7L 2BCKB 1E6OL 4PY8J 1DQTA 3S2CA 4LIQL 3I6GB 3I85A 4PTTB 3RPKA 1MXGA 4KRMB 3O2DL 3AWGA 2FH8A 2OMYA 3VD5A 1I1AC 5CSGA 1AQ8A 1UT9A 3ZUCA 1BMWA 4H0HB 2PO6A 2DICA 5D96C 3LEYH 5IY5B 2ZAHA 3TV3L 4AGQA 3S36H 3VYOA 1QFWI 3ZE0F 2WXMA 4JG0H 1JWMB 2Y36H 5I16B 4Y1AA 3X1EA 3FOLB 1XZWA 2PP8A 1XEUA 3CPLA 4EEEA 2WXLA 4OI8A 2ADGB 4PI0A 4WI0A 3F84A 3AT0A 1KCKA 4Z3HA 4U1MB 5EU6A 2VRQA 5I8EA 5INCA 4Z76A 4KI5C 3MGTB 4M4PA 5GGSA 2ADIB 5H2BA 4XNQB 2PP9A 1GS6X 3BUYA 3IDJA 4Y7OC 4WW1A 5DEFA 3ZN6A 3PAUA 4ELKB 4F2MB 4WJ5B 1TCRA 1F4XL 1JXGA 4HCRH 4LGSB 3MQIA 3AVEA 2JKJA 2AK4B 3R0MA 3VGBA 1TYJA 1FUNA 1XF3A 1HNYA 1A7QH 4BQBA 4GW4A 2NTFA 3LSOB 2BVYA 1YQVH 4HUUA 5E5LA 4DZBB 3TBSB 2Y9RT 1Z9PA 3ZDXB 4G5ZH 1IBBA 4F7KA 3IFPB 3FOMA 1F58L 4X6DA 1KC5H 2QVIA 3BPNB 3NEEA 4R97B 4AM0Q 1MHCA 1AR1B 3FW6A 3VG9C 3VRIA 3BGAA 2A99A 3KLSA 4YDLC 1YEHL 3PL6C 3QNZA 1GSMA 1E27B 4J27A 4L0ZA 3O4LB 5DRNB 5ENWA 1XB8A 1IGCH 1OP9A 5SX4H 5HYFA 2A5UA 4JZNA 4LSDA 3PWLB 3WMQA 1CE6A 4CKQA 3IKKA 3TNNB 2HWZH 5J4MA 2BNQD 2IOOA 3BW9A 4FFTA 4PG2C 4A6YH 3NTCH 2HFGH 2P8LB 4EBQL 4PJGB 3IKCA 3P3RA 4GRWH 3F6JA 1ILUA 4DP6X 5I15H 2WN3A 2ZX9A 1ID2A 5TK2A 3LMJL 1QO3B 4YL4A 5G4MA 3QP3A 3ZGHA 1A0QH 4EOWL 2H9GB 4XN4A 2FT7A 3UTTA 1IBGL 4WV1A 3U6XS 3KS0J 3EJTA 4FYSA 1FNGB 3I3DA 2ZKHH 4IJ3C 4N0YH 5GS0H 3D52A 4RFNB 4JGNA 2C7UA 3LNDA 5DQ9B 4NQCD 4POYA 2CJUL 4IBTA 5HGHB 3MACL 3FB5