3VYPA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase ldtmt2-n140 adduct with meropenem
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
268
structure length
268
Chain Sequence
LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
publication title Crystal structure of L,D-transpeptidase LdtMt2 in complex with meropenem reveals the mechanism of carbapenem against Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.3.2.12: Peptidyltransferase.
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3vypA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vypA01
5LBGA 3U1PA 3ZQDA 1Y7MA 4A1JA 4GSRA 5LB1A 4JMNA 5DZJA 4QR7A 4HU2A 4QTFA 4A1KA 4LZHA 4ZFQA 1ZATA 5E5LA 3VAEA 4Z7AA 4QRBA 4A52A 5DZPA 2MTZA 3U1QA 4GSUA 4HUCA 5DVPA 5DUJA 3VYPA 3VYNA 4QRAA 3ZG4A 4GSQA 2HKLA 4LPQA 3ZGPA 5E1GA 4K73A 4A1IA 5DU7A 3TX4A 5E1IA 5DCCA 5E51A 4JMXA 5K69A 4XVOA 3VYOA 5DC2A 5D7HA 3TURA
chains in the Genus database with same CATH superfamily
1QSEE 1P5UA 3W0WA 5B8CB 5JQ6L 2CNYA 2HVKB 5GISL 2G3ZA 2ZAGA 3U7YH 4WSJA 2VW4A 4Z7QE 3JUYA 1L6PA 3EDEA 3FQ4A 3FCSA 4OCXH 3W0WE 1Z9LA 4O51A 2XIDA 4UF7C 4AYBA 5AW6B 2KH2B 3ZTDC 4P3CH 2N01B 1HXYA 4RCAA 5AAMC 4NEHB 4KKCC 5GZND 3LIZH 3TVMD 4AENA 4IDJH 4XO9A 1KDIA 1P2CA 2BCKA 3HZMA 4PJAF 2ENYA 1J9QA 4QRSB 1CBVH 4J1UB 3ZDYF 1JPSH 3P0GB 3BZDA 3O4OC 3VXNA 1HAWA 5HYQA 2EEAA 4AQOA 3AREC 1KB5A 3ABGA 3RILA 4NHCH 1OV8A 3HUJE 2R0LL 1PZDA 2F5AH 2PETA 2UZXA 1WZMA 1A2YA 2ZX6A 3FCTA 3PGFL 4PRPE 2BY0A 5CLZA 4A67A 2OMYA 1YQVL 3ARZA 4BHUI 4MNQB 3P2DA 1LYQA 2BY1A 4NAMA 1MHEA 1GCYA 4JFTA 1CE6A 4MB1A 3NCXA 4NZRL 1WWAX 3H42L 1E5UI 3FW6A 4ODSL 4JKWA 3EOYG 4R5TA 2XZZA 4U3SA 1QLRB 2R1XB 3V4LA 3X1BA 4AE0A 1OAZL 5A3IC 2DZEA 3NH7L 2PO6A 5JHLL 2G60H 5IROC 3QUZD 1OT4A 1Y1UA 1KDJA 4ZZFA 4HX1A 5F8RC 1TFHA 4U1MA 4FQXD 1N10A 3N44B 1QFWL 3KDMB 1W72L 2CGZA 3FSOA 4XOBA 1EZLA 2VR5A 1SN2A 4PBDA 4Z3HA 4X7TB 5IBLC 3HKFA 2AK4D 4NQEA 2HB0A 5A2FA 4B50A 1PYWB 4UIKL 4BFIA 4F8QA 1PLGL 1OP5H 2K9UA 4KI5F 4K5NA 4I2XB 5L2KA 3QGVA 4PJCE 4W4OC 1RUKL 3WE1A 3ZQ9A 2I26N 4NRZA 3DMMD 3ELAT 2DJUA 1FO0H 4KI5D 5C3TA 1PAZA 2UZPA 2D3NA 2QQNL 3BSZL 4L29B 3R0NA 4G80B 4NP9A 1UYWH 3MUGB 4EOWL 5KS9A 1ID2A 2FJHB 2DEWX 2DQUL 2FT7A 3HVNA 3VVVA 2NNXA 4OZGE 4EN2A 3RPKA 1JAEA 4ZTEA 3QUGA 1NIEA 3DUHA 5D9SB 4QF1A 3ZN6A 2X6UA 2UUDK 1OP5K 4IOIA 3OJDB 3OMNB 5J89A 3FUKA 5FLVA 4F92B 3WOVA 2EE3A 4YSSA 3RWGA 4GAGH 4F15C 4XNYH 5FV1L 2ATKA 2TSAA 5D7LB 2AQRA 3ALXA 2VABB 3BPLB 1DDHB 1N6VA 3QDGD 4D8PB 4GG6B 4HWBA 3LEYL 3KPQB 4BSVB 4XP9L 3VG9C 2P5WD 3EFDL 4FQQA 1SJHA 2VR4A 1FZJB 4JHZA 4LLUA 4C83A 3HRPA 1XGUA 5HI3D 5FB8A 2QGEA 1AXSB 2WVTA 4F8NA 5MHSD 2G2NA 1IQWL 4QTHB 1WHOA 2X40A 4HLZG 4YWGH 1XF2A 3VFVA 2DQCL 1LHZA 4L4TD 5DMKB 3GINA 2JVUA 1IBDA 3QWRA 3UPRA 4LZHA 2PCYA 1GHFH 2WO4A 2Y3AA 2FO1A 5IQNA 4R26H 4OJDH 4WUUD 1WBYB 1KCUH 3DSFL 2EE6A 2EEDA 4ONGL 4JBSA 2MCMA 3IGFA 2VN3A 5IMKB 4MXQD 1UKSA 4FKEA 4XVUD 5JPMB 1ZDQA 1Z5HA 2BS71 1KTCA 3EBIA 3BIAX 4HGWB 1UJ3A 1N67A 2XN9D 2FUQA 4N0CC 4JFPA 4YPGA 4YFLF 3WFHB 2QSQA 4WUKH 3F58L 1A22B 1UM5H 2XPYA 1UB5A 2PTTA 5TGBA 4X7TA 4G42A 4Y5XB 4NDMB 3WKPA 4PLNC 3KWUA 4ZZKA 1I85C 4J2XA 3DPBB 4XAWH 3LRSA 2CM6A 2YGOA 4BV1A 1XR8A 3ARDC 3TV8A 4WI7A 4HXBL 3PWPA 1J88A 3APCA 3ASWA 3RZCD 5C09B 1DBMH 1DQKA 3K0WA 3PWPE 3DX7B 1S9WB 3OAZH 2ZP8A 3I84A 1ICTA 3VGFA 3G5YB 2Q6WA 3G5XA 4K23L 3U0PA 4FKHA 2BSED 3JVGA 4A6YA 1QW8A 4JFED 5KBMA 5C0CD 5I6KA 4UZSA 4DK5A 5IQLA 1USZA 3VFGH 4ACPA 2OL3B 4F58L 1CL7L 4HG4J 4UQ3B 5CLWA 1RZKC 3I6GB 2CIIA 5G5DB 2EXSA 2VR7A 3WTSA 2JKLA 5D7LA 4OFDA 1MJ8L 1D6EA 3ZR6A 2VABA 1E43A 3MLWH 4IKIA 4K7PX 5DQDH 1QEXA 4XP4H 4BSVA 1QPKA 1KJ2L 3D33A 3C6LB 2X12A 4RRPG 1AZVA 1FZJA 4N2LA 5C7XL 1FLRH 1BD2B 5LAXB 1DEEB 4E41D 4U3XA 1AXSA 3E6HB 1FL3B 1RK1A 3AU0A 3QUXB 4DQAA 1WICA 2HT3D 3QQDA 1RP8A 5FO2A 2VGLM 2LQRA 3CSBA 1I8AA 1B0WA 2WYHA 2P5ED 3SDDD 4DP9X 1YLBB 4XBMA 3D2UA 3V5KB 2CKBA 3CX2A 1EVTC 2WINB 3PPSA 4NQQA 2E27L 5EC2B 5C0RL 2QADC 4JDEA 5I75B 4FYTA 3IK2A 3STBA 4HIXH 4WI6A 1KGUA 1JNHB 1SY6H 3ARGC 3BW9A 5HGDB 1TCMA 4WGKA 5CU5A 4J3WA 2O5YL 1WIPA 5JHDA 3SE9L 2OJ1A 3B2XA 3D34A 1F58L 1J8HD 1EEZA 3D0VB 5IMKA 5DJYA 1SQMA 3PWJA 1C12B 1ADWA 1OK8A 5JPMA 2WZ6A 4HGWA 4HKJB 5DD0L 4S1DD 5JPNB 3DV6B 3UH8A 5AVUB 3WXWH 1I8IA 1I82A 1CFSA 2BHYA 1SN5A 4L3EB 1YRKA 1F13A 4GI9A 3DPBA 1BOGB 4FJZA 1CMOA 5C71A 5CBAB 2N0KA 3Q0HA 4JQVA 4L4VD 4QAWA 1LM8V 2V8LA 2A7BA 4M8QA 4WI5A 1KBPA 3VG0H 5B21A 3HNSL 1UFUA 4KK6D 1HI6A 1P84K 4QY8A 3RWCA 3NGBC 2BSTB 2VDKH 2CALA 1OPGL 4LIQE 4A2EA 2Q1EA 5D4QA 43CAA 4WJG3 4PCYA 4XPHH 4XPBL 5E8NB 2OYPA 3TA4D 1I9RL 4JUSA 5EG6C 12E8L 3KPSA 2HVJA 4GKSB 4AKQA 3U0WH 3SGJA 3CSGA 2CUMA 3KPSE 3QJXA 5J12C 5K9OA 5D1XC 3CVHH 4MGXA 1YECH 1F1AA 1R0AH 4OR1A 2XPGA 3I6GA 3I9GL 5HHMB 5MENA 1NC2D 3T8MA 3ILQC 3Q1SL 2J8UB 2CO2A 4IBWA 3GC3A 5MENE 2NZIA 4MMXC 1OSZB 1BREA 3APFA 1XCXA 4UT7L 5AOIA 3QEQA 3TO4B 4ZMYA 4X99B 3GYRA 2GCYA 3OZ9L 3W38A 3BRGC 3QEQE 2XKUA 3GSVB 4AEIH 5LAXA 3B8SA 4H2AA 3E6HA 2BRRL 5B38G 1FL3A 2BNRD 1YJDH 2X89D 4Z7QF 5TE7L 1DVQA 4XBEL 2MWCA 1LJMA 4MQXD 2DQHH 3JZYA 2PWGA 3CSFA 3IRCA 3MLVL 4HZLA 5JZ7C 2WXHA 1JGEB 1VACB 4TUOB 4OF7A 1B4JH 4A2FA 1FNGA 4LSTH 3FO2B 3FO1B 3WHE0 1UWXH 3BVUA 5D5MA 3CTTA 4JO8A 4YHOL 3U82B 3W3BA 3ETTA 2JCCA 5D5ME 1T21A 1YNKL 3MLUL 1OAYH 4FNLL 1H8OA 5F6HI 3IFLL 4YE0A 2JCCE 4MAYD 4XMVA 3KYKL 3NVQA 4OF6A 5DJAA 4Y1SA 1FDLH 3T65A 2ZWLT 3QEGH 5FXCH 1YYLH 1QR4A 5KN5A 1LQBC 1FNHA 2AQPA 2YUWA 4JZNA 3FUMA 4L9LB 4NQXB 5FA3B 4WEBH 4EIUA 5FYJD 1U6AL 4AL8H 4P59L 1UWXK 2BLFA 3DRQA 4L3EA 5F44A 1QKZL 3DI2B 3TO2A 1XDTT 4DPAX 4I3GA 1S7RA 2VZOA 3DK0A 3KPPA 3GF8A 5DMJB 3KEHA 4W9ZA 1X5JA 1NCIA 2Q10A 1A6TB 5CBAA 3IKKA 4YR6A 4AEHL 4FN0A 3FUEA 3HZVA 4Z7OE 2VDQB 5IHHA 3HJEA 4KKCD 4XVOA 3BWUF 1GY1A 3DVIA 4K9EL 1A6VL 4CDGC 2AZAA 3R1GH 3G6AB 2BSTA 1ZJAA 5GRVL 1MCQA 1GYWA 1ZS8B 1E9OB 1H8LA 1UENA 5CEYB 3SBQA 5D70L 2DMGA 3IJHB 3Q2VA 1EFQA 4KK5C 1A6ZA 5LQBH 1TQTA 3TV3H 5I1HL 4WAFA 5LCVH 1S5HA 1DQJA 1DN0A 3AT0A 1Y18A 3M88A 3IXTB 5DD5L 1JZ3A 1KN2H 3F6JA 2G5BB 3TP4A 5IW3A 1OE3A 4WV1A 3EFFA 4XWOC 1DJWA 3PP4H 4G7RB 5MEQB 5AW1B 5AVYB 4OCSH 2K6WA 2O6CA 3HAEB 4MD5A 4FG2A 3EOAA 5HDLA 3SE4C 2HX8A 3QDAA 1YMMA 1MY7A 4RSVA 1ZA6B 4C56B 5AB2A 4K2UL 5FOBB 1GW0A 3QUYA 5A3ID 5HHPA 4MWFB 1YMME 2ZOLA 5T1DH 5KBPA 4OZGF 4WCYH 1VERA 2XFGB 3LN9A 3NBNA 3EYOB 4DZBB 4F33A 4N2HA 3VJ6A 5I1IL 1E4WL 4IHOB 1JJUA 3QZPA 4Z7UA 1QHQA 5HVGB 3VMPA 1RULH 6PAZA 5HGAB 1ZVSA 2PP8A 2BNUB 2GTWB 2UVEA 2W92A 4Z7UE 4IU2B 1TZGL 1BVOA 1TYEB 3VFSB 4TUOA 2BJML 5HYSG 4ZTOH 2B0SL 3B7YA 3OXRA 5IBLD 5ICZB 1JPGA 4U4IA 1HC1A 3V5HA 3UTZB 3QYCA 5KYUA 2PW2B 3S5LB 4PJ9A 3NA9H 4FI8A 2NY0D 2XZQL 4CVXB 1NWPA 4L1DA 4A1KA 5BS0B 3CUPA 1K8IB 1MLCB 2ICWJ 4KI1A 1PCSA 4HIHA 2UV3A 3DX3A 4Y5YC 3U6RB 1G7JB 3AG2B 2VH5H 3QJSB 4EZMA 3EH1A 3MR9B 1QLEH 1SXSA 2WANA 3WD5H 3WMQA 2WPGA 3DJ9A 5T1KD 2OZ4H 3FYEB 4I3SH 2ZCKL 2PNDA 3NZUA 3NACH 3OMIB 4X6BA 3UC0H 4TSCL 4F8PA 4UV4L 2L8AA 3UDWA 3KWTA 1C1EH 2Y7SA 4JM4L 4W6WB 5HHOD 5C6WH 3IETB 2G3MA 3GXMA 4L4JA 4NLAA 1U9KA 2HJFA 1I3UA 3M17B 1C7TA 3HA0A 5FDWA 1IC4L 1ADQL 1DVFC 3FYIB 3H3PL 2FGZA 3B2UD 4AIOA 3NIDB 5CZVL 4QRAA 2JQMA 1YEJL 1G7PA 1NUDA 4BCXA 2E9BA 4JO4H 5EORL 3QFDA 2NY4B 3GS7A 1I1YB 1RIUH 1UWFA 4GAJH 2YSSA 1YYCA 2HUEA 2P42B 3ZYOA 3LEXB 4DGYL 2Z4QA 3MBEB 4GQ9L 1IBYA 4AWJC 2DL2A 1NCDL 4G6MH 5AVWB 1FZOB 1VF5C 1R47A 2RB8A 4Q89A 4P5TD 3F7VB 1M6OB 3NCCB 2D9QB 1IEAA 3CVIL 3TPUA 2M1KA 3VXOB 1JPFB 4H13C 3JV0A 4MB5A 3SPGA 4XVTL 1DTUA 1QEWB 2YXFA 5BRZA 3T6VA 2X7LA 3K6SB 2IJ0C 1OAKH 2IBZX 3DYMA 2ADGA 1CCZA 1SOKA 4S2SB 4TVPD 5BRZE 2BVTA 2J5WA 3MRCA 1BZQK 5CKAA 2J72A 3FQ1A 1TUPA 3JTSB 4F5CA 4NN7C 3V0IA 1ZEAL 2AEWA 3QJUB 1GGTA 3CLEL 4F5CE 4N0CD 3UCQA 2XG4A 3ATFA 5CP7B 3AFLA 4TPRH 5EHFA 4ZUVB 3ULSB 5GJTL 4F9LA 1ES0A 5EF0A 4AW4A 3I02B 5I24A 3POHA 2JCWA 2V3FA 1BVKB 3D39A 4WFFD 4WSKA 5KVDE 5AL0A 3UTZA 3EADA 1CDJA 1N64L 1MG2C 3GO1L 4CVXA 1K8IA 1KG0B 1KJMB 1XH2A 4QTIL 2OTUA 2C4XA 4HHAB 3CMOH 1JGDA 3FB7A 4HD9A 3UBHA 1OIOA 1B4TA 2K4WA 2VE6A 4DTGL 1CLOL 3TJHD 4JRXB 1DVSA 5HYJA 3UJJH 4MMZB 4MD4A 4ZXBA 4LL9A 1JXFA 2D0HA 1FYHB 5CR8A 5BO0D 2QSVA 2G2RA 2Y2YA 4NUJB 5JMOC 4BDVA 2AITA 4YHMH 1DL7L 3UBXB 2PXYC 5TF1H 5GRUH 5C6TL 4BK5A 2Z93A 2DI7A 4M1GL 1G87A 3IXAA 5D93B 3ULVL 5KWYC 2X6VA 5AKSA 4X4KA 3KDPB 5K69A 2X41A 2MHAB 5TH2B 4ZSOA 4Z77B 1KACB 4OJFL 3A47A 1L9SA 4GIAA 1MWAB 3QNXB 4ZSOE 5T8IA 2M83A 3IJEB 5J11C 1MFDL 2BWIA 2N0MA 4Q4IA 4EI5B 3GI8H 3O8XC 4MZIA 3CN3A 2FCBA 5AWNL 2VDLB 5CBEB 5FC9A 1Q1PA 4Y2DB 1NMBL 3CN0A 3OPZH 3MBEA 3V6ZB 1NTDA 1F1GA 5DZLA 3VWJC 1EQWA 3L3GB 4F7TA 4LKXB 4WTWA 3TURA 3QHZL 2C1OB 3MJ8A 1UWYA 5CCHE 2A99A 1S7TB 3JVFC 2QADD 4F2MA 4OF3A 2VXUL 5B1KA 3VXOA 3DURB 4ODTL 2VMFA 1S9YB 4F2ME 2WQRA 5JOFB 4J3OG 1DE4B 4LEOA 2YD4A 3ARGD 3F7LA 2C9PA 4JFWA 2Z8WC 4HWEL 3DV4B 4UNVA 1YEIL 2APVA 4ETQB 4RISH 1HJBC 3M7OA 1T4WA 3V4PA 1FFNA 4RIRB 3L7FA 3S8GB 1YCSA 2COQA 1JD7A 3CFDB 4ZUVA 4JO2L 2GI7A 3MJ7B 3BUDA 4U1KA 2DMHA 2XNAB 1Q0EA 2H3KA 3KYNB 1BVKA 1Z6JT 2XQYG 3P9LA 3QK0A 3M1CA 2VDOB 4KZ0A 3IM1A 5GS0C 4KMLB 4GMTH 3WENA 1ODAA 1E6JH 3RWIA 5HGGS 1EEYB 2DS4A 1NICA 4F91B 1NJ9B 4KX8A 1KG0A 3HHSB 1DQDH 4RGND 4P48A 1RUML 2F18A 3CFTA 2V7HB 5E8DL 3RLSA 5AD0A 5SWZD 4OJCA 1X3DA 5I5RA 3QI9C 2C9AA 3GKZA 3G6JA 2GBVA 4NYLB 3T4YB 1UACH 2B9AA 3SQOH 3LOWA 1M05A 2OL3L 4Y89A 3RBGA 3V52L 3RWFB 4JRXA 5A2AA 4BQ6A 1V7ML 3CZLA 5LN4A 3GRWA 3ESPA 1UOWA 4OCNC 3QZLA 3QXAA 4QXUL 4NUJA 1Q9OB 2UY7A 1G9NL 1DJZA 3NSXA 4MKMA 4PLJC 3WXVL 5DVNA 2FDBP 4J27A 4X2UA 1W16A 3C6EA 4TQPA 3K91A 2R0KL 1FZMB 1JVLA 2ED9A 4JPVL 5CGYC 1VAHA 5D1XD 3WTUA 3VD4A 3GMOA 4L8SB 4G6KL 1TMCB 1OD9A 4PJFA 4KDVA 1X5FA 3ALPA 5I5JA 3AB0C 2PYEB 4N2AA 1R24A 4HCFA 1MWAA 2BVQB 5DS8B 5JW5B 2IPUG 3VXUD 4M5SA 3GJEB 1AFVL 4XN4A 5F9JB 2C3XA 1KCSL 3J7HA 5DS2A 3LZNA 3UBXI 1IC5L 3HI6L 1OXYA 3GMLB 2EILB 2L04A 2R15A 3SCMB 1WEJL 3DKHA 4J3XA 4Y2DA 2CK2A 3V6ZA 1BFOB 5HYSA 4DPRA 4N9OB 4ZFOB 3WY3A 1FAIH 2B9BA 1KXVC 2VJ8A 5LGKA 5EU6E 5IB2A 2BDNH 3S37L 4KDTC 3AROA 2PP7A 1V7NL 1AIFB 1EANA 3BUPA 3SDAB 3X11B 5FHBH 5KBKA 2HFEB 4C58B 4DP0X 4ZFFA 3WL9B 1YN6A 2FIKB 4H8UA 4N0FA 1NDMB 4B9CA 3OLIA 1QWUA 5E2UH 3DGCR 2MOVA 4KK9D 4U1JB 3FBQA 1ESOA 3LKSA 3RP1A 1DE4A 3BWAA 3WFCH 4KZEL 3CZKA 5CJXC 5AVTB 4YHPA 2J20A 3P3RA 2LLNA 3LKNA 4Q7DA 1A14H 3VD5A 3IDXL 4MX7A 2N59A 4ETQA 5T1LB 4H25A 1FJ1A 1F6AB 4YGAB 5HHVH 1YEWA 3UGUA 3WKML 1GGBL 5FYJH 1B90A 1AD9B 1JNNL 2OMUB 4IMKA 4NLHA 3MJ7A 2P52A 2O6EA 2BP0B 3QO0A 4LGSB 1VSCA 4Y2OB 2Y5TA 3FDWA 4ZUUB 2I9TA 1GL4B 2V2TA 1QRNB 1SXNA 4NHUA 1XO8A 1U8PA 5I82A 3TIDA 2ZUUA 4AV5A 3PHQA 3UZVB 4NO0D 3B9AA 4JMXA 1G1KA 3QQ4A 1R33A 3IFOB 3ZKNC 3ZHDA 3RGVB 2A73B 2V7HA 1MVUA 1RERA 2HRPH 4DAGL 2DYPA 4ACTA 3VWKC 1O7DC 2X2UA 3T3PB 2F74B 4LSRH 4BGDA 3MXWL 1E7VA 4DKFL 3ECWA 3FT2A 1KSRA 3QJHB 1E3FA 1HHGB 1AR1C 5EC1A 2XTJB 4PVMA 3ZDXF 1Q9OA 2DY2A 1MEXH 4HC1H 2YAEA 4ONHB 4KK5D 2JE8A 5SWSB 2D0FA 4NENB 2VN4A 1FZMA 1U8QB 3WFEL 1KFAH 1CG9B 5DHVB 1BAWA 2IBGA 4N0UA 1JPTH 1I9EA 1NCBH 4XWOD 4XX5A 5E2VH 3T08A 4A2MA 1FIGH 3UAEA 4C4UA 5KVGE 1W8NA 4N0UE 2FL5B 2O1AA 3JWNC 4HS8H 4JJ5A 3S5YA 4MA7H 1Z1WA 3FTVA 4GLRH 5LHDA 1RVFL 4P57B 1QFOA 2OSXA 3OLGA 5FA4A 2LAGB 3O0RL 3EKCA 3MV7D 4B7IA 2WZ0A 1KIPA 1FV1A 3LKPA 4FZEL 3AQZA 4EXPX 2K78A 1ORQB 3JWDL 2XWBA 3FONB 2BRQA 2R8SL 4TLKA 1RSYA 2IWKA 3HFML 4QOKD 2RIKA 5BVJA 3MLTB 2QVTA 3KPRD 1ND0B 3A22A 4OT1L 3JXAA 3L95A 5F6IB 2FYYB 3SDAA 1R5WB 2AJ3B 4XN8A 5IVZA 3MRHB 2ITDB 4E36A 4MZ2A 1JIBA 4Y19E 3ZZSA 4CC1A 3QFJA 4B9FA 4UQ9A 1TT6A 4HS3B 4PGDA 2Y2TA 2GC4C 3LXBA 1F4AA 3QFJE 3NPZB 3KBPA 3U4BH 2DJ4A 5AAWC 1IGYB 3KXFA 5MEPA 4IGBB 2E86A 2PLTA 4OD2B 1IGCH 4QKXB 1UH2A 4RMUA 5F97E 3S8FB 1BECA 4ECNA 4KKBC 4DUVA 2EIDA 1GRWA 2EDEA 1QI3A 1XB8A 5ETUA 2AABL 1DFBL 1QPXA 1LXMA 5C07A 5T5FH 1Q0YL 2NY6B 2VDQL 1RUPL 3KPLB 4D7PA 3HMXA 5C07E 1XQ4A 2O61B 1SZNA 3LYRA 3UZVA 4HETA 3WIFB 2FO4B 1E8ZA 4GQQA 2VLRA 3RKDC 5DHEA 2ADYA 4PV8B 5GGQH 2IBZY 3FQ2A 2ZNWA 4PJXF 1Z9SB 3QC5X 5E8OA 3FXIC 1DVFD 2AJVL 4LVOB 5GS2D 4AUYA 4XPTL 1N4XH 4QHPA 5EUOF 3V9EA 1QZNA 1QI4A 2A5UA 4DKEH 2N3JA 4NQSA 2EYSB 3O3BB 5E6RB 4OLZL 3GNML 1K6QL 4IQHA 4QYAA 4D0DA 4ABQA 2EDXA 1HKLL 2XETA 4XMKH 3JTTA 2BFGA 1F86A 2AHIA 5CNHA 4DP5X 5C08B 5A6LA 1RUQH 1NFKA 4N85A 5DSCB 1OTSC 2X1XR 3FU6A 1U8QA 3WO4B 4Z3IA 3H9YA 3CK0H 1QFPA 4TSAL 3WFBL 1HCZA 2AJZB 4NO3A 5CJOL 5E23A 2F9BT 4OVVA 1A7NH 3OXSB 4UT6H 2ZP0T 1Q9WA 1I8LA 3GSWB 3GK8H 3EBGA 4PRHD 5BZXA 4X4YB 1J5OH 5DC2A 4NAJA 1HOCB 1SMAA 1JWUB 1VPOL 4NN6B 2OLDA 2IPTL 4TVPH 1DBKL 5EO9B 2WXIA 3S35X 3VMOA 5JR1H 3RIAK 1JZ8A 2BOBA 3QHFH 1ET5A 4XXCC 5CEXB 1ITBB 1I3GL 4GRLB 3BT0A 4V1DB 5IIEB 4ZMLA 2VDRB 4ELKB 2XQYA 2YUVA 3L3OC 3QC6X 4G8GB 4L3AA 2ZPKH 2XYCA 3GQFA 1E2VA 2DN7A 4KGJA 2FYYA 4Y1AB 3CC1A 2DQTL 1I8MA 3K0YA 2AJ3A 3EGDB 3PPEA 1CURA 4OLUL 2D3JA 3SGEH 1CR9L 1WE5A 4LK4A 2DKUA 3HBZA 1R19A 2OMTB 3QUKB 4OB5L 3HLAB 4JGUA 2JELH 1GOHA 4KZDH 5CN3A 1USQA 1XSJA 2KERA 4XBGB 1N5AB 3HZKB 5HPMB 2G75B 3W57A 4DGVL 2ZKXA 1I3VA 4NPYA 4CSTA 4OU3A 3EHBC 1TQBB 4JAMA 4PGCA 2MQ3A 2WZ5A 4YL4A 4BFOA 4R90L 2ORBL 2X1OA 4ZMZA 5E0QA 4F7MB 1YSOA 4H0IA 4OIIL 1YC8A 4BFNA 2O61A 1HL4A 1GIGH 3UTQA 2PXYD 1RZKH 5IBTH 3IS0X 1AQ8A 1HHHB 3MXVL 4EMZA 3LRLA 2X4QB 3QZOA 4FFZL 5KUKA 1GA2A 2APBA 2CRYA 2GUYA 3MRBA 2ICEB 2ZSWB 4OLWL 3FQNB 1NCAH 2A6JB 3CHSA 2EDKA 1P4IL 4JFDE 4E9XA 1KJVB 1KYOK 4JGMA 3B2DC 1OP3K 1YMHA 2HFGL 3ES6A 1IGIL 1FCGA 5KSAD 4MZ3A 1YEDA 5DWPA 3EDFA 3O8XD 2GG1A 1JGUH 1W0VB 1NGWB 3NA4A 1OP4A 2HKHL 1ZA3A 2NY2D 3TEZA 3SKUD 4P4KC 1BXVA 5DSCA 3KW8A 5IW1A 2IQ9H 4F7PB 2WCSA 5EBMB 1IKFH 2QSTA 4I48B 3KLHC 3DXAB 5HHNA 2AJZA 4DERA 3BQVA 1E5ZA 1ZD6A 3L48A 1UVQA 3FKUS 1DUZA 3SBWA 1HT6A 1EFXA 1ZAGA 4LSSH 4TKWA 1K8DA 5D2NB 1OZTG 2B1HH 4Y4KA 2G0KA 1O6TA 5E5MA 4CA4A 4WHYH 3LIUA 1UUSA 1VZHA 5IWLA 5CEZE 4F27A 4R8WL 1Z3GH 4P2RA 4PV1C 1HSAB 2J57A 4JO3L 2C1PB 5EOQL 4DCQB 3LS5H 2MFNA 2XVKA 3H7LA 3A23A 3D07A 3PQYB 4LSPH 4GRLA 5IW6B 4KVPA 1SQ2N 4Z0BH 4ELKA 1BIHA 3IDNB 5DURB 1II4E 5ITBL 3JTBA 2DQGH 2KUTA 4FCAA 1QSFD 2H9GA 5LN8A 1MJJA 1FNSH 4WO4A 4HUMB 5F89A 3BIKA 1ETA1 1F97A 5H94B 5GS0D 1IAMA 1F8TL 3LRKA 1ACYL 3SE3A 1EJOH 1OE2A 3HLAA 1JG9A 4PS8A 5A2LH 3ULUE 2VQ1B 5E1GA 5D1QA 4BKLB 4WEUD 3SIKA 4N8CH 3OKEB 1QFUL 3ZE0E 5IFAL 3HZKA 1T0MA 4YIQA 3ZMNA 1DHKA 1J5HA 2G75A 2V6HA 5AOMA 2V2WA 5KTEL 5AVQB 5E1AB 1DO5A 4U3CA 4M8VA 3U4EB 3VXRD 1LNUB 1GVIA 1NAMH 1NKGA 5HJ3A 3U9UB 5E6ID 4ZW8A 1MKFA 4W9IC 2F6AA 5E8PA 2XWTB 3U2JA 3MRPA 2YOAA 1X5YA 3RI5F 1MWAL 4JPQA 2A6IB 5G55A 1I9IL 2ZG2A 5C2BL 3NIFB 2X4QA 5KYXB 3MV11 1NCGA 5AUMB 2EXYD 3FQNA 3AAZB 4N3UA 3ZDZF 3BWSA 3BH9B 1K5WA 2EDJA 2JIXB 1KJVA 2VDLL 5DK3A 2VSKB 4PJ7E 4HH8A 2Z8SA 3AS1A 1M7DB 2HLEB 7CGTA 4K5PA 4P05A 4WWKB 4PCSA 1MQKL 2GHWB 4TMPA 5AW2B 1NZRA 4LPUA 2L0DA 3N91A 3FU8A 2VDNH 3DIVA 3MJ9L 3EO1B 1ZSDA 1BP3B 4XH2A 1KMGA 1EO8L 4DN3L 1JZGA 4XMUA 5D4HA 4UYQA 5F7EH 3R4RA 3B43A 2XWJB 4FXLA 3P9MB 2RFXB 2IH9A 3VI3E 3LNIA 3UMTA 1UZ8B 2VLKD 3BFOA 4X5XA 5D7SL 4FQ1H 4DVBB 4F57H 3QJTB 3LHPH 4DN4L 1AKJB 5BPPA 4R4BA 4CW1B 5EA0L 1F3RB 2VDMB 4RMTA 3LRMA 2R69L 2YQ3A 1CICD 2NW2B 2ZWSA 3IPFA 2C1PA 5EN3A 4G6FB 3K2KA 2G5UA 4QHLB 4BSWB 1FO0B 2NTSP 5C0GA 1IX2A 3UTTA 5EEYA 4L37B 3MNWA 5BVPH 1ZV5A 4CDHA 3UTTE 5F7DB 2VDOL 1H6TA 1P7KB 2WN3A 2R1WA 4HIPA 1KNOB 3W11C 4NJAH 2HKFL 3WNJA 1HWWA 3P77A 4QJ3B 5IHLB 5BQDA 3ARFC 3CPLA 3MNVA 4A37A 2H2PC 4X6DB 1JZDC 3U1SL 1P69B 1AP2B 3VTAA 4DF9A 5AZ2L 3SGKA 1NGQL 4WK2B 4BH8B 4F8LA 1TKWA 1ZK5A 3NFSH 4LCUA 3ZKND 5F72S 3LIZA 4MNHA 2IIJA 4GFTB 3NSYA 3B7UX 3S3PA 3U46B 4G3YH 3CBJB 4N68A 3DC0A 5DVOA 3MBWB 4XO8A 4N20A 4JY5H 1CPUA 1IGTB 4QRPE 1A9BB 5I1CH 3RZWA 4GIPD 3FQRB 4WW2C 1ZT4A 2XFXB 1MFEH 2L4OA 1JV5B 1U8NB 4F7KA 2XQ0A 4OLYH 3IGAA 4PJDF 3QIBA 2VXQL 3SEPA 1V10A 3W2DH 2DF3A 1P5UC 3DBSA 1UURA 3NN8A 2J1YA 3UO8B 2AXJA 1JZ4A 1NBQA 3V6BR 2F1EA 4YLQT 2TAAA 3AAZA 4M62L 4PUBL 1B4RA 4DGWC 4GP8B 2P24B 4JHAH 4NZFA 3BHBB 3SB3A 3CFMA 3EZ8A 3UTSA 1OGTB 4X98A 3TA3B 3M8OL 4ZFOL 1YNTA 1KLFB 3LPPA 1HHIB 4WWKA 3UTSE 2FJFB 4LKCB 4MXWH 4MCNA 3GXFA 4LLAA 3SO5A 3HCVA 3IDIB 1TJIH 1R17A 2FRGP 2WUBL 3EO1A 3VFUB 3T6QC 4E0RA 4IBYA 1ZLEA 2WWKT 2PYFA 4WI0A 4HJJL 2NZ9D 3Q9PA 3D50A 3MRKA 5A43C 3F85A 2RFXA 4B9JA 5T3XE 4M9OA 1K4CB 2XHNA 3VXQB 3HHMA 5I1JL 3JT2A 3EFOB 5EZJB 4J6IA 2OAAA 2WK2A 1WTLA 5IV2B 2Z1KA 1L3WA 3CH8A 1AHKA 2XSKA 4ANWA 3P11L 4RFOL 3QQXA 5ESAB 4P2OB 1C5DA 4HSQA 1LO4L 5DZNA 3FFCA 4BSWA 4JFFB 4H40A 3ESUF 4L37A 4NUQA 3OWEA 4KMQA 5L9DH 5PAZA 1CD1A 1D2OA 5ICUA 4BK4A 5ACZB 3GD1C 4P2QE 5IB3A 1P7KA 1U8CA 2F53B 4FL4B 3OKDA 4KKBD 4YC2C 2Z35A 1JGLL 2PO6C 1WZ1L 1HEZA 2ATPA 5E00A 3FK3A 3QBTB 2Q7YB 4FHKA 3FB6A 1JV2A 1AP2A 4XNZC 3MLRH 3S3BB 1XCTB 3GXNA 4TRPL 4WFGE 5GS2H 1OM3H 1FFPB 5MERB 3VFPA 3MROB 3LKRA 4P46B 5J3HD 1EHNA 1PKOA 1W6WA 3DO4A 3LMJH 3L3DA 1AZCA 2Q8BL 5LNGA 1CDGA 4PHXA 3S88L 32C2B 3PNWB 1SBBA 4FJYA 4YXKH 1IGTA 1S2EA 1AQDA 3J27A 1EHAA 3IU3B 3IMUA 1XEDA 1GKEA 3AXHA 3OAWA 4HU2A 1W2KT 4WGVB 3CHPA 5FYKL 4POZC 5IMOB 3DDFA 4X6EB 2XICA 2X5PA 4BFFA 1NGZA 4M00A 4PG2A 3KWVA 1CDYA 2ZT9C 1NIFA 1C08B 2FQEA 5AB0A 3BKCH 2UXTA 3VI4F 2QKIC 4RZCB 2XTLA 1FF5A 1ZV9A 4QT5A 3KVDD 2FATL 2AGJH 3SJVA 5I26A 3FCBA 3SOBH 4OJYA 4YSUA 4S1RL 4XP5H 3SJVE 3BHBA 4K3EH 3LZFH 2IEPA 1EGJH 2YXVA 5CIPH 4QHUB 4XNQB 1TETL 3R7RA 1KLFA 1RZIB 1VFBA 4JN2B 3BZEA 4K5OA 2FJFA 4LKCA 4C59B 1INDH 3KR3H 2WXQA 3IDGA 3OR6A 2W0KA 1LVEA 3RNQB 4HKBB 4LCVA 3S4SA 3QAZB 2JFCA 3EDDA 4LSVL 3QJZA 5DT1L 5T5NG 1CS6A 2DQFB 1H15B 1F45A 4KV5E 4YHYC 2E4TA 4N2OA 1I7ZA 1NBVL 2VXVL 3I9PA 2NYKA 3QIWD 1B0IA 5AENA 5H35B 3EOTL 1CF8L 3QJQB 4WW1A 1GS8A 2VERN 1LEKB 1JF1B 5E94A 2WBJB 4MJ5B 1CFQB 1RZPA 4ODHL 1KGCD 1WT5A 5DMIH 1G0XA 3ZSTA 2NSQA 3EHBD 1A7QH 2F53A 5DJZA 4P23B 5EZOL 2MEJB 2GAZB 3EYFA 3EYVA 1ODUA 3PREA 3VYOA 2DWTA 2HX7A 4FFWC 4OD1H 3PXJA 1X7QB 4TUJB 3IS1X 2VAJA 4POYA 1G6RB 1UJ3C 2FB4H 4WENB 1D7CA 4OFIA 1RJYB 1MCOH 3CVHB 1XCTA 4M7ZB 4GEIA 1RK7A 4DO5A 2B5IB 3BZ4B 4YHNB 3GT6A 4C47A 3MROA 4LHUA 4QRUB 3QXDA 4OUUB 4PJGF 2Z31A 2ITFA 3M46A 2E7HA 4OCRL 2D03H 1ZHLB 2YD9A 4IRJC 5FK9B 1RZJL 1LE5B 5E9DD 1SBSL 4NNPH 1S3KL 3KNBB 4HMCA 2F15A 1TSRA 4UT9A 5CGBA 4P4KD 4WTZA 2R29A 1S7QA 3VU1A 3PABA 4HLEA 3JVGC 3O6ML 3KLHD 1E6OL 1OAQL 4TNWK 3ZRCC 2CRIA 1KIUA 2CBTA 5GSRA 5ICYB 3ILPA 4AKOA 1N6UA 3BO8B 1VENA 2X6BA 2N4IA 4LOUD 2MTPA 2AK1H 3ABMB 2XX1A 3DI3B 1QUNB 4M8UA 1AGFA 1RZFL 4LLWB 1SY6A 2VDRL 3Q6FA 4Q6IB 4I2XE 3NCBB 3KWWB 4P9MH 2HPTA 1QATA 2WVUA 3ZZQA 3QQNA 3WUWB 4QO1B 3MRDA 2HWZL 3LD8B 1IUZA 5FF6A 2Z65C 1HXMB 1H15A 4ZFGL 1S6NA 2GSGB 2NUPB 2X9ZA 2WSKA 3Q2CA 2Y7NA 3LH2L 1F0LA 5B1BB 3U7AA 3WSQL 5A6IA 5CSZB 1PZBA 1B0RB 1LILA 1IGMH 1QQDA 2RCSL 4I9XA 1UT2A 4HA1A 1RPUA 3ECBA 3B5HA 2DWXA 4MA1C 3I6KA 4XOAA 1CDCA 2CR6A 2WBJA 1F90H 2IAMA 4OQTH 1PZ3A 4NZUL 3T6ZA 5AOLA 3UAFA 3U9PH 5IR1A 4I4WB 3PWLB 3OX8B 1PLBA 3IT8D 5DK2B 5EEWA 4RFEB 5DD3H 3LJ3A 4PWEA 5JW4R 1DZBA 2FGWL 5D6CA 2XA8H 3BD3A 1SXZA 4IK6A 4FYRA 3O2VL 3ML8A 4TS6A 4BFEA 4IOSD 2F5BL 2AXWA 3VYPA 3GBNL 4BGLA 5JIPA 2X38A 2WMPB 4EZKA 4FRWA 3IMWA 4KKAC 4JDTL 3EO9H 1SUHA 3B9DA 3WI9A 3MCLH 4N2NA 2O6DA 2Q9OA 4QRUA 4Z95L 1BQLL 1SEQH 5E56A 4OUUA 2WV3A 4IS6A 1BZ7B 2AJSH 1WC7B 2XACC 4QR7A 4DGUA 3BISA 4JQVC 1S9VA 4R2GC 5INCB 3QUZB 1QBMH 1TR7A 3HAEG 3VB8A 5EDXA 4NQCA 1A3QA 2WO3B 1KGJA 1BDYA 4QRFA 4I1PA 4NQCE 5F88B 3HBGA 4FXKB 5KSBA 2AV7A 1VADB 4CRPA 4OGZA 4H88H 4Z7IA 4G5AA 3RWJB 2AK4B 1QA9A 3SGJC 1IC0A 3RAJH 2BVOA 2GY5A 1KTKE 3BO8A 3BC9A 5KW9L 2E9WA 4FNPA 5MP6L 2WBWB 2PW1B 1FNFA 4ZUWA 2FBJL 3DMMB 4V2CB 5DJ0B 4NI3A 3O2DH 4KO7A 3V0GA 2DJMA 3U7YL 4IIQB 1U93A 5IJBC 4HUVA 4OCXL 1HOEA 4W9LC 1HQ4A 1P5VB 1QLEB 1F4HA 3SKNA 1N3NA 1O0VA 2Q76A 5DJDB 4C8XA 5TF0A 4NCC1 3W11D 1J0KA 4P3CL 1F3DJ 1U95B 2APSA 2WW8A 2VIRA 3ARFD 1S5IL 3MRGA 3O41A 3LIZL 4X4XB 2H2PD 5CSZA 4O9HH 3AADB 4H20H 4IDJL 3T4AA 4NBXB 4YLBA 2EE2A 5EBLA 5ID0B 2X70B 3LCYA 4JQIA 1EERB 1CBVL 1JPSL 3NFNA 1E4JA 4EBQH 1U21A 4ZMVA 2ZCHH 3QDGB 4PW4A 4M7KH 3FN3A 2O93L 3ZE1F 4K71C 2P5WB 2NXZC 4K8RH 1BF5A 2WQSA 4I4WA 4M03A 3PWLA 2NCMA 3B7TA 2AXGA 2D7NA 3B2PA 2F5AL 3CFKB 4MJIE 4KXAA 4WW2F 5C0BD 3TCTA 3OAYH 1LGVA 1IGJA 4TQ8A 1G7MA 4KKNA 2H4EA 4MLIA 1MHPL 1HU8A 2NT0A 2BVEA 4NZTH 4OBSA 4L4TB 2OFQA 4AYGA 1D3CA 4XP6L 1D9KA 1ROCA 3QPQD 1A4JB 2CQVA 2PWDA 5I76B 4ZJ9A 5I30H 1SJEA 3W0WD 3L5WB 4WO0A 5I1DB 5CWSA 2YAQA 5HVHC 3JWNH 4HUUB 5DRXA 3V0VB 2XY1A 1VGKA 2VMCA 3PV6A 2G60L 1BZ7A 1J1PH 3CVCA 5I8EB 3SODB 2VLLB 5IEKB 1U58B 2WLLA 3LS4H 3C6SB 1EXUA 3NEOA 3CPUA 1PJ9A 1FNEA 3L4YA 5G2NA 2ZG3A 2CO3A 3BFQG 2NR6A 4E9VA 2JJVA 3V79C 2XN9B 5C0AE 1ZLWK 3U36B 2CIKA 4IHBA 5JXAH 1CFNA 1RZGA 3VGAC 4KJYB 3QEHB 4ANUA 1UT1A 3CHXA 3Q2WA 2G9HB 3H7BA 1QSZA 2VDML 3RVUC 2WKLA 2ZX7A 1O6SA 1SDYA 4JPKH 5D7JB 3MGTA 5HHQB 1T5WA 5BO1H 1BZ9B 1FO0L 5IB1B 1DQQB 1KELH 1DO6A 1MREH 2A1WL 2PW1A 4YZFF 4OF8A 4XBPB 4WV1C 3K6FA 5E1QA 4P5KB 3BN3B 5GS1A 1AZUA 1UYWL 1ZT7B 2E56A 3UCRA 1KIRA 3RDTB 1I7UA 5C0DB 2GJ6B 4JFZH 3RBSA 3VQLA 3KBHE 4JFEB 1BFSA 1P5VA 1Y6MR 5C0CB 1QVOB 5DJDA 6PCYA 2WUCH 4JKLA 2CSPA 5DHXB 5E6SB 5TJWK 1FA4A 3QUYC 1D6VH 3UP1A 3CZNA 4IU3A 2PO6D 2FWOA 3QCVH 4GAGL 3FU7B 1AO7D 3JQOB 1A47A 4XNYL 1TQSA 2YPKA 4A7UA 5IMMA 2WBKA 1ETJA 4JUTA 1NFDA 5HY9B 1RURL 3JWDC 4QMEA 2V5TA 1IFGA 1NFDE 5HHME 3UBXG 4LU5L 2J8UE 1F4WH 4UZGA 4NQED 5IF0A 1MAML 4ODBD 5CO1A 1GW6A 5E99H 5F70A 4YWGL 3D4YA 3MNZA 4PJ9C 5L2KD 5LGJB 1NEZB 1COBA 1QAWA 1OGAB 4KV5F 3D85A 1XSIA 4R7DB 3RY6A 1BBDH 3N06B 4FZ8H 4XC1H 4LL1A 1QLFA 3ML9A 3QP3A 1XAKA 5SX4H 4ANKA 4BD4A 1DZ0A 3O0LA 4U1SB 3HS0A 4XNMB 1GHFL 1UXWB 1NCUA 4AIZB 1WVZA 1IAOB 2H32H 4R26L 2VL5B 1MCWM 4HUWB 3AQXA 4LLYA 4MNGE 4J39A 1TCRB 3A6BH 5AZUA 4F8TA 1KCUL 5A7BA 3OKNA 3S96A 3V0VA 3DHMA 4B41A 3K8MA 2MH4A 1NPUA 3GSNB 2VLLA 2HG0A 4V2BA 4AVJA 1U58A 2FAUA 1NL0H 2Q7NA 4JZJB 7PCYA 2E7CA 1J8HB 3E8UH 3IMRA 4Y16A 5AB9A 1IV8A 2I9LA 4X8XA 3BDBA 4WUKL 3P3UA 5EDSA 1UM5L 4Q6YA 3TEWA 3S3JA 3P40A 3BN9C 1S9XA 4NFBA 1XGTB 2P8LB 5ID1B 4AMXA 4E5XG 3QYMA 1H5BB 2O6FA 2W60B 4DEPB 1FSKB 4XAWL 4MA8H 3NCYS 3L1OH 3OB0H 4JQXA 2QTVA 4HOZA 3I6LD 4IM8A 5D7JA 1DBML 5DZJA 1EMTH 3V5DB 1BZ9A 2NQ3A 2PF6A 4L4VB 4TUKL 5KYNA 1F00I 4DESA 4PJ8B 2Z91B 4KKLC 2C9RA 4MNQD 5IB5B 5JUEH 4G9FA 3ISRA 5GGVY 3QWRD 3RDTA 4F20A 2RAMA 1UB6A 2GJ6A 5B3JF 4X9GA 4N2IA 4YFLI 3GMMB 1DCEA 4PLOB 3OB0K 1KPUA 5GS3A 2VR6A 3N9GH 4Q9BA 4GS7B 3N44F 2WY3B 2R1YB 3BQUA 3O2WH 4FFWD 4HJUA 4PJHB 1JZ7A 1S3RA 2BP8B 2ZNXA 4G9DA 2NSXA 1NC2B 2A4ZA 2AVFA 2BXZA 2WQVA 3KLAB 3QG6B 3MLWL 4L1HA 4CJ1A 4ZOBA 5DQDL 4DHLA 1Q94B 4XP4L 3P2BA 4F9LC 4QRTA 4OM1H 5EBWA 2J44A 2AAAA 5I0YA 1XX9C 1HE7A 4BH7A 3FQXB 2Z8RA 3WEAA 4MASA 3L08A 4Z7VA 5BJTA 3DSNB 3RJDA 5ANMB 5DVMA 1IE4A 1JDCA 1EO7A 1NANI 3L4UA 4LO9A 4Z7VE 3WEXA 3PWPD 1LE9B 3SJVD 4OQ1A 4FGMA 4AGLA 3V0EA 1D5IL 1OGAA 1AGEB 2BS8A 5DQ9B 1H9DA 2CHDA 2IG2L 3KYOB 1QO3B 1UXSB 5F0PB 3L81A 4MAUL 4FKKA 3U2IA 1JZEA 4UQ2B 4LHJB 4TTDC 4YDLC 4AEEA 4LF3B 3IJSA 1VEPA 3QRLA 4U1SA 4X6CA 2GITB 2YJLA 3QDMA 1IAOA 4ZXBC 4X6CE 2FHBA 4HEMA 4HIXL 3T0VA 4FAAB 2WTRB 4UQCA 3QDME 4ODXA 2YXMA 4CGUB 2NNCA 3ZGHA 5IFHH 1HS6A 3C08H 5IB4A 4BK5C 4RLDA 2XWXA 2X05A 4B3EA 5E4AA 4ADJA 4DT2A 1AH1A 2V7NA 4JZJA 3HG1A 3FZUC 2CAKA 3ULVF 1OF2B 4U6YB 4GG6F 4FABH 5DJCB 3VACA 2LTQB 3HG1E 5D7LD 5FWQA 3SKMB 1A4BA 5BS0E 1OAJA 2GVYA 3I75B 4WK0B 1P4LA 5DUML 1MCHA 3WXWL 2DIBA 3ULVD 2BX5A 2J6EA 4WU5A 3AUWB 3GBLA 2X4UA 5ID1A 2K0RA 5FO7B 3QARA 4GRWE 2UX7A 1G6VK 4EEEA 3RVXD 4NX0A 8CGTA 4GI8A 1IAII 3HR6A 5I1LA 5I23A 3MJ6A 4OZ4B 1BGXH 1RXLA 4UAHA 2P7TB 4N1EA 3DX9A 3D2UD 3MOQA 3VD9A 1FYTA 3DIFA 4U1HA 4YXHH 4ZPVA 4XPHL 3PAVA 5HYEA 3TOPA 4LPXA 3MRLB 5J6HA 3P02A 1MN4A 3O4OB 1TQVA 2X4SB 4QXWA 4Y8AA 1IILE 1G6RL 3AREB 4JVWA 2KL6A 4RQQA 3D12B 4MQ7A 2G30A 3VYNA 1YECL 2J88H 2P1YA 3CVHL 1BLIA 3X1EA 5JHDD 1R0AL 4PW9A 2QZQA 4H8WL 1OWRM 2NNFA 2OXGB 3ROOB 2BP8A 4Z0XA 4AX3A 1TZAA 2A6DA 3KW7A 2ZXCA 4J28A 5EPMA 3TCXA 1M71B 4X8CA 4CJ0A 4LAQH 3KVQA 1F02I 1SFHA 1XD0A 2CBQA 4AEIL 3CXHK 4UDTB 3QJVB 9CGTA 5TE4H 2EUXA 3FQXA 2EDMA 3D05A 2EVIA 1YJDL 2EDTA 3ZTEA 3TFBA 1JDAA 1OCOB 5BZDB 4N28A 5KAQG 1T1WB 2IVFC 4ANVA 3DVGB 4LEEA 4B53A 4U1LA 2DQHL 2VLMD 3GMNB 3LKQB 4GO9A 1AGEA 4MYPA 2B39A 4AC4A 4BINA 1JWMA 1B4JL 1A4KB 4LSTL 4UQ2A 4APQA 2CLVB 1U36A 3NT0A 4UNIA 4DUWA 5E08H 4FMKA 1U8IB 5H2BB 2XBZA 5ITFB 1OAYL 1XGQA 4DPCX 4NWTH 1MJUH 1NUGA 4OZHB 1SRDA 5EULV 4CUCA 2VR9A 1NGXB 1CGUA 4MA3B 5FW7A 1OSYA 1FDLL 4HJGB 3QEGL 4FG6D 5A2IH 1IRAY 4GXFA 1YYLL 1XF5A 5DUJA 1Z2KA 2RA1A 3QULA 2QV4A 5JW4M 5L7XH 5IJVB 4XMTA 5C2UB 1JZJA 3HBQA 4WEBL 2YUZA 2VO5A 3S36H 1SYSA 4AL8L 3QEUA 3C6LD 5T1JA 4ZQTA 4DW2H 3EJZC 4TL5A 1E4XH 2EDQA 4IBZA 3W39B 5HVFB 1BD2D 3OKMA 3R06B 2EIMB 2YPVH 2VZUA 3FO9B 1ZHKB 4KXZH 2IFFL 4Y2DC 3VFRA 5HHOB 1MH5A 1A3ZA 1JYVA 3BD5A 5FCSH 1EDYA 4F15B 2X4NA 2XTSA 3R1GL 2WQAA 4YE4H 4WWOA 2X6CA 3BDXA 1KCBA 4IRZH 4NO2B 3B1UA 5LXGH 1UG9A 2VXTH 4FQCH 5FPIA 5A16B 3NABH 5JIQA 3QZMA 2UYLB 4KDWA 3GDBA 4FJ6A 2NXZD 5DEZA 5T5NF 5FKPA 3VG9B 5LQBL 1G43A 1JRHI 3TV3L 1YVLA 1G9MC 2DIEA 3AREA 5LCVL 5AEAA 3STZA 3KG5A 3GDCA 4FQLH 4JVUA 2XKNA 2O30A 1N8OE 2KZBA 3GHEL 3U4AA 1PX3A 4HC1A 4JN1H 5DQJA 5IM7B 3PP4L 4LASH 1ZT1A 3LZPA 3T0AA 4TM9A 1HNGA 2BM3A 3AT9A 1GGCH 3BJ91 4OCSL 4W93A 4N8VB 3KYMA 2DJSA 2CGYA 4PGEB 5B7MA 4IMKC 1FL6A 1R3LA 4PY7B 4K15A 3SPHA 3O45A 1KYFA 3HI5H 4L3ED 1A21A 1QASA 5T1DL 3WY1A 4P07A 2YN3A 4WCYL 4A2DA 2EUVA 1ZIAA 3P4OB 2CU9A 5FGSA 3LKQA 3GMNA 3QNYB 1RULL 2JJTA 5IROA 1MFUA 2PR9A 1I1AA 1MI5A 3L9RB 3FQUB 1IM3B 2ZWZA 4M43H 3LQMA 2C8NA 3F62A 5FEBA 3O9WA 3QNZB 1MI5E 3IDMB 1T5KA 2AMUA 1KB5H 2HJLA 4KXCA 5FYLE 3TJEH 3GRBA 2W38A 4PRDB 5H2BA 4J8RA 5TPWH 3DOHA 3KLDA 3RVUD 3NA9L 3SPCA 5KYWA 3OR7A 1V27A 1PZUB 5E1IA 1G1YA 2J8UF 3T0XA 1KPVA 4NM4H 3ARDB 3NQKA 2OSYA 1LO5A 3AWGA 1HYRC 2VH5L 2W0PA 1WFOA 1QLEL 4A66A 5DI8A 4X0KB 4OLVH 5D2LB 3WNNA 2OZ4L 1KXQE 1M2VB 3Q9QA 4H26A 1J5IA 3NACL 1TO4A 3UC0L 2XWCA 3D0AA 3NZ8B 3RFZA 3QH3A 4JKKA 1C1EL 2D7TL 2XVGA 1LD9B 3K2MC 4I0KA 2ZOUA 4NN5C 3QUYD 2D7MA 5JIIA 3ZHKA 2X10A 4YNYA 2F7QA 4Y2NA 5ENWB 4JG1H 4UYPA 1ZWIB 4FERA 2C3WA 5ADOH 3MA9H 3V7AG 4PJ5A 1YY9D 5HDRA 3OHXA 4ZNCD 3T3MB 2GUOA 3MTRA 4PJ5E 4JO4L 2F08A 1G7LA 1ZTXH 5T1MA 1OHQA 4GAJL 4FFVC 1L5GB 4AZUA 1M7UA 2F8IA 3A6CH 4DOHE 2M8XA 4G1MA 1UUNA 4PJ9D 5T3ZE 2PTUA 1XIWA 4WDIB 4G6ML 3MV9B 1AXIB 4M6MH 3WUZA 5IM7A 2NNAA 3FTXA 2V8MA 5F0LB 3QJFA 3U4KA 5H37A 2ZZUT 2YPLA 2E75C 1FORH 2CHZA 2X9YA 3WKQA 2YD8A 1GZPB 5SWQB 2QADB 3FF7A 2Q3XA 1PNCA 4ODVH 4PRNA 3LY6A 1QNIA 3TNMA 5C92A 1YA5A 1BVLB 2DWDA 3AY4A 2A9BA 3ARGB 4NP4H 1GC1H 4ZO8A 1SVBA 2IALB 3WS3B 4HVBA 4GXVH 4FX5A 1PQZB 2WNGA 4XXDA 1OW0A 4YZWA 4N8PA 2JKJA 4PV9B 3KPMA 4HWBH 3IJ9A 4NPJA 1TQCC 4FI7A 2AERT 2HFFB 3QDHA 1E3XA 2YD0A 4P9HC 3BN9D 2ED7A 2NQDA 4HBCH 1OCCB 4PTTA 4XCEB 1SJMA 2PR4H 1HEJC 2CMRH 1L0PA 3MRNA 1FZKA 4PD4J 2JKWA 2JB6B 1I85A 3OGCB 4CU6A 2BSSA 1AZNA 3N42B 2A2QT 3ARDA 4XZUB 4XMLH 3CMOL 4YN3A 3GIZH 3R0MA 3TLRA 3ZGIA 2X1PA 4N6RA 3LXAA 1XF1A 4RNRB 5SWZB 1YUKB 3H8NA 3SDXA 1GAFH 1I8LC 3NGBB 3FSAA 2O26U 3IE4A 3V4VA 4IBVA 2R7EB 2GHZA 4U1IB 2IGFH 3T3PE 3FC8A 5TF1L 5GRUL 4Z3FA 2DM2A 5BRZD 4C56D 1AD0B 1HWHB 4NUGH 4FULA 2F2HA 1NAMB 3Q8CA 3PGCA 5E95B 2WXJA 4PR5B 1EZSA 3LZQA 5K9JH 2XTJE 5J12B 3DUSB 5D1XB 4HKZB 4UUJA 3L4VA 3O3AB 1UOVA 5E8EB 3CXDH 1TQWA 5E2JA 5LWYH 4L48A 4MMXB 1OANA 2Q3ZA 3VXUB 2G4EA 4PVNA 3GI8L 5FYKE 1AC0A 3GPEA 3D39D 4JY4B 3FH8A 3QAQA 3WHXA 4ZPTA 3OPZL 3GKWL 1I1FB 4WWPA 2GIXA 1U92B 1MF2H 4MDRA 1LP9B 1YDPA 2HJKB 4BZYA 4A6YH 3LEVH 2VDNB 1VCAA 2EDWA 3DA0A 4TTDD 5HJBA 3JYBA 3FRPB 3GLZA 4KXBA 5HYJD 5I2IB 3ZYIA 1YC7A 3SDCA 5FFLA 3GSNL 4ZXBD 1L9OA 1JOIA 2YIHA 1ORSA 1S7WB 2ITCB 3OSVA 1J10A 3ZRSA 4NQDB 1JD9A 1RJLB 9PCYA 3FTUA 3REWB 4D0CA 2YKLH 2V5MA 5D1ZC 2OK0H 4Z3EA 3MODH 3N43B 1S78C 3NIDF 4RISL 3FZUD 4MCYB 3KBFA 3N55A 3OMAB 4G71B 5FHAL 5FM4A 4HYTB 4A63A 4CN6A 1ZIBA 5K59F 1U2CA 3MA7B 2QPUA 4WU7A 2H7WA 4BIKA 3VH8G 4PJIB 1W80A 1E5AA 2DIJA 4GMTL 4Y4FA 1X6NA 2YZ8A 2IO5A 1E6JL 3H54A 4YFEA 4B0MM 2ZXBA 4YDNA 3GM0A 3OGCA 1TJMA 3KS0H 2LVCA 1GMIA 4NO0B 5CMAA 1DQDL 2LU7A 3MBED 4HOXA 5IQ7H 1RZJC 1BOYA 4WTXA 5TE6H 5FDYA 1AMYA 2CKBH 1EHKB 4M4RA 1UACL 2VCOA 4XI5D 3SQOL 1SVCP 4RGMC 3UP6A 5ISZA 2F7OA 4XNXH 3SBWC 4MKTA 4AQEA 3KGSA 4G7YH 2JKNA 4Y4KC 4A1RA 4U1IA 2JF1A 5LNEA 4ZYKA 1TVDA 1G7IB 5IWLC 5HDBB 1U3HA 2NY5L 1HYSC 4D9QD 4QHKI 4EUPB 4GW4B 4LPYA 4QAMB 3IU4H 2QPFA 3GGWA 3VRJB 3MRRA 3GSRB 5C08E 3HE6C 3O3AA 4XVJH 5I18H 4N2GA 3RNKA 1U8MB 2CH8A 2VMDA 5D7IB 5LGHH 1P0SE 1UWEH 2FH6A 2IAAC 5LG6A 3H3BC 4JO1L 2JTDA 4ZAKA 4WO4C 1OALA 4IBUA 2M2DA 1W9XA 1AQHA 4M6OH 4A7GA 3MV7B 2I5YL 1JXKA 1WBXA 3SE3C 3ULUC 1DSFH 4BBWA 1FAIL 3DLQR 5CCJA 4MDJA 1DSYA 4LIQH 5D1QC 2BDNL 3B2VL 1KC5H 1AQKH 4O2EB 3VE0A 1SJVA 3D08A 4QOKB 1FFQA 4P3DA 5FHBL 2DEYX 5IMLB 1U8JA 3MRQA 4HWZA 5IQMA 5FM5M 4JRXD 4B9KC 5I2IA 3MZGB 2GJRA 5F1NB 4V1DE 5HYIA 4FTVA 3CFEA 5E2UL 2WWNA 1LEIA 1M56B 4C54A 4G8GE 2CUHA 2NW3B 5HI4C 4NQDA 3HMWH 2OSLA 3IF1B 3L2LA 3LX9A 4RX4D 3BAXA 2Q87A 1A65A 2D31B 4CU7A 4AC2A 1A14L 3E3QC 2YD6A 1IBGH 1VESA 3APDA 1OTTC 2A4CA 25C8H 3OSKA 4EO5A 4MCZA 5HHVL 3ASNB 3FB8B 5FYJL 2P4AB 4Y5YB 5F7UA 3RVVD 2H8PA 4AZ8A 4RZKA 3OB8A 1Z9NA 3EXLA 2JJUA 1N59A 4FG0A 1CVRA 3EJZD 4EI5D 1QZ1A 4R4FH 3AG1B 1WPCA 4C55A 4KK8D 2KLSA 1F11B 4W4NA 1J48A 4IYKA 3TGXA 3BAKA 4Y2DD 1RUAH 3V7AE 3DARA 5GGRB 1IZKA 2HRPL 4ELMB 3VXTB 4NXKA 4P5MB 3X3GL 5HD8C 4F8OA 3BWZA 3WMSA 1DVFB 4LSRL 3B2MA 2CR0A 3GZPA 4ES8A 1CK0H 1VDGA 3MVSA 3KCWA 1MEXL 1FGVH 4HC1L 2HAZA 3U2SA 5C1MB 1W0WB 3CN1A 2Y1ZA 1KV3A 3MGOB 4F7CB 3NFPB 1KFAL 2ARJB 3D52A 5E2VL 4GW4A 1NCBL 1HEHC 1GH7A 1FIGL 3MRMA 4MDIB 4JDZA 1SOSA 1I7RB 4G5ZH 4G8IB 4HS8L 1FHNA 3VA2C 2ODHA 1XZ0A 4MA7L 4PRBB 4QD2E 1PDKB 1U0QA 2OQJA 4PRHB 2P44B 4AM0B 1GOFA 1HK6A 4IDLA 3BFWA 3EH4B 3ZZ1A 1QD0A 2A9MH 3MLXH 1WWCA 4XGZB 1WF5A 2ZYHA 1MWOA 2R2HA 3L1FA 3SGKC 3TBTA 1PKQE 2HRHA 2J43A 5CIPB 1SYVB 3CZGA 1MOEA 3GSOB 2HN7A 3VFWA 1OCWH 3TT1H 2EDBA 3W9DB 2LAAA 3MYJA 4UM9B 3O3DB 2YK1L 4NN7B 4HLZH 2DYPD 3BP7A 4CBPA 2LE9A 4PGBB 3BD4A 3GSUB 3EDKA 3PQYE 5J6GA 2VZ1A 1MELA 5F1NA 2BNQA 2WIIA 3GSXA 2YA2A 2Y25A 4OVUA 2W95A 1VFMA 1CXIA 4RA0C 5J56B 4UTBA 1KWGA 2KZKA 3U4BL 4N2FA 3D18B 1BQKA 5DLMH 3X14A 3QIBC 3ZT5A 5GGUA 4YSCA 5KANI 4JM2A 1F3JB 1P4BH 3QWOB 1IGCL 4KRPC 1UKTA 5DEGA 4A2GA 2V9TA 1Z9MA 5IVXB 1AYOA 4Y5YA 5F7MC 2LHAA 1SF3A 2J2ZA 1R6VA 1HTYA 3IPEA 1PL3A 3D69A 3FFDA 5T5FL 2O6PA 1AZBA 2YBGA 3NCYP 1AZZC 3RJQB 2V2XB 3TEXA 3CX5K 1YY8A 1Y6NR 3SBPA 5J5EA 3TX4A 1BMWA 3MNMA 4AMKH 3JYCA 4OKVB 2PXYB 5GGQL 2EIZB 4LLMA 3DX6A 4AIXA 2B4CC 1MFVA 1N4XL 4EN3A 3GS4A 2YOCA 4L9DA 3O11B 4DKEL 3CU1A 1A0QH 1NGPH 3SDAD 3A67H 3NEXA 5J11B 4JRYB 4R3SB 1SHSA 1Q0XH 3BKJH 4PJEA 2RQ8A 4X7SH 5DUBA 3O8XB 1RUQL 5CFHA 2PN5A 2WO2B 2FH8A 3PAZA 5EZPA 3CK0L 3KXFD 3RYMA 1T0PB 4UT6L 3VWJB 3AS3A 5T1LD 4FFYA 3LZRA 1MY5A 1ZHBA 3GK8L 1J5OL 1TZHA 1RI8A 3I9IA 1J11A 3G5ZA 4PLKC 3AXIA 2R59A 2ZUQC 4TVPL 5C07D 5JR1L 1UXMA 4WFHE 5DTFA 1KTDB 1JUFA 1QRND 3C09C 5CZRA 2D7PA 4XWGH 4OZIB 3AXLB 4L3CB 5FO9B 1RK0B 3IDUA 4OW6A 3V2AR 1S7VA 5GJSH 5E1HB 1DEDA 1MCNA 2VLRD 3T3PF 3C60A 5J13C 4GT7A 3RGVD 1LO3H 3TYFA 1R75A 3F12A 2ZPKL 4G8AC 3V0FA 3WY2A 3MRIA 2H6OA 4PGBA 4HK0A 3FB5B 3GSUA 2OX5A 4Y1TA 1QSFB 2JB5H 4QRQB 1BEYH 1IVLA 1FP5A 1C9SA 5CF3A 5C8JA 3IVKB 3WUWG 2F8OA 4H0GA 2JELL 4RDBA 4A39A 4KZDL 1MLBA 5SWSD 3D18A 3IKCA 4PG2C 1MRDH 5HDWA 4ZI8A 2EDDA 1E9PA 4ZUTB 1LO0H 4M5YH 3II2A 1XCQB 2TSBA 3QQ3B 4AXWA 1WZLA 4KFZC 4NQVB 1NQBA 3QI9B 3SHSA 4LLQB 4DKDC 2X4RA 1QTSA 4P2CG 4JNXA 1F18A 3BEVB 2RACA 3SKOA 2CDEB 3VXRB 2WCGA 1HILA 4G72B 2ZUWA 3JV4A 1RZKL 5IBTL 2V5RA 5M95B 2G3NA 3HHRB 1L7IL 2EXTA 1HL9A 2WKOF 5JDSA 1NCAL 5I1GL 3T8XB 5CAYB 3DX2A 1U42A 3BDYH 2YD1A 4NWUH 3W9EB 4JCLA 3LN5B 1TVHB 1J05B 4LAJH 3RL2A 3G5WA 3KJ6H 1JDDA 2QQLL 3AB0B 3Q3GB 2IF7A 3Q01A 3K71A 43C9A 1AGCB 1Q1JH 4JRYA 1JGUL 3LQZA 1O9ZA 1K3ZA 1Z0MA 4JDVA 5DEFA 2IQ9L 2B8OT 1IKFL 4M1DH 3T0EA 2NLJB 4Z3GA 4AT6A 3RDJA 3T0EE 1WT5C 3VFNB 2E9JA 2XC8A 2HLAA 3A4EA 2PABA 4NC1E 4ABVA 4LSSL 3H85A 1PIFA 2B1HL 2VYRE 4L8DA 4PJBA 4S10A 2VLKB 1Z3GL 1M57B 2O5XH 3WY4A 2NY6D 2YC1A 2YAFA 3DHUA 1G7QB 3ZTCC 1HHKB 4L3CA 1FVCB 1U8LA 1UD2A 3LS5L 2V0AA 3TBYA 2IXQB 2FT8A 8FABB 4LSPL 3AVEA 2V3EA 2XG5B 1XBRA 4Z0BL 1KULA 4JK0D 4OAWB 4FQHB 1AS7A 2Z31C 3EF7A 4I0PA 4TNEA 1MW1A 4KHTH 2YBRB 5J1SC 1NBYA 1D5BB 1FNSL 2C3GA 3BVNA 4FQJH 4QRQA 2V9UA 2Y24A 3E1ZA 3PFQA 2Z34A 1EJOL 3GI9H 2ITEA 3WDJA 1UGNA 2AC0A 3NP3A 1KN4H 3RWDB 1XTLA 3L3HA 2AQNA 2ZXDA 3B37A 4N8CL 5FO8B 3FT4B 4L05A 2ESVA 1XWVA 3D25B 1Y0LB 2P8PB 4AKPA 1NKOA 2CLZA 3HZYA 3ESOA 2ESVE 3VWKB 1M42A 4BXSV 2E8ZA 4OQTA 1EFXD 1NAML 5I6PA 1AR1B 1XL6A 3NJIA 2CXGA 1FLTX 5F7AA 2R2BB 4EAEA 4P2RD 4CN4A 1NEUA 4GXUN 3ZT7A 3BKYH 1RCYA 1HYSD 4KX9A 3KPNB 1YAIA 2E7DA 4DP4X 3V4PH 4KNUA 2F54A 4GRLD 3CFBB 3CN4A 5D6DA 4Z5RB 3W9EA 3LN5A 4HMEA 3G5VA 2GBTA 5TFSL 5BCAA 1UWGH 1NC4A 2GT9A 2X3BA 3TNNB 2EQDA 4Y1AD 1I8KA 2YRPA 2VKWA 5IT2H 2IMMA 4ZFZA 1SLVA 5KJRH 1M1XA 2XWRA 3HFFA 4L23A 1BX2A 1CE1H 2VDNL 2WQUA 4CC0A 5IKCB 3CDYA 5DD1H 4G6AC 3AW5A 5D1QD 5F7EL 4Z1PA 2IAMC 2ZOOA 2EC9U 1OD7A 2ZX8A 4ANXA 4I5BB 4OF5A 2P3YA 3E0GA 2BERA 4FQ1L 5A2KH 3LHPL 3HPLA 2IOMA 2HVBA 1N68A 3NCJL 1QSVA 2BCMA 4EPSA 1A1MB 1PW3A 1G7QA 4PBXA 1HHKA 3K4DA 2CRZA 3PFUA 3Q1EA 4M7ZC 1OTTD 4JZOB 2XN1A 3MRJB 1HHJB 5F2FA 3FT1A 3LV3B 3LN4A 3RVWC 4NJAL 2E8YA 4E9YA 3A5VA 4C57C 4OLEA 1BG1A 1OARL 2LT9A 2XWZA 4YEEA 4X5WB 2TRHA 4NKDB 2YMXH 1XXFC 2JI3A 3O4LE 4RMWA 2KZWA 5I1AA 3MRFA 3FAXA 3HTLX 3ZG4A 3K8KA 5DDHA 4ZX4A 2R9HD 2E47A 3N2JA 1WD9A 5EO1B 3EGXB 35C8H 1SDDB 3RUGA 3H9SA 5KVEH 3F5WA 1QPPA 2DWEB 3DXAD 4H1LB 1S8DA 3E2HC 4G3YL 3WJMA 4HG4K 5KZCB 3H9SE 3K72B 5J9PA 4JY5L 4XHJC 5I74C 1CGWA 3N0AA 3VWKA 3L7EB 1DYZA 1UM6H 2QKSA 1T20B 4M7JH 4GJTB 4F3FB 1RMFH 1G9MH 5F7LB 1MFEL 3C8KB 4OLYL 5IEHB 2JI1A 5AZEH 1BV8A 4QRBA 3W2DL 1ZGLA 1H0DA 1KCRH 3MGAA 2UWEA 5C0EB 3K5SA 1UCBH 4PRIA 4QXTB 5DRWB 2VLJA 1FFOB 2UWEE 4Z7WA 4HK3N 5DHMC 4XRCA 4Z5RA 1P53A 4LVEA 2VLJE 4JHAL 2JKTM 4Z7WE 5DURD 3M7FB 1BSIA 2H32B 4NHCL 1CIUA 1JK8B 4B97A 5GRWA 4QRRA 4YDKH 5AAPA 1HFUA 4MXWL 3PWUA 1H3VA 4PGZA 1MCFA 4E2OA 2RALA 4KC3B 1XZWA 3T4AC 3DNKA 1TJIL 1XBDA 4AVKA 4MBRA 1BG9A 2E6PA 1MXDA 4AG4H 1HZKA 3DOSB 1BQ5A 4X7DC 3L3OB 1JWSB 5JYMA 5AW5B 4GKLA 2NUTA 4RMSA 3UAAA 4IEFB 2W9DH 2CJSA 5EU4B 1CTMA 3NIFF 2OJEB 2BSCA 4L8BB 2EEXA 3C2SA 1D9KC 2OMWA 5KVGH 4HIEA 3T2PA 2FEDC 5F1IB 2OR9H 5GZNA 3TVMA 4KRPD 5L9DL 1NAKH 4RAUB 4QPEA 4U05A 3IRPX 3LV3A 5JORB 1XMWA 5IHZB 4MS8C 1FAKT 1GGIH 3TH3T 5I16B 3KGUA 3MV8A 3EHBB 5HP5A 3IDJB 4X4MA 4YDMA 1A1OB 4JLRA 3NEEA 4PJAA 3T77B 4X5WA 5JOPD 4NKDA 4WWKD 4BWWA 4OGQC 2SEBB 2XJLA 5GPRA 2NR6C 4GY4A 3ZDYE 4QYOB 4AVIA 4U6XB 1KPRB 4QGTA 1SDDA 3PUCA 3T1WA 1AS6A 4YHZH 5C3LD 3LMJL 4XNBA 4X8JB 3FH7A 4UINH 3V8OA 3U0TA 3ASOB 2H0FA 3P3TA 2Q20A 2B1AH 4YXKL 2DLEA 4HS6A 3D4ZA 2ENPA 2NOYA 3ZMRA 3VXSA 3BAIA 2CO7B 3H0TB 4NNXB 3L4ZA 5GISH 4N9GA 4QGYA 3ZIMA 5HGHB 3HPJB 4X5PA 5JLZB 1JFQH 2LV4A 3WEMA 5CHNB 5E9DB 3SDYH 4ZD3H 5FKAA 5IEHA 3VO0A 4DP1X 1K3IA 2WLYA 5AKTA 5GS1C 3GMRA 4B96A 1OTUC 4C4KO 4DPBX 3BKCL 1V3KA 2BOCA 3RGBA 3FFCD 3TESA 4FQXA 3RE0A 3HBPA 1UJTA 1U8OA 4M48H 3SOBL 3CH1A 1GTNA 1ILSA 2AW2A 3G08A 1QFWI 4XP5L 3CDGB 3T1FA 1MIEH 4X6DF 3LZFL 5BMFL 1EGJL 4JHUA 1G7HB 4PLKD 5AOJA 3HMXH 2N7AA 3B3IA 4ZMOA 3L17A 1XGZA 4B0MB 2AK4E 1INDL 3KR3L 4X42A 1YEFH 2ED8A 2ZICA 4LSUL 3RGHA 4A2LA 4UM8B 4J4PA 3PGFH 4X9FA 4QJ5B 1BQHA 4IJTA 4XXCA 1YQVH 3K74B 4AI7A 2P43B 4I13B 4P9HH 4WTQA 2HP4A 3DOSA 4KI5E 1FG2A 4TOYH 4YHLL 3P4LA 3PP3H 1JWSA 3CDCA 1J0JA 1WP6A 5AVSB 1AQMA 4EIZC 3P0VH 1YEKH 3NJKA 4IEFA 2A9CA 4Z76B 5EU4A 5E4EC 3S36X 5ERWA 4OFQA 3RY6C 3SY0B 3PWVA 4L8BA 1YPZB 5AG9A 4U1NA 3NH7H 5JHLH 2IDQA 3HS0C 4B9PA 3BP5A 5EN2B 5FUOH 3F6IA 2ZF9A 3EJQA 4J3OH 5DMIL 2RR3A 4O2FB 2F58L 4XC3H 5JORA 1A7QL 1DCLA 3MFGB 7FABH 5I16A 4R5VA 3QDGE 4LLVB 5INDA 5AG8A 1YYMH 4OD1L 2X4OB 1I4FA 5C0IA 1JVOA 3TA3D 2P5WE 5F9DC 5JNYA 3TBVA 5EOTB 1QWNA 1EXHA 3LH9A 4UIKH 3VXMB 5KSVA 2KQNA 5ADPH 5MHSE 4Y16C 1OOWA 3DWTA 2VC2B 3L3KA 1AGBB 2ICCA 4AQAA 1GYAA 1TZIB 4JGNA 2HA1A 4N1CA 4X6FB 1HVXA 2GABA 3MOBH 3Q2LA 4P49A 3L3IB 3QO1B 5IG7A 1T5XA 2EO7A 4CSSA 2D03L 3LNEA 4JQXC 3W5MA 4NNPL 2ZXQA 3H0TA 3P69A 1XD1A 3FQWB 5L8KB 4WUUA 1MVFA 3CLWA 5CHNA 2MKLC 5A1AA 4WUUE 3EOBB 3VFTA 4IJ3C 5JMRA 2B3IA 5J57B 1BJMA 2YD3A 3C8HA 4PREA 3V10A 1W8EA 3RDTC 3UTPE 4JS7A 2VWEC 2XQYK 4HJIA 3SQBA 3VCLA 4CVZB 2DEXX 2J8OA 3WNLA 2OW7A 3QDGA 1U8HA 2XN9E 1N5YH 5HGBB 2CBMA 4YGVA 3CDGA 2F53D 2AK1L 2ZUXA 3GHBH 4W1TA 3DPDA 4YDJB 1C8QA 3BQUC 5AYUH 3R19A 1IIIA 3NK4A 4QHMB 3ATDA 1IQWH 4P9ML 1R1CA 5GQBA 2ADJB 1T83A 4TNVK 3RZCA 5EEXA 1CDBA 3GEWB 3ME0A 2NYZA 4GW5A 5DVKA 5AYTA 3REVA 1A3RL 4LHUD 2IANB 2FJGA 4EJ1C 3OQ3B 3DUUB 4F1SA 1RJZA 2ZX9A 3S6CA 2ZWYA 5GS0L 1HAUA 1CI5A 1IJ9A 3NRFA 3GIVA 1AGDA 4JY6B 1IGML 5C0CE 3ARFB 5LB1A 3HR5B 3TEYA 3TZVA 4F7EB 2ZKMX 3ARPA 2IPUK 3BMWA 3DSFH 1CL7I 3EJUA 3FUJA 2VAAA 1MCJA 1F90L 3DETC 3KJ4C 1JI1A 4EVNA 2YEZA 2EYRB 4J3TA 5EN2A 3OG4B 4YSOA 3U9PL 2VSMB 4TV3A 2BMKB 4MSWB 1EO5A 5AVRB 5DD3L 3EIFA 4JL1A 5CEZH 1THCA 2PCPA 4UIMA 1GR7A 1MUJA 1SUJA 5AOZA 5EU7E 3W82A 1MHCA 4GKNB 5C0BB 4TQEH 3ROLA 3F8UB 3ESNA 4LCCA 3RTQA 1CGXA 4BFGA 4E41E 3VXMA 4GW1B 3MUHL 2DOCA 1HH6B 3BZFB 3HNTH 1QSEB 3EO9L 3NTCH 4MMYA 3L9EA 4QTFA 2WXGA 2P5EA 3OBAA 3SDDA 1P5UB 3W0WB 1SEQL 1R46A 1XH3A 4A7VA 4R7LA 2P5EE 4PN6A 2F68X 4GKZA 4HGKC 1MFCH 3B5GA 3HE7A 4DKAA 1M6UA 2BINA 4O51B 2GFBA 3HW7A 4Y9FA 4UMSA 2AVGA 1QBML 1IAKA 3ULUH 1GGYA 1VFAA 2OI9C 5C70A 4AENB 5CCKH 1GS7A 1DN2A 5DYOA 2H26A 2A9NH 3H9HB 4ZUSA 3ZIYA 1HJCA 4H88L 5EEUA 2WBJD 1P2CB 4G6AD 2BCKB 3HZMB 1XB6A 4OBRA 2DI9A 4J3BA 3GMQB 3RAJL 3VXNB 5HYQB 4LCWA 3HUJB 2Y6TE 3AWEA 1FCCA 1KB5B 4P23D 2ZSVA 2J12B 1ZLVH 4LCWE 2UZXB 1A2YB 3FCTB 3WN6A 4LGRB 1UD4A 2EE9A 1SEBA 2DLHA 2YAPA 3ENEA 4M3HA 1TTRA 3MMEA 3O2DL 3VW3H 3BGAA 2FEEL 2WXFA 4ZDHA 3UERA 2C3VA 1LWRA 1MHEB 1ZLUK 1CE6B 3MACH 4L4VE 1ZHNA 2DQJH 5K39B 1ED3A 4WVRA 3EYUL 3GTVA 4U3SB 5F7FA 1MFMA 1UQSA 3HLKA 4YC2B 1MCPH 4O9HL 4H20L 1ZLVK 2PO6B 2DBLH 1X9UA 4K73A 1ILUA 3BGMA 1A5FH 4JEGB 4HX1B 2YPVA 1RHHA 3OMZA 5ICXB 4U1MB 4QCIA 3TS8A 4XNZB 4N90D 1GCFA 4M7KL 2EYRA 3Q8EA 4PJHE 4APQC 4OCLC 2W07A 3Q8FA 3B7RL 3UROR 1R34A 1YUHA 4LBEA 4ORZC 4XHJD 1KTLA 3FU9A 4IRZA 5DD0H 4GKOA 4BFIB 5J0BA 2MQGA 1B9KA 3QDJA 4GKNA 4U31A 5DRNA 1EH9A 4G43A 4CL7A 5L2KB 2LR4A 1AHWB 4NO5A 4NRZB 1CTOA 5A6MA 3ARRA 1TZOA 2LOEA 2MMXA 4NM8H 5EFIA 4L1BA 2RHEA 5I30L 2E0PA 1HH6A 2BNRE 2QT6A 4FP8H 5FCUL 1QSEA 3ZR5A 4NZ8A 1UT9A 1XF4A 4FYQA 2IWFA 3ARBA 5KS9B 3FHAA 4HWUA 4LNRA 2QKIB 1FNLA 4XP1H 2J8HA 3C5ZA 1J1PL 1DLHA 2NY3C 1H6UA 1AE6L 4LRIA 3I3BA 3LS4L 5E2TH 4QF1B 1XGRA 5IUCA 2QFPA 4APXB 4IOIB 2VJ0A 1R5VA 4NBZB 3RWGB 4HQQH 4A2HA 5DD6B 2ATKB 4M4PA 3L3JA 4MAYA 4YUEH 4HF5H 5JXAL 3H9HA 1JHTA 3IRZA 3GXTA 4R0LA 3I9GH 2JKIS 1IQDA 3CZJA 4FQQB 1SJHB 2H1PH 3BPCB 3GMQA 4LLUB 4C83B 5IJCC 1XGUB 4JPKL 3HUJA 4YHYB 5FB8B 2Z92B 1SLUA 5BO1L 4PRPA 1KELL 2Y6SC 1MREL 3STLB 4P8QA 1XF2B 1XTMA 5FYJE 3JWOC 3VFVB 4MRCA 1D9KD 1MJ7H 2FLRT 2NYYD 2WYIA 3F7YA 4JFQA 2YR3A 2FEDD 4JFZL 3N0PB 1FL5A 4DP2X 2AZUA 5EEZA 1E8YA 3UPRB 5K39A 2EP6A 2WUCL 2BW4A 1D6VL 4O00A 1FVDA 2XQBH 3MZTA 1UZ6F 3QCVL 4DFHA 1U8KB 1PPIA 1YEHL 5GIRA 3G9VA 3BP6A 3G3LA 3KEDA 3QUMA 2JJTC 4KKQA 4AMWA 2OCJA 2DMBA 2NXYC 1I1AC 2E3VA 5BUAA 3LB6C 2B4CH 2NR6D 5ICXA 1PIGA 1RSFA 1UJ3B 3MPCA 5T3XH 3HS8A 5DZPA 3O9WC 1SDAB 1F4WL 4JFPB 4YPGB 1D7BA 3NMEA 4GQRA 2IADA 1UB5B 2PTTB 5E99L 2R2EA 1Y7VA 4G42B 4H4NA 5TGBB 2X9WA 2A6KA 2C9XA 3INUH 4PJCA 1IBZA 3LRSB 1XR8B 1NMCC 2UUDH 2Y7QA 5GSVA 4AQ8A 2MSPA 3ZQDA 3PWPB 1BBDL 4IRJB 1AHWA 4FZ8L 4L5FE 5LAPA 4FNTA 3QRGH 3NJFA 3EBHA 5I17A 4ZK8A 3X12A 1OTUD 5EU5A 1K2DA 1BEXA 4RFNC 5DO2C 2Q6WB 3G5XB 5E4OA 2VL4A 3VD0A 3U0PB 3A6BL 5AW8B 4IKNA 3CDZA 4S11A 4A6YB 4BWTA 4OZGA 2H6UA 3RFZC 4GEJA 1MCCA 5GGTL 2QKIA 4D9RD 1N2RB 4JG9A 1NL0L 1E27A 5KG9B 1R3HA 3WIIH 2YKKA 2R56H 5CJ5A 1L0XA 3E8UL 3NRPA 4APXA 5ECJE 1ZMYA 1E3ZA 2FZ3A 2CIIB 3PDOA 5I66A 5KSUA 3DO7A 4BM7A 5DD6A 5I1HH 3OHXC 3BKMH 4YDZA 2WP3O 2BZ7A 3EYQC 1D6EB 4OTXH 2DYRB 5K93A 2Q2LA 4MA8L 4YBLC 3L1OL 3DRTA 4M93C 3CC5A 2V5YA 4BE6A 3MKGA 5CUSH 2FNBA 3BPCA 2FSEA 1WWBX 1HESA 1EMTL 2GJPA 2Z92A 1KXTA 4W9FC 1XIWC 3RA7H 5KBDA 1RK1B 3STLA 4Z78A 2NY7L 3D85D 4HEPA 3QQDB 2APXA 2XV2A 2XIBA 4H2CA 4UWQB 3PJLA 1UD3A 4DP6X 5JUEL 4GMSH 1PCXA 2CCLA 3NOIA 1BQUA 4KO5A 2AQ1A 3PGDA 5HHOE 1IGFH 3D2UB 1WH0A 1WISA 2CKBB 4MA1B 1N26A 1VKXB 2K8QA 5EZIL 4JDEB 4JHVA 1F6FB 3UPCA 1GPOL 1Y07A 1JBJA 1KCVH 4GQPH 3ZY7A 1CC3A 4UANA 3T0BA 3AY4C 1U8KA 3O2WL 3PRZA 1IT9H 3BW9B 3Q2NA 4MBOA 5HYFA 5JHDB 1B2YA 4DP7X 2EZ0C 1OW0C 2WSDA 4Y5VA 1EEZB 2VN5A 2VQTA 4Y16D 3MBXH 3PWJB 5DJYB 3X1NA 2DPKA 3UZEC 2BWDA 4BCZA 4NOFA 4PB0H 1SOXA 5L0QC 4P5TA 5MEOA 4EUPG 1I8IB 1CFSB 3O3EA 2LU5A 2D8KA 1RIHH 1UZGA 3UFIA 1A02N 3IJYA 2ZCKH 5D7JD 2MTZA 4IRJA 4R2GB 4V33A 5DFVD 4XB3A 1B6DA 4JM4H 2W81C 4M8QB 4U1GC 1BXAA 4U6TA 3ZSSA 2X4PA 4R7NA 1HI6B 4TVPE 3RWCB 4QY8B 4G9FD 4KNSA 4B9ZA 3RDTD 3SZ6A 2GJ6D 3GJFH