3VYPA

Crystal structure of mycobacterium tuberculosis l,d-transpeptidase ldtmt2-n140 adduct with meropenem
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
268
structure length
268
Chain Sequence
LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of L,D-transpeptidase LdtMt2 in complex with meropenem reveals the mechanism of carbapenem against Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords Probable conserved lipoprotein LPPS
total genus 74
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature ec 2.3.2.12: Peptidyltransferase.
pdb deposition date 2012-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 3vypA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vypA01
4GSQA 4QRAA 4QTFA 5DZPA 5DCCA 5DVPA 5DUJA 5E51A 5E5LA 5LB1A 4Z7AA 4A1KA 4ZFQA 5K69A 3TX4A 3VYPA 2MTZA 4A52A 4GSRA 4HUCA 5DC2A 3VYNA 3ZQDA 4JMXA 4A1IA 4HU2A 4LZHA 5DU7A 5LBGA 3U1PA 4A1JA 4QR7A 5E1GA 3ZGPA 4K73A 4QRBA 5D7HA 1ZATA 3ZG4A 4GSUA 1Y7MA 5E1IA 3U1QA 5DZJA 3VYOA 3VAEA 2HKLA 3TURA 4XVOA 4JMNA 4LPQA
chains in the Genus database with same CATH superfamily
3WS3B 1PX8A 2SEBB 4TLKA 4QCIA 1JOIA 8FABA 4BZ1A 1VDGA 2E6PA 5E51A 3FHQA 2W0FB 1G94A 2Z4QB 3HPLA 4PBXA 5D72H 4E9LA 1BQHG 3TCLA 1NZRA 2Z34A 1OGAD 2AQTA 1PX3A 2OW6A 4HSCX 4I0CC 4R4FL 1I8MA 3GBML 3GSQA 3NSJA 1MRFH 1FG2B 2Z1KA 1E4JA 3HAEB 3IMBA 3WFZA 3GDBA 3QZOA 3SKOB 2NQCA 3ZYOA 4HT1L 2FHFA 4E41D 2V2TB 1KBPA 2W95A 1R33A 2QADC 4PRDB 2Y36L 5C0CD 1U9KA 3DV6A 3STBA 1IUZA 2DV6A 4GQZA 3ULUH 3PJSB 1HQRB 2BSEA 3CMOH 3OLGA 4KKAD 4B9ZA 3CXFA 4EDWL 2B4CC 1NBQA 1PDKB 2MTAA 3NSYA 5JIQA 5AG8A 3ULVF 2P47B 2BZDA 4PR5B 4NUJB 1QI4A 3SODB 3HVDA 4OLYH 2DWTA 4NC0B 2CDEB 3VD1A 2EZ0D 2OYMA 1QEWB 2EDQA 1IC5L 2OTWB 3PE9A 3MRQA 3L5WA 1Y18A 4FEMA 3SPVB 5J9PA 2XQ0A 4WV1A 5I1CH 4RRPG 1UA6H 1BGXL 4FG2A 5DFVD 1QFHA 4LMQE 2CUIA 1HHHB 4GXVL 1SJEB 5E70A 2NPLX 4IS6B 1XSKA 4MAYD 3SKJH 1ZKAA 1DUYA 5T1KD 1EANA 1UT9A 2J1XA 3AS0A 4WJG3 1SOQA 3CUPB 4LASL 4NNXA 4F24A 3ARFC 3H42L 3S3SA 4XPHL 4MJHA 4LPWA 2CK0L 4WWPA 1GCYA 4JJ5A 2NOYA 2XICA 2AJ3B 2JB5H 1VFBB 4JFWA 3BSZL 4IBYA 3RE0A 3SY0B 1KJ2A 2VISB 1TQSA 2CJ3A 5AZ2H 1AD0A 4M3JA 1KTJA 5J6HA 3EH1A 1AZUA 4JRFA 1J18A 3WFEH 4XP9H 1PLBA 4NO3A 5ADOL 4V1DE 1GPOL 3LTVA 2OMVA 3CAFA 4PJHA 3GSOB 4ODTH 1UOLA 2DLGA 5TH2B 4JREB 1E9OA 3O4LA 4EE2A 4JO2H 4PJ7E 1UOKA 4IJTA 4N2BA 1BYNA 1UD3A 2JCCE 2AEOA 2OJZH 3GMPB 3L5HA 4GI9A 5C0JB 4Y4FB 2P8MA 3HI6L 4MMZA 5FO9B 1XGTA 4ZW7A 5LXVA 2PCXA 3WCYA 1IGML 1DCEA 1L9NA 1NAMH 4P4RA 5BZDB 1PZ5A 3CC1A 4YDKL 3STZA 1ZLUK 2X53A 3B9EA 4IU2A 4Z0BH 1KFGA 1KULA 3OAWA 4M7LL 3K6IA 1RPUA 3CFIC 3UEQA 5FA4A 1DO5A 3APNA 4LARL 5KBPA 2XWCA 4N0UA 4HCRL 1UGKA 4Q0XH 1TTUA 5C07B 4Y5XA 5CSZA 4JFXB 1PG7L 3FQRB 5INDB 2Y3AA 5KZCB 5LXGL 2BERA 3OB0H 4ONGL 2KL6A 3KPSE 3DRQB 3KYKH 4UIKL 5AD0A 1KY6A 1OGAA 3BFQG 2ZT9C 2VWEC 4YXLL 1GY2A 4JHVA 2YBRA 1SJMA 4ZFZA 3TIEB 5JIIA 2ROXA 1E6JL 2RJMA 5GZOC 3VXMB 4PJEE 5IEHB 1HT6A 2VERA 2C3VB 4F92B 4J3BA 2G9HA 3GGWA 4YFDB 1OARL 3P2DA 5HYFA 3X11A 2JIXD 1J8HA 1I7ZA 3TPKA 2N3JA 1QW8A 3HEIB 2GITB 1EAOA 1HFUA 4PYGA 1I1AD 5SWQA 2WSPA 3NJLA 2WCSA 4FKKA 5FHBL 4AE1A 2VDKH 2UY6A 2QSCH 3GMLB 1XEDA 4QD2E 1XL4A 3KLQA 3U0WH 3RA7L 5AB0A 1FNLA 2FE0A 4OR1A 1VCBC 3QXUA 4OUUB 5IHUH 4OIIL 4FG6C 1BM3H 2BOBA 4DP7X 4FHJA 4F15B 1MCIA 4B0MB 1FRGL 4X6DA 5DJZB 2Q87A 4BA8A 1F8TH 4ZW5A 1GC1C 4F93B 3SO3B 3BEVA 4QXGH 1NCWH 4CVWA 1EHXA 3MV9A 5CHNB 4P2OB 1LEGB 1PCSA 5CKAA 4I48A 1KCKA 2EIMB 2WWKO 4UM9A 4ZPVB 4IQHA 4TTDC 2NW2A 3WFCL 2W9DH 1M7UA 3HMWH 3QJFA 4NM4H 1NGPL 2WIIB 2WQWA 1J9CT 5FGCE 2JTYA 2BVQB 2NY1D 1PVHA 2OXGB 4WI0A 2J8HA 4W1TA 1IGJA 2IH3B 3AG4B 1KXVC 3VWJA 3K71A 1OW0A 3K2MC 3MOAH 2W8CA 3KNBB 1X6NA 2WAHA 4CADB 4U6VH 3L6FB 3TH4T 4BKSC 3IFNH 2HFFB 4HKBA 1S7WA 2EABA 1HHJA 2YFOA 3AG1B 2PLTA 4BWUA 1Q1JL 3D87B 3K6DA 1KCUH 1BZEA 5I6LA 2FLRT 1A4KB 2IOOA 3R4DA 3MNDA 5EUOE 3EGSA 4LU5H 4M8QA 1FL6A 1WFMA 2E47A 2F7QA 1QX1A 2B1AH 2WLLA 2Y1YA 4JN1H 4M1CD 5GGSB 4EUPA 5CEXB 4IBUA 2MOQA 4X5RA 1TO5A 4HC1H 2ENYA 1Z5LA 2XQYA 4K4KA 4H7VA 3Q48A 3TNMA 2VRAA 2ZKHH 1LWHA 5D1XD 5AYUL 2C9AA 3NIDB 2R0WL 4X7FC 3ILDA 5CS7A 2KI6A 2QR0A 5IHZB 3QFJE 3ZKQD 1J8RA 1DBAL 2EXTA 1L9OA 2WVSA 4AX3A 4TRPL 1KT2A 2ZPKH 2BVPB 4BKTC 4IJ3C 1JYWA 4AEHL 3JTBA 1T2JA 3FFDA 4CDGC 5IVZB 1TEFA 3RUGE 2XWXA 1ASPA 1R75A 3F04A 4XNXH 5D1ZI 1NC2B 5IR1A 1HINH 1KB5H 1J1OH 1JZHA 2HLAB 2XA8L 5HYJD 3L3DA 3RGHA 4PIBA 3RWGA 3WKQA 4KK8C 3FTYA 4LAQH 1DJHA 5CCKL 4IGBA 4MJIE 3TWCL 3WLWC 5C86A 3MRPB 3ULVC 5GRWA 1L9PA 1AP2B 3HI1B 2H6UA 3HFMH 1QYGL 5DI8A 2B2XL 3MV8B 4FL4C 2H8PA 4RGNC 3SKUD 3PHOA 4YFEA 1CL7I 4LPVA 3HFFA 3AQDA 4DFIA 3DWTA 2J1YA 3L2MA 3L08A 2L8AA 1TTFA 4OGYL 3WNKA 3ETSA 4I3SL 4YHOL 4AL8L 3WTXA 1T21B 3UP6A 2WMPA 4GSQA 2ICWJ 1MFDH 1KB5B 3QDMD 4NZRL 2DJSA 2G2RA 4O02H 5C09B 1OAJA 4HKXA 3OXRB 3KLSA 2Y3NA 4PGDA 3QIWA 5JHMA 1WBXB 2NSMA 1G9MC 2I5YL 4Y1AB 1IT9L 2P5WE 1EZSA 1ZHKB 4YGVB 4NN7B 3EDJA 3C6LD 3WY1A 5K93A 3CFKA 4PJFF 4N8PA 3KCPA 3X3GL 3DYMA 5DHEA 3RY6A 5E94A 3AROA 4X5WA 2H6PA 4OD2B 3MAWA 5KVEH 4PWKA 4AG4H 4OF8A 4NQCB 1DVFB 1Q94A 2QHRL 1F6AB 4UMGA 4IKIA 1KWGA 3IPFA 5HGAA 3KPSD 3EH5B 2UZXA 2EP6A 3K4ZA 4Y1TA 1TCMA 5GGVH 3EFFA 3NJNA 3VXOA 3LZLA 3MBEB 5IMKA 4NKMB 4HX1A 5AAMA 2ICEA 4OCXL 4OQTH 4RDBA 4B0MM 1NFAA 1FVDA 1ZSDA 1U2YA 3HMXA 3EW3B 2ATKB 1WBYA 1GOHA 1N6UA 2BSED 3FQUB 3FW6A 1ACZA 3MFGB 1F4WH 3BPCA 1TTRA 1JYNA 4ZD3H 5BS0A 4G1EA 4Y16C 1EXUA 3QRGH 4MVBD 4AKPA 4Q52A 4TVUA 2CA3A 2WYTA 2CJUL 3EYOB 1KLFA 1IM9A 3L3HA 4XX5A 2OI9C 3VWJC 3MUHL 3X14B 1KPRB 5ENWB 3F85A 1X4XA 2EJ1A 4AZ8B 4PRPB 4QTIH 3T0DA 1X7QB 2A38A 1T2XA 3P77B 1J9SA 1XF3A 2QDWA 4ORGB 4X9FA 4DAGL 5E8DL 2PUQT 3L4XA 3E0GA 5FECB 1HKLH 1S9YA 4WWNA 2F7IA 3N2JA 4NQCE 25C8L 4S1QH 3T0WA 1ROWA 3KJ6L 2X88A 2Z92B 1P84K 2A9ML 1KV3A 3ZDYF 1MNUL 3ZE1B 4XTRD 5L4MA 5CBAB 2BY1A 1HYSC 4F2FA 2EECA 1WZKA 2XJKA 4XVTL 3ESUF 3HMXH 2ZSWB 4EI5D 8CGTA 4HUNB 2JMRA 4WGVB 4XNMB 5T5NF 5E1GA 3HZKB 4EI5C 4N2LA 4ICWA 4RAHA 4FAAB 3IAPA 3OM3B 3FFCD 1EFXD 3WIIH 4DN3H 1JI1A 4BUQA 1NDMA 3J8F7 2X6MA 5TDPB 3DGGB 4QI3A 3BAYA 5HPOA 1NC4A 3JWDC 1EHNA 1N6VA 3BXNA 5TDNA 2PWEA 3T77A 2Q76B 3K80A 1X9RA 4JQIA 1JNLL 3LXCA 5MI0B 4G82A 4NZDA 2DQHH 3L3OC 1C5DA 1OAYL 4U6TA 2J72A 2YAPA 1U8JA 4LPCA 1HXMA 1XF2B 4TNGA 1ND0B 4E9XA 1BAFL 2XYBA 3T4AC 3OTTA 1QBLH 3VXUD 2ATPA 3ARVA 1TQCB 4RH4A 3SGEH 3V0GA 5JIDA 3GSUB 2X4NA 3S5LG 1MI5E 5ADPH 3QQ4B 1YNLH 5SV4A 4BRVA 1UJ3C 4JRXB 4G7RB 4K71B 4R3SA 2XG4B 3DK2A 4S2SA 1A9EA 4FTVA 1HIML 2DQEH 2FEDC 2QZ5A 3FCSB 3BRDA 2R4RL 5D7IA 4NUGL 3EDKA 2RBLA 5ID0A 1GSMA 1U8LA 3IXTA 4DVBB 2AMGA 2IH9A 2J57A 1AO7E 1H8OA 1HL9A 3Q06A 3KH3A 4HJUA 5CU9A 3NSFA 5GGRY 6TAAA 2NZ9D 4RZCB 4J39A 3GWJA 4MD0B 1R3HB 3BMVA 3CZSA 1HQ4A 4LSPL 5D7JA 1XT5A 4YL9A 3EFOA 5ETUB 5KAQF 4M6OH 5DYFA 4KNQA 4QRQA 4HYTB 4JMXA 2E5EA 1YEIH 5CILL 5DU7A 2LU7A 1UT2A 3P30L 1X7SA 2AEPL 4R26L 2NR6D 4RAVA 3ULUD 1JWSA 2BRQA 4DO6A 2FJUB 1HNFA 4HJJH 3PP4L 3WOVA 4AGMA 1F00I 1VFBA 3OR6B 3ATEA 4OZHF 1ONQB 3ZE0B 2K4WA 4G6KL 4L0ZA 1XAUA 1KFAH 4JRXE 1RCYA 4FG6D 2P42B 4U1KB 4B9KC 4DP1X 3BWAA 1YN7A 4N85A 3DX6A 4PJ5D 1ZANL 4Y9CA 5CN3A 4LOUC 2XTJD 3GTVA 1M2OA 2EYRA 3QORB 5JA8B 5JUEH 1NGZB 3OLEA 2FJSA 4GG8A 4K9EH 1A7RH 2FX8H 1YEDA 4AJVA 2PKDA 1S9XA 1AG0A 3DOHA 4Y2OB 1WZMA 4L05A 1YEJL 3D39E 3QWOA 3V4LA 1KJVA 1AR2A 1HL5A 4G80B 3ZDWA 3RZCD 1DSWA 1SMAA 3V4PH 2QLVB 2KBGA 5B8CB 4HU8A 5KSAD 3ZSTA 5F0MB 2P8MB 3SDXF 1NUGA 4LSQH 4QOKE 2DL2A 4X42A 4XO3A 5C6TH 3QUMA 1EXGA 1IGMH 3DV6B 3WTWA 3VYPA 3IYLW 1JZFA 2CJTA 3STZB 4PJ5E 3THMH 3TNNB 4A1IA 4GW5B 4C4UA 4HF5L 1MCWW 2X4UA 4X9YA 3T6VA 1ML0A 1S9KC 2JXMB 3EJUA 4LSSH 4PJ9B 4BRJA 5ID1A 3IU4L 5E6ZA 1NDTA 1NDGB 2FWUA 3QDJB 1NIAA 4P06A 5CCKH 1A6ZB 3MNVB 5E8OB 1T89A 1E3ZA 1T89C 3NABL 1ZOXA 3OG4B 1T7VA 1QP1A 5J12B 1MKFA 3DRQA 1EK3A 4NPJA 5AVYB 1ZXQA 1OSEA 1CT8A 1TFPA 3MRMB 1GZHA 1PAMA 2YBRB 4KDWA 3TIEA 1S7VA 3HZYB 4WWKB 4XVUC 4PJXB 5H94A 4E41E 3SQBB 5IOKA 3QJXA 3FB6A 5A2AA 2V2WA 2D7OA 1BQLL 5I30L 5DUPL 3MV7D 3VCLB 3VG9C 4BHUI 1LLAA 5C08E 2BNUB 4PS4H 3W11D 4MJ5A 4XP6L 1ACCA 3FO1A 1UASA 1AD0B 1II4E 4QTHB 1EDYA 1G4RA 2X4PB 3O41B 4Z7UA 4Q6IC 3QJSB 2DM7A 4NO3B 1OV8A 1E3XA 3NJFA 4XCFH 1JNHA 2BOBB 4PVLA 5EUOF 4BKLB 5MENA 3AAZB 3IKCB 3CNKA 4OM0H 5MERB 4QHUA 1OWWA 2VE6B 1WAAE 1FRGH 4F2EA 3W38A 1D5ZA 2H32H 2RR3A 5EBGA 1GIGH 2YXVA 3JBG7 1W9XA 3D3VE 2CR0A 1UD6A 3D2UD 3JT2A 2X1QA 1SYVB 2YOAA 4MMZB 5MHSE 3UOAB 4JR9H 1JVLA 1GS7A 2JKIS 4GW4A 2R51A 3IXAB 4XNQB 4LP5A 2Q2EB 3IDUA 1U3HB 4K7PL 1TVDA 3PQYB 3BP5A 3VWJB 2FYVA 4NB7A 5F1SA 5DD5H 3C60B 2YPVL 3C6LC 3IRPX 3DUSA 2BP3A 3RGVC 5IQOA 2XJLA 1HN1A 3IDIB 5DD3L 5CJ8A 1S7WB 3IFNL 4WW2C 3KVQA 3FQRA 1PZDA 4V11A 1OSPL 1DE4B 3TOPA 4NNPL 4J3OF 2RCSL 5FIEA 2FLBT 5SWZE 4PLJD 1PZSA 2WLLB 3HHRB 3FQWA 4PLJC 3CWGA 4KI5C 1TEYA 5FW6A 2ALAA 3LZQA 1FDLH 2R4SL 2R23A 1AGFB 1OK8A 1FFRA 1ZHBB 4K9EC 4M3HA 2P3YA 2G5RA 5FUOH 2AV1A 1R5VB 2HTLC 2YA1A 5FYKE 4LSVH 4UANA 3RX5A 5E95B 3HLKA 4F7CA 1J8HB 1F97A 1MNUH 3QZNA 1BAWA 5EBLB 3RWEA 2CIKB 4PJ8B 5EBMB 1ZV9A 4YEFA 2BSTB 3VRJA 4AEIL 4U1MA 2WQUA 2WZ6A 2VABB 1RZQA 3SQOL 5IVZA 2DWXA 2FBJH 2OTUB 1FYHB 4X4ZA 5E8NB 5C0DA 1K3IA 1ETB1 3UADA 1NC2A 1F1GA 1ZT7A 3S36H 4DZBA 4FN0A 3ZW3A 1NGQL 5CKGA 1BZQK 3ENEA 4X6EB 4LBAA 3B2VL 2Q6WA 5J0BA 2IDSA 1KSRA 1IGFL 3X1EA 5GZNC 1MUJB 4X6DB 2PABA 3X1FA 4NWTH 5DRNA 3O4LE 1JZDC 1FP5A 1F90H 1FZJA 4BH8A 3O3DA 1KBGH 3KPQA 4ZUUB 1OOAA 2KZBA 3IETB 3VFNB 3DVIA 4KRPD 1NGWB 1BD2B 4DW2H 4PV8B 2PCFA 4FQQB 5DEGB 4HH8A 5IUCA 2FB4L 2H26A 3A6CH 3QDHA 4AJWA 1LE9A 2OSYA 2GEQA 3MNZB 5JDJA 3QISA 2P5PA 4AV5A 4PJGA 3AREA 4JFFE 4RGOL 4P5MA 3QYCA 1NOAA 4FOMA 5KSVA 4P57B 3L9RA 4K5OA 3OV6A 3BPLC 3L6FA 5IF0A 4M62L 2FDBP 4E0RB 1L0QA 4FJ6A 2Y7SA 3DXAB 4X6CA 2YOCA 2ARJQ 4IIZA 4AYSA 1XBDA 3II3A 4R5TA 2NUTB 1RZJL 4NUGH 4QRRE 3OKMA 4DHLA 2AVGA 4LCCC 5EOTB 4NQCA 5KW9H 4WK0B 5AENA 2PWDA 1P6WA 5LDUA 4F80A 1G9NC 1T66C 3EO1A 3TCXA 4ZFOB 1C5CL 4YX2H 4JLRB 3I3BA 1CG9A 2ZOKB 2YRLA 2SODB 4WI4A 4JFEB 3CV5A 2IDTA 2NY3B 3H9ZA 5JPMC 2QSTA 5F7KC 4U4BA 3FT2A 1RMFH 4Z8FH 4OZIE 4JFFB 4JM4H 3HCVA 2CCLA 5T5FL 2ZF8A 1OT1A 3HB3B 2W9EL 4N9OB 3LNFA 4Y88A 4ZUVB 5J3HC 4NQEE 4LCUA 3QWNA 4LEOA 3UAJD 1W0VA 2K9FB 5DS8B 4ANWA 2Y23A 3WS3A 1E4XH 3B4NA 2AANA 3DNKA 3MJ7B 2EEFA 3ARZA 1SBSL 3PLYA 3QZLA 1C9SA 2XN9E 3SKJL 4YDZA 5DI8B 3EAKA 1VIWA 3NBNA 1CQKA 1T4KA 3AG3B 5B1AB 1A7QH 1XCXA 3D4ZA 1JV2A 5BV7B 2W81C 5A6LA 2NW3B 5KOVC 2G2NA 1GZQA 4GEIA 2WMPB 1LP9E 5JOFB 2ZD0A 1PAZA 1H6TA 2ZCHH 4HU2A 4MCZB 4OZFG 3V4PL 4P07A 2IBGA 2V5SA 3BSHA 5C2BL 5KYWA 5I0DA 1SM3H 1SQ2N 3HBGA 1TYRA 3WFEL 3HJ0A 3KS0J 3C2AH 1QNZL 2AXHA 4JKWA 4KJWD 2PTUA 2CJSA 4NKDB 4BUHA 1V7ML 3UPCA 5MENE 1BWMA 1JV5B 3HNVH 2P24B 1JVOA 5E08L 2EEXA 4YSDA 4ONFH 5BV7H 2A83B 2EE3A 4HUWB 1IZKA 4ZTEA 4JCWA 4PRAA 3WIHA 1SEQL 2DYPA 4AH2B 2LLGA 3QPQD 5B3NA 5CGMA 4J1UB 1AC0A 1AMXA 1QEWA 4MA7H 3BCFA 1EO5A 3NFNB 4R7DA 4GW1B 4WV1B 3SPGA 2Q20A 4FLOA 4NKOA 3PIQB 1HCYA 1HHHA 3BVXA 3QP3A 1I9JL 3QHFH 2UXTA 4EF3A 5EEYA 1JZ3A 2W9LA 2CKBH 3BC9A 4B96A 3HOGA 3MCLL 5K9JH 1HXYB 3BGMA 2ZOLB 3LRKA 1NAMB 5TPWL 2X6VA 1F02I 1KN4H 2NRDA 1HHKB 3FO9B 4XHQA 1QAWA 3N06B 1I82A 5F9DC 4GKZB 3S37H 3F62A 4DGYL 1B6DA 3NOIA 5ECGA 2VDRH 5DFWH 4ANVA 2F8OA 4OGAD 1XB8A 4IOIA 3E6HA 3GSVA 3HS0A 3JV6A 1BJMA 3UPAA 2QDVA 4QRBA 4WIQA 5DDHB 3DDFA 1KTLA 3IMTA 1A9EB 1X44A 4IOFD 2YXFA 2VXUL 2OQJB 4PMFA 5J5EA 3WY4A 2HB0A 2NUPB 2F2HA 3GJFB 3GBLA 3PDOA 2WGXA 3DO4A 4XCNB 5EU4A 3MLRH 3MRKA 5CLTA 5C0AE 1JYXA 3FCBA 3GB7A 4OY9A 1LYQA 5C0BD 4L5FH 3PGDB 3TO2A 1HJCA 1XMWA 4HALA 4L1DA 3VWKA 5SWSB 1E7VA 1ROCA 1BEYH 5EG6C 1NAKL 1UWYA 4MD0A 1PIGA 2VW7A 2Z92A 2ZICA 1AGEB 3BAEH 4HIHB 3AMLA 2P1YA 3AS1A 3ZGPA 1RP8A 1HC1A 3ESVF 4WY7H 1CXLA 1NM4A 1R17A 3K5RA 5E5MA 4QRQB 2NSXA 3QC5X 3VXRA 1U8NA 4YLQT 4WUUD 1JWSB 1A47A 3FOMA 3BAXA 2V17H 3LPPA 3FK3A 1XXFC 1DQKA 1RZKH 2L0DA 3ORJA 4QT5A 3WY2A 4ZMZA 3UEZA 1LGVA 3Q8CA 3QWQB 2FT7A 4I88A 3D12B 4GINA 1NEZG 4J28A 4N3UA 1JF5A 1UA6L 3RVVD 1ECZA 4R0LC 2C9VA 1GVIA 1OANA 1S78C 1XR8B 2BHFA 3IMVA 4UOZA 5GZOA 4UQ2B 3ASWA 1KMGA 5LBSH 2EXWD 2EQDA 1LK3L 2DQDH 2CQVA 5JUEL 4P2QE 1YEWA 3QGVA 3L5XH 3LB6C 4JHAL 5IGXL 3FONB 4K7FB 2CO2A 3DMMA 1U93B 3WJLA 4YDVB 3VFTA 3VFSB 3NVQA 2FCBA 3QWOB 3NGBB 5F1KC 4O2CB 3ZKMD 4G71B 2LOEA 4LQFL 1PEWA 2VMEA 5F3BA 1Q9KA 3QK0A 1AD9B 1PG7W 4MMXA 3ISYA 1GR7A 1EJOL 3IS0X 5EOCL 4FKEA 4HCRA 4NIYE 2NY5L 3SDCD 2CNZA 5FFLA 4AIEA 2YQBA 1ADWA 5D4IA 1JFQL 2AXGB 1KIPA 4W4NA 5I76B 2AJVL 1RJYB 2G3NA 1FYTD 5HYEA 3QA3B 4GJTB 2ENPA 3B2VH 4D0DA 2R2BB 3CPUA 1IGFH 5I23A 3GSNA 2X4SB 4Q56A 4FQHA 4NOBA 1A66A 3UIYA 2IQAA 1DBAH 4U6YB 4UNVA 1AHMA 3IPEA 3RL1B 4YE4L 4GBXB 4O2FA 4U3CA 3A6BH 2BVQA 4M8UA 1KBBA 3GZOA 2BJMH 2JVUA 3CQFA 3GRWL 2NNRA 3FB6B 4RAVB 1INQB 4L3EA 1J5IA 3FU5A 2GSIA 5E00A 5EU6B 2YAMA 4LE8A 4EN3C 2JB6A 5DVNA 1ED3B 1W0WA 3MA9H 3OR6A 4G9DB 4QJ4B 4PS4L 2WLYA 4J4PC 1CVRA 1LO3H 2ZKYA 3SDAD 3U4EA 3T0EA 1E40A 3RVWC 2MTZA 2A0LC 1KJ2L 3O6LH 4O51A 5I1IL 4IKNA 1JPTL 4Z7UB 4UIKH 2A6DB 4A66A 1G5AA 5SWZA 3FQ2A 1PCXA 4HZLA 5FO7B 1BOYA 3SEPA 1WAPA 3NEXA 4KTYA 1HSBA 1P69B 5GS2D 1SLVA 2X4TA 2NY2C 2YD4A 1CZ8L 4X4XB 5HYSA 3WJJC 1FN4A 3K0YA 1YMMD 2HTKD 2NY2D 2OV0A 4HA1A 1S9XB 4C54A 4JM2F 4M5ZH 4PJBA 1YNTA 3REVA 2V8LA 3ULUC 4HULB 3WLWD 3ULVD 3PJSA 5AFAA 5DVMA 3RHWF 6FABH 1KYUA 2BSSB 5LQBH 4GW4B 3MXWH 4N26A 2E9WA 5TE4H 4Z76A 1EFQA 4C59B 1ORQB 2WV3A 1FI8C 2GIMA 4H0LC 4GW5A 2UX7A 2IV8A 1TKWA 3L3DB 2OYKA 1EERB 2GIYA 4QRSA 1YY9C 2ADGA 3QZWB 1A6TA 1A7PL 4EZLA 2NY7H 2QHRH 2OL3H 4QTFA 3VGBA 4ZFFB 3FCUB 3QUZC 5C0IB 2NNAA 4XB8A 4XCCL 4N0YL 3HE6B 4PRBA 5I74C 3CIAA 4IS6A 4NO0A 4QRFA 4PD4J 5C0EB 4AEFA 2P80A 5AVWB 4P5TD 3D3VD 2X09A 4YHMH 2IC2A 3HG4A 4H1LA 1WC7B 5FO8B 3PGFL 1IILE 4Z77A 1GMIA 4K73A 1XGYL 1IAIL 4IHOA 5FGCB 1RZGA 4GKSB 2RB8A 4JO4H 4YDLB 4ONOA 3F6JA 5DJXA 4JY6A 1QA9B 1XH3A 4WWID 1AGFA 2Z35B 3QFJD 1KB9J 3ZE2B 5AZUA 1S6NA 4HKXB 1MREH 5BZXA 3P3YA 4XNUL 1KJ3L 4Z3EA 3QRGL 2HKFL 1BZ7B 3FQ1A 1FG9C 1E28B 2IXQA 5D2LB 4Y1AA 2BNUA 3ROOA 2BC4B 4LPUA 2HRLA 3ZSSA 4HS6B 1FLTX 4YGVA 4ZNEE 3LEYH 4ZXBA 2G75B 3C2AL 4UZSA 4LF3B 4KO5A 3AGVA 5I9QB 4LU5L 5KANG 1AIFA 4GUOA 3HNVL 4FQLH 4WUKH 5TH2A 3EYSH 1XWVA 4ONFL 5BV7L 4L0YA 1FQ9C 3HNTL 5DZAA 1FCGA 1WZAA 2A6IA 2GTZA 2GY7B 4LEXL 1MUJA 5F7LB 5FLUA 3SDXA 5KYYB 5BZWA 4M7ZB 3QZMA 4JZNB 4Y4FA 3F6LA 4NAJA 1MFEH 4RNRA 1D7DA 1BD2A 5C8JB 2J25A 3MZTA 4EQ3A 3QG6A 2XN0A 3MLYH 4IU2B 4CU7A 4NQED 4PI2A 1T22B 1QPXA 2PXYD 3ZDXB 3BPCB 3ZX1A 5DD0L 4PJGB 3LN4A 4N0UB 1KIRA 1EXUB 4M93B 5FA3B 4MNQE 1Z3GH 1OCCB 3M17B 5J6GA 3MTXA 4YZWA 3MLTB 1BP3B 2DQJL 1P7KA 3IDIA 4N5UA 5LN8A 4WSGA 2OBGA 2KPWA 5ANHA 1X7QA 2B77A 1T6BX 3D25B 4I0PB 1SUJA 1V55B 1U30A 1GJUA 1IFRA 2XWBB 5ALBH 2NX5A 1QABA 3GINA 1A8JH 2YRBA 3GRGA 5DHMC 3IFPA 5LCVH 4BFIB 2OR9L 3FUJA 1LO4H 5CFAA 1XBRA 1I7RB 2ALWA 5D1QB 5HHVL 3GHBH 4EIZC 1U8PA 4K3JL 1XZWA 1X3DA 3WJJA 1G7IB 3HG0A 3MZGB 2OI9B 5CMAA 2ICES 2QKIB 2IG2H 3RGVD 4Z7NE 1NMBH 3K91A 2XKNB 4OUUA 2DI8A 4MZRA 4UV4H 4V1DB 5HXMA 2PW2B 2OMZA 2X7LB 4E9TA 1YPZF 1SF5A 3TZVA 4QY8A 4AMKL 4RETB 3BSGA 3MGOB 1OQOA 3QEQD 4UWQB 5DK0B 3RWCA 3U1SH 2F08A 1I1RA 5F7FA 1SY6H 4ZUVA 4U7MA 1I9RH 3MSPA 1LEGA 1YEKL 3NIFE 4ILDA 1SBBA 1I9IH 5DS8A 2BP0B 1NBVH 1SJHB 1C5DB 1TMCB 4ZUUA 1J8KA 1PLCA 4LSRL 3IETA 4HGMA 3UJJL 1X5FA 3PXLA 1URZA 1YDPA 2P5EA 1O5PA 3M1OA 4PV8A 3LYRA 2BSBA 3UBHA 3ZGIA 2HLFD 4GUPB 1MXGA 5F1NB 1RK0A 5GS3A 2ATPB 2VM3A 4QRPE 1ITBB 1K85A 2X4NB 2Z6FA 3QIBA 2WLHA 3T6ZA 1N68A 2AJYL 4JFOA 5DO8A 5BW7C 3VG0H 1A64A 2OSXA 3D39D 1FNGB 1YLBB 3CDCA 3NJXA 2XG4A 3GIZH 5JXAL 3D34A 3KXFB 1U2HA 1S7TB 3ZLQC 4YHYC 1DEEA 3NEEA 3W0WB 3TV3L 3DTXA 3OQ3B 4RIRA 4KO9A 1JD9A 2L7JA 5EO9B 5CEXA 1FVCA 2A74B 4X6CB 5E4EC 5C1MB 4AGPA 1Z5LB 1I1AC 1RIHH 2ZSVA 2DEWX 2NUTA 5FPIA 2DYPB 4IHBA 2ETWA 5GGQL 5DQ9A 2R7EA 1WD8A 4ICXA 3F7YB 2C1PA 3MODH 5EOTA 1WBZA 1C08A 2QEJA 4YOKA 1WEJL 1ZWIB 4LPXA 5HSFA 1SLWA 3Q7JA 1HH6A 5EULV 2CHWA 1U8HA 4LLDA 5IQMA 2FGWH 1A6PA 2IGLA 5DCCA 4ZFOA 5KVGL 3FFDB 3OMNB 1FBIL 3HC3L 1JF1B 2EACA 2Y0SA 2GHWB 1F58L 2OW7A 2ZX6A 3BPOB 1KPUA 1JP5A 3L3OB 4UUJA 5CD5C 4YH6A 3PAVA 3WIIL 4DN3L 3W11C 2LLLA 2BX5A 2EVFA 1IZJA 5JW4N 2XQYK 3NA4A 5JIHA 5TJWK 4U1KA 4S1SH 2VKXA 5L7XH 2GJJA 3WIFB 1E3FA 4QGYA 1OAYH 5D55A 3TA3A 3QORA 5KBLA 4TSCH 4P2RA 1B6UA 2VDMB 4KVNH 1FFTB 2FEJA 2BIMA 3MLRL 2KHAA 5A40E 3FH5A 3TWYA 1B0GB 1CIDA 2EYTB 2J7LA 2NW3A 3NJIA 5EZOH 1E4WH 3BP4A 1RJCA 1SQMA 3BFOA 3VWKC 4ZOCA 5HDBE 2CHZA 1E27A 1TLKA 3HRZC 4X7TA 3ETBJ 3O0RH 1ZHKA 2XZAH 4NRYA 4HEPG 4FTVD 2IWGA 1J5OL 2F8XC 5AL8A 4YDNA 3VXQB 4OZHA 4NQDD 4W9ZA 5B4MC 1U8NB 1C12A 7FABH 3KYNB 2O30A 4IRZH 1TQUA 4JO3H 4N1CA 4HVBA 4UQIM 2H6PB 4OD2A 1KCSH 1LMIA 1OVZA 1PZBA 3M07A 4B5ZA 3FN9A 3OKDA 1A0QL 1TQTA 4PRAB 1F6AA 1J11A 4AMXA 3I9PA 1M7XA 4LK4A 4DKFH 1NDGA 1N70A 2OXHA 2XWZA 4HBCH 1BBJA 2K4AA 4XNZC 2OTPA 3MRGA 4OLUL 1DVYA 3BIKB 4TSAH 4NKOB 4PJCF 3DX9A 3LKRB 3EDDA 3N3EA 4J2QA 2JE8A 1Z5HA 1JSYA 3D9AL 5HHOB 1NOFA 4A1RA 1HXYA 2I9TA 3B8SA 2Q8BH 1IM3D 3FONA 4BZYA 3DMMB 3V4VA 2V3DA 3LN5B 1JRHH 2G4EA 4PRHD 3RNQA 3PGCA 1DQIA 4DEPB 1CLOL 4OSUL 3B3BA 4ZTOH 1EFXA 2A3TA 1KEGH 1IM9B 3UBXI 5FUZH 5KN5B 4BFNA 2EKSA 3ROLA 1J12A 5ENWA 3OZ9L 1JPGB 5IFJB 1XGQA 3LZOA 4A7GA 4ORGA 3NTCL 4FFVD 1K4CB 1K8IB 1ZEAL 2NCEA 4P9HC 3ZXAC 2AQSA 3BJLA 3EYSL 3KPRA 4HUXA 5E1HB 3EYUH 1AYOA 4D0DB 3JZYA 3TO2B 1OTSC 5JLZA 3HG1E 5HYIA 4LLWA 3IEAA 3CU7A 2Y22A 5SWSA 5IJKC 4XXWA 1CE6A 1RSFA 1LP9A 4WI7A 3BVUA 2OMXB 3WUZA 1GJWA 5HD8C 1AXTL 4G72B 1LE5B 3OPZH 2Y1AA 5E6UB 2PPFA 4XNMA 5I6PA 4Y0GA 4DZ8B 2CXKA 1BREA 2D3JA 3BH8B 4L4VB 2CRYA 4L29A 4N6RB 5IB3A 5FOJA 2D4FA 4OI9A 4ODXB 3JWDH 2HFGH 3PV6A 5F72S 5TDPA 1A5FH 2P48B 1DJZA 4J8RA 1D3CA 2R15A 3DO3A 3HZVB 3R0NA 3AU0A 4HKJB 4Z0XA 3MNWA 3SJVB 1Z3GL 2J44A 2FL5B 3NIGE 3VJ6B 2VERN 4YLBA 2Q76A 5E2UL 3T0EB 5BW7A 2JKTM 1R47A 4B5EA 5AB1A 4NNYB 2PP7A 3KBHE 1A3RH 3GI9H 1CGSH 1XR8A 2DBLL 3NT0A 5ITBL 3GM0A 5J1AA 5IKCA 2P43B 3Q8BA 4HZLB 4RRPA 5AAWC 4KAQL 4ZUTA 2NY1C 3K8MA 3W9DB 4O02B 4ZS6C 3ARXA 3DX7A 3RGBA 4Y16D 3V7AE 3V9CA 2ICEC 1G6RB 5DEFB 1JK9A 4TLUA 4K07A 3HR5A 2X89D 4L4TD 3ZL4H 1OTTD 4J6RH 1S5IH 4Y9GA 3D30A 2BCMA 4UT9L 5A2BA 2J5WA 2JKNA 1NIEA 2QPEB 5D9SA 1KNOA 3VFUB 3S5LB 1P9MC 4HD5A 3HRZB 3FCSA 1QSEA 3MRRA 4L37B 3NH7H 3CVBA 1FH2A 2FX7H 1N0XL 2VDNB 4N0CD 4Z7QB 2ZUYA 2CIIB 5F9WC 1JPSH 2AKRB 1MI5B 3UZVA 3LD8B 4ADJA 3U79A 4FXKC 2XQBL 3PWPA 2I32A 4KQ0A 3FN0L 4JO1L 2DQCH 2ZP0T 1DQLH 4FFYH 4LKXB 3O3DB 1JZJA 4W9KC 3AT0A 1ZGLB 1IC5H 4M4PA 3VFNA 5HYJE 4OCWH 4MA8H 4XP4L 5LGYA 1VADA 5HDBF 4HJSA 1FNFA 1NBVL 1DLHA 3E9UA 5D2NE 4U6YA 2D03L 1LE9B 2LE9A 5FO8A 1GS8A 4TN9A 5GIRA 3HG2A 4CN1A 4IHOB 3C8DA 1TZHA 5E56A 1H3GA 1P4BL 3O8XB 1OLLA 4Y4KB 2B15A 1AR1C 3E2HC 4IGBD 4YDKH 5KBMA 5E4AA 1H8NA 3H3PL 1DLFL 4O00A 5KSVB 3BPLB 4ZO8A 2XFXB 1CDGA 5CJQH 3QUXB 3VSTA 5SX4H 3U2SB 3EH3B 1QUNB 1AGCA 3IU3A 3L4ZA 4ZZFA 5HHQA 4K7PX 3U83A 5T1DL 3VD4A 4NQXA 4LF3A 2B5IC 4Q6IA 2OSLA 4LO9A 1H5BB 4CVXA 3CG8A 4H88L 4KVPA 5DZNA 5SWZB 4X83A 2CO4A 1MRCH 2WLJA 3DI3B 5FO7A 3L8QA 4FG4A 2FLMA 2W5PA 5EIIG 4XXCC 3L4CA 5D7LB 1C7TA 2ID5A 4CC4C 4G7SB 2PWFA 3KXFE 5GGQH 3FTWA 1QLFB 1JGLL 3G5ZB 3L3JA 4NC1E 4HMDA 4DGIL 3LHPH 1U0QA 2CPUA 5B38B 4AIZB 2DQGH 3OB0K 1R1CA 4JJHA 3KR3L 4ATTA 3ZHFA 3U1QA 4OCRL 3BE1H 4D8PA 3W1ZA 4PP1C 5TDOA 1OO2A 4UZGA 4ZQKB 2XCMC 5J11C 2UZIH 3ZTDC 3T04D 1EZVY 4H25B 3QEHA 4PJAA 4IIQA 5T5FA 2JFCA 5JDSB 5GSRA 1KIRB 1T0MB 5CZKA 5KVDH 2EINB 4LCUB 2ADGB 3QZWA 1OZUA 4DERA 3D0VA 4IOFC 3STLA 5K1NA 3UDWA 2B0SH 4PH8A 4O2EB 15C8L 4YSPA 5C0IA 2Z8VC 1CGUA 3HE6A 1MWAL 4NO0B 4CILA 1O7SA 2GFBB 2WAQA 2EDRA 1AACA 1TCRA 2ERJB 3H9SA 4HIPA 4LLQB 4WJ5A 3T3PE 3TO4D 3UP1A 2NXYD 1WC7A 3MV9D 3UACA 3QXAA 5C08B 1UG9A 3HMWL 3N6YA 1GZQB 2WC7A 5H4ZA 5ICYB 4KO6A 2NT1A 4JM2C 3WXWH 1OXYA 3RFZB 2YPLB 3WEXB 1EZUA 3FO1B 4U1NA 2R56L 3DIVA 3HUJB 4Z78B 1E2VA 2APSA 5DVKA 4D3CH 3R7QA 3KWUA 3W3BA 1ET7A 4FYQA 2ADFH 1ZIAA 3RQ3A 3HPJB 2MRYA 1HNGA 5FHBH 4I8DA 3UJIH 1JD7A 1EMTH 2G75A 3ULUL 5MP6L 3U0WL 2VLRA 4XBPA 3IKCA 3N42B 1N0LA 4DQOH 4OFIA 1K6QL 3RWCB 2NYKA 2XY2A 4XRCB 1SVZA 2ZOTA 4OLYL 3MLVH 4G3YL 3GK8L 5DO2C 3F58H 2OYLA 2QFPA 4RCAA 3SDDB 2CO1A 5I1CL 5L9DH 1BMWA 1BGXH 3CC5A 4W9LC 1X4YA 3WXVH 3BGMB 2FJGB 4WY7L 2Y7LA 3T0VA 2VC2L 5C8JA 1AH1A 4AV0A 1KLGA 2X9YA 3KGSA 1U6AL 5I5MA 1UH2A 5DZJA 1HHKA 3FO9A 1Q8MA 3DPBA 1F3JA 3AVEA 1A2YA 4CVUA 3SBWA 1F2QA 5AAMC 4PUBH 3LZRA 3KWWA 2AP2A 5JZ7D 5DK2B 2GUOA 2ADJB 3HKZA 4X7SH 4BDVB 4JY4B 3EJYD 3PL6C 1R4XA 2D7TH 3M17A 4O5LH 5J6GB 3AB0B 4ZFQA 4I4WA 1Q9LA 4WLCA 5DDHA 4HV8A 1NCOA 1KTLB 2CLVB 4OF7A 5E2VL 4P59L 3DTXB 4RIRB 1MAJA 5FDWB 4G7QB 3TH2T 5B21A 3WFDH 4PGZA 4M7ZC 3FQWB 2WZPD 4MHHI 2VDOB 5KSBA 4JBSA 5E2WL 1O9VA 3B2MA 5E9NA 4H8PA 1RUPH 4PJEA 5JPMA 1PKQB 2R2CA 2NX5B 3N44B 1UOWA 3T2PA 1C08B 3CLFH 3IKKA 3CSYB 3N9GH 3K2KA 4KK8D 4PYHA 5DRWB 5DRXB 3S4SG 3UBGA 3ZHNA 1A3LH 2UVFA 2W94A 3L7EA 3MRDA 2QV4A 4P2RD 4PJ8A 5EUOB 5K69A 4WTWA 4MJ6A 1CIUA 2WOBA 5CGYD 3PG2A 4Y4HA 1M57B 2E7CA 4M6ML 4Z7VB 4DVRH 4MNGE 1M7DA 5DC2A 1T0PB 2XV2A 5D5MF 5F7DA 4F8OA 1MHEB 3TVMB 1A7NH 3HAEH 3VVVA 5GS0H 3D5OF 5JMOC 5TGBA 4ORZC 2OMZB 3EDEA 4G7YL 2L7UA 2FO1A 4HZAA 3RDTD 2XA8H 1NCNA 3G5VA 2UZPA 4Z7OF 2V9UA 3MGOA 3QEGL 4YO0A 3UMNA 4UQCA 2J8UE 1PBYA 1BYOA 2GIXA 4PPTA 4ZMPA 4HCRH 1DQML 3OKLA 1YYLH 1TLMA 3P4OB 5CZXD 4F8NA 4UQ2A 2YMXL 3QO0B 3HFML 5GRVL 1SJHA 2RAMA 3WJLC 4F57L 5DHVH 1QW9A 1IGIH 1AJ7L 4NDMB 4ZUWB 4EDXB 1LP9F 4D94A 4CNIB 4QNPF 4DP4X 5E0FA 1GL4B 2NZ1A 2V0AA 1S7QB 5EF0A 3FQTB 2BIQA 2BNRD 3GRBA 1WIUA 2C7UB 3MJ6A 3KPLB 1FL5B 4XOEA 1SNRA 5LBVA 2AXJA 1PLGH 1JHTB 3DXAE 1L7TL 1ZTXE 3FU9A 4Q7DA 4G6FB 3BZ4B 1PZ2A 5KWYC 1H9VA 2ZCKL 5H8DA 2UWEF 3VXQA 4WFEE 1H8SA 3OGCB 4KNSA 5GZNA 4EAEA 2GW5A 4C4KO 2WCGA 4ZMOA 3QA3A 1MW0A 1CZ8H 2QTEA 2ZSVB 4XXCA 2VLMD 5IV2A 4Y16A 4FTVE 2DMGA 2GJ6A 3RZCC 4FQ2H 3BKML 3F7YA 1Y6MR 4FG0A 3CFDB 3SOTA 1UURA 2CGRL 3VM5A 5D70L 1L9SA 4Q4EA 3TT3L 2ZOKA 5C0FB 4ODWA 2ZKMX 1OP5H 5C7XL 5HTSA 5GZOD 4PTUB 4OAWB 4OM1H 2XTSA 4U1HB 4N87A 1LQSR 2F54D 2CRZA 2OJEA 3QEQA 3ZO9A 1HAWA 1WA0X 1YRKA 2GT9B 3FT1A 1JF6A 3HN8A 4PJGE 2E3VA 4GXUN 2R8SL 1MFUA 3DV4A 4WFGE 1E8YA 2AJZB 1MCBA 4RBPH 3VI4E 4MDJA 4LLUA 4L1HA 2AW2A 3H9SE 2GBAA 5IMLA 2EADA 3OX8B 2A6DA 4NT6B 3FTVA 4PJXF 5F2FA 3EF7A 3WIFA 4E9RA 2BS9A 3V0IA 4G42A 3U7YL 4A2FA 2GJ6D 1HSBB 4HLJA 3V8CA 2D3NA 4ODVL 3WIHH 3L5XL 3CVHH 2LTQB 4P8QA 3LIZA 1G9HA 2BNQD 2J55A 1Q9OB 1CYXA 3M1BB 3GQFA 3HC4H 4Q2ZB 1OF2B 1MJ8L 4FNSA 2F53B 3Q8EA 2EIZB 3GS4A 3UG4A 4NFCA 5FR3A 3IVKB 3QCUH 2AQNA 4NKDA 4WI9A 5BV7C 3BWSA 4HOWA 3ECWA 1AG6A 4LIQL 1Q0EA 3GXDA 2QL1A 3OKYA 2A83A 4R8WH 5F6IB 1A6WL 2YAFA 2VL4A 1F13A 1C12B 4WTZA 5EWIL 2VJ0A 3JWDL 5JA9A 2FRGP 2DKSA 3OKKA 1ZIBA 4LBEA 1AS7A 2X89A 4XP5L 1EV2E 4BSWA 1EHLL 3VJ6A 3ZPDA 2Y72A 4LHUB 1FLRH 1MG3C 1T6WA 5KJ4A 3UZEC 3V9FA 4ZS7L 4N22A 1MAMH 1A3RL 3BIKA 5L8KB 2EILB 3RJQB 2E7LC 2H4EA 3LKRA 4FMVA 2DQHL 3MN8A 1QHQA 3FT3A 3KYMB 1MEXH 1HZHH 3AXHA 5IQ9A 5AQ0A 1UM5H 2FHBA 5GPRA 2CCVA 4XVSL 3FOLB 1FZMA 1PY9A 3GRWH 4A7QA 5AKSA 5MHSD 2K8QA 5G4OA 3SGDI 1BLNB 3TBYB 3F65A 4PBWD 4N2OA 5E7BA 2EDOA 5E6SB 5AW9B 3ZHDA 1KTKE 3FU7A 4G7VH 4CMMB 1K5WA 2O61B 4KJQC 4EZJA 5FLVA 3CVCA 4G83A 3JV6B 2GVYA 5KBKA 3N43F 3V10A 4ZXBB 4I18B 2OQJA 4RFOH 5B7EA 4KGJA 2PP9A 3ZYJA 2XN2A 4OF0A 1RZ8A 3TV8A 1P7QA 2VW4A 1AIFB 2HKAA 4EUPH 2FHCA 3V6OE 4NP9A 3CHQA 1BVNT 1J8SA 4XB7A 1W72B 5CCHE 1U42A 3ECQA 3U6RB 5IHLB 3SKMB 3A0OA 5F9OH 1KEML 1X6LA 4HFUL 3KPRB 1XH2A 5EBWA 2WP3O 3SCMD 4J3OC 5T3ZE 4YXKH 2WZPA 2VQ1B 4FYRA 2H3KA 4EI6A 3PCYA 3FUKA 2XKSA 4P5TA 4C56E 1FIEA 4IOSA 5LG1A 3FQNA 3L3IB 3KDMA 3MXVH 1QSEE 4JS7A 1OGTA 3CXHK 3MJ8A 4LHUG 2CNYA 4NHUB 3V6FB 4JDTH 4P46C 4QT5B 4TNVF 3FB5B 3C5JA 5CD3A 5L0QC 1UQSA 1TPXC 2HRHA 5FA3A 1TTGA 5GGRB 3TIDB 2BP5M 2GCYB 2VLLA 2HH0H 1P6AB 3MLWH 2XFXA 3U2SA 1PZAA 5D1QC 1ZCRA 3HZVA 5HVWA 1P1VA 2FL5A 4Y5VA 3IU3B 5HHQB 3I6GA 5FHAL 5L2KB 4GRMA 1WIOA 2O5YL 2YLHA 1E8ZA 3L3KA 4A39A 3TFKD 2R69A 3CXDH 4N8CL 3MOBH 3R0MA 4QTIL 4H88H 5J1AB 1MDAA 4YBQC 2YMTA 4BA0A 4YDVA 4S0TD 4UT6H 1O7VA 2X3AA 4O2CA 4OJYA 3S2AA 4TQEH 1NFIB 1DJXA 2HPOA 3EJJX 4W4OC 1PY0A 3FPXA 2WNWA 4Y19D 3HR5B 1AD9A 4MMXB 1A6AA 1OK0A 2CDFA 4FZEL 3RWHB 1ZD6A 3SE9H 2IOMA 5CEZH 3V6ZA 4GIPD 1DVSA 1IC1A 2WLIB 3H85A 4GAJH 3VH8G 3QDME 3EJTA 2LHAA 2ZCZA 4DVRL 5JZ7C 1R5WA 4D8PB 2R2EB 1QSEB 3MRRB 3WMPA 3BKJH 1T5WB 3EH2A 5LDSA 3S9DB 3MROB 2F58L 4KZCA 4ZO7A 2XTJE 3KW7A 5AW3B 5AWNL 1MFBL 5HHMB 2C9SA 2BY0A 1B3JA 4IJ3B 3X3FL 1MI5A 3UZVB 4YWGH 3G7TA 2G3MA 5EIQA 3QCVL 1P4IL 4OCMC 2QGCA 4DEWA 1MCLA 2EUXA 3B9KA 3PWPB 3H9SD 4X6FA 3QUKB 4K5LA 4F7MA 2R59A 4EZMA 1F4XH 2BP0A 2CKBB 2P5ED 3BH4A 1QSFD 2H45A 2UZYA 2XVKA 3TESA 2KT6A 4XMZA 3QPXL 1ID2A 3U9WA 3BT2L 1U8OB 5F7MC 5MEOB 1WWWX 3C5ZB 3EHBD 4GO6B 4OZGA 4F57H 4E5XA 5FW7A 1BAFH 2DQUH 4WK4B 3CFEB 3VGGA 3C08H 2PO6B 1JGDB 2W38A 2P9RA 4LSUH 4G9DA 2MQCA 1UATA 2PWHA 4JPKH 4KMTH 4E9SA 4Z78A 1BF5A 3SD5A 2Y06L 5L7XL 3KXFA 2NDGA 1PSKL 2OJ1A 3VW3H 3G5XB 2J43A 3ARYA 5EO9A 2XPGB 2AITA 2DQMA 4NQXB 4LP4A 2HJKA 4CKQA 3RB5A 3ZTJG 3V5KB 4M48H 1MJJA 4C57C 5JORA 3ZTNL 3EJCA 3OJDA 5KSBE 2I26N 1IEAA 4D0CB 1FAKT 2EO7A 4XCFL 5E6YA 2V6HA 2C1PB 5DR5H 4Y5YB 1YMMA 3EGXB 1U58B 3DX8A 3REVB 3KLKA 5HHVH 1T80A 4PJIE 1YAZA 1F11B 2IANA 3BKMH 4M4RA 1S46A 1AHWA 4KQ3L 1XTMA 2CBOA 1BFVL 3O81A 2LTQC 4P99A 4KKCD 1QBMH 2QVKA 2DAVA 1CF1A 4S1DC 1PKOA 4OM1L 4UV4L 3QUHA 4L8DA 3P30H 5TDOB 4QRSB 4PJIF 5I18H 1F3JB 5ES4B 3T0EC 1HI6B 4KXAA 3PFQA 3SQOH 3QEHB 4BK8A 4DSYA 3U1SL 2BVOA 4ZFFA 4BDVA 4POYA 4Z3HA 2F0CA 2YPVH 4KKLD 4WFHD 1Q9LB 4WU7B 5DJAA 2YQGA 2A77H 4FQXA 4O2EA 5E2VH 4HK0B 4N2FA 2I07A 1CFSB 3LRLA 4AK1A 4MB1A 3GSXB 5I1LB 5AOJA 3O2DL 1M05A 2AV7A 4IBZA 4BH7B 3AGWA 4XCEA 2Z35A 5GGTL 3A6CL 5DJ6A 1M9WA 1MW1A 3LPFA 5IJBC 4MD5A 1WT5C 3SDAC 3S34L 1RU9H 1KEGL 3N50A 3WEXA 4HS6A 1BQHA 2A4ZA 5F3HB 3S7GA 5TK2A 2WO2B 4JG0L 4Y4HB 2WXMA 2FWSA 1GA2A 2C34A 2YKKA 4AJYV 4ELMF 5IIEA 1HVXA 1OB1A 1W8OA 2VJ8A 3QE5A 3VRLE 1CQYA 3DJSA 4XE5B 4IRSD 3VXSB 2H47C 4X99B 4L4TA 1BHGA 3D18B 1OW0C 2ESVE 4MZIA 5JQIB 2M83A 4N5EC 4J3OD 2CO7B 3CLWA 1SN5A 1BZ8A 3VGAB 5HI4D 2LR4A 4ANUA 1UKTA 4QRTB 2CG9X 3FUFA 5LGHH 3V55A 5I8EB 2OJZL 4WGWB 2FT6A 3BZ5A 4FXTA 1DBBH 4LCYA 1UB5A 2GTWA 4WW2B 2ZNWA 4K0OA 1AXTH 3AITA 3WL9A 4BYHA 7PCYA 1T22A 2PCPA 2WNKA 4JFPA 5BJTA 2GC7C 2DOCA 2A99A 4U7KA 5KANI 2F68X 4Y9BA 4N0UE 3FB8B 4EDXA 3AJ7A 1ZT1B 3LV3A 3FZUD 5FO2A 1E2WA 2XVGA 4UQ3A 2Y5QA 3FQTA 3DPBB 3TH3T 3T09A 4F7TB 1FHGA 5IT2H 3S48A 4LVEA 2VN6A 4OZIB 3KBEA 4IRJD 3H3KA 4HUMB 2Q7AA 2JTDA 5T1LB 2ZWKA 3BD3A 3CBJB 2AI0H 4AVJA 1C7SA 1OAUH 3QC6X 2KDGA 4RFNB 4J27A 1BG9A 4NC1C 2J3SA 2RQEA 1QQDA 3OPUA 1G1YA 2A9CA 4HHGA 3CE1A 3U7WH 2YFNA 2F5BH 3GEWB 4HUXB 1XXDC 4JQIH 4UT7H 4XP9L 3VXTB 1LEKB 3DBSA 5AVRB 3WDHA 1OAQH 4PJCA 1K2DB 3VWKD 1J5HA 4CN4A 4AC4A 5EZOL 3LQZB 5E5LA 2X05A 3MX0A 1UADC 4FNPA 4ZAKB 3MOAL 5IFHH 4Z7NB 1UEYA 3B8YA 3HTLX 5TQ2H 1BPVA 1GAFL 3AT8A 3T4AB 5KS9B 1NIFA 1CGXA 1SLUA 3SGDH 4Y5XC 4JO8A 4PTUA 4OAWA 1ORSB 4N8UA 5EFIB 4ODXA 4TLSA 1B9ZA 1T04A 4GAAA 3UABA 4LL1A 5IHUL 2XZCH 3EBIA 4XE0A 5DC9B 3JQOB 5TGBB 5CR1A 5I28A 4Z0XB 2BOCB 4DKFL 3NCFB 1DJIA 3A23A 2UWEB 2DM3A 1TIUA 2FSDA 2JK5B 1IQDA 2VSDA 5ANMB 2NR6A 1UVQA 4W9HC 4KJPD 4CU8A 5IWLA 4TVPL 3KPNA 1WICA 3BESR 3D3VA 2WBJA 5IKCB 5HBBA 2VZOA 3RI5K 1OSPH 1BVKB 1NMCC 3KGUA 5F7EL 3DOSB 5F1NA 5D7JD 2CLZB 3PWLB 1I3GH 1Z9LA 4O02A 3QXDB 4NN5B 2HKLA 2WLZA 4PRNB 2NY6D 3QIBB 1JRHL 1GS6X 2VO5A 1FYTA 3MMEB 3LRSB 3O9WD 4XNXL 3QEQE 3RIKA 1X5YA 4E5XG 5AW4B 5E9DE 3ARUA 1U92B 5JPNB 1DCLA 2C7UA 3VFUA 3MLUL 1YEEH 1F18A 4YN3A 2O72A 3VX1A 2Q3XA 1PQZA 4P46D 3QHZL 2YUVA 4W93A 4AQ1A 2DWYA 3CX2A 2BVEA 3ZL1A 1NEPA 3OLIA 1WZ1L 1L6XA 4DK5A 1FVCB 2A74A 4AIOA 5EB9A 2YO3A 3T9WA 2AJSH 1AZVA 1USZA 2LT9A 3OGCA 2DQFB 2YAHA 4ODUB 2WZ0A 5L0QB 3T4YA 5DQ9B 1A6VL 2CWRA 3OHXC 3S2CA 4NHCL 2GB2A 2ZOUA 1TQWA 3KYAA 3V0WL 1WSST 1KN2L 2A4CA 1ZWIA 5EA0L 1HESA 2R0WH 1D6EB 3RNKA 3DO7B 1H15A 5ANME 1U8HB 4LLDB 3BOVA 3IK2A 3DVGB 4XZUA 2XPYA 3EOBA 3FRUA 4A7TA 1OE2A 3D48R 3QI9D 2WWNA 2OK0L 4YE0A 5DURD 3QULA 3CGTA 4HCIA 2EDJA 1P1ZB 4PJ7B 1FZMB 4BZ2H 2H32B 3SGKA 3T8MA 2UUDK 1E90A 1YYML 3GHEH 3SKNA 1J1PL 4QNPE 5BRZB 4L3ED 2KDYA 2O61A 4BWTA 1RIUL 1QUNA 5FAAA 1TSRA 2KUTA 4H8WL 2A2QT 4X8XA 1H3WM 15C8H 5IMOB 3RWIA 2VLJD 3KLAA 3F7VB 3PU7A 3US0A 3S97C 1LO5A 1U4FA 5SX5K 5GGVL 1DL7L 3CD4A 4OVUA 1MWOA 2ZUTA 1W6WA 4TNFA 2BP8A 4WO4B 1YEFH 2DDQH 3D4GA 1RZJH 1J0KA 4G8FB 2W1NA 1H3XA 5H37H 5EF2A 3AC0A 4OZGF 3WV0A 2DQDL 4MQXD 2R1WB 4ELMB 4OQTA 4ZNCD 5DT1L 1Q9OA 5C71A 1SMOA 3TN0B 1BQSA 5SX4I 4OTXL 5D7SL 1T1WA 4DP5X 1H6EA 3HJEA 4A1KA 4JRLA 4XGZA 2IBBA 1IT9H 3IVKA 1C8PA 4IRSC 3BRFA 2XWJB 1M3IA 1OP9A 2ZWNA 3EIFA 3VFRB 4ODHL 4G8GB 3GF8A 4HS3A 5AOZA 4ETQB 4GT7A 3RVUC 4LRNH 2R83A 3VI3B 4IIQB 4APQD 4P23B 1UQSB 4TNVK 4A6YB 1BMGA 3ZUNC 5T3XE 4NENA 5E8DH 1FGVL 2A9BA 3VXNA 2ZUXA 4GQQA 4XAKE 4N0FA 3T71A 1RH8A 1I9EA 1JG9A 1BW8A 3FQXB 3DX9B 2ICCA 1AXSB 3UYRL 1S3KH 2L04A 1QO3B 2WSDA 4GRWE 2A9MH 3C75A 1GYAA 1WZLA 2QHLA 3D2UA 4F7PB 2PW1A 4UDTB 3ZIYA 2KQMA 4XMKH 1BVOA 2PXYC 3RL2B 2Y25A 4QKTA 2QSQA 2XC8A 4POZD 3AZUA 2RFXA 3O6KH 4Y8DC 2KPNA 5FUCC 1TG8A 2FAUA 4YS4A 1QLRA 4DK3A 4YHOH 4AL8H 3JSSA 1YEGH 5EIVA 1NCBL 4BQ9A 4MLSA 1XF4B 1JZ6A 5C2BH 1T3FA 5AW5B 1ITCA 2CM6A 4G9FA 5EOCH 1V05A 1R5WB 2MSPA 4RAUA 3BAIA 4N8VG 4KKBD 4XOAA 3U48A 4Q9RH 4PREB 3FSWA 1FO0L 5AKRA 1P7QB 2C26A 3EOTH 1EX0A 2F58H 2H6OA 4L2LA 3QIWD 4AMWA 2ESVD 2BIIA 4PGBB 5CJ5A 1Y7MA 1A25A 5F7AA 4ZPTB 1PZCA 1NKRA 4Y9FA 1YMME 3V52H 3WE6B 4I3RL 3EJSA 1LP9B 3X3GH 1KLUA 2ITDA 5I1DB 4P3CH 5HYSG 3M8OH 3LHAA 3WSQH 1NCAL 3SGKC 2X2HA 2UZYB 2WLMA 3INUL 3K6SA 1HHIB 3K2IA 4FQXD 1FFOA 4JPWH 2DQTL 1BG1A 3FQNB 1SJXA 4L8BB 3FAXA 3BH9B 4OI7A 2HKHL 1KDIA 5LQBL 5GS0L 2ZXWB 1WS7A 3D52A 5ESQB 1EBAA 2NY4B 3I85A 3O45A 4K8RD 2AXFA 3UTPE 1FHNA 5IT2L 3PPEA 3TF7C 5GGRA 4RDQF 1O9ZA 4ZI8A 3SHSA 1JNNH 3EXLA 4ZYKA 2CLVA 2AEWA 2QGBA 4IKKA 3G5XA 4JN2B 3VI4B 1QRKA 2DICA 3P73A 1TVBB 2WUBH 3B37A 3TA3C 2DL9A 1SN0A 3ME0B 4PSPA 4ZUTB 4JPVL 4X6BB 1A4JA 1GYUA 1HSAB 1AZCA 3DYPA 4AXWA 2Z9TA 1SXZA 3EOAA 4M48L 3LKQB 1U95B 3U7WL 2EIKB 5DHVB 4D0CA 4JQIL 4UILL 4RGND 4UT7L 4JHWH 2F5AH 5L2KE 1P2CB 1BFOB 2PYFB 5DHDA 4Y1AE 2ITFA 2YD1A 2XT1B 3U9UA 4WHDA 1TOXA 1VFUA 2EDBA 4K8RL 5E8EA 3W81A 3TJPA 1AHWB 1EDHA 1X4ZA 5DLML 3UTTA 5EIIA 3V6ZB 3MJ9A 5AEAA 2HKFH 1IKNA 1KFAL 3SY0A 3OKOB 4FJZA 4TOYH 1EMTL 4ZK8A 6FABL 2QV2A 2AKRA 4A38A 2VN4A 2X6BA 1T5WA 4ELDA 5L2JA 1V54B 5KJRH 3RUGA 3ARED 5KYUA 1O9WA 3W57A 4OFVA 4B3EA 2DJ4A 3WELA 1KYFA 4DP8X 4LKXA 3RTQB 4HFWA 2R69H 1ZGLA 5B3JF 1P84J 5IQNA 1UZ6E 3LNEA 3LS5H 4BZ1L 1SVCP 3NSCA 2CA4A 3I2CH 3NK3A 5L9DL 4HIIA 4RBPK 3SE4A 1J5DA 1E9OB 3O4LB 1VACB 1BA9A 3KCWA 4H1LH 4W68A 5AW8B 5KOMC 4ACPA 5FB8B 2VKWA 2OR8A 2VNCA 1PG7X 4OD1L 3WKMH 1I1CA 2ED6A 1K3ZA 3B9KD 3Q6FB 2AEPH 4R26H 4XCEB 3WTVA 3GBNH 2Y6SD 4G8EA 3IDJB 3QQNA 4GP4B 4JO4L 4P0DA 4XAKD 2DLFL 1J9TA 3KM1A 3DBXA 2J6WA 4N2DA 4Q9QL 4OJEH 2D7NA 4NS0A 4NBZB 4V2CB 4X80H 3PWVB 3VA2C 1HAUA 1J10A 4R4ND 2EH8L 3WJMA 4PY7B 1LDSA 4NN6B 1H5BA 2VITA 4U0RB 1N59A 3E2HB 1AR1B 1NH6A 1Y0LB 3O3EA 3DRTB 4LCVA 5CN2A 1OY3B 3D18A 1QKZH 3LSOB 1CFMA 1GGBH 3C87A 4CVZB 4LAJH 4AYGA 1T83C 4M7KL 4GKNB 5CGYC 5H35A 4KROD 5LNEA 1AO7B 1X5XA 3G6AB 4KY2A 1MJ8H 5JR1L 5LGHL 4AQAA 4PI0A 3VXMA 1B0RB 4PCYA 4DF9A 1I4FA 1KG0A 1NUNB 4IMKC 4PAZA 4EVNB 5BMFH 1YHPA 4ZT1A 1NIBA 4KKZA 5DK3A 4ZX4A 3FB8A 2V8MA 4ZO9A 1SHWA 3GHPA 2F15A 3K8LA 3BLBA 3GT6A 4YR6B 3UBXB 2YD8A 4UAHA 3H53A 4F9LC 1OEZW 2J8UF 4L8SB 3FSZA 3NZHH 4M9OA 1HOCA 1KXTB 3TP4A 5ICZB 1Z6JT 2XZZA 3ZN6A 4YHKL 1GIGL 4EI5A 4RFEB 1E67A 4XVOA 5A1AA 5D6DA 2OX5A 5KBDA 1R3LB 5C0CE 1LNUA 4I1RA 12E8H 2FD6H 3FMGL 3OAUH 2NR6C 1AJ7H 4NUQA 5INCB 4F3FA 4X50A 3ISRA 3H1ZA 1IGCL 4M6NL 3FCTB 4OB5L 4ABVA 3RPIA 4Q2ZA 2F74B 3QAQA 3QXTA 1OGAE 3SPIA 2IALB 5DUPH 2BOLA 4CC1A 4MD5B 3HUJA 2OR9H 5AVZB 5DGRA 3SDCA 2Z91A 4LDLB 2QGDA 2GY5A 3IMRA 1IGJB 4XP6H 2IH3A 2AJYH 3CHRA 5F1OB 2JQMA 3MACL 1YNKL 4GLRH 1XCQA 4PJ7F 3F2LA 2COQA 2NY0B 1FCCA 1BFTA 4YSSA 2X40A 1O75A 5AW0B 2IDQA 3UL4A 1Y7VA 4ODHH 2WIMA 1UFUA 1V5JA 3QT2A 3V0JA 5KSUB 4JQXA 5F9JB 5AYQA 3K1DA 1EHAA 3FBKA 1BCIA 5LAXA 4YDLC 1W72H 5DLLA 1ID5I 4XRCA 1CE1H 3FCGA 4MS8C 5A2IH 4YXKL 1JXGA 1FJ1B 5L8LB 1HK6A 3N1MC 1TJHL 3SDDA 3BUIA 1R3KB 4JUSA 5LNGA 2Z8SA 4ODSL 4BQ8A 2LW3A 3WU1A 4TVPH 1P6FA 2VN7A 3ILPA 4OGAC 3TBWA 4LVOB 3UC2A 5D4HA 3S96B 2AFNA 4ZODA 2ZAGA 4JFPB 5BJTB 1D9KA 1YQ2A 4R90L 1AHWC 4PJEF 4AEIH 1WGVA 1F3RB 1BLNA 2NSQA 4L3CB 4MJIB 4G6JH 5DD1H 1O7DE 2QQNH 1LHZA 1N19A 3I9GH 3Q8AA 3D8MA 4GG6E 1CLYL 4FMFA 3W82A 5DMKB 4Z0BL 4EI0A 5JPNA 4L48A 4F7TA 5CSBA 2FWLB 4I4WB 5LHDA 4UT9A 3IWVA 3VXRD 1TETH 1UM6L 2Z65C 4TUKL 4FQIH 3LKOB 4QYAA 4H8WC 3DJZA 3MRLB 3S5YA 5FDWA 4K94C 1G7PB 4QHLB 4N25A 3V0DA 3GIZL 4I3GA 5JXAH 1WPCA 4YDMA 3ARQA 2UXFA 3B2UC 3P9MB 3QJHB 1AP2A 2GJPA 3HI1A 3EOTL 4CGUB 1Q9WA 1JMXA 4OVVA 4APXA 2PCYA 3TS8A 3BEWB 3S3JA 5IBTL 2HSIA 2J1WA 2VQ1A 2VYRE 3CSYA 4BGLA 3UC0L 2VWEE 3RPBA 4I3RH 3MX0B 1I8IA 1A21A 3GLZA 4YC2C 3RWFB 4AQEA 4BSVA 4ZAKA 3QCUL 4PJ5A 5AW6B 4OLZH 2IBZY 1CFQA 4LCIL 2IFFL 4LIQH 3MRCA 2EC9U 5AWNH 3RG1C 4FCHA 3DROA 4WCYL 3FB5A 3NCXA 4PLOB 5JQHC 2XQYG 2AQ1A 4B60A 4KQ4L 4FE9A 2FSEA 5BS0D 4AYBA 3SYAA 2DTML 1IAOB 4P4KD 4U1IB 4NUMA 1UXSA 3LD8C 3C09B 4MXQC 4GQ9L 3BLPX 1UJ3B 3KCPB 4Y5VB 1Z9SA 4CBPA 2HVKA 3PJLA 3NCYP 4WFGD 5E1IA 5AUMB 5I1AB 1I1FB 2AK1L 3GIVA 1D5RA 3Q6GL 2YQ3A 1JPST 4NDMA 1C5CH 4YX2L 4NKIH 3GDCA 4EOWL 4QXTA 4I9WE 3KHQA 4IBQA 4UM8A 2DF3A 2D8KA 1EUTA 3GXTA 3QXDA 2C3XA 5E2TL 1MJUH 3T3MB 5D72L 2R1WA 1NGPH 3NN8B 4BCYA 2ICEB 4JFDE 2Q8BL 3U0TA 4JM4L 2BY2A 2VO8A 3NCMA 1EXHA 1MF2L 1PQZB 2EZ0C 5LLIC 2ZYHA 1HDMB 4J6IA 1E4XL 5DGQA 4CMHC 2FO8A 5DQJA 4LCWE 1PF3A 2EDHA 2UVEA 2YARA 5DVLA 4IMLB 3BUYA 4YIQA 1I8LC 3G04A 3QO1B 5IV2B 3EJRA 1KEMH 1ET5A 3PJNA 1MW3A 1NFDA 1MCCA 3I50L 2AF2A 4PS3A 4WFFE 2QBWA 1JWUB 2VZUA 4G2AA 1L6ZA 1MPAL 3T6QC 2ZKHL 2RIKA 1FORL 1MVUB 2XNAA 1XGRA 1U8OA 3FRUB 5FM4A 5K59F 4OD3H 4HOZA 5MEOA 2HFTA 3EJQA 4OZGB 1F90L 5D8JL 1B4TA 1A9BB 5E4EB 7TAAA 1NC4D 2IAAC 3Q5YA 4PJ7A 2EUZA 4BM7A 1JGDA 2FWOA 5E08H 3UTSA 4TUUA 3CDYA 4GAYB 4JFDB 5E1AB 2N1TE 1XCTA 1OTSD 1NSNH 1AS6A 4CJ1A 1MCEA 5E6IA 5IVOA 3TFKC 5IMLB 4KMQA 2AQPA 3ARDA 1E65A 2V5YA 5T33L 2RGSA 2XFGB 5L6YH 2BHYA 1D5XA 1RJZA 3BISA 1I9JH 4G42B 1G7JA 4RGMC 4JRYA 4E68A 4JRWA 3P4MA 4PJDE 3IRZA 3KPPB 2WTOA 3S0PA 2AVFA 4JK0D 4PGBA 3ZU8A 3C6EA 4RMSA 3ZMEA 2BIOA 5IW6B 1BQKA 3BO8B 3MBEC 3QH3A 4KTEL 3J2PA 3GSWB 1F11A 2IANB 3MODL 1D7CA 1WAAA 4N86A 1N64H 2MQGA 4CUCA 4GMTL 4ZOEA 1CFNB 4JKPH 4C83A 3LXUX 3N5AA 5I8CA 3BWUC 4LT7A 5HI3C 4K9JA 4BK4A 4QOKA 4L8DB 1NAML 2Q86B 4JG1H 5HI3D 3I6LE 2FJFA 2VDKL 2VXUH 2KLTA 3OKKB 2BVUA 2X1OA 4ISVA 5J11B 2Y5TB 3QXWA 4BSWB 3MV7E 3CZEA 2AXFB 4LHUA 3JWNE 4M7LH 1GW0A 2X4RB 3OKEB 4J8QA 5DUBA 3BRGC 3Q1SH 1T66D 1PZ3A 4QRUB 2HLEB 1EAQA 1OQXA 4ZMLA 1CGVA 1DBJL 3FN0H 4HK0A 3G3LA 1BEYL 4JN2A 3VI4A 2O5XL 5E5UB 3GSXA 1TVBA 1V7NL 2P49B 2KZWA 1IC4L 1JGVL 2MIZA 4Q6KA 1HSAA 4MMZC 4AXWB 12E8L 1EPFA 3RFRA 1R3HA 4OJDH 3PF2A 1CXFA 2PW1B 2W9DL 4UDTA 3EFOB 3GS0A 2D7PA 3RL2A 4M6NH 4OB5H 4PBDA 4WQOA 2GSGA 5IESL 4X0KB 1I3UA 1NUDA 1Z5YD 2V17L 2VLRD 3DHMA 3MBWB 4EJ1C 1GGCL 1TQCC 4JPKL 4KMTL 3ZTEA 4OJFH 5EC1A 3T65B 4UT9H 5FYJH 3ZE1F 5T3XL 3OC8A 2CMRL 2YWZA 1INEL 3MCKB 4QO1A 1RZ8B 2ZJSH 4XBMA 2FQGA 3VXSA 2YK1L 3HIZA 1JAEA 1GRWA 3IJEB 1W72A 3N41F 3WNMA 5B38G 1XIWA 3S8GB 2FIKB 2F5BL 2JIXA 3JV5A 4G1MA 1QNZH 1JPSL 3QFDA 5J7CC 5BVJA 4X7CC 4AI7A 2ZWZA 4NWUL 4ZPTA 5DEJA 3S35L 3W0WE 2R69L 1CDCA 1KGUA 2VLKB 4IRJC 2QQKL 4UDUA 2ITDB 4M7JH 2YEQA 3L3IA 4Y2OA 5LVEA 2B7DT 5AB2A 1KJVB 1RVFL 3MYJB 3APDA 2OZNA 1XF1A 3LV3B 5KG9B 2CGZA 5HDWA 4OCRH 5HYJA 3TIDA 3INOA 3QUMB 1VGKA 5AVXB 5JXEA 1CB4A 1S9WB 2Q0ZX 3TGXA 1U8MB 5C92A 2HMIC 4EKJA 5IOPA 1P5UC 2K3TA 2WTRB 5CZVH 5L2KA 1ZS8B 4RZKA 4G6ML 1E4KA 3WO4B 1ICTA 3GNMH 4LEEA 2LFEA 3T3MF 4LOVA 5C0CA 2ZWSA 5I73B 4R2GB 1TUPA 3CVHB 4XN9A 3ME0A 5GS1C 3DRTA 2VTFA 3N43B 1TJGL 3ARWA 3EOAB 1CU4L 2B1AL 5MEND 3MYZA 3DOIA 3VSVA 3BKCL 1S8DB 2Y7NA 2YGOA 3BUTA 3OMIB 5FUCE 5I1EH 3C5SB 1S7VB 3HZYA 5AYUH 3U9UB 2J4WL 2JCCF 1JNJA 4O4YL 3MREA 4KOBA 4F1ZA 2IWKA 3GMNB 5E6IC 4KJPC 1IBBA 4RMWA 2EDYA 3MRJB 1ZTXL 4H8UA 1CD1B 5FM5O 2EH7L 3RWDB 3BAWA 3BAEL 3WLBA 4KJWC 1L9RA 4JE4B 3FUNA 2DB8A 4PW3A 3TEXA 3QXVA 3BIBX 1CC3A 1X5ZA 2DTMH 2XXFA 4D7BA 4PFEA 2P5WA 5CINH 4HFWB 2VZSA 4KJYA 4MJ4A 3HE7B 3HG1B 4XH2B 3NYKA 4HOMA 1H9DA 5KVEL 4F91B 5C9KA 2AERT 2F8IA 2IAMC 4UM9D 3L48A 4C56B 2VE6A 2MCG1 1D5ZB 1DZBA 5LGJB 5DMYA 1PNCA 1JZ5A 5ITBH 4Y4HC 5FB8A 1T20A 3N0AA 2ITCA 4X5XB 2R0ZL 5INCA 3UYOD 1I53A 2ZQKA 5TF1H 2WGNB 2PPCA 2QQLL 2CAKA 2VN5A 1OTUC 3AY4C 4JDVA 1IGCH 4AYID 3GXUB 3MRHA 1DHKA 3OJVC 1U6AH 2IALA 3RU8L 2TSAA 5A6MA 5ECJE 3IXAA 4DGUA 1LD9A 3IGKA 4HJJL 3RVVC 1DJSA 2OL3L 3GMOA 2OCCB 5I82A 4NZUL 3EYFA 4FQCL 2C9XA 2DZEA 4M1DL 2EXYD 2ZXEB 4X7SL 3TBTA 5JPNC 4YBQD 1GTNA 1XSIA 3ASNB 4PY7A 3V5KA 2B39A 2VDQB 1UZ8B 2UYLA 3MUGA 1W16A 4LCWD 1FNHA 3GZQA 5DZVA 1GCFA 1Y0LA 1EBPA 5F9JA 4GRLB 1H6UA 3D85A 4HK3J 4Y5YA 1DE4A 3LSOA 1CLZL 1U4EA 1OGPA 4GUCA 1H15B 2I27N 5KBNC 2Y07L 4JDEA 3MU3A 3DVGA 1ZVSB 1CLCA 3EOBB 3VTTA 1RP9A 4J4PA 3HR6A 4KI5F 5C6PB 3LIZH 1WISA 4PP2A 2VQ4A 1KG0B 1YEHH 3QULB 3D85D 3RVTC 4A68A 5ALCH 1R5VA 2H32A 4BFOA 4FJYA 5EN2B 4MFHA 4UNIA 5K39A 4OKDA 2AGJH 4R4NC 3HMXL 2CIKA 1KZYA 4Y4KC 5G5DA 3WO3B 5E9DD 1OSZA 5F7NC 1CFVL 2BPBA 2LQRA 2NY7L 3CZGA 4Y2DD 4YR6A 3UBXA 3EHBC 1A4BA 4BK5C 1B4LA 4KRMB 4HPHA 4OUOA 4DCQB 4KGLA 1KXTA 4GQPH 4U1LB 3UTSD 1MFNA 3I3DA 1U3YA 1BBDH 1MFCH 1MFVA 4OZIF 3PWUA 1RUML 3U7AA 1FZJB 2ZOWA 3ARTA 3APFA 1L9TA 2XETA 4N2KA 4XPAL 5EO0A 1UD4A 4A2EA 4CL7A 3D50A 3VQLA 4B9FA 2H2SD 2OMNA 4EN3D 3TM6A 3HI5L 4GG6A 3G6JB 2IJ0C 4Z95H 2R27A 1MREL 3VDAA 1IAII 3IBEA 1JGLH 1HOEA 2VLME 3GZPA 3EFDH 3KYOB 1F86A 4NZTL 5FWQA 3EO0A 3ARBD 2ZX7A 2ORBL 5ADPL 3K72A 4M6MH 4X8JA 2IFFH 3ARGA 3CPLA 1CBJA 2MTPA 3HE6C 4X4KA 1I1AA 4GP8B 1WFIA 5F7WC 3MCG1 3KLDA 3O6FD 2DBJA 4KXZH 4MSWA 5IM7B 1ACYL 5C97A 5I8KH 1A7NL 4O9HL 1MAKA 3MNMA 3HNTH 2O6PA 1TVHA 1MCQA 4JM2B 1TJMA 2MQ3A 4FFYA 4OCSL 4PG9A 1UXSB 2V2XA 3KGTA 1X5JA 5JOPE 3JXAA 3PS6A 2Q1EA 1T7YA 2O26U 3O6MH 4H26A 1MRFL 1RD6A 1Z9SB 3GD1C 3K6FA 3SZKC 1OWRM 1DUZA 4CGTA 3GIVB 1FC1A 4KI5D 1PFOA 2YMXH 3PRZA 2C7FA 3ILPB 2R0KL 1V7NH 3TBWB 3VSUA 4WTZG 2LGNA 2VT0A 1BXUA 2WKGA 3PL6A 1A7OL 1IGIL 1UWGH 4EDWH 2HMID 2ZYIA 4JLRA 4OFPA 5JHDD 2E76C 5DD0H 3Q3GA 4WEUD 1CG9B 1NWOA 3QSKB 5CCGE 3KWXA 3O3BB 5DVOA 4HH9A 4MS8D 4KHXH 4OLVL 2Z31B 1KCVL 1SY6L 5I6MA 5DD5L 1AMYA 1JCKA 1I9RL 4PWJA 3MUJA 1QQDB 2R8SH 4XNUH 2G5BB 1N10A 3TYFA 3VXPA 1AC6A 1RK1A 3ZDZB 1O7DC 3S8FB 5HP5A 1CURA 3MJ7A 3SE3C 3L9BA 1PIFA 4NUPA 1I8AA 4QJ3B 4QAMB 4NJAL 3WKYA 2MWCA 4HPOH 5C3LD 3QIUD 1I31A 2NXZD 3NFSH 4AQ8C 3CBRA 4QHMA 5CIPA 5D7IF 4K71C 1MVUA 4HKZB 1MCFA 5D1ZA 4P2YA 1QFUL 4XMLL 4LEXH 1A1MB 4QRAA 3OAYK 3AWEA 2BCKA 3BH9A 3HBZA 2RA1A 4KV5F 1CICB 5D8JH 4PJ6A 2VH5L 4ZJ9A 4PRID 3QUXC 3CK0H 2GPZA 4MCMA 1IIKA 2BOCA 5ADOH 1BJ1J 4MXVF 3FRPB 5DEZA 1AGDB 2YWYA 2AJUH 5TE6L 1JV5A 4DO4A 2HN7A 3E9TA 5E6IB 1L9QA 4Y5YC 4DQAA 3QQ9D 4HUWA 2A73B 1MCKA 1ETJA 1H3TA 4KNUA 1OTTC 5AZEL 5T33H 2JKRM 4MAYA 3NFNA 1G7JB 4R7NB 1BIIA 2MMXA 3KPSA 1OKEA 4DFHA 1U95A 3IDYB 3EJPA 1VPOH 5E2WH 3QYMA 1XB6A 4P2QB 2BFVL 5D2LE 4YHPA 3C2SA 3QHTC 4WAFA 4OLWL 5JQ6L 3CZFA 5I1EL 4AQ1B 3PWNA 3Q1EA 1U3NA 2H0JA 3CN0A 3A4DA 3S37X 3CBKB 4KKBC 4IRZA 3O6FA 1KGYE 2ATAA 1QFWM 2CM5A 3MUUA 4GBXC 4XMPL 3FFOA 4JFHD 3SN6N 2YD2A 3WI9A 3MLZH 4E41A 4QOKB 3HC2A 1P5VA 3E6HB 3GSVB 4HT1H 2PYEB 5IP4A 5K1VA 2ZXGA 3CMOL 1LL1A 1E5ZA 1NCCH 5I0ZA 1NFDB 3RBGA 3PDOB 2APBA 4XCNA 1BECA 4YHNA 3PHQB 4EN3A 3TPUA 4KKAC 3WSQL 3VH8A 1IGTA 1XH1A 2QVIA 4W4OA 5F0JB 3UTSE 1U91B 1WFOA 4J3XA 4M1GL 3LMJL 3E1F1 4TVPD 5CO1A 1WWAX 2XLLA 5AVQB 4JPWL 3KHOA 4U0QB 3O0RL 4Z7WB 3RTLA 4LRIC 3GRWA 1IC7L 1ADQL 2EC9T 4OV6F 1KV7A 5B1JC 1RLBA 1G6RH 3I3EA 2VM9A 5BO0D 3QNXB 3SKNB 4LLAA 4PTTA 3FUDA 5K9QG 1C5BH 2JKLA 3TZVD 5H37G 1H8LA 5ILTH 3P0GB 3UO8B 5I30H 2IBZX 2Q7NA 1TNMA 5E9DA 4TSBL 5EC1B 4WU5A 3T65A 4YBLC 5DJ8B 1ZLDA 5FYJL 2ZUVA 4GRLC 4W9JC 5T5FH 4OIAA 5JHDA 2HTLD 3ULVL 3ARFD 4DP0X 2C4XA 3ARDB 5D5MA 1KPVB 4KPHL 5CNHA 5ISZD 1OCRB 3ZR5A 2X28A 2FD6L 3FMGH 5ERWB 1QASA 4KVNL 2CO3A 3P4MB 2FYYB 4TULH 4G1MB 4KK9C 4JHWL 1FFNA 1M7IB 4FFTA 1RHFA 1B2WH 4GKNA 2VB5A 4GMSL 1IAKB 5DD6B 2XUWA 2NZ9C 5BRQA 4OZHE 2WSKA 3VGEA 1UWEL 4TPRL 1HZLA 4XGZB 1FIGL 2Z4QA 2FBOJ 1YECH 4G8GE 4ZMXA 1QWNA 2YGVA 3WNLA 1N2RB 4GNKB 5I6OA 2CGRH 1BF8A 3SPCA 3TT3H 4NQVA 4KUCF 1QLEL 3AREC 1CVSC 3HAEA 2WLNA 3UG5A 3ARGD 4IRZL 3NTCH 1W2KT 3TBSB 1G84A 4U3SA 4F37K 2V2TA 4ZZKA 1W72L 3NIFB 2QQQA 4U3HA 3HLAA 5LBSA 3Q0HA 4MNGB 3SYCA 1UA3A 1HOCB 4HBCL 4Z5RB 3AWFA 1NBZA 4GAGL 3A24A 3RURA 5FOBB 4GFTB 2ERJC 4L4VE 1QZ1A 3AS3A 4MTMA 3VSQA 4YHZL 1RZKC 2OX5B 1UACH 4Q4IA 2BZ7A 2DWDB 2X3BA 2QSVA 5DQDL 2XN9D 4S1SL 1IBFA 4NNPH 1R6VA 2ICWI 1HNYA 4XNZB 5ITFA 3QG7L 3DC0A 3WGUB 1SJEA 3QQDA 2NLJB 4GBXA 1DUYB 2WY3B 2NNFA 4G43A 5IB1B 4G9FB 4QRRD 5HGHA 5HDLA 1QRNB 4RMBA 2FQFA 1OAKL 5C0RL 4IBTA 4KOCA 4QRPB 4LXFA 1ED3A 1W0WB 2MJWA